BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31491_g1_i1 len=1390 path=[1:0-1389]

Length=1390
                                                                      Score     E

ref|XP_009761201.1|  PREDICTED: ervatamin-B-like                        379   7e-125   
ref|XP_009609383.1|  PREDICTED: ervatamin-B                             366   2e-120   
emb|CDP15898.1|  unnamed protein product                                354   7e-115   
ref|XP_003635767.1|  Cysteine proteinase                                345   6e-112   
ref|XP_002275891.1|  PREDICTED: zingipain-2                             343   1e-110   Vitis vinifera
ref|XP_011100224.1|  PREDICTED: zingipain-2                             340   1e-109   
emb|CBI21941.3|  unnamed protein product                                340   2e-109   
ref|XP_002525147.1|  cysteine protease, putative                        339   2e-109   Ricinus communis
ref|XP_004513101.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    337   2e-108   
ref|XP_004243398.1|  PREDICTED: ervatamin-B                             331   2e-106   
gb|AIA26572.1|  cysteine protease                                       330   1e-105   
ref|XP_010070267.1|  PREDICTED: zingipain-2                             328   3e-105   
ref|XP_008229136.1|  PREDICTED: zingipain-2                             328   4e-105   
ref|XP_006446742.1|  hypothetical protein CICLE_v10015835mg             328   6e-105   
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    327   1e-104   
ref|XP_010670721.1|  PREDICTED: ervatamin-B isoform X1                  327   2e-104   
ref|XP_010670725.1|  PREDICTED: ervatamin-B isoform X2                  325   3e-104   
gb|EYU29820.1|  hypothetical protein MIMGU_mgv1a009422mg                324   2e-103   
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             323   3e-103   
ref|XP_004307286.1|  PREDICTED: oryzain beta chain-like                 322   8e-103   
ref|XP_006417940.1|  hypothetical protein EUTSA_v10008102mg             322   1e-102   
gb|KDO45769.1|  hypothetical protein CISIN_1g041120mg                   321   2e-102   
ref|XP_007050023.1|  Cysteine proteinases superfamily protein, pu...    320   4e-102   
ref|XP_008458487.1|  PREDICTED: ervatamin-B-like                        319   2e-101   
ref|XP_010522111.1|  PREDICTED: ervatamin-B                             317   1e-100   
ref|XP_003607546.1|  Cysteine proteinase                                317   1e-100   
ref|XP_004148072.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    315   3e-100   
gb|KFK42951.1|  hypothetical protein AALP_AA1G060200                    315   5e-100   
ref|XP_004169046.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    313   7e-100   
ref|XP_010099502.1|  KDEL-tailed cysteine endopeptidase CEP2            315   8e-100   
gb|KGN62053.1|  hypothetical protein Csa_2G292830                       314   9e-100   
ref|XP_002889596.1|  hypothetical protein ARALYDRAFT_887827             314   1e-99    
ref|NP_563764.1|  Cysteine proteinases superfamily protein              313   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462580.1|  PREDICTED: ervatamin-B-like                        310   3e-98    
ref|XP_010279240.1|  PREDICTED: zingipain-2                             310   5e-98    
ref|XP_006306197.1|  hypothetical protein CARUB_v10011832mg             309   2e-97    
ref|XP_008790576.1|  PREDICTED: ervatamin-B-like                        309   3e-97    
ref|XP_010475355.1|  PREDICTED: ervatamin-B-like                        306   6e-97    
ref|XP_010917956.1|  PREDICTED: ervatamin-B-like                        306   2e-96    
ref|XP_010501342.1|  PREDICTED: ervatamin-B-like                        305   2e-96    
ref|XP_009790365.1|  PREDICTED: ervatamin-B-like                        301   2e-95    
ref|XP_002525123.1|  cysteine protease, putative                        301   2e-94    Ricinus communis
ref|XP_006348972.1|  PREDICTED: oryzain alpha chain-like                298   3e-94    
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    300   4e-94    
gb|KDP31767.1|  hypothetical protein JCGZ_12228                         298   6e-94    
ref|XP_009110997.1|  PREDICTED: ervatamin-B-like                        298   2e-93    
ref|XP_009119072.1|  PREDICTED: ervatamin-B                             297   6e-93    
emb|CDY10188.1|  BnaC05g04310D                                          297   6e-93    
emb|CDY15571.1|  BnaA08g28550D                                          296   2e-92    
ref|XP_002531151.1|  cysteine protease, putative                        294   5e-92    Ricinus communis
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    294   7e-92    
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    293   1e-91    Vitis vinifera
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        293   1e-91    
ref|XP_004501841.1|  PREDICTED: vignain-like                            294   1e-91    
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        293   2e-91    
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    293   2e-91    Vitis vinifera
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    293   2e-91    
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        293   2e-91    
emb|CAN70559.1|  hypothetical protein VITISV_032465                     292   4e-91    Vitis vinifera
ref|XP_002875897.1|  hypothetical protein ARALYDRAFT_347926             293   4e-91    
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             292   5e-91    
ref|XP_011005600.1|  PREDICTED: vignain                                 292   6e-91    
ref|XP_004303175.1|  PREDICTED: vignain-like                            291   9e-91    
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    291   1e-90    
ref|NP_680113.3|  KDEL-tailed cysteine endopeptidase CEP2               291   1e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CAN64655.1|  hypothetical protein VITISV_005140                     291   1e-90    Vitis vinifera
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        290   1e-90    
ref|XP_002523448.1|  cysteine protease, putative                        291   1e-90    Ricinus communis
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    295   2e-90    Vitis vinifera
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        290   2e-90    
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    290   2e-90    Vitis vinifera
ref|XP_008381611.1|  PREDICTED: ervatamin-B                             291   2e-90    
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    291   3e-90    
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             290   3e-90    
ref|XP_008805113.1|  PREDICTED: vignain-like                            290   3e-90    
emb|CAN61026.1|  hypothetical protein VITISV_001146                     294   4e-90    Vitis vinifera
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    289   4e-90    
ref|XP_004297571.1|  PREDICTED: vignain-like                            289   4e-90    
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        290   5e-90    
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    290   5e-90    
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    289   5e-90    
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         289   5e-90    
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        289   5e-90    
ref|XP_006469012.1|  PREDICTED: vignain-like                            289   6e-90    
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             289   7e-90    
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             289   7e-90    
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         289   8e-90    
gb|AFO83614.1|  papain-like cysteine protease                           293   8e-90    
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          293   9e-90    
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    289   9e-90    
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             288   1e-89    Populus trichocarpa [western balsam poplar]
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like          292   1e-89    
gb|KHG18408.1|  Cysteinease RD21a -like protein                         289   1e-89    
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like          289   1e-89    
ref|XP_002531152.1|  cysteine protease, putative                        288   2e-89    Ricinus communis
gb|KHG06908.1|  Vignain                                                 288   2e-89    
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    288   2e-89    
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    288   2e-89    
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             287   2e-89    
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    287   2e-89    
ref|XP_004515849.1|  PREDICTED: vignain-like                            288   3e-89    
ref|XP_010932269.1|  PREDICTED: LOW QUALITY PROTEIN: vignain-like       288   3e-89    
ref|XP_004290089.1|  PREDICTED: vignain-like                            287   3e-89    
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        287   3e-89    
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             286   3e-89    
ref|XP_002523447.1|  cysteine protease, putative                        287   3e-89    Ricinus communis
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         286   4e-89    
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    287   4e-89    
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    287   5e-89    
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             286   5e-89    Populus trichocarpa [western balsam poplar]
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    286   5e-89    
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             286   6e-89    
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          287   6e-89    
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    286   7e-89    
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             286   7e-89    
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        286   7e-89    
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             286   8e-89    
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             286   8e-89    Populus trichocarpa [western balsam poplar]
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...    293   8e-89    
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        286   8e-89    
ref|XP_004306597.1|  PREDICTED: vignain-like                            286   9e-89    
dbj|BAG16377.1|  cysteine protease                                      289   9e-89    Brassica rapa var. perviridis [kabuna]
ref|NP_568651.1|  cysteine protease SAG12                               286   9e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                      286   9e-89    
gb|AEZ65083.1|  cysteine protease                                       290   9e-89    
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44               287   1e-88    Vitis vinifera
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    286   1e-88    
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like          290   1e-88    
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like        286   1e-88    
ref|XP_008228922.1|  PREDICTED: vignain-like                            285   1e-88    
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                        286   1e-88    
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             286   1e-88    
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             286   1e-88    
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    285   2e-88    
emb|CDP15086.1|  unnamed protein product                                286   2e-88    
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             285   2e-88    Populus trichocarpa [western balsam poplar]
gb|KEH31479.1|  papain family cysteine protease                         286   2e-88    
ref|XP_006469011.1|  PREDICTED: vignain-like                            285   2e-88    
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg                288   2e-88    
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             285   2e-88    
emb|CDY06760.1|  BnaA10g05390D                                          289   2e-88    
dbj|BAG16371.1|  cysteine protease                                      288   2e-88    Brassica oleracea var. italica [asparagus broccoli]
ref|XP_008340724.1|  PREDICTED: vignain-like                            285   2e-88    
emb|CDP18645.1|  unnamed protein product                                285   2e-88    
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like          289   2e-88    
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          289   3e-88    
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        285   3e-88    
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    289   3e-88    
emb|CDY17093.1|  BnaC06g00260D                                          288   3e-88    
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             285   3e-88    
ref|XP_002321654.1|  Cys endopeptidase family protein                   285   3e-88    Populus trichocarpa [western balsam poplar]
gb|ABG33750.1|  cysteine protease                                       288   3e-88    Hevea brasiliensis [jebe]
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    285   3e-88    
ref|XP_010515152.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    285   3e-88    
ref|XP_007050065.1|  Senescence-associated gene 12                      285   4e-88    
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44               285   4e-88    
gb|ABQ10200.1|  cysteine protease Cp2                                   285   4e-88    Actinidia deliciosa [Chinese gooseberry]
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             284   5e-88    
gb|AAA92063.1|  cysteinyl endopeptidase                                 285   5e-88    Vigna radiata [mung bean]
ref|XP_003527350.1|  PREDICTED: vignain-like                            284   5e-88    
emb|CDX71540.1|  BnaC04g17750D                                          288   5e-88    
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg             288   5e-88    
ref|XP_009359967.1|  PREDICTED: vignain-like                            284   5e-88    
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        284   5e-88    
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease       288   5e-88    Brassica oleracea
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like          285   5e-88    
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        284   6e-88    
ref|XP_003607647.1|  Cysteine proteinase                                284   6e-88    
ref|XP_006374886.1|  cysteine proteinase                                288   6e-88    
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                   285   7e-88    
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         285   7e-88    
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    284   7e-88    Vitis vinifera
ref|XP_003638507.1|  Cysteine proteinase                                285   7e-88    
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor     285   7e-88    
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a               288   7e-88    
emb|CDY22370.1|  BnaA06g36920D                                          288   7e-88    
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          288   8e-88    
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a               288   8e-88    
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like          285   8e-88    
ref|NP_001148706.1|  cysteine protease 1 precursor                      288   8e-88    Zea mays [maize]
gb|KDP41692.1|  hypothetical protein JCGZ_16099                         288   8e-88    
ref|XP_009361500.1|  PREDICTED: vignain-like                            283   9e-88    
emb|CDY63586.1|  BnaCnng42340D                                          287   9e-88    
ref|XP_006376886.1|  hypothetical protein POPTR_0012s09270g             284   9e-88    
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                          288   1e-87    
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease       288   1e-87    Brassica oleracea
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        283   1e-87    
ref|NP_001237379.1|  cysteine proteinase precursor                      284   1e-87    
emb|CDP18644.1|  unnamed protein product                                283   1e-87    
ref|XP_007226517.1|  hypothetical protein PRUPE_ppa025615mg             284   1e-87    
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    283   1e-87    
ref|NP_001237199.1|  cysteine proteinase precursor                      284   1e-87    
ref|XP_003599736.1|  Cysteine proteinase                                283   1e-87    
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             283   1e-87    
ref|XP_010245279.1|  PREDICTED: vignain-like                            284   1e-87    
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...    283   1e-87    Vigna mungo [urad dal]
ref|XP_010094652.1|  Cysteine proteinase RD21a                          287   2e-87    
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        283   2e-87    
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    287   2e-87    
dbj|BAC75923.1|  cysteine protease-1                                    286   2e-87    Helianthus annuus
ref|XP_006341791.1|  PREDICTED: vignain-like                            283   2e-87    
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like          284   2e-87    
gb|AFK44139.1|  unknown                                                 283   2e-87    
ref|XP_008374352.1|  PREDICTED: vignain                                 283   2e-87    
ref|XP_006592465.1|  PREDICTED: vignain-like                            283   2e-87    
dbj|BAF46304.1|  cysteine proteinase precursor                          287   2e-87    Ipomoea nil [qian niu]
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    282   2e-87    
ref|XP_008782844.1|  PREDICTED: xylem cysteine proteinase 1-like        283   2e-87    
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             282   2e-87    Populus trichocarpa [western balsam poplar]
gb|AAX84673.1|  cysteine protease CP1                                   286   2e-87    Manihot esculenta [manioc]
dbj|BAD29960.1|  cysteine protease                                      286   3e-87    Daucus carota [carrots]
gb|KHN04480.1|  Cysteine proteinase RD21a                               283   3e-87    
gb|AAC49135.1|  SAG12 protein                                           282   3e-87    Arabidopsis thaliana [mouse-ear cress]
prf||1910332A  Cys endopeptidase                                        283   3e-87 
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                281   3e-87    
ref|XP_010503462.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    283   4e-87    
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like          286   4e-87    
gb|AAC35211.1|  cysteine proteinase                                     282   4e-87    Hemerocallis hybrid cultivar
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        282   4e-87    
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg             283   5e-87    
gb|AFK46775.1|  unknown                                                 282   5e-87    
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    281   5e-87    
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        281   5e-87    
gb|ACJ85307.1|  unknown                                                 282   5e-87    Medicago truncatula
ref|XP_006592467.1|  PREDICTED: vignain-like                            281   5e-87    
ref|XP_003557016.1|  PREDICTED: vignain-like                            281   6e-87    
ref|XP_004297572.1|  PREDICTED: vignain-like                            281   6e-87    
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        281   6e-87    
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    281   7e-87    
ref|XP_009774957.1|  PREDICTED: vignain-like                            282   7e-87    
ref|XP_004239155.1|  PREDICTED: vignain-like                            281   8e-87    
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        281   8e-87    
gb|AFK47737.1|  unknown                                                 281   8e-87    
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    281   8e-87    
emb|CAA46863.1|  thiolprotease                                          285   9e-87    Pisum sativum [garden pea]
ref|XP_006469128.1|  PREDICTED: vignain-like                            281   9e-87    
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    281   9e-87    
ref|XP_002525124.1|  cysteine protease, putative                        281   9e-87    Ricinus communis
ref|XP_009365508.1|  PREDICTED: vignain-like                            287   1e-86    
ref|XP_003540013.1|  PREDICTED: vignain-like                            281   1e-86    
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             281   1e-86    
ref|XP_006582264.1|  PREDICTED: vignain-like                            281   1e-86    
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             281   1e-86    
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             281   1e-86    
emb|CAA40073.1|  endopeptidase (EP-C1)                                  281   1e-86    Phaseolus vulgaris [French bean]
emb|CAA53377.1|  cysteine protease                                      281   1e-86    Vicia sativa [spring vetch]
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    284   1e-86    
gb|KHN08873.1|  Vignain                                                 280   1e-86    
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            281   1e-86    
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg             284   1e-86    
gb|EAY93078.1|  hypothetical protein OsI_14879                          280   2e-86    Oryza sativa Indica Group [Indian rice]
emb|CDY46179.1|  BnaA05g20660D                                          284   2e-86    
emb|CAH66233.1|  H0825G02.10                                            280   2e-86    Oryza sativa [red rice]
emb|CAB16317.1|  cysteine proteinase precursor                          281   2e-86    Nicotiana tabacum [American tobacco]
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like          284   2e-86    
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       283   2e-86    Brassica oleracea
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like          281   2e-86    
gb|ABQ10204.1|  cysteine protease Cp6                                   284   2e-86    Actinidia deliciosa [Chinese gooseberry]
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        280   2e-86    
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        280   2e-86    
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                280   2e-86    
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    280   2e-86    
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             280   2e-86    
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         280   2e-86    
gb|AAK48495.1|AF259983_1  putative cysteine protease                    284   2e-86    Ipomoea batatas [batate]
ref|XP_007048674.1|  Senescence-associated gene 12                      280   2e-86    
ref|XP_011072006.1|  PREDICTED: vignain-like                            280   3e-86    
ref|XP_009800981.1|  PREDICTED: vignain-like                            281   3e-86    
ref|XP_011040442.1|  PREDICTED: vignain-like                            280   3e-86    
ref|XP_006362426.1|  PREDICTED: vignain-like                            280   3e-86    
emb|CAD40112.2|  OSJNBa0035O13.5                                        280   3e-86    Oryza sativa Japonica Group [Japonica rice]
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                    283   3e-86    
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        279   3e-86    
ref|XP_008221945.1|  PREDICTED: vignain-like                            280   3e-86    
ref|XP_009617207.1|  PREDICTED: vignain-like                            280   3e-86    
emb|CDX99227.1|  BnaC05g33420D                                          285   3e-86    
ref|XP_006360707.1|  PREDICTED: vignain-like                            279   3e-86    
gb|AGV15821.1|  cysteine protease CP8                                   280   3e-86    
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...    284   3e-86    
ref|XP_009341503.1|  PREDICTED: xylem cysteine proteinase 1-like        280   4e-86    
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        280   4e-86    
ref|XP_006582263.1|  PREDICTED: vignain-like                            279   4e-86    
ref|XP_009333898.1|  PREDICTED: vignain                                 280   4e-86    
ref|XP_004506025.1|  PREDICTED: vignain-like                            279   4e-86    
gb|ABK24495.1|  unknown                                                 283   4e-86    
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    280   4e-86    
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        281   4e-86    
gb|AAT34987.1|  putative cysteine protease                              279   4e-86    
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like          280   4e-86    
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        279   4e-86    
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              279   4e-86    
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    279   5e-86    
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    279   5e-86    
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             278   5e-86    
gb|AAW78660.1|  cysteine protease                                       280   5e-86    
gb|ABV22590.1|  KDEL-tailed cysteine endopeptidase                      280   5e-86    
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 283   5e-86    
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a               283   5e-86    
ref|XP_009333784.1|  PREDICTED: xylem cysteine proteinase 1-like        279   6e-86    
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like          283   6e-86    
ref|XP_004515851.1|  PREDICTED: vignain-like                            280   6e-86    
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             279   6e-86    
ref|XP_004236298.1|  PREDICTED: vignain-like                            279   6e-86    
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        279   6e-86    
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             279   6e-86    
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like          279   7e-86    
ref|XP_010545991.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    279   7e-86    
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             279   7e-86    
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             279   7e-86    
ref|XP_007048792.1|  Senescence-associated gene 12                      278   7e-86    
gb|EYU25614.1|  hypothetical protein MIMGU_mgv1a023209mg                279   7e-86    
dbj|BAD29955.1|  cysteine protease                                      279   7e-86    
dbj|BAF56429.1|  cysteine proteinase                                    278   7e-86    
gb|KHN08187.1|  Thiol protease SEN102                                   278   8e-86    
ref|NP_001105993.1|  cysteine protease component of protease-inhi...    282   8e-86    
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             278   8e-86    
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    283   8e-86    
ref|XP_006592475.1|  PREDICTED: vignain-like                            278   8e-86    
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             278   8e-86    
ref|XP_003539970.1|  PREDICTED: vignain-like                            278   9e-86    
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             278   9e-86    
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like          282   9e-86    
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391             282   9e-86    
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like        278   9e-86    
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...    279   1e-85    
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   278   1e-85    
dbj|BAD29958.1|  cysteine protease                                      283   1e-85    
ref|XP_010426322.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    278   1e-85    
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like          282   1e-85    
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like                282   1e-85    
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    278   1e-85    
gb|KHG00992.1|  Cysteinease RD21a -like protein                         279   1e-85    
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    278   1e-85    
ref|XP_003589133.1|  Cysteine proteinase                                282   1e-85    
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    278   1e-85    
ref|XP_011013690.1|  PREDICTED: vignain-like                            278   1e-85    
ref|XP_009779832.1|  PREDICTED: vignain-like                            278   1e-85    
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             277   1e-85    
ref|XP_003589135.1|  Cysteine proteinase                                281   1e-85    
ref|XP_003527349.1|  PREDICTED: vignain-like                            278   1e-85    
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a-like          282   1e-85    
ref|XP_006351440.1|  PREDICTED: vignain-like                            278   2e-85    
dbj|BAJ85145.1|  predicted protein                                      281   2e-85    
ref|XP_003556992.1|  PREDICTED: vignain-like                            278   2e-85    
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like                281   2e-85    
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    290   2e-85    
dbj|BAD29959.1|  cysteine protease                                      278   2e-85    
ref|XP_010645699.1|  PREDICTED: xylem cysteine proteinase 1             278   2e-85    
emb|CDY17044.1|  BnaA08g04080D                                          281   2e-85    
ref|XP_008340130.1|  PREDICTED: vignain-like                            278   2e-85    
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             277   2e-85    
ref|XP_007048796.1|  Senescence-associated gene 12                      277   2e-85    
gb|KHN12137.1|  Thiol protease                                          277   2e-85    
gb|EYU22236.1|  hypothetical protein MIMGU_mgv1a008784mg                278   2e-85    
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1     281   3e-85    
ref|XP_006291370.1|  hypothetical protein CARUB_v10017509mg             278   3e-85    
ref|XP_010545992.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    278   3e-85    
gb|KHN13721.1|  Vignain                                                 276   3e-85    
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...    278   3e-85    
gb|KEH31736.1|  KDEL-tailed cysteine endopeptidase CEP1                 278   3e-85    
ref|XP_006439985.1|  hypothetical protein CICLE_v10020781mg             278   3e-85    
ref|XP_003527388.1|  PREDICTED: vignain-like                            277   3e-85    
gb|KFK34125.1|  hypothetical protein AALP_AA5G104600                    277   3e-85    
ref|XP_009797968.1|  PREDICTED: vignain-like                            277   3e-85    
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             281   4e-85    
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like          281   4e-85    
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g             281   4e-85    
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg             282   4e-85    
gb|AAK07730.1|  CPR1-like cysteine proteinase                           278   4e-85    
ref|XP_011005599.1|  PREDICTED: vignain-like                            277   4e-85    
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                276   4e-85    
ref|XP_006476933.1|  PREDICTED: vignain-like                            277   4e-85    
ref|XP_002301901.2|  hypothetical protein POPTR_0002s00720g             277   4e-85    
gb|EAY97106.1|  hypothetical protein OsI_19029                          277   4e-85    
ref|XP_003526232.1|  PREDICTED: vignain-like                            276   4e-85    
ref|XP_007135980.1|  hypothetical protein PHAVU_009G008100g             277   4e-85    
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    276   4e-85    
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          281   5e-85    
ref|XP_002865220.1|  senescence-associated gene 12                      276   5e-85    
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                   281   5e-85    
ref|XP_006404274.1|  hypothetical protein EUTSA_v10010486mg             277   5e-85    
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              276   5e-85    
gb|ABK24233.1|  unknown                                                 280   5e-85    
ref|XP_003538185.1|  PREDICTED: vignain-like                            276   5e-85    
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg                280   5e-85    
dbj|BAC75924.1|  cysteine protease-2                                    277   5e-85    
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        277   5e-85    
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        276   6e-85    
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        276   6e-85    
ref|XP_002522559.1|  cysteine protease, putative                        276   6e-85    
emb|CAE54307.1|  cysteine proteinase                                    277   6e-85    
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             276   6e-85    
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    280   6e-85    
ref|XP_008392874.1|  PREDICTED: vignain-like                            277   7e-85    
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...    280   7e-85    
ref|XP_003609015.1|  Cysteine proteinase                                276   7e-85    
ref|XP_009357242.1|  PREDICTED: ervatamin-B                             276   7e-85    
ref|XP_011034818.1|  PREDICTED: xylem cysteine proteinase 2-like        276   7e-85    
ref|XP_008382503.1|  PREDICTED: xylem cysteine proteinase 1-like        276   7e-85    
ref|XP_006360708.1|  PREDICTED: vignain-like                            276   7e-85    
gb|AER60490.1|  cysteine proteases                                      277   8e-85    
gb|AAA50755.1|  cysteine proteinase                                     276   8e-85    
ref|XP_010102922.1|  hypothetical protein L484_018940                   276   8e-85    
gb|KEH44128.1|  papain family cysteine protease                         280   8e-85    
ref|XP_008440309.1|  PREDICTED: cysteine proteinase COT44-like          276   8e-85    
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...    280   8e-85    
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          276   9e-85    
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              276   9e-85    
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    280   9e-85    
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                276   9e-85    
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like                280   1e-84    
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g             277   1e-84    
ref|XP_007025398.1|  Senescence-associated gene 12                      275   1e-84    
gb|KHN27806.1|  Vignain                                                 275   1e-84    
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             276   1e-84    
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                275   1e-84    
ref|XP_007209277.1|  hypothetical protein PRUPE_ppa007566mg             276   1e-84    
gb|ABR19827.1|  cysteine proteinase                                     280   1e-84    
ref|XP_002524912.1|  cysteine protease, putative                        276   1e-84    
gb|ABF70145.1|  cysteine protease, putative                             276   1e-84    
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                277   1e-84    
ref|XP_004489011.1|  PREDICTED: vignain-like                            275   1e-84    
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg             279   1e-84    
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        275   1e-84    
gb|AEZ65082.1|  cysteine protease                                       280   1e-84    
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 274   1e-84    
ref|XP_002510170.1|  cysteine protease, putative                        279   1e-84    
ref|XP_008239373.1|  PREDICTED: vignain-like                            276   1e-84    
ref|XP_003539989.1|  PREDICTED: vignain-like                            275   1e-84    
emb|CAB17076.1|  cysteine proteinase precursor                          279   2e-84    
ref|XP_002285397.3|  PREDICTED: vignain-like                            276   2e-84    
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg             279   2e-84    
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...    279   2e-84    
gb|KHN22488.1|  Cysteine proteinase RD21a                               279   2e-84    
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg             279   2e-84    
ref|XP_009618803.1|  PREDICTED: cysteine proteinase COT44-like          276   2e-84    
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...    279   2e-84    
ref|XP_002511277.1|  cysteine protease, putative                        275   2e-84    
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like          275   2e-84    
emb|CDX86529.1|  BnaC08g01740D                                          277   2e-84    
ref|NP_566633.1|  Granulin repeat cysteine protease family protein      278   3e-84    
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            275   3e-84    
ref|NP_568620.1|  Granulin repeat cysteine protease family protein      278   3e-84    
gb|KHN12823.1|  Cysteine proteinase RD21a                               275   3e-84    
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        275   3e-84    
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    273   3e-84    
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like          279   3e-84    
gb|ABQ10195.1|  actinidin Act2d                                         276   3e-84    
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          275   3e-84    
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        274   3e-84    
gb|ACU23531.1|  unknown                                                 275   3e-84    
gb|ABA97421.1|  Vignain precursor, putative                             275   3e-84    
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like          278   3e-84    
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like                278   3e-84    
ref|XP_003522989.1|  PREDICTED: xylem cysteine proteinase 2             275   3e-84    
dbj|BAF56430.1|  cysteine proteinase                                    274   3e-84    
dbj|BAF56427.1|  cysteine proteinase                                    274   4e-84    
dbj|BAD16614.1|  cysteine proteinase                                    278   4e-84    
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        274   4e-84    
ref|NP_001148894.1|  LOC100282514 precursor                             275   4e-84    
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like              274   4e-84    
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          278   4e-84    
ref|XP_009149829.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    275   4e-84    
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...    278   4e-84    
ref|XP_010100336.1|  hypothetical protein L484_027645                   276   4e-84    
gb|KHN38752.1|  Vignain                                                 273   4e-84    
ref|XP_009340788.1|  PREDICTED: xylem cysteine proteinase 1-like        274   5e-84    
ref|XP_006852216.1|  hypothetical protein AMTR_s00049p00133800          275   5e-84    
ref|NP_001242584.1|  uncharacterized protein LOC100804015 precursor     275   5e-84    
ref|XP_007135981.1|  hypothetical protein PHAVU_009G008200g             274   5e-84    
gb|AAC49455.1|  Pseudotzain                                             277   5e-84    
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like          275   5e-84    
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...    278   5e-84    
ref|XP_010107858.1|  Cysteine proteinase RD21a                          278   5e-84    
dbj|BAE80740.1|  cysteine proteinase                                    278   6e-84    
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                278   6e-84    
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    278   6e-84    
gb|KHG05637.1|  Cysteinease RD21a -like protein                         277   6e-84    
dbj|BAD29954.1|  cysteine protease                                      278   6e-84    
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like          278   6e-84    
ref|XP_008390108.1|  PREDICTED: vignain-like                            274   7e-84    
ref|XP_010270545.1|  PREDICTED: xylem cysteine proteinase 1             274   7e-84    
ref|XP_010037483.1|  PREDICTED: vignain-like                            274   7e-84    
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        273   7e-84    
ref|XP_002894032.1|  F2G19.31/F2G19.31                                  277   7e-84    
gb|KHN33772.1|  Xylem cysteine proteinase 2                             272   7e-84    
emb|CDX87758.1|  BnaC02g31910D                                          273   7e-84    
tpg|DAA40428.1|  TPA: Vignain                                           275   8e-84    
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              273   8e-84    
gb|KHN33962.1|  Vignain                                                 272   8e-84    
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                    277   8e-84    
gb|ABQ10193.1|  actinidin Act2b                                         274   8e-84    
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like          278   8e-84    
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550          274   9e-84    
ref|XP_003605890.1|  Cysteine proteinase                                273   9e-84    
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             273   1e-83    
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         273   1e-83    
ref|XP_009599970.1|  PREDICTED: xylem cysteine proteinase 1-like        273   1e-83    
dbj|BAD29957.1|  cysteine protease                                      276   1e-83    
ref|XP_008357314.1|  PREDICTED: xylem cysteine proteinase 1-like        273   1e-83    



>ref|XP_009761201.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=344

 Score =   379 bits (973),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 243/342 (71%), Gaps = 10/342 (3%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR-MVKRYQDWLQKHGKRYEDKDEWEKRY  245
             +KN     +L   L   TNAS E H+  +H    M+KRYQDWLQ+H ++Y  KDEW  R+
Sbjct  1     MKNAYLNFVLFFTLWWLTNASVELHKKKNHGSNPMLKRYQDWLQRHSRKYGSKDEWNMRF  60

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH--KKESHNFTLHG  419
              IYQ NV +I+FFNS+N SY L DN FADMTN E+KS Y  YK   H  KK + N T  G
Sbjct  61    GIYQSNVQFIDFFNSLNLSYNLTDNAFADMTNLEFKSKYSGYKKHTHNSKKAAPNITCAG  120

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
              +LP    S+DWRKSG VT VKDQ +CGS WAF AVAAVEGIN+I+TGKLVSLSEQ+LVD
Sbjct  121   SKLPV---SLDWRKSGVVTRVKDQKNCGSCWAFSAVAAVEGINKIKTGKLVSLSEQELVD  177

Query  600   CN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GC GG  EKA+ FIK+NGGIT E NYPYVGKD +C T   + H VTISGY  
Sbjct  178   CDVNSDNQGCNGGFMEKAFSFIKKNGGITTEKNYPYVGKDQKCNTTKAKQHAVTISGYEM  237

Query  768   VPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQP  947
             V ++E  LQAA  +QP++  +DAS  DF+ Y+ G+++  C  +LNHGVT++GYG ++G+ 
Sbjct  238   VAKNEESLQAAVTKQPISVAIDASGYDFQLYAGGVYSGFCGNSLNHGVTLIGYGVDDGEK  297

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             YWLVKNSWGT WGEDGYIK++R S DK G CGIAM ASYPLK
Sbjct  298   YWLVKNSWGTMWGEDGYIKIKRGSNDKKGMCGIAMQASYPLK  339



>ref|XP_009609383.1| PREDICTED: ervatamin-B [Nicotiana tomentosiformis]
Length=309

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 229/308 (74%), Gaps = 9/308 (3%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             M+KRYQDWLQ+H ++Y  KDEW  R+ IYQ +V +I+FFNS+N SY L DN FADMTN E
Sbjct  1     MLKRYQDWLQRHSRKYGSKDEWNMRFGIYQSSVQFIDFFNSLNLSYNLTDNAFADMTNLE  60

Query  348   YKSVYLRYKIDEHKKE--SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
             +KS YL YK  +H K+  + N T     LP    SVDWRKSG VT VKDQ +CGS WAF 
Sbjct  61    FKSKYLGYKKHKHSKQLAAPNITCDRSSLPI---SVDWRKSGVVTRVKDQKNCGSCWAFS  117

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNY  689
             AVAAVEGIN+I+TGKLVSLSEQQLVDC+      GC GG  EKA+ FIK+NGGIT E NY
Sbjct  118   AVAAVEGINKIKTGKLVSLSEQQLVDCDVYSDNQGCNGGFMEKAFAFIKKNGGITTEKNY  177

Query  690   PYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             PYVGKD RC T   + H VTISGY  VP++E  LQAA  +QP++  +DAS  DF+ Y+ G
Sbjct  178   PYVGKDQRCNTTKAKQHAVTISGYEMVPKNEESLQAAVTKQPISVAIDASGYDFQLYAGG  237

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             +++  C  +LNHGVT++GYG ++G+ YWLVKNSWGT WGEDGYIKM+R S D+ G CGIA
Sbjct  238   VYSGFCGNSLNHGVTLIGYGVDDGEKYWLVKNSWGTMWGEDGYIKMKRGSNDQKGICGIA  297

Query  1050  MMASYPLK  1073
             M ASYPLK
Sbjct  298   MEASYPLK  305



>emb|CDP15898.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   354 bits (908),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 242/337 (72%), Gaps = 10/337 (3%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
             F ++ +L LC   +ASF +         + KRY++WL+K+G+ Y + DEWE R+ IYQ N
Sbjct  25    FVLLCILFLC--PSASFGEGRKLYDRGPVFKRYEEWLKKYGRTYANGDEWEMRFGIYQSN  82

Query  264   VLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPE  443
             V YI++ NS N SY+L DN++ADMTN E+ S YL YK    +++  NFT   V+LP    
Sbjct  83    VQYIDYINSRNLSYQLTDNQYADMTNEEFISTYLGYKTRSLQRDGQNFTSDPVKLPA---  139

Query  444   SVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC----NKH  611
             +VDWRK GAVT VKDQG+CGS WAF A+AAVEGIN+I+TGKLVSLSEQ+LVDC    N  
Sbjct  140   TVDWRKQGAVTPVKDQGACGSCWAFSAIAAVEGINKIKTGKLVSLSEQELVDCDYNRNNE  199

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGF  788
             GC GG  +KA++FIK NGGIT E +YPY GK  +C    E+ H VTI+GY K+P+ +E  
Sbjct  200   GCNGGFMDKAFEFIKTNGGITTESDYPYKGKKDKCNRAKEKDHAVTITGYGKIPKSNELA  259

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNS  968
             LQ AAA+QPV+  +DAS  +F+ YS+G+++  C + LNHGV V+GYGEE G+ YWLVKNS
Sbjct  260   LQTAAAKQPVSVAIDASGFNFQLYSKGVYSGYCDKNLNHGVAVIGYGEEGGKKYWLVKNS  319

Query  969   WGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             WGT WGE GYIKM+R + DK+G CGI + ASYP+K S
Sbjct  320   WGTKWGEAGYIKMERGTKDKDGLCGINLEASYPVKQS  356



>ref|XP_003635767.1| Cysteine proteinase [Medicago truncatula]
 gb|KEH39221.1| papain family cysteine protease [Medicago truncatula]
Length=338

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 238/348 (68%), Gaps = 18/348 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLC--LHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDK  224
             MK  + L  V   + ++   C  +HT  S       ++   M KRY+ WL+++G+ Y D+
Sbjct  1     MKTTITLSIVILNLWIIASACPEIHTKNS-------TNPAVMKKRYETWLKRYGRHYRDR  53

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN  404
             +EWE R++IYQ NV YIEF+NS N+SYKLIDN+FAD+TN E+KS YL Y      +    
Sbjct  54    EEWEVRFDIYQSNVQYIEFYNSQNYSYKLIDNRFADITNEEFKSTYLGYLPRFRVQTEFR  113

Query  405   FTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
             +  HG    E P+S+DWRK GAVTHVKDQG CGS WAF AVAAVEGIN+I+T  LVSLSE
Sbjct  114   YHKHG----ELPKSIDWRKKGAVTHVKDQGRCGSCWAFSAVAAVEGINKIKTENLVSLSE  169

Query  585   QQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             QQL+DC+      GCEGG+   A+++IK++GGI     YPY G+DG C     +++ VTI
Sbjct  170   QQLIDCDIKSGNEGCEGGDMYIAFNYIKKHGGIATAKEYPYKGRDGNCNKSKAKNNAVTI  229

Query  753   SGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG  929
             SGY  VP  +E  L+AA A QPV+   DA    F+FYS+GIF+  C + LNHG+T+VGYG
Sbjct  230   SGYESVPARNEKMLKAAVAHQPVSIATDAGGYAFQFYSKGIFSGSCGKNLNHGMTIVGYG  289

Query  930   EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             EENG  YW+VKNSW  +WGE GY++M+R + DK+G CGIAM A+YP+K
Sbjct  290   EENGDKYWIVKNSWANDWGESGYVRMKRDTKDKDGTCGIAMDATYPVK  337



>ref|XP_002275891.1| PREDICTED: zingipain-2 [Vitis vinifera]
Length=358

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 237/348 (68%), Gaps = 7/348 (2%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHE-MDSHHVRMVKRYQDWLQKHGKRYEDKD  227
             MK  +  +NV F ++++  + +  +A  E+HE M+S    M KRY+ WL +HG+RY+++D
Sbjct  1     MKTSMFCRNVYFALLIMWTVGVSWSAFSEEHEPMESEMSDMEKRYERWLVQHGRRYKNRD  60

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNF  407
             EW++ + IYQ NV +I + N+ NFS+ L DN+FADMTN EYK++Y+     E  +++ + 
Sbjct  61    EWQRHFGIYQSNVRFINYINAQNFSFTLTDNQFADMTNEEYKALYMGLGTSETSRKNQS-  119

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
             +    R    P SVDWRK GAVT V++QG CGS WAF  VAAVEGIN+I TGKLVSLSEQ
Sbjct  120   SFKRERSKVLPISVDWRKMGAVTPVRNQGECGSCWAFSTVAAVEGINKIRTGKLVSLSEQ  179

Query  588   QLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTIS  755
             +L+DC+      GC GG    A+ FIK+NGGIT   NYPY+G+ G C      +H V IS
Sbjct  180   ELLDCDIDSGNEGCNGGYMVNAFKFIKQNGGITTARNYPYIGEQGICNKDKAANHVVKIS  239

Query  756   GYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             GY  VP  +E  LQAA A+QPV+  +DA   +F+ YS+GIFN  C + LNH VTV+GYGE
Sbjct  240   GYETVPPNNEKILQAAVAKQPVSVAIDAGGYEFQLYSKGIFNGFCGKQLNHAVTVIGYGE  299

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKG  1076
             +NG+ YWLVKNSWGT WGE GY +M R S D  G CGIAM ASYP+K 
Sbjct  300   DNGKKYWLVKNSWGTGWGEAGYARMIRDSRDDEGICGIAMEASYPIKA  347



>ref|XP_011100224.1| PREDICTED: zingipain-2 [Sesamum indicum]
Length=348

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 233/348 (67%), Gaps = 9/348 (3%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR-MVKRYQDWLQKHGKRYEDKD  227
             MK   I  +    ++L+  L + ++A  E  +   +    M KRY+DWL+++G+RY   D
Sbjct  1     MKTPTITTSYHRGVVLMCILFVSSHAYLENDQQRENVTESMEKRYKDWLKRYGRRYSSTD  60

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNF  407
             EW  R+ IYQ NV +I+F NS N  Y +IDN+FADMTN E++S+YL Y+   +  +  N 
Sbjct  61    EWNLRFGIYQSNVQFIDFTNSQNRGYTVIDNQFADMTNLEFQSIYLGYRNHGNSHKPQNS  120

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
             T +     + P SVDWRK  AVT +KDQG+CGS WAF AVAA+EGI +I+TGKLVSLSEQ
Sbjct  121   TFNS---SDLPRSVDWRKHKAVTPIKDQGTCGSCWAFSAVAAIEGITKIKTGKLVSLSEQ  177

Query  588   QLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTIS  755
             +LVDC+      GC GG  EKA+ FI +N GIT E  YPY GK+G C T  E+     I+
Sbjct  178   ELVDCDSTPDNQGCRGGYMEKAFQFIIKNHGITTEKRYPYQGKEGMCNTTKEKMKAAKIT  237

Query  756   GYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             GY  +P  DE  +QAA A+QPV+  +DA   DF+FYS G+F   C   LNHGVT+VGYGE
Sbjct  238   GYVAIPARDEKRIQAAVAKQPVSVGIDAGGYDFQFYSSGVFAGYCGNNLNHGVTIVGYGE  297

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKG  1076
             +NG+ YWLVKNSWGT WG+ GY+KM+R S DK G CGIA+ ASYP KG
Sbjct  298   DNGEKYWLVKNSWGTTWGDSGYVKMKRGSADKRGTCGIALQASYPTKG  345



>emb|CBI21941.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 235/344 (68%), Gaps = 7/344 (2%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHE-MDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             +  +NV F ++++  + +  +A  E+HE M+S    M KRY+ WL +HG+RY+++DEW++
Sbjct  1     MFCRNVYFALLIMWTVGVSWSAFSEEHEPMESEMSDMEKRYERWLVQHGRRYKNRDEWQR  60

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
              + IYQ NV +I + N+ NFS+ L DN+FADMTN EYK++Y+     E  +++ + +   
Sbjct  61    HFGIYQSNVRFINYINAQNFSFTLTDNQFADMTNEEYKALYMGLGTSETSRKNQS-SFKR  119

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
              R    P SVDWRK GAVT V++QG CGS WAF  VAAVEGIN+I TGKLVSLSEQ+L+D
Sbjct  120   ERSKVLPISVDWRKMGAVTPVRNQGECGSCWAFSTVAAVEGINKIRTGKLVSLSEQELLD  179

Query  600   CN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GC GG    A+ FIK+NGGIT   NYPY+G+ G C      +H V ISGY  
Sbjct  180   CDIDSGNEGCNGGYMVNAFKFIKQNGGITTARNYPYIGEQGICNKDKAANHVVKISGYET  239

Query  768   VP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP  +E  LQAA A+QPV+  +DA   +F+ YS+GIFN  C + LNH VTV+GYGE+NG+
Sbjct  240   VPPNNEKILQAAVAKQPVSVAIDAGGYEFQLYSKGIFNGFCGKQLNHAVTVIGYGEDNGK  299

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKG  1076
              YWLVKNSWGT WGE GY +M R S D  G CGIAM ASYP+K 
Sbjct  300   KYWLVKNSWGTGWGEAGYARMIRDSRDDEGICGIAMEASYPIKA  343



>ref|XP_002525147.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37274.1| cysteine protease, putative [Ricinus communis]
Length=347

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 235/348 (68%), Gaps = 9/348 (3%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEM--DSHHVRMVKRYQDWLQKHGKRYEDK  224
             M+   ++KN    ++ L  L + + A  E H +  DS    M  RY  WL+++G++Y+ K
Sbjct  1     MEAPTMIKNAGLMLITLCTLWIPSIARSEIHSLPIDSAPTAMKVRYDKWLEQYGRKYDTK  60

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN  404
             DE+  R+ IY  N+ +IE+ NS N S+KL DNKFAD+TN E+ S+YL Y+I  +K+   N
Sbjct  61    DEYLLRFGIYHSNIQFIEYINSQNLSFKLTDNKFADLTNDEFNSIYLGYQIRSYKR--RN  118

Query  405   FTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
              +       + P++VDWR++GAVT +KDQG CGS WAF AVAAVEGIN+I+TG LVSLSE
Sbjct  119   LSHMHENSTDLPDAVDWRENGAVTPIKDQGQCGSCWAFSAVAAVEGINKIKTGNLVSLSE  178

Query  585   QQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             Q+LVDC+      GC GG  EKA+ FIK  GG+T E++YPY G DG CE    ++H V I
Sbjct  179   QELVDCDVNGDNKGCNGGFMEKAFTFIKSIGGLTTENDYPYKGTDGSCEKAKTDNHAVII  238

Query  753   SGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG  929
              GY  VP  +E  L+ A ++QPV+  +DAS  +F+ YSEG+F+  C   LNHGVT+VGYG
Sbjct  239   GGYETVPANNENSLKVAVSKQPVSVAIDASGYEFQLYSEGVFSGYCGIQLNHGVTIVGYG  298

Query  930   EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             + NGQ YWLVKNSWG  WGE GYI+M+R S D  G CGIAM  SYP+K
Sbjct  299   DNNGQKYWLVKNSWGKGWGESGYIRMKRDSSDTKGMCGIAMEPSYPIK  346



>ref|XP_004513101.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Cicer 
arietinum]
Length=353

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 238/351 (68%), Gaps = 10/351 (3%)
 Frame = +3

Query  36    HQKSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRY  215
             H K+      I   + F ++  L +      +  ++      V M KRY+ WL++HG+ Y
Sbjct  7     HTKNTAMKTTITLTLSFAVICNLWITASAYPAMHKNVSTDPEV-MKKRYETWLKRHGRHY  65

Query  216   EDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKE  395
              +++E+E R++IYQ NV +IEF+NS N+SYKL DN+FAD+TN E+KS YL Y      + 
Sbjct  66    RNREEFEVRFDIYQSNVEFIEFYNSQNYSYKLTDNRFADLTNEEFKSTYLGYLPRLRVET  125

Query  396   SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
                +  HG    + P+++DWRK GAVTHVKDQG CGS WAF AVAAVEGIN+I+TGKLVS
Sbjct  126   EFMYHQHG----DLPKNIDWRKKGAVTHVKDQGRCGSCWAFSAVAAVEGINKIKTGKLVS  181

Query  576   LSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHT  743
             LSEQ+L+DC+      GCEGG+ E A+ +IK++GG+ +  +YPY G DG+C     E H 
Sbjct  182   LSEQELIDCDTKSGNEGCEGGDMEIAFSYIKKHGGLDSSKDYPYEGTDGKCNKAKAEKHV  241

Query  744   VTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVV  920
             VTI+GY  VP  +E  L+AA   QPV+   DA    F+FYS+GIF+  C + LNHG+T+V
Sbjct  242   VTINGYESVPAGNEKMLKAAVCYQPVSVATDAGGYAFQFYSKGIFSGSCGKDLNHGMTIV  301

Query  921   GYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             GYGEE+G+ YWLVKNSW  +WGE GY++M+R   DK+G CGIAM A+YP+K
Sbjct  302   GYGEESGEKYWLVKNSWANDWGESGYVRMKRDITDKDGTCGIAMDATYPVK  352



>ref|XP_004243398.1| PREDICTED: ervatamin-B [Solanum lycopersicum]
Length=342

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 227/336 (68%), Gaps = 16/336 (5%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
             F +++ L LC  TNAS            ++ RYQ+W++K+ ++Y+++ EW  R+ IYQ N
Sbjct  11    FMLLIFLTLCYVTNAS-------QDDPIILNRYQNWVKKYRRKYQNEAEWNMRFGIYQSN  63

Query  264   VLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRY-KIDEHKKESHNFTLHGVRLPEFP  440
             + +I+FFNS+N SY L DN FADMTN E+ S+YL Y K  + +K+ +N T + +     P
Sbjct  64    IQFIDFFNSLNLSYSLTDNAFADMTNREFNSIYLGYEKPIQEQKDINNVTSYDIS--TLP  121

Query  441   ESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC----NK  608
               VDWRK G VT +KDQ SCGS WAF AVAA+EGIN+I+TGKLVSLSEQQL+DC    + 
Sbjct  122   IGVDWRKDGVVTPIKDQKSCGSCWAFSAVAAIEGINKIKTGKLVSLSEQQLMDCDVYSDN  181

Query  609   HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDEGF  788
              GC GG  E A+D+I  NGGIT   NYPY+GK+ +C T   + H V IS Y KVP +E  
Sbjct  182   QGCNGGFMESAFDYIMENGGITTSKNYPYIGKEQKCNTKKAKQHEVRISNYEKVPPNEES  241

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG--EENGQPYWLVK  962
             LQ A  +QP++  +DAS  +F+ YS G+F+  C   LNH VT++GY   E NG+ YW+VK
Sbjct  242   LQVAINKQPISVAIDASGYNFQLYSRGVFSGYCGNMLNHAVTLIGYDVEENNGEKYWIVK  301

Query  963   NSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
             NSWGT WGE GY+K++R S D  G CGIAM ASYPL
Sbjct  302   NSWGTMWGESGYMKIKRGSSDNGGMCGIAMQASYPL  337



>gb|AIA26572.1| cysteine protease [Cicer arietinum]
 gb|AJA74417.1| cysteine protease [Cicer arietinum]
Length=347

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 224/313 (72%), Gaps = 15/313 (5%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             M KRY+ WL++HG+ Y +++E+E R++IYQ NV +IEF+NS N+SYKL DN+FAD+TN E
Sbjct  38    MKKRYETWLKRHGRHYRNREEFEVRFDIYQSNVEFIEFYNSQNYSYKLTDNRFADLTNEE  97

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCG------SS  509
             +KS YL Y      +    +  HG    + P+++DWRK GAVTHVKDQG CG      S 
Sbjct  98    FKSTYLGYLPRLRVETEFMYHQHG----DLPKNIDWRKKGAVTHVKDQGRCGIKLDTGSC  153

Query  510   WAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITA  677
             WAF AVAAVEGIN+I+TGKLVSLSEQ+L+DC+      GCEGG+ E A+ +IK++GG+ +
Sbjct  154   WAFSAVAAVEGINKIKTGKLVSLSEQELIDCDTKSGNEGCEGGDMEIAFSYIKKHGGLDS  213

Query  678   EHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFR  854
               +YPY G DG+C     E H VTI+GY  VP  +E  L+AA   QPV+   DA    F+
Sbjct  214   SKDYPYEGTDGKCNKAKAEKHVVTINGYESVPAGNEKMLKAAVCYQPVSVATDAGGYAFQ  273

Query  855   FYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNG  1034
             FYS+GIF+  C + LNHG+T+VGYGEE+G+ YWLVKNSW  +WGE GY++M+R   DK+G
Sbjct  274   FYSKGIFSGSCGKDLNHGMTIVGYGEESGEKYWLVKNSWANDWGESGYVRMKRDITDKDG  333

Query  1035  KCGIAMMASYPLK  1073
              CGIAM A+YP+K
Sbjct  334   TCGIAMDATYPVK  346



>ref|XP_010070267.1| PREDICTED: zingipain-2 [Eucalyptus grandis]
 gb|KCW89603.1| hypothetical protein EUGRSUZ_A01887 [Eucalyptus grandis]
Length=349

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 232/349 (66%), Gaps = 7/349 (2%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQH-EMDSHHVRMVK-RYQDWLQKHGKRYEDK  224
             M++ LI +N+  T+ ++  LC    A    H  + S    +++ RY+ WL ++ + Y+ +
Sbjct  1     MELRLISRNLSPTLFVVWILCARPGAFPGDHLSLKSDRASLMEDRYESWLARYNRTYKSR  60

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN  404
              E   R++IYQ NVLY++F N +   +KL DN FADMTN E+K+ YL +    +++    
Sbjct  61    AERLLRFQIYQANVLYVDFINRLPLPFKLTDNGFADMTNVEFKATYLGFHRRTNRRTDME  120

Query  405   FTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
               +      + PES DWRK GAVT VKDQG CGS WAF AVAAVEG+NQI+TGKLVSLSE
Sbjct  121   TNVTDETDGDMPESFDWRKEGAVTPVKDQGQCGSCWAFSAVAAVEGLNQIKTGKLVSLSE  180

Query  585   QQLVDCN--KH--GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             Q+L+DC+  KH  GC GG  + A+ FI+RNGGIT+E +YPY G+DG C+     SH  TI
Sbjct  181   QELMDCDVGKHNQGCSGGEMDTAFSFIQRNGGITSESDYPYRGRDGSCDAAMLRSHAATI  240

Query  753   SGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG  929
             SGY  VP  DE  LQAA A+QP++  +DA   +F+ YS GIF  IC   LNHGV  VGYG
Sbjct  241   SGYGDVPPNDERSLQAAVARQPISVAIDAGGLEFQLYSRGIFTGICGYDLNHGVAAVGYG  300

Query  930   EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKG  1076
              E  + YW+VKNSWG +WGEDGY++M + + D+ G CGIAM ASYP+KG
Sbjct  301   SEGSRNYWIVKNSWGRDWGEDGYVRMLKGAPDRRGVCGIAMDASYPVKG  349



>ref|XP_008229136.1| PREDICTED: zingipain-2 [Prunus mume]
Length=343

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 238/348 (68%), Gaps = 11/348 (3%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHE-MDSHHVRMVKRYQDWLQKHGKRYEDKD  227
             M+  ++L     T  ++   C+ + A  E ++ + +    M +RY+ WLQK+G+ Y++++
Sbjct  1     METSMVLTRASLTFFMVWIFCISSTACSETYKPLRTDPKAMKERYERWLQKYGRIYKNRE  60

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNF  407
             E E R+ +Y+ N+ +++F NS N SYKL DNKFAD+TN E+ + ++ ++   H K   ++
Sbjct  61    EAEYRFGVYKSNIEFVDFVNSQNQSYKLTDNKFADITNLEFTNTFMGFQTRSHPKTKFSY  120

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                  +  + P +VDWRK+GAVT +K+QG CGS WAF AVAAVEGINQI+TGKLVSLSEQ
Sbjct  121   D----KDEDLPTAVDWRKNGAVTPIKNQGQCGSCWAFSAVAAVEGINQIKTGKLVSLSEQ  176

Query  588   QLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTIS  755
             +LVDC+      GC GG  EKA+ FIK NG ++ E +YPY G DG C+  + ++H V IS
Sbjct  177   ELVDCDVKTGNEGCNGGYMEKAFSFIKDNG-LSTEKDYPYKGSDGICDEDSLKNHAVNIS  235

Query  756   GYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             GY  +P + E  LQAA A QPV+  VDA+   F+FYS GIF   C + LNHGVT VGYGE
Sbjct  236   GYESIPANSEKSLQAAVAHQPVSVAVDAASYAFQFYSSGIFTGQCGKNLNHGVTAVGYGE  295

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKG  1076
             ++G+ YW+VKNSWG +WGE GYI+M R S DK G CGIAM ASYP+KG
Sbjct  296   DSGKKYWIVKNSWGPDWGESGYIRMTRDSVDKKGTCGIAMQASYPVKG  343



>ref|XP_006446742.1| hypothetical protein CICLE_v10015835mg [Citrus clementina]
 gb|ESR59982.1| hypothetical protein CICLE_v10015835mg [Citrus clementina]
Length=341

 Score =   328 bits (840),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 228/342 (67%), Gaps = 10/342 (3%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++L+NV  ++ LL  L +   A  E +        M +R+++WL+++ + Y  +DEW++R
Sbjct  3     MMLRNVVLSLFLLWVLGIPAGAWSESYPQKYDPQSMEERFENWLKQYSREYGSEDEWQRR  62

Query  243   YEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             + IY  NV YI++ NS N S+KL DNKFAD++N E+ S YL Y      K  +      V
Sbjct  63    FGIYSSNVQYIDYINSQNLSFKLTDNKFADLSNEEFISTYLGYN-----KPYNEPRWPSV  117

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
             +    P SVDWRK GAVT VK+QG CGS WAF AVAAVEGIN+++TGKLVSLSEQ+LVDC
Sbjct  118   QYLGLPASVDWRKEGAVTPVKNQGQCGSCWAFSAVAAVEGINKLKTGKLVSLSEQELVDC  177

Query  603   N----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GC GG  EKA++FI + GG+T E +YPY GK+ RC+T   + H VTI+GY  +
Sbjct  178   DVNSENQGCNGGYMEKAFEFITKIGGVTTEDDYPYRGKNDRCQTDKTKHHAVTITGYEAI  237

Query  771   PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPY  950
             P  E  LQA  + QPV+  +DA    F+ YS G+F+  C   LNHGVTVVGYGE++G+ Y
Sbjct  238   PASENNLQAKVSLQPVSVAIDAGGYAFQLYSHGVFDEYCGHQLNHGVTVVGYGEDHGEKY  297

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGIAMMASYPLK  1073
             WLVKNSWGT+WGE GYI+M R S   N G CGI M ASYP+K
Sbjct  298   WLVKNSWGTSWGEAGYIRMARNSPSSNIGICGILMQASYPVK  339



>ref|XP_004505522.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Cicer 
arietinum]
Length=343

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 227/335 (68%), Gaps = 10/335 (3%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMV-KRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             F+++++   C+  +     H+  S  + ++ KR+Q WL++HG++Y+D +EWE R+ +YQ 
Sbjct  12    FSLLMVFNTCITASECPPTHKHKSSDIEVLRKRFQGWLKRHGRKYKDNEEWEVRFGVYQA  71

Query  261   NVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFP  440
             NV YI+  N    SY L DNKFAD+TN E++S Y+      H      +  HG    + P
Sbjct  72    NVEYIKCINLQKNSYNLTDNKFADLTNEEFRSTYMGLSTRLHSHTGFRYDEHG----DIP  127

Query  441   ESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----K  608
             +S DWRK GAVT VKDQG CGS WAF AVAAVEGI++I+TG+LVSLSEQ+LVDC+     
Sbjct  128   DSKDWRKEGAVTEVKDQGQCGSCWAFSAVAAVEGIHKIKTGELVSLSEQELVDCDVKNGN  187

Query  609   HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEG  785
              GCEGG  E A+ FI +NGG+T E  YPY G DG C       H V+ISGY +VP E+E 
Sbjct  188   QGCEGGLMETAFTFIVKNGGLTTEKEYPYEGVDGTCNKEKAAHHAVSISGYEEVPAENEA  247

Query  786   FLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKN  965
              L+AAA+ QPV+  +DA    F+ YSEG+F+ IC + LNH VTVVGYGE N   YW+VKN
Sbjct  248   KLKAAASHQPVSVAIDAGGYSFQLYSEGVFSGICGKQLNHAVTVVGYGEVNSDKYWIVKN  307

Query  966   SWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
             SWGT WGE GY+K++R + DK+G CGIA +ASYP+
Sbjct  308   SWGTEWGESGYMKIKRDTFDKDGLCGIAKLASYPV  342



>ref|XP_010670721.1| PREDICTED: ervatamin-B isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670722.1| PREDICTED: ervatamin-B isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670723.1| PREDICTED: ervatamin-B isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670724.1| PREDICTED: ervatamin-B isoform X1 [Beta vulgaris subsp. vulgaris]
Length=345

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 236/348 (68%), Gaps = 15/348 (4%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASF----EQHEMDSHHVR-MVKRYQDWLQKHGKRYEDKD  227
             +   +VC    LL+  C+   +S+    E     ++++  M KRY++W++ HGK+Y+DK+
Sbjct  1     MAFTSVCRNSSLLILACILWISSYVDPCEVEPPTTYNLSVMEKRYRNWMESHGKQYKDKN  60

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVY---LRYKIDEHKKES  398
             EWE R+ IYQ NV ++++ NS N ++KLIDN FADMTN E+ S++   L+ +        
Sbjct  61    EWEIRFGIYQSNVQFVDYINSQNLTFKLIDNSFADMTNEEFNSIFTGRLKSRTPIKNHFP  120

Query  399   HNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSL  578
              N T H + LP     VDWRK GAVTHVKDQG+CGS WAF A+AAVEG+++I+TGKLVSL
Sbjct  121   TNKTRHRLHLPI---EVDWRKKGAVTHVKDQGTCGSCWAFSAIAAVEGLHKIKTGKLVSL  177

Query  579   SEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVT  749
             SEQ+LVDC++    GC GG  E A+++I+RNGGI +E  YPY+G+DG+C     + H V 
Sbjct  178   SEQELVDCDRGDNLGCSGGYMELAFEYIRRNGGIASEKAYPYIGRDGKCNKHRAKHHAVK  237

Query  750   ISGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGY  926
             I GY  V   DE  LQ A A+ PV+  +DA   +F+ Y  GIFN  C  +LNHGVTV+GY
Sbjct  238   IKGYKTVRTNDEKSLQYAVARNPVSVAIDAGGYEFQLYDSGIFNGNCGTSLNHGVTVIGY  297

Query  927   GEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
             GE+ G  YW+VKNSWGT WGEDGYI+M R S +++G CGIAM ASYP 
Sbjct  298   GEKKGIKYWIVKNSWGTAWGEDGYIRMNRDSSEESGLCGIAMDASYPF  345



>ref|XP_010670725.1| PREDICTED: ervatamin-B isoform X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670726.1| PREDICTED: ervatamin-B isoform X2 [Beta vulgaris subsp. vulgaris]
Length=305

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 219/308 (71%), Gaps = 10/308 (3%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             M KRY++W++ HGK+Y+DK+EWE R+ IYQ NV ++++ NS N ++KLIDN FADMTN E
Sbjct  1     MEKRYRNWMESHGKQYKDKNEWEIRFGIYQSNVQFVDYINSQNLTFKLIDNSFADMTNEE  60

Query  348   YKSVY---LRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAF  518
             + S++   L+ +         N T H + LP     VDWRK GAVTHVKDQG+CGS WAF
Sbjct  61    FNSIFTGRLKSRTPIKNHFPTNKTRHRLHLPI---EVDWRKKGAVTHVKDQGTCGSCWAF  117

Query  519   CAVAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNY  689
              A+AAVEG+++I+TGKLVSLSEQ+LVDC++    GC GG  E A+++I+RNGGI +E  Y
Sbjct  118   SAIAAVEGLHKIKTGKLVSLSEQELVDCDRGDNLGCSGGYMELAFEYIRRNGGIASEKAY  177

Query  690   PYVGKDGRCETIAEESHTVTISGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSE  866
             PY+G+DG+C     + H V I GY  V   DE  LQ A A+ PV+  +DA   +F+ Y  
Sbjct  178   PYIGRDGKCNKHRAKHHAVKIKGYKTVRTNDEKSLQYAVARNPVSVAIDAGGYEFQLYDS  237

Query  867   GIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGI  1046
             GIFN  C  +LNHGVTV+GYGE+ G  YW+VKNSWGT WGEDGYI+M R S +++G CGI
Sbjct  238   GIFNGNCGTSLNHGVTVIGYGEKKGIKYWIVKNSWGTAWGEDGYIRMNRDSSEESGLCGI  297

Query  1047  AMMASYPL  1070
             AM ASYP 
Sbjct  298   AMDASYPF  305



>gb|EYU29820.1| hypothetical protein MIMGU_mgv1a009422mg [Erythranthe guttata]
Length=342

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 230/343 (67%), Gaps = 13/343 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             KN    I+    LC+ +  S E  ++ +    M +R+ DWL+ + + Y+  +EW  R+ I
Sbjct  4     KNRSLAIVFFCMLCVSSKCS-EDRKVKNETETMEQRFNDWLKTYRQTYKSTNEWNFRFGI  62

Query  252   YQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH----KKESHNFTLHG  419
             YQ NV YI+F NS N SY L DN+FADMTN E++S+YL Y    H      E+ N TL  
Sbjct  63    YQSNVQYIDFVNSQNLSYSLTDNQFADMTNHEFQSIYLGYNNSNHLHGNSVETRNGTLRN  122

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               LP    S+DWRK GAVT +K+QG+CGS WAF A+AAVEGIN+I+TGKLV+LSEQ+L+D
Sbjct  123   YALPA---SIDWRKKGAVTPIKNQGTCGSCWAFSAIAAVEGINKIKTGKLVTLSEQELMD  179

Query  600   CN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GC GG  E A+DFI +NGG+    +YPY G++ +C++   ++    ISGY  
Sbjct  180   CDTKGGNQGCSGGIMEDAFDFIIKNGGVATSKDYPYKGRNDKCDSKKGKNKAAKISGYKY  239

Query  768   VP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP  +E  L+AA A+QPV+  +DA   +F+ YS G+F+  C ++LNHGVTVVGYG + G+
Sbjct  240   VPVGNEENLKAAVAKQPVSVAIDAGGYNFQLYSSGVFDGYCGQSLNHGVTVVGYGVDGGK  299

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YWLVKNSWGT+WG+ GY+KM R S DKNG CGIA+ ASYP K
Sbjct  300   KYWLVKNSWGTSWGQKGYVKMSRGSSDKNGICGIALQASYPTK  342



>ref|XP_007214244.1| hypothetical protein PRUPE_ppa023515mg [Prunus persica]
 gb|EMJ15443.1| hypothetical protein PRUPE_ppa023515mg [Prunus persica]
Length=343

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 234/348 (67%), Gaps = 11/348 (3%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHE-MDSHHVRMVKRYQDWLQKHGKRYEDKD  227
             M+  ++L     T +++   C+ + A  E ++ + +    M +RY+ WLQK+G+ Y++++
Sbjct  1     METSMVLTRASLTFLMVWIFCISSTACSETYKPLRTDPKAMKERYERWLQKYGRIYKNRE  60

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNF  407
             E   R+ +Y+ N+ +++F NS N SYKL DNKFAD+TN E+   ++ ++   H K   ++
Sbjct  61    EAAYRFGVYKSNIEFVDFVNSQNLSYKLTDNKFADITNLEFTKTFMGFQTRSHPKTKFSY  120

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                  +  E P +VDWRK GAVT +K+QG CGS WAF AVAAVEGINQI+TGKLVSLSEQ
Sbjct  121   D----KDEELPTAVDWRKHGAVTPIKNQGQCGSCWAFSAVAAVEGINQIKTGKLVSLSEQ  176

Query  588   QLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTIS  755
             +LVDC+      GC GG  EKA+ FIK NG ++ E +YPY G DG C+  + ++  V IS
Sbjct  177   ELVDCDVKTGNEGCNGGYMEKAFSFIKDNG-LSTEKDYPYKGSDGICDEDSLKNSAVNIS  235

Query  756   GYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             GY  +P + E  LQAA A QPV+  VDA+   F+FYS G F   C + LNHGVT VGYGE
Sbjct  236   GYESIPANSEKSLQAAVAHQPVSVAVDAAGYAFQFYSSGTFTGQCGKNLNHGVTAVGYGE  295

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKG  1076
             ++G+ YW+VKNSWG +WGE GYI+M R S DK G CGIAM ASYP+KG
Sbjct  296   DSGKKYWIVKNSWGPDWGESGYIRMTRDSVDKKGTCGIAMQASYPVKG  343



>ref|XP_004307286.1| PREDICTED: oryzain beta chain-like [Fragaria vesca subsp. vesca]
Length=344

 Score =   322 bits (826),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 235/349 (67%), Gaps = 13/349 (4%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTN--ASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDK  224
             M+  ++L+   F ++L+  LC+ ++   S  Q  +++    M +RY+ WL K+ +RY+++
Sbjct  1     METSIMLRCASFMLLLVWTLCISSSLACSERQKPVENDQNAMKERYERWLAKYDRRYKNR  60

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN  404
             DEWE R+ IYQ NV  I+F NS N SYKL DN FADMTN E+ + +L ++   + K    
Sbjct  61    DEWEHRFGIYQSNVELIDFINSQNLSYKLTDNVFADMTNQEFTTTHLGFRAGRNPKT--K  118

Query  405   FTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
             F   G++    P +VDWRK+G+VT V+DQG CGS WAF AVAAVEG+++I TGKLV LSE
Sbjct  119   FRYEGMK--GLPTTVDWRKNGSVTPVRDQGRCGSCWAFSAVAAVEGLHKINTGKLVPLSE  176

Query  585   QQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             Q+LVDC+      GC GG  E A+D+I++ G IT + +YPY G DG C    ++   V I
Sbjct  177   QELVDCDVNTGNQGCRGGFMENAFDYIRKYG-ITTQKDYPYTGSDGTCNKSKQKKSGVKI  235

Query  753   SGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPI-CPETLNHGVTVVGY  926
              GY  VPE DE  LQAA A QPV+  +DAS    + YS GIF+ + C ++L+HGVT VGY
Sbjct  236   GGYETVPENDEKSLQAAVAHQPVSVAIDASGFAMQLYSSGIFSGLLCGKSLDHGVTAVGY  295

Query  927   GEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             GEENG  YW+VKNSWGTNWGE GYI++ R   DK G CGIAMM+SYP+K
Sbjct  296   GEENGLKYWIVKNSWGTNWGESGYIRITRDYIDKEGACGIAMMSSYPVK  344



>ref|XP_006417940.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
 gb|ESQ36293.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
Length=344

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 218/336 (65%), Gaps = 11/336 (3%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +CF +++   LC    + F+  +       + KR++ WLQ HG  Y  KDEW  R+ IYQ
Sbjct  16    ICF-VLIASGLCSANASVFDPRKT------LKKRFEKWLQTHGILYGGKDEWMLRFGIYQ  68

Query  258   YNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
              N+  I++ NS+   +KL DN+FADMTNSE+K+ +L       +   ++  +        
Sbjct  69    SNIQLIDYINSLQLPFKLADNRFADMTNSEFKAHFLGLNTSSSRLHRNHMPVRDPAAVNV  128

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----  605
               +VDWRK GAVT V++QG CG  WAF AVAA+EGINQI+TGKLVSLSEQQL+DC+    
Sbjct  129   SAAVDWRKQGAVTPVRNQGRCGGCWAFAAVAAIEGINQIKTGKLVSLSEQQLIDCDTGTY  188

Query  606   KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDEG  785
               GC GG  E AY+FIK NGG+T E +YPY   +G C+    ++  VTI GY KV ++E 
Sbjct  189   NKGCSGGLMETAYEFIKTNGGLTTETDYPYTAAEGTCDQEKAKNKVVTIQGYQKVAQNEA  248

Query  786   FLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKN  965
              L+ AAAQQPV+  +DA    F+ YS G+F   C   LNH VTVVGYGEE GQ YW+VKN
Sbjct  249   SLRIAAAQQPVSVGIDAGGFIFQLYSSGVFTGYCGSNLNHAVTVVGYGEEGGQQYWIVKN  308

Query  966   SWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             SWGT WGE+GYI+M+R    + GKCGIAM+ASYP +
Sbjct  309   SWGTGWGEEGYIRMERGYSQETGKCGIAMLASYPTQ  344



>gb|KDO45769.1| hypothetical protein CISIN_1g041120mg [Citrus sinensis]
Length=340

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 219/351 (62%), Gaps = 31/351 (9%)
 Frame = +3

Query  36    HQKSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRY  215
             H K  + + ++L+N   ++ LL  L +   A  E +        M +R+++WL+++ + Y
Sbjct  14    HLKIAIDMRMMLRNAVLSLFLLWVLGIPAGAWSEGYPQKYDPQSMEERFENWLKQYSREY  73

Query  216   EDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKE  395
               +DEW++R+ IY  NV YI++ NS N S+KL DNKFAD++N E+ S YL Y      K 
Sbjct  74    GSEDEWQRRFGIYSSNVQYIDYINSQNLSFKLTDNKFADLSNEEFISTYLGYN-----KP  128

Query  396   SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
              +      V+    P SVDWRK GAVT VKDQG CGS WAF AVAAVEGIN+++TGKLVS
Sbjct  129   YNEPRWPSVQYLGLPASVDWRKEGAVTPVKDQGQCGSCWAFSAVAAVEGINKLKTGKLVS  188

Query  576   LSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHT  743
             LSEQ+LVDC+      GC GG  EKA++FI + GG+T E +YPY GK+ RC+T   + H 
Sbjct  189   LSEQELVDCDVNSENQGCNGGYMEKAFEFITKIGGVTTEDDYPYRGKNDRCQTDKTKHHA  248

Query  744   VTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             VTI+GY  +P                         F+ YS G+F+  C   LNHGVTVVG
Sbjct  249   VTITGYEAIPARYA---------------------FQLYSHGVFDEYCGHQLNHGVTVVG  287

Query  924   YGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGIAMMASYPLK  1073
             YGE++G+ YWLVKNSWGT+WGE GYI+M R S   N G CGI M ASYP+K
Sbjct  288   YGEDHGEKYWLVKNSWGTSWGEAGYIRMARNSPSSNIGICGILMQASYPVK  338



>ref|XP_007050023.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
 gb|EOX94180.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
Length=340

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 227/341 (67%), Gaps = 8/341 (2%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNA-SFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             ++N  FT++L+  L + +   S      +     + +RY+ WL +HG++Y+DK+E   R+
Sbjct  1     MENAGFTLVLVCALWMSSGVWSRNNRPENCDPENIQERYERWLVQHGRQYKDKEEMTLRF  60

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
              IY+ N  +I+  NS N S+KL DNKFADMTN+E++S YL        +ES  F     +
Sbjct  61    GIYKSNSEFIDSINSQNLSFKLTDNKFADMTNAEFRSAYLGSWSRRSPRESDEFQHD--K  118

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                    +DWR+ GAVT +KDQG CGS WAF AVAA+EGI +I+TG+L SLSEQ+L+DC+
Sbjct  119   HYNLSTYIDWREKGAVTPIKDQGQCGSCWAFSAVAAIEGIGKIKTGELTSLSEQELIDCD  178

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GC+GG  EKAY+FI +NGGIT E NYPY+G+DG C+ I   +  V ISGY  VP
Sbjct  179   VNNENQGCKGGYMEKAYEFIIKNGGITTEENYPYIGEDGICDEIKARNLAVAISGYKTVP  238

Query  774   -EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPY  950
               +E  LQ A A QPV+  +DA   +F+ YSEGIF   C   LNHGVTVVGYGE+ G+ Y
Sbjct  239   VNNERSLQDAVAHQPVSVAIDAGGYEFQLYSEGIFTGFCGNQLNHGVTVVGYGEDGGRKY  298

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             WLVKNSWGT+WGE GYI+MQR   DK G CGIAM ASYP+K
Sbjct  299   WLVKNSWGTSWGESGYIRMQRDFTDKRGICGIAMEASYPVK  339



>ref|XP_008458487.1| PREDICTED: ervatamin-B-like [Cucumis melo]
Length=346

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 231/348 (66%), Gaps = 10/348 (3%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQH--EMDSHHVRMVKRYQDWLQKHGKRYEDK  224
             M+ + ++ +V    ++L      T  S         S+   +  RYQ W+ K+G++Y+ +
Sbjct  1     MEAYKMIWSVSLISLILWVFWTPTRVSMAMDYPSGSSNSGELQDRYQKWMDKYGRQYKSR  60

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN  404
             +EWE+R+ IYQ NV YI+ FNS+N SY L +N F D+TN E+ + YL Y+      ++  
Sbjct  61    EEWEQRFTIYQANVQYIDNFNSLNHSYTLAENNFTDLTNEEFMATYLGYET-VSLPDTDT  119

Query  405   FTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
             F  +G  +   P +VDWRK GAVT +K+QG CGS WAF AVAAVEGIN+I+ GKL+SLSE
Sbjct  120   FFRYG-NMVNLPTNVDWRKEGAVTPIKNQGQCGSCWAFSAVAAVEGINKIKAGKLMSLSE  178

Query  585   QQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             Q+LVDC+      GC GG   KA++FIK+ G +T E  YPY      C+   E+  +V+I
Sbjct  179   QELVDCDVTSGNQGCNGGYMYKAFEFIKKTG-LTTELEYPYTATRSACDKQKEKYQSVSI  237

Query  753   SGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG  929
             SGY KVP  DE  LQAA A+QPV+  +DA  +DF+FYS GIF+  C + LNHGV +VGYG
Sbjct  238   SGYEKVPVNDEKSLQAAVAKQPVSVAIDAGGNDFQFYSGGIFSGNCGKQLNHGVAIVGYG  297

Query  930   EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             E++ Q YWLVKNSWGT+WGE GYI+M R S DK G CGIAMMASYP+K
Sbjct  298   EDSNQAYWLVKNSWGTSWGESGYIRMMRDSTDKQGTCGIAMMASYPIK  345



>ref|XP_010522111.1| PREDICTED: ervatamin-B [Tarenaya hassleriana]
Length=344

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 211/309 (68%), Gaps = 8/309 (3%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             M++RY+ WL++H K Y  KDEW  R+ IYQ NV +I+F NS++  + L DNKFADMTN E
Sbjct  37    MMQRYETWLKQHRKVYGSKDEWLLRFGIYQSNVQFIDFINSLDLPFNLTDNKFADMTNDE  96

Query  348   YKSVYLRYK---IDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAF  518
             +K+ +L +    +     E+H       R  + P +VDWR+ GAVT VKDQG CG  WAF
Sbjct  97    FKAKHLGFSKSFLPSEIPENHRHDAPCER-GDGPVAVDWRQKGAVTPVKDQGQCGGCWAF  155

Query  519   CAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHN  686
              A+AAVEGIN+I+TGKL+SLSEQ+L+DC+      GC GG  E A+ FIK NGGIT E N
Sbjct  156   SAIAAVEGINKIKTGKLISLSEQELIDCDTGKDNQGCNGGLMETAFAFIKSNGGITTESN  215

Query  687   YPYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSE  866
             YPY  +D  C+    ++H VTISGY KV  +E  LQAAAA QP++  +DA    F+ YS 
Sbjct  216   YPYKARDNTCDKSKAKNHAVTISGYGKVRTNEKSLQAAAASQPISVGIDAGGYAFQLYSS  275

Query  867   GIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGI  1046
             G+FN  C   LNHGVTVVGYGEE+ + YW+VKNSWGT WGE GYI+M R      G CGI
Sbjct  276   GVFNSYCGTQLNHGVTVVGYGEESKKKYWIVKNSWGTGWGEKGYIRMARNVKGTKGMCGI  335

Query  1047  AMMASYPLK  1073
             AMMASYP+K
Sbjct  336   AMMASYPIK  344



>ref|XP_003607546.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003637651.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89743.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/343 (50%), Positives = 223/343 (65%), Gaps = 11/343 (3%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNAS--FEQHEMDSHHVR-MVKRYQDWLQKHGKRYEDKDEWE  236
             IL    F +++L   C+  + S     H+  S  V  M KR+  W+++HG++Y+  DE E
Sbjct  5     ILTTTIFILLMLCNTCVIASESECPPTHKQKSSDVEAMKKRFDGWVKRHGRKYKHNDERE  64

Query  237   KRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLH  416
              R+ IYQ NV YI+  N+   SY L DNKFAD+TN E++S Y+       +  SHN    
Sbjct  65    VRFGIYQANVQYIQCKNAQKNSYNLTDNKFADLTNEEFQSTYMGLST---RLRSHNTGFR  121

Query  417   GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
                  + PES DWRK GAVT + DQG CG  WAF AVAAVEGIN+I++GKL+SLSEQ+L+
Sbjct  122   YDEHGDLPESKDWRKEGAVTEIMDQGQCGGCWAFAAVAAVEGINKIKSGKLISLSEQELI  181

Query  597   DCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             DC+      GC+GG  E AY FI  NGG+T E +YPY G DG C+      +  +ISGY 
Sbjct  182   DCDVKSGNQGCQGGLMETAYTFIIENGGLTTEQDYPYEGVDGTCKMEKAAHYAASISGYE  241

Query  765   KVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENG  941
             +VP D E  L+AAAA QPV+  +DA    F+FYSEG+F+ IC + LNHGVTVVGYG+E  
Sbjct  242   EVPADNEAKLKAAAAHQPVSVAIDAGGYSFQFYSEGVFSGICGKQLNHGVTVVGYGKETI  301

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
               YW+VKNSWG +WGE GYI+M+R +  K G CGIAM ASYPL
Sbjct  302   NKYWIVKNSWGADWGESGYIRMKRDTLSKEGMCGIAMQASYPL  344



>ref|XP_004148072.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cucumis 
sativus]
Length=317

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 211/304 (69%), Gaps = 10/304 (3%)
 Frame = +3

Query  177   RYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKS  356
             RYQ W+ K+G++Y+ ++EWE+R+ IYQ NV YI+ FNSMN S+ L +N FAD+TN E+K+
Sbjct  18    RYQKWMDKYGRQYKSREEWERRFTIYQANVQYIDNFNSMNHSHTLAENNFADLTNEEFKA  77

Query  357   VYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAV  536
              YL YK          +      +   P +VDWR+ GAVT +K+QG CGS WAF AVAAV
Sbjct  78    TYLGYKTVSIPDTCFRYG----NMVNLPTNVDWRQEGAVTPIKNQGQCGSCWAFSAVAAV  133

Query  537   EGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGK  704
             EGIN+I+ GKL+SLSEQ+LVDC+      GC GG   KA++FIKR G +T E  YPY G 
Sbjct  134   EGINKIKAGKLISLSEQELVDCDVTSGNQGCNGGYMYKAFEFIKRTG-LTTEIEYPYQGA  192

Query  705   DGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNP  881
             +  C    E+   V+ISGY KVP  DE  L+AA A QPV+  +DA  ++F+FYS GIF+ 
Sbjct  193   ESACNEQKEKYQFVSISGYEKVPVNDEKSLKAAVANQPVSVAIDAEGNNFQFYSGGIFSG  252

Query  882   ICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMAS  1061
              C   LNHGV +VGYGE + Q YWLVKNSWGT+WGE GYI+M+R S D+ G CGIAMMAS
Sbjct  253   NCGNQLNHGVAIVGYGETSNQAYWLVKNSWGTDWGESGYIRMKRDSTDRQGTCGIAMMAS  312

Query  1062  YPLK  1073
             YP K
Sbjct  313   YPTK  316



>gb|KFK42951.1| hypothetical protein AALP_AA1G060200 [Arabis alpina]
Length=343

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 227/347 (65%), Gaps = 18/347 (5%)
 Frame = +3

Query  66    ILKNVCFTIMLLL-PLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             +L+N   T+++L+  + + +        +   H  + +R+++WL+ HGK Y  K+EW  R
Sbjct  4     VLRNSNLTLVVLMCSVLIASRLCSVNSSLYDPHKTLKQRFENWLKTHGKLYGGKEEWMIR  63

Query  243   YEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             + IYQ NV  I++ NS+N S+KL DN+FAD+TN+E+K+ +L          + + +LH  
Sbjct  64    FGIYQSNVQLIDYINSLNLSFKLADNRFADLTNAEFKAHFLGLN-------TSSLSLHRN  116

Query  423   RLP------EFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
               P        P +VDWR  GAVT +++QG CG  WAF AVAA+EGIN+I+TG LV+LSE
Sbjct  117   HRPVCDSAGNAPAAVDWRTQGAVTPIRNQGRCGGCWAFAAVAAIEGINKIKTGNLVTLSE  176

Query  585   QQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             QQL+DC+      GC GG  E AY++IK NGG+T   +YPY   DG C+    ++  VTI
Sbjct  177   QQLIDCDTGTYNKGCSGGLMETAYEWIKTNGGLTTGTDYPYTATDGTCDQEKAKNKVVTI  236

Query  753   SGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             +G+ KV +DE  LQ A AQQPV+  +DA    F+ YS G+F   C   LNHGVTVVGYGE
Sbjct  237   TGHQKVAQDETSLQIATAQQPVSVGIDAGGFIFQLYSSGVFTGYCGANLNHGVTVVGYGE  296

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             E GQ YW+VKNSWG  WGE+GY++M+R   ++ GKCGIAM+ASYPL+
Sbjct  297   EGGQKYWIVKNSWGVGWGEEGYVRMERNYSEQTGKCGIAMLASYPLQ  343



>ref|XP_004169046.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like, partial 
[Cucumis sativus]
Length=314

 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 166/302 (55%), Positives = 210/302 (70%), Gaps = 10/302 (3%)
 Frame = +3

Query  177   RYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKS  356
             RYQ W+ K+G++Y+ ++EWE+R+ IYQ NV YI+ FNSMN S+ L +N FAD+TN E+K+
Sbjct  18    RYQKWMDKYGRQYKSREEWERRFTIYQANVQYIDNFNSMNHSHTLAENNFADLTNEEFKA  77

Query  357   VYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAV  536
              YL YK          +      +   P +VDWR+ GAVT +K+QG CGS WAF AVAAV
Sbjct  78    TYLGYKTVSIPDTCFRYG----NMVNLPTNVDWRQEGAVTPIKNQGQCGSCWAFSAVAAV  133

Query  537   EGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGK  704
             EGIN+I+ GKL+SLSEQ+LVDC+      GC GG   KA++FIKR G +T E  YPY G 
Sbjct  134   EGINKIKAGKLISLSEQELVDCDVTSGNQGCNGGYMYKAFEFIKRTG-LTTEIEYPYQGA  192

Query  705   DGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNP  881
             +  C    E+   V+ISGY KVP  DE  L+AA A QPV+  +DA  ++F+FYS GIF+ 
Sbjct  193   ESACNEQKEKYQFVSISGYEKVPVNDEKSLKAAVANQPVSVAIDAEGNNFQFYSGGIFSG  252

Query  882   ICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMAS  1061
              C   LNHGV +VGYGE + Q YWLVKNSWGT+WGE GYI+M+R S DK G CGIAMMAS
Sbjct  253   NCGNQLNHGVAIVGYGETSNQAYWLVKNSWGTDWGESGYIRMKRDSTDKQGTCGIAMMAS  312

Query  1062  YP  1067
             YP
Sbjct  313   YP  314



>ref|XP_010099502.1| KDEL-tailed cysteine endopeptidase CEP2 [Morus notabilis]
 gb|EXB79006.1| KDEL-tailed cysteine endopeptidase CEP2 [Morus notabilis]
Length=346

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 216/314 (69%), Gaps = 11/314 (4%)
 Frame = +3

Query  150   DSHHVRMVK-RYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKF  326
             + H+ + V+ RY  W +++G+ Y  ++E E R++IY  N+L+IE  NS NFSYKL DNKF
Sbjct  37    EEHNRQAVRQRYDRWAEQYGRNYGSEEEKELRFQIYHMNLLFIEQVNSQNFSYKLTDNKF  96

Query  327   ADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGS  506
             ADM N+E++   L Y+   H + S  F   G  L   P+ VDWRK+GAVT VKDQG CGS
Sbjct  97    ADMMNAEFRLRLLGYRPLLHNQTS--FRFGGPML--VPKQVDWRKNGAVTPVKDQGQCGS  152

Query  507   SWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGIT  674
              WAF +VAAVEG+NQI+TG+LVSLSEQ+LVDC+      GC GG  EKA+ FIKRNG IT
Sbjct  153   CWAFSSVAAVEGVNQIKTGELVSLSEQELVDCDVNTGNQGCNGGYMEKAFQFIKRNG-IT  211

Query  675   AEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDF  851
                 YPY G +GRC+        V ISGY KVP  DE  LQA  A QPV+  +DA   +F
Sbjct  212   TNGKYPYRGANGRCDEDKLRGRRVKISGYEKVPHNDEERLQATVAHQPVSVAIDAGGSEF  271

Query  852   RFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN  1031
             +FYS GIFN  C   LNHGVTVVGYGEE+G+ YWLVKNSWGT WGE GY+++ R S D  
Sbjct  272   QFYSHGIFNGRCGTDLNHGVTVVGYGEEDGKTYWLVKNSWGTEWGESGYVRIHRGSVDGR  331

Query  1032  GKCGIAMMASYPLK  1073
             G CGIAM ASYP+K
Sbjct  332   GTCGIAMEASYPVK  345



>gb|KGN62053.1| hypothetical protein Csa_2G292830 [Cucumis sativus]
Length=340

 Score =   314 bits (805),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 211/304 (69%), Gaps = 10/304 (3%)
 Frame = +3

Query  177   RYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKS  356
             RYQ W+ K+G++Y+ ++EWE+R+ IYQ NV YI+ FNSMN S+ L +N FAD+TN E+K+
Sbjct  41    RYQKWMDKYGRQYKSREEWERRFTIYQANVQYIDNFNSMNHSHTLAENNFADLTNEEFKA  100

Query  357   VYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAV  536
              YL YK          +      +   P +VDWR+ GAVT +K+QG CGS WAF AVAAV
Sbjct  101   TYLGYKTVSIPDTCFRYG----NMVNLPTNVDWRQEGAVTPIKNQGQCGSCWAFSAVAAV  156

Query  537   EGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGK  704
             EGIN+I+ GKL+SLSEQ+LVDC+      GC GG   KA++FIKR G +T E  YPY G 
Sbjct  157   EGINKIKAGKLISLSEQELVDCDVTSGNQGCNGGYMYKAFEFIKRTG-LTTEIEYPYQGA  215

Query  705   DGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNP  881
             +  C    E+   V+ISGY KVP  DE  L+AA A QPV+  +DA  ++F+FYS GIF+ 
Sbjct  216   ESACNEQKEKYQFVSISGYEKVPVNDEKSLKAAVANQPVSVAIDAEGNNFQFYSGGIFSG  275

Query  882   ICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMAS  1061
              C   LNHGV +VGYGE + Q YWLVKNSWGT+WGE GYI+M+R S D+ G CGIAMMAS
Sbjct  276   NCGNQLNHGVAIVGYGETSNQAYWLVKNSWGTDWGESGYIRMKRDSTDRQGTCGIAMMAS  335

Query  1062  YPLK  1073
             YP K
Sbjct  336   YPTK  339



>ref|XP_002889596.1| hypothetical protein ARALYDRAFT_887827 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65855.1| hypothetical protein ARALYDRAFT_887827 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 224/345 (65%), Gaps = 14/345 (4%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTN--ASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             +L+N   T+++L+   L  +   S      D H   + +R++ WL+ H K Y  +DEW  
Sbjct  4     VLRNSNLTLVVLICFVLIASKLCSVNSSVYDPHKT-LKQRFEKWLKTHSKLYGGRDEWML  62

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDE---HKKESHNFT  410
             R+ IYQ NV  I++ NS++  +KL DN+FADMTNSE+K+ +L         HKK+     
Sbjct  63    RFGIYQSNVQLIDYINSLHLPFKLTDNRFADMTNSEFKAHFLGLNTSSLRLHKKQRPVCD  122

Query  411   LHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQ  590
               G      P++VDWR  GAVT +++QG CG  WAF AVAA+EGIN+I+TG LVSLSEQQ
Sbjct  123   PAG----NVPDAVDWRTQGAVTPIRNQGKCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQ  178

Query  591   LVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISG  758
             L+DC+      GC GG  E A++FIK NGG+T E +YPY G +G C+    ++  VTI G
Sbjct  179   LIDCDVGTYNKGCSGGLMETAFEFIKSNGGLTTETDYPYTGIEGTCDQEKAKNKVVTIQG  238

Query  759   YTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN  938
             Y KV ++E  LQ AAAQQPV+  +DA    F+ YS G+F   C   LNHGVTVVGYG E 
Sbjct  239   YQKVAQNEASLQIAAAQQPVSVGIDAGGFIFQLYSSGVFTSYCGTNLNHGVTVVGYGVEG  298

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              Q YW+VKNSWGT WGE+GYI+M+R   +  GKCGIAM+ASYPL+
Sbjct  299   DQKYWIVKNSWGTGWGEEGYIRMERGISEDTGKCGIAMLASYPLQ  343



>ref|NP_563764.1| Cysteine proteinases superfamily protein [Arabidopsis thaliana]
 gb|AAF80223.1|AC025290_12 Contains similarity to a cysteine endopeptidase 1 from Phaseolus 
vulgaris gb|U52970 and is a member of the papain cysteine 
protease family PF|00112 [Arabidopsis thaliana]
 gb|AEE27969.1| Cysteine proteinases superfamily protein [Arabidopsis thaliana]
Length=343

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 223/345 (65%), Gaps = 14/345 (4%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTN--ASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             +L+N   T+ +L+   L  +   S +    D H   + +R++ WL+ H K Y  +DEW  
Sbjct  4     VLRNSNLTLAVLICFVLIASKLCSVDSSVYDPHKT-LKQRFEKWLKTHSKLYGGRDEWML  62

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDE---HKKESHNFT  410
             R+ IYQ NV  I++ NS++  +KL DN+FADMTNSE+K+ +L         HKK+     
Sbjct  63    RFGIYQSNVQLIDYINSLHLPFKLTDNRFADMTNSEFKAHFLGLNTSSLRLHKKQRPVCD  122

Query  411   LHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQ  590
               G      P++VDWR  GAVT +++QG CG  WAF AVAA+EGIN+I+TG LVSLSEQQ
Sbjct  123   PAG----NVPDAVDWRTQGAVTPIRNQGKCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQ  178

Query  591   LVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISG  758
             L+DC+      GC GG  E A++FIK NGG+  E +YPY G +G C+    ++  VTI G
Sbjct  179   LIDCDVGTYNKGCSGGLMETAFEFIKTNGGLATETDYPYTGIEGTCDQEKSKNKVVTIQG  238

Query  759   YTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN  938
             Y KV ++E  LQ AAAQQPV+  +DA    F+ YS G+F   C   LNHGVTVVGYG E 
Sbjct  239   YQKVAQNEASLQIAAAQQPVSVGIDAGGFIFQLYSSGVFTNYCGTNLNHGVTVVGYGVEG  298

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              Q YW+VKNSWGT WGE+GYI+M+R   +  GKCGIAMMASYPL+
Sbjct  299   DQKYWIVKNSWGTGWGEEGYIRMERGVSEDTGKCGIAMMASYPLQ  343



>ref|XP_010462580.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 213/319 (67%), Gaps = 17/319 (5%)
 Frame = +3

Query  147   MDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKF  326
             M   H  + +R+++WL+ H K Y  +DEW  R+ IYQ NV  I++ NS++  +KL DN+F
Sbjct  1     MYDPHKTLKQRFENWLKTHSKLYGGRDEWMLRFGIYQSNVQLIDYINSLHLPFKLTDNRF  60

Query  327   ADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLP------EFPESVDWRKSGAVTHVKD  488
             ADMTNSE+K+ +L       +       LH  + P      E P +VDWRK GAVT +++
Sbjct  61    ADMTNSEFKAHFLGLNTSSSR-------LHRKQRPVCDPAGEVPAAVDWRKQGAVTPIRN  113

Query  489   QGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIK  656
             QG CG  WAF AVAA+EGIN+I+TG LVSLSEQQL+DC+      GC GG  E A+++IK
Sbjct  114   QGKCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEYIK  173

Query  657   RNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvda  836
              NGG+  E +YPY G +G C+    ++  VTI GY KV ++E  LQ AAAQQPV+  +DA
Sbjct  174   TNGGLVTETDYPYTGIEGTCDQEKTKNKVVTIQGYKKVAQNEASLQIAAAQQPVSVGIDA  233

Query  837   SMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR  1016
                 F+ YS G+F   C   LNHGVTVVGYG E  Q YW+VKNSWGT WGE+GY++M+R 
Sbjct  234   GGFIFQLYSSGVFTSYCGTNLNHGVTVVGYGAEGDQKYWIVKNSWGTGWGEEGYVRMERG  293

Query  1017  SGDKNGKCGIAMMASYPLK  1073
               ++ GKCGIAM+ASYPL+
Sbjct  294   LSEQTGKCGIAMLASYPLQ  312



>ref|XP_010279240.1| PREDICTED: zingipain-2 [Nelumbo nucifera]
Length=353

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 229/357 (64%), Gaps = 19/357 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLL----LPLCLHTNASFEQHEMDSHHVR--MVKRYQDWLQKHGKR  212
             M +   ++N C T++++    +P   H   S E   M   +    M+ RY+ WL +H + 
Sbjct  1     MALLHFMRNACLTVLVMWVKWMPSDAHNCKSRESGGMGGKYDDNPMLHRYEQWLMRHNRS  60

Query  213   YEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKI---DE  383
             Y D +EWE R+ IYQ N+ +I + NS N+S+KLIDNKF D+TN E+K++YLR K     E
Sbjct  61    YHDHNEWEVRFGIYQSNLQFINYINSQNYSFKLIDNKFTDLTNEEFKAIYLRLKTCHQQE  120

Query  384   HKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETG  563
             +K+ S N           P SVDWRK GAVT VKDQG CGS WAF AVAAVEGIN I+TG
Sbjct  121   NKESSRN-----KNPTNLPSSVDWRKEGAVTPVKDQGRCGSCWAFSAVAAVEGINMIQTG  175

Query  564   KLVSLSEQQLVDCNKHGCEGGNTEK----AYDFIKRNGGITAEHNYPYVGKDGRCETIAE  731
             +LVSLSEQ+L+DC+ +    G        A+++IK+NGG++ E  YPY G DG C T   
Sbjct  176   ELVSLSEQELIDCDVNNGNQGCNGGYMSGAFEYIKKNGGLSTEDEYPYKGADGTCNTSTG  235

Query  732   ESHTVT-ISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHG  908
              ++ V  I GY  V   E  LQAA A+QPVA  VDA    F+FYS G+F+  C   LNH 
Sbjct  236   SANRVAAIRGYENVTASEDSLQAAVAKQPVAVAVDAGGFAFQFYSGGVFSGHCGINLNHA  295

Query  909   VTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +T VGYGEE+ Q YW+VKNSWGT+WGE+GYI+M+R   D  G CGI+M+ASYP+K S
Sbjct  296   MTAVGYGEEDSQKYWVVKNSWGTDWGEEGYIRMKRDVDDIEGLCGISMLASYPVKDS  352



>ref|XP_006306197.1| hypothetical protein CARUB_v10011832mg [Capsella rubella]
 gb|EOA39095.1| hypothetical protein CARUB_v10011832mg [Capsella rubella]
Length=344

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 221/338 (65%), Gaps = 7/338 (2%)
 Frame = +3

Query  75    NVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIY  254
             N+ F +++   L      S      D H   + +R+++WL+ H K Y  KDEW  R+ IY
Sbjct  9     NLTFGLVICFVLTASRLCSVNSSVYDPHKT-LKQRFENWLKTHSKLYGGKDEWMLRFGIY  67

Query  255   QYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
             Q NV  I++ NS++  +KL DN+FADMTNSE+K+ +L       + + +   +      +
Sbjct  68    QSNVQLIDYINSLHLPFKLTDNRFADMTNSEFKAHFLGLNTSSLRIQKNQRPVCD-PAGD  126

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---  605
              P +VDWRK GAVT +++QG CG  WAF AVAA+EGIN+I+TG LVSLSEQQL+DC+   
Sbjct  127   VPAAVDWRKQGAVTPIRNQGKCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGT  186

Query  606   -KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDE  782
                GC GG  E A+++IK NGG+  + +YPY G +G C+    ++  VTI G+ KV ++E
Sbjct  187   YNKGCSGGLMETAFEYIKTNGGLVTQTDYPYTGIEGTCDQEKTKNKVVTIQGFNKVAQNE  246

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVK  962
             G LQ+AAA+QPV+  +DA    F+ YS G+F   C   LNHGVTVVGYG E  Q YW+VK
Sbjct  247   GSLQSAAAKQPVSVGIDAGGFIFQLYSSGVFTSYCGTNLNHGVTVVGYGAEGDQKYWIVK  306

Query  963   NSWGTNWGEDGYIKMQRRSGD-KNGKCGIAMMASYPLK  1073
             NSWGT WGE+GYI+M+R   D   GKCGIAM+ASYPL+
Sbjct  307   NSWGTGWGEEGYIRMERGLSDVTTGKCGIAMLASYPLQ  344



>ref|XP_008790576.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=375

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 226/360 (63%), Gaps = 25/360 (7%)
 Frame = +3

Query  45    SVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDK  224
             + +K+ L  +     ++    L L T+ S +Q  +D     M +RY+ WL ++G+ Y+D 
Sbjct  24    AALKLLLTTR----LVVAFFALTLITSCSGDQPTLDP----MRQRYERWLARYGRTYKDG  75

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK-----  389
              E E+R+E+YQ NV  I+ FN+++  YKL DNKFAD+T+ E+++ Y+             
Sbjct  76    SEKERRFEVYQSNVQLIDKFNAISQGYKLTDNKFADLTSEEFRTKYMCLSNSRQSSPKAE  135

Query  390   -------KESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGIN  548
                    K  +NF          P SVDWRK GAVT+VKDQG CGS WAF AVAAVEG+N
Sbjct  136   IPNSGRLKRENNFAADHEDETVLPPSVDWRKKGAVTNVKDQGQCGSCWAFSAVAAVEGVN  195

Query  549   QIETGKLVSLSEQQLVDCNKHG----CEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRC  716
             QI TG+LV LSEQ+LVDC+ +G    C GG   +A+DF++RN G+T+E NYPY GK G+C
Sbjct  196   QIRTGQLVPLSEQELVDCDTNGVNSGCSGGFMNQAFDFVRRNHGLTSEMNYPYDGKQGQC  255

Query  717   ETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPE  893
             +T     H  TISGY  V  + E  L  A A QPV+A +DA    F+FYSEG+F   C  
Sbjct  256   QTTKLSDHVGTISGYRNVTANCEQCLLQAVAGQPVSAAIDAGGFAFQFYSEGVFTGPCGM  315

Query  894   TLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              LNHGVTVVGY     + YW+VKNSWGT+WGE GYI+M+    D+ G CGIAM+ASYPLK
Sbjct  316   NLNHGVTVVGYETAGEERYWMVKNSWGTDWGEQGYIRMRLGIPDEQGLCGIAMLASYPLK  375



>ref|XP_010475355.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 212/316 (67%), Gaps = 11/316 (3%)
 Frame = +3

Query  147   MDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKF  326
             M   H  + +R+++WL+ H K Y  +DEW  R+ IYQ NV  I++ NS++  +KL DN+F
Sbjct  1     MYDPHKTLKQRFENWLKTHSKLYGGRDEWMLRFGIYQSNVQLIDYINSLHLPFKLTDNRF  60

Query  327   ADMTNSEYKSVYLRYKIDE---HKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGS  497
             ADMTNSE+K+ +L         H+KE       G    + P +VDWRK GAVT +++QG 
Sbjct  61    ADMTNSEFKAHFLGLNTSSSRLHRKERPVCDPTG----DVPAAVDWRKQGAVTPIRNQGK  116

Query  498   CGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNG  665
             CG  WAF AVAA+EGIN+I+TG LVSLSEQQL+DC+      GC GG  E A+++IK NG
Sbjct  117   CGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVDTYNKGCSGGLMETAFEYIKTNG  176

Query  666   GITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMD  845
             G+  E +YPY G +G C+    ++  VTI G+ KV ++E  LQ AAAQQPV+  +DA   
Sbjct  177   GLVTETDYPYTGIEGTCDQEKTKNKVVTIQGFKKVAQNEASLQIAAAQQPVSVGIDAGGF  236

Query  846   DFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGD  1025
              F+ YS G+F   C   LNHGVTVVGYG E  Q YW+VKNSWGT WGE+GY++M+R   +
Sbjct  237   IFQLYSSGVFTSYCGTNLNHGVTVVGYGAEGDQKYWIVKNSWGTGWGEEGYVRMERGLSE  296

Query  1026  KNGKCGIAMMASYPLK  1073
             + GKCGIAM+ASYP +
Sbjct  297   QTGKCGIAMLASYPFQ  312



>ref|XP_010917956.1| PREDICTED: ervatamin-B-like, partial [Elaeis guineensis]
Length=361

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/362 (48%), Positives = 224/362 (62%), Gaps = 32/362 (9%)
 Frame = +3

Query  42    KSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYED  221
             K ++   L++    FT+         T+ S +Q  MD     M +RY+ WL ++G+ Y+D
Sbjct  5     KLLLTTRLVIAFFAFTL---------TSCSGDQPTMDP----MRQRYEQWLARYGRTYKD  51

Query  222   KDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVY------------L  365
               E E+R+EIYQ NV  I+ FN+++   KL DNKFAD+T+ E+++ Y            L
Sbjct  52    GREKERRFEIYQSNVQLIDEFNAISQGSKLTDNKFADLTSEEFRTKYMCLGNLKSRQGPL  111

Query  366   RYKI--DEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVE  539
             + +I      KE+ N   H       P SVDWRK GAVT VKDQG CGS WAF AVAAVE
Sbjct  112   KEEIINSSRPKETDNLGTHYEDKIVVPPSVDWRKKGAVTQVKDQGQCGSCWAFSAVAAVE  171

Query  540   GINQIETGKLVSLSEQQLVDCNKHG----CEGGNTEKAYDFIKRNGGITAEHNYPYVGKD  707
             GINQI TG+LV LSEQ+LVDC+  G    C GG   +A+DF++RN G+T+E NYPY G  
Sbjct  172   GINQIRTGQLVPLSEQELVDCDTEGANSGCSGGFMSQAFDFVQRNHGLTSEDNYPYDGSQ  231

Query  708   GRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPI  884
             GRC+T+    H  TISGY  V  + E  L  A A +PV+A +DA    F+FYSEG+F   
Sbjct  232   GRCQTVKLSDHVGTISGYRNVTANCEQNLLQAVASRPVSAAIDAGGFAFQFYSEGVFTGP  291

Query  885   CPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASY  1064
             C   LNHGVTVVGY     + YW+VKNSWGT WGE GYI+M+R   D+ G CGIAM ASY
Sbjct  292   CGMNLNHGVTVVGYETAGEEKYWIVKNSWGTEWGEQGYIRMRRGISDEQGLCGIAMQASY  351

Query  1065  PL  1070
             PL
Sbjct  352   PL  353



>ref|XP_010501342.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 212/316 (67%), Gaps = 11/316 (3%)
 Frame = +3

Query  147   MDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKF  326
             M   H  + +R+++WL+ H K Y  +DEW  R+ IYQ NV  I++ NS++  +KL DN+F
Sbjct  1     MYDPHKTLKQRFENWLKTHSKLYGGRDEWMLRFGIYQSNVQLIDYINSLHLPFKLTDNRF  60

Query  327   ADMTNSEYKSVYLRYKID---EHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGS  497
             ADMTNSE+K+ +L         H+KE       G    + P +VDWRK GAVT +++QG 
Sbjct  61    ADMTNSEFKAHFLGLNTSFSRLHRKERPVCDPTG----DVPAAVDWRKQGAVTPIRNQGK  116

Query  498   CGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNG  665
             CG  WAF AVAA+EGIN+I+TG LVSLSEQQL+DC+      GC GG  E A+++IK NG
Sbjct  117   CGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEYIKTNG  176

Query  666   GITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMD  845
             G+  E +YPY G +G C+    ++  VTI G+ KV ++E  LQ AAAQQPV+  +DA   
Sbjct  177   GLVTETDYPYTGIEGTCDQEKTKNKVVTIQGFKKVAQNEASLQIAAAQQPVSVGIDAGGF  236

Query  846   DFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGD  1025
              F+ Y  G+F   C   LNHGVTVVGYG E  Q YW+VKNSWGT WGE+GY++M+R   +
Sbjct  237   IFQLYGSGVFTSYCGTNLNHGVTVVGYGAEGDQKYWIVKNSWGTGWGEEGYVRMERGLSE  296

Query  1026  KNGKCGIAMMASYPLK  1073
             + GKCGIAM+ASYPL+
Sbjct  297   QTGKCGIAMLASYPLQ  312



>ref|XP_009790365.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=288

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 201/283 (71%), Gaps = 9/283 (3%)
 Frame = +3

Query  198   KHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKI  377
             +H ++Y  KDEW  R+ IYQ NV +I+FFNS+N SY L DN FADMTN E+ S YL YK 
Sbjct  5     RHRRKYGSKDEWNMRFGIYQSNVQFIDFFNSLNLSYNLTDNAFADMTNLEFNSKYLGYKK  64

Query  378   DEHKKE--SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQ  551
              +H K+  + N T    +LP    SVDWRKSG VT VKDQ +CGS WAF AVAAVEGIN+
Sbjct  65    RKHSKQLAAPNITCDSSKLPI---SVDWRKSGVVTRVKDQENCGSCWAFSAVAAVEGINK  121

Query  552   IETGKLVSLSEQQLVDC----NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCE  719
             I+TGKLVSLSEQQLVDC    +  GC GG  EKA+ FI +NGGIT E NY YVGKD +C 
Sbjct  122   IKTGKLVSLSEQQLVDCDVFSDNQGCNGGFMEKAFAFINKNGGITTEKNYHYVGKDQKCN  181

Query  720   TIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETL  899
             T   + H VTISGY  V ++E  LQAA  +QP++  +DAS  DF+  + G+++     +L
Sbjct  182   TTKAKQHAVTISGYEMVAKNEESLQAAFTKQPISVAIDASGYDFQLCAGGVYSVFFGNSL  241

Query  900   NHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDK  1028
             NHGV ++GYG ++G+ YWLVKNSWGT WGEDGYIK++R S DK
Sbjct  242   NHGVPLIGYGVDDGEKYWLVKNSWGTMWGEDGYIKIKRWSNDK  284



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 217/337 (64%), Gaps = 17/337 (5%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
               +  +L +C    AS E HE++     M  R++ W+ KHGK Y+D  E  +R++I++ N
Sbjct  12    IALFFVLAMCADQAASRELHELE-----MTGRHEKWMAKHGKVYKDDKEKLRRFQIFKSN  66

Query  264   VLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYK--IDEHKKESHNFTLHGVRLPE  434
             V++IE FN+  N SY L  NKFAD+TN E+++ +  YK  +   +K +  F    V    
Sbjct  67    VVFIESFNTAGNKSYMLGINKFADLTNEEFRAFWNGYKRPLGASRKITP-FKYENV--TA  123

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---  605
              P S+DWR  GAVT +KDQG CGS WAF AVAA EGI+++ TGKLVSLSEQ+LVDC+   
Sbjct  124   LPSSIDWRSKGAVTPIKDQGVCGSCWAFSAVAATEGIHKLRTGKLVSLSEQELVDCDVKG  183

Query  606   -KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GC+GG    A+ FIKR+GG+T+E NYPY G+DG+C+T  E S  V I+GY  VP++ 
Sbjct  184   QDKGCQGGLMVDAFKFIKRHGGMTSEANYPYQGRDGKCDTKKEASRAVKITGYQAVPKNS  243

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-GQPYWL  956
             E  L  A A QPV+  +DA    F+FY  GIF  IC + +NHGV  VGYG  N G  YW+
Sbjct  244   EAALLKAVANQPVSVAIDAGSLSFQFYRSGIFTGICGKDINHGVAAVGYGRSNSGSKYWI  303

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWGT WGE GYI+M+R    K G CGIAM  SYP
Sbjct  304   VKNSWGTEWGEKGYIRMKRDVRSKEGLCGIAMECSYP  340



>ref|XP_006348972.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=288

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/283 (55%), Positives = 197/283 (70%), Gaps = 7/283 (2%)
 Frame = +3

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+ IYQ NV +I+FFNS+N SY L DN FADMTN E+ S+YL Y+    ++E  N  +  
Sbjct  2     RFGIYQSNVQFIDFFNSLNLSYSLTDNAFADMTNREFNSIYLSYEKPMQEQEDIN-NVTS  60

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               + + P  VDWRK G VT +K+Q +CGS WAF AVAA+EGIN+I+TGKLVSLSEQQL+D
Sbjct  61    YDISKLPVGVDWRKDGVVTPIKNQKNCGSCWAFSAVAAIEGINKIKTGKLVSLSEQQLMD  120

Query  600   C----NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C    +  GC+GG  E A+D+I  NGGIT   NYPY+GK+ +C T   + H VTIS Y K
Sbjct  121   CDVYSDNQGCKGGFMESAFDYIMENGGITTSKNYPYIGKEQKCNTKKAKQHEVTISNYEK  180

Query  768   VPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG--EENG  941
             VP +E  LQ A  +QP++  +DAS   F+ YS GIF+  C  +LNH VT++GY   E NG
Sbjct  181   VPPNEESLQVAINKQPISVAIDASGYSFQLYSGGIFSGYCGNSLNHAVTLIGYDVEENNG  240

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
             + YW+VKNSWGT WGE GY+K++R S D  G CGIAM ASYPL
Sbjct  241   EKYWIVKNSWGTMWGESGYMKIKRGSSDNGGMCGIAMQASYPL  283



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   300 bits (768),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 213/336 (63%), Gaps = 11/336 (3%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             + F ++L+L +      +++          M++R+++W+ +HG+ Y+D  E  KR++I++
Sbjct  9     LIFAVLLVLEMW-----TYQATARSLPDASMIERHEEWMAQHGRAYKDDVEKAKRFKIFK  63

Query  258   YNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV YI+ FN      YKL  NKFAD+TN E+++    YK+  + K S   +     +  
Sbjct  64    ENVEYIQSFNEAGTRPYKLAVNKFADLTNEEFQASRNGYKMGSYGKASKVSSFRYANVTA  123

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P S+DWR+ GAVT VKDQG CG  WAF AVAA EGINQ+ TGKL+SLSEQ+LVDC+   
Sbjct  124   VPTSMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSE  183

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-E  782
               GC GG  + A++FI  NGGIT E NYPY   DG C +  E SH   I+GY  VP + E
Sbjct  184   DEGCNGGLMDNAFEFIISNGGITTESNYPYEAVDGTCNSKKESSHAAKITGYEDVPANSE  243

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLV  959
               L  A A QPV+  +DAS  DF+FY+ G+F   C   L+HGVT VGYG+  +G  YWLV
Sbjct  244   SALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWGT+WGE+GYI+MQR      G CGIAM ASYP
Sbjct  304   KNSWGTSWGENGYIRMQRDVDAAEGLCGIAMQASYP  339



>gb|KDP31767.1| hypothetical protein JCGZ_12228 [Jatropha curcas]
Length=315

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 219/324 (68%), Gaps = 21/324 (6%)
 Frame = +3

Query  126   ASFEQHEMDSHHVR-MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFS  302
             A  E H +  ++ + M KRY  WL+ HG++Y +KDE+  R+ IYQ N+ +I++ N+    
Sbjct  2     ADLEIHSLPRYNPKAMRKRYDRWLKHHGRKYHNKDEYYLRFGIYQSNIQFIDYINAQKLP  61

Query  303   YKLIDNKFADMTNSEYKSVYLRYKIDEH--KKESHNFTLHGVRLPEFPESVDWRKSGAVT  476
             Y+L DNKFAD+TN E+KS+YL ++ ++H  KK SH    HG    + P SVDW K GAVT
Sbjct  62    YELRDNKFADLTNDEFKSIYLGFQANKHGRKKPSHE---HG-NSSDLPTSVDWIKEGAVT  117

Query  477   HVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH----GCEGGNTEKAY  644
              VKDQG C        VAAVEGIN+I+TGKLVSLSEQ+LVDC+ H    GC GG  E A+
Sbjct  118   PVKDQGQC--------VAAVEGINKIKTGKLVSLSEQELVDCDTHNDSQGCNGGFMETAF  169

Query  645   DFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpva  821
              +I++ G ++ E +YPY GKDG C     ++ TVTISGY  VP  DE  LQ A A+QPV+
Sbjct  170   TYIQKQG-LSIEDDYPYEGKDGNCHKNKNKNQTVTISGYEAVPANDEKSLQTAVAKQPVS  228

Query  822   avvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYI  1001
               +DA    F+FYS+GIF+  C   LNHGVT VGYGE +G+ YWLVKNSWGT WG+ GYI
Sbjct  229   VAIDAGGFSFQFYSKGIFSGFCGTQLNHGVTAVGYGETDGKKYWLVKNSWGTEWGDSGYI  288

Query  1002  KMQRRSGDKNGKCGIAMMASYPLK  1073
             K++R S  K G CGIAM  SYP+K
Sbjct  289   KLRRGSKGKKGICGIAMEPSYPVK  312



>ref|XP_009110997.1| PREDICTED: ervatamin-B-like [Brassica rapa]
Length=343

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 204/306 (67%), Gaps = 5/306 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             + +R++ WLQ H   Y  K+EW  R+ IYQ N+  I++ NS++  +KL DN+FADMTN+E
Sbjct  39    LRERFKKWLQTHSILYGGKEEWMLRFGIYQSNLQLIDYINSLHLPFKLTDNRFADMTNAE  98

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAV  527
             +K+ +L       +  +    +    +   P SVDWRK GAVT V++QG CG  WAF  V
Sbjct  99    FKAHFLGLNTSTLRLNTDQRPVCDA-VGNVPASVDWRKEGAVTPVRNQGKCGGCWAFAVV  157

Query  528   AAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             AA+EGIN+I+TG LVSLSEQQL+DC+      GC GG    AY+++  NGG+  E +YPY
Sbjct  158   AAIEGINKIKTGNLVSLSEQQLIDCDVSAFNKGCSGGLLTTAYEYLIPNGGLVTEADYPY  217

Query  696   VGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
                 G C+    ++  VTI GYTKV ++E  LQAA AQQPV+  +DA    F+ YS G+F
Sbjct  218   TAIQGTCDQEKSQNKVVTIQGYTKVEQNEESLQAATAQQPVSVGIDAGGFIFQLYSSGVF  277

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMM  1055
                C   LNHGVTVVGYGEE+GQ YW+VKNSWGT WGE GY++M+R   ++ GKCGIAM+
Sbjct  278   TGFCGNHLNHGVTVVGYGEEDGQKYWIVKNSWGTGWGEQGYVRMERGYSEETGKCGIAML  337

Query  1056  ASYPLK  1073
             ASYP K
Sbjct  338   ASYPTK  343



>ref|XP_009119072.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY57814.1| BnaA10g28030D [Brassica napus]
Length=344

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/341 (46%), Positives = 219/341 (64%), Gaps = 7/341 (2%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             L+N   T+++L+   L  +          + H  + K++  WLQ HGK Y  KDEW  R+
Sbjct  5     LRNSNLTLVVLICFVLIASRLRSVSSSVYNPHNTLKKQFGKWLQYHGKSYGGKDEWMFRF  64

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
              I+Q N+ +I++ NS++  +KL +N+FADMTNSE+K+ +L       +  S N +     
Sbjct  65    GIFQSNLQFIDYINSLHLPFKLAENRFADMTNSEFKAHFLGLNTSSSRLHS-NHSCDPSA  123

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P++VDWRK GAVT ++DQG CG  WAF  VAA+EGI +I+TG L+ LSEQQL+DC+
Sbjct  124   SGNVPDAVDWRKEGAVTPIRDQGRCGGCWAFATVAAIEGITKIKTGNLIPLSEQQLIDCD  183

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGR-CETIAEESHTVTISGYTKV  770
                   GC GG  E AY+++  NGG+ A  +YPY   DG  C+    ++  VTI+GY KV
Sbjct  184   TGSYNKGCSGGLMETAYEYLIANGGLVALDDYPYTATDGTGCDQEKSQNKIVTITGYEKV  243

Query  771   PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPY  950
               +E  L+ AAAQQPV+  +DA    F+FYS G+F   C  +LNH VTVVGYGEE G+ Y
Sbjct  244   APNEASLEVAAAQQPVSVGIDADGFIFQFYSSGVFTGYCGSSLNHAVTVVGYGEEAGEKY  303

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             W+VKN+WGT WGE+GYI+M+R    + GKCGI M+ASYPL+
Sbjct  304   WIVKNTWGTGWGEEGYIRMERGYRKETGKCGITMLASYPLQ  344



>emb|CDY10188.1| BnaC05g04310D [Brassica napus]
Length=343

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/341 (46%), Positives = 221/341 (65%), Gaps = 8/341 (2%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCL-HTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             L+N   T+++L+   L  +  S     + + H  + K++  WLQ HGK Y  KDEW  R+
Sbjct  5     LRNSNLTLIVLICFVLTASRLSSVSSSVYNPHNTLKKQFGKWLQYHGKSYGGKDEWMFRF  64

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
              I+Q N+ +I++ NS++  +KL +N+FADMTNSE+K+ +L       +  S N +     
Sbjct  65    GIFQSNLQFIDYINSLHLPFKLAENRFADMTNSEFKAHFLGLNTSSLRLHSSNHSCDPAD  124

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P++VDWRK GAVT ++DQG CG  WAF  VAA+EGI +I+TG L+ LSEQQL+DC+
Sbjct  125   --NVPDAVDWRKEGAVTPIRDQGRCGGCWAFATVAAIEGITKIKTGNLIPLSEQQLIDCD  182

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGR-CETIAEESHTVTISGYTKV  770
                   GC GG  E AY+++  NGG+ A  +YPY   DG  C+    ++  VTI+GY KV
Sbjct  183   TGSYNKGCSGGLMETAYEYLIANGGLAALDDYPYTATDGTGCDQEKSQNKVVTITGYEKV  242

Query  771   PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPY  950
               +E  L+ AAAQQPV+  +DA    F+FYS G+F   C  +LNH VTVVGYGEE G+ Y
Sbjct  243   APNEASLEVAAAQQPVSVGIDADGFIFQFYSSGVFTGYCGSSLNHAVTVVGYGEEAGEKY  302

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             W++KN+WG  WGE+GYI+M+R    + GKCGIAM+ASYPL+
Sbjct  303   WILKNTWGIGWGEEGYIRMERGYRKETGKCGIAMLASYPLQ  343



>emb|CDY15571.1| BnaA08g28550D [Brassica napus]
Length=343

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 203/306 (66%), Gaps = 5/306 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             + +R++ WLQ H   Y  K+EW  R+ IYQ N+  I++ NS++  +KL DN+FADMTN+E
Sbjct  39    LRERFKKWLQTHSILYGGKEEWMLRFGIYQSNLQLIDYINSLHLPFKLTDNRFADMTNAE  98

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAV  527
             +K+ +L       +  +    +    +   P SVDWRK GAVT V++QG CG  WAF  V
Sbjct  99    FKAHFLGLNTSTLRLNTDQRPVCDA-VGNVPASVDWRKEGAVTPVRNQGKCGGCWAFAVV  157

Query  528   AAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             AA+EGIN+I+TG LVSLSEQQL+DC+      GC GG    AY+++  NGG+  E +YPY
Sbjct  158   AAIEGINKIKTGNLVSLSEQQLIDCDVSAFNKGCSGGLLTTAYEYLIPNGGLVTEADYPY  217

Query  696   VGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
                 G C+    ++   TI GYTKV ++E  LQAA AQQPV+  +DA    F+ YS G+F
Sbjct  218   TAIQGTCDQEKSQNKVFTIQGYTKVEQNEESLQAATAQQPVSVGIDAGGFIFQLYSSGVF  277

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMM  1055
                C   LNHGVTVVGYGEE+GQ YW+VKNSWGT WGE GY++M+R   ++ GKCGIAM+
Sbjct  278   TGFCGNHLNHGVTVVGYGEEDGQKYWIVKNSWGTGWGEQGYVRMERGYSEETGKCGIAML  337

Query  1056  ASYPLK  1073
             ASYP K
Sbjct  338   ASYPTK  343



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 213/338 (63%), Gaps = 11/338 (3%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             +N C ++ L+  L    + +  +   D+    M +++++W+ + G+ Y D +E E RY+I
Sbjct  6     RNGCISLALIFLLGALVSQAMARTLQDAS---MHEKHEEWMSRFGRVYNDGNEKEIRYKI  62

Query  252   YQYNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV  IE FN  +  SYKL  N+FAD+TN E+K+   R+K   H   S         L
Sbjct  63    FKENVQRIESFNKASGKSYKLGINQFADLTNEEFKTSRNRFK--GHMCSSQAGPFRYENL  120

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
                P S+DWRK GAVT +KDQG CGS WAF AVAAVEGI Q+ T KL+SLSEQ+LVDC+ 
Sbjct  121   TAAPSSMDWRKKGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCDT  180

Query  609   ----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GC+GG  + A+ FI++N G+T E NYPY G DG C T  E +H   I+G+  VP 
Sbjct  181   KGEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPA  240

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYW  953
             + EG L  A A+QPV+  +DA    F+FYS GIF   C   L+HGV  VGYGE NG  YW
Sbjct  241   NNEGALMKAVAKQPVSVAIDAGGFGFQFYSSGIFTGDCGTELDHGVAAVGYGESNGMNYW  300

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             LVKNSWGT WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  301   LVKNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYP  338



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 157/308 (51%), Positives = 199/308 (65%), Gaps = 6/308 (2%)
 Frame = +3

Query  162   VRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMT  338
               MV++++ W+ + G+ Y+D  E  KR+ I++ NV YI+ FN      YKL  NKFAD+T
Sbjct  32    ASMVEKHEQWIAQFGRVYKDDAEKAKRFNIFKENVEYIQSFNEAGARPYKLAINKFADLT  91

Query  339   NSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAF  518
             N E+++    YK+  + K S   +     +   P S+DWRK GAVT VKDQG CG  WAF
Sbjct  92    NEEFQASRNGYKMGSYGKSSKVSSFRYANVTAVPASMDWRKKGAVTGVKDQGQCGCCWAF  151

Query  519   CAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNY  689
              AVAA EGINQ+ TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGIT E NY
Sbjct  152   SAVAATEGINQLTTGNLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTESNY  211

Query  690   PYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSE  866
             PY G DG C +  E SH   I+GY  VP + E  L  A A QPV+  +DAS  DF+FY+ 
Sbjct  212   PYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYTS  271

Query  867   GIFNPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCG  1043
             G+F   C   L+HGVT VGYG+  +G  YWLVKNSWGT+WGE+GYI+MQR      G CG
Sbjct  272   GVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAAEGLCG  331

Query  1044  IAMMASYP  1067
             IAM ASYP
Sbjct  332   IAMQASYP  339



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 212/337 (63%), Gaps = 14/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++ +L        +   HE       M +R++DW+ ++G+ Y+D DE  KRY+I++
Sbjct  10    ICLALLFVLAAWASQATARNLHE-----ASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  IE FN +M+ SYKL  N+FAD+TN E+++   R+K      E+ +F    V    
Sbjct  65    DNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYENV--TA  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P +VDWRK GAVT +KDQG CGS WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+   
Sbjct  123   VPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-D  779
                GC GG  + A+ FI++N G+T E NYPY G DG C           I+GY  VP  +
Sbjct  183   EDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANN  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  LQ A A QP+A  +DA   +F+FYS G+F   C   L+HGV+ VGYG  ++G  YWL
Sbjct  243   EKALQKAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKYWL  302

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  303   VKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYP  339



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 207/337 (61%), Gaps = 13/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++L+L        S E          M  RY+ WL ++G+ Y D +E E R++I++
Sbjct  1     MCLGLILMLGAW-----SSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFK  55

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV +IEF N   N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V +P 
Sbjct  56    ENVAFIEFSNKDANKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKTSSFKYENVTVP-  114

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P ++DWRK GAVT VKDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ LVDC+   
Sbjct  115   LPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQXLVDCDTAG  174

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GCEGG  + A+ FI++N GI+ E NYPY G DG C T  E      I+G+  VP + 
Sbjct  175   EDQGCEGGLMDDAFQFIQQNHGISTEANYPYNGVDGTCNTKKEAIIAAKITGFEDVPANS  234

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  YWL
Sbjct  235   EKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWL  294

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  295   VKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMSASYP  331



>ref|XP_004501841.1| PREDICTED: vignain-like [Cicer arietinum]
Length=362

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 215/340 (63%), Gaps = 11/340 (3%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             ++L   L L  + SF+ H+ D S    +   Y+ W   H   +   +E  KR+ +++ NV
Sbjct  9     LVLSTSLVLGISESFDFHDKDLSSDETLWDLYERWRSHHTISHS-LNEKHKRFNVFKANV  67

Query  267   LYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPE  434
             +++   N M+  YKL  NKFADMTN E++S Y   K++ H+        N T    ++ +
Sbjct  68    MHVHDTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRGTPRGNGTFMYEKVNK  127

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---  605
              P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T KLVSLSEQ+L+DC+   
Sbjct  128   VPSSVDWRKKGAVTDVKDQGRCGSCWAFSTVVAVEGINQIKTNKLVSLSEQELIDCDNQE  187

Query  606   KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDE  782
               GC GG  E A++FIK+ GGIT E NYPY   DG C+++ E S  V+I G+  VP  DE
Sbjct  188   NQGCNGGLMENAFEFIKKTGGITTESNYPYTANDGSCDSLKENSPAVSIDGHETVPANDE  247

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLV  959
               L  A A QPV+  +DA   DF+FYSEG+F+  C + LNHGV VVGYG   +G  YW+V
Sbjct  248   DSLLKAVANQPVSVAIDAGGSDFQFYSEGVFSGDCGKELNHGVAVVGYGTTVDGTNYWIV  307

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +NSWG  WGE GYI+M+R   +K G CGIAM ASYP+K S
Sbjct  308   RNSWGAEWGEQGYIRMKRNVSEKEGLCGIAMEASYPIKHS  347



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 207/337 (61%), Gaps = 13/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++L+L        S E          M  RY+ WL ++G+ Y D +E E R++I++
Sbjct  1     MCLGLILMLGAW-----SSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFK  55

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV +IEF N   N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V +P 
Sbjct  56    ENVAFIEFSNKDANKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKTSSFKYENVTVP-  114

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P ++DWRK GAVT VKDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ LVDC+   
Sbjct  115   LPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQVLVDCDTAG  174

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GCEGG  + A+ FI++N GI+ E NYPY G DG C T  E      I+G+  VP + 
Sbjct  175   EDQGCEGGLMDBAFQFIQQNHGISTEANYPYBGVDGTCNTKKEAIIAAKITGFEDVPANS  234

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  YWL
Sbjct  235   EKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWL  294

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  295   VKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMSASYP  331



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 211/337 (63%), Gaps = 14/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++ +L        +   HE       M +R++DW+ ++G+ Y+D DE  KRY+I++
Sbjct  10    ICLALLFVLAAWASQATARSLHE-----ASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  IE FN +M+ SYKL  N+FAD+TN E+++   R+K      E+ +F    V    
Sbjct  65    DNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYENV--TA  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P +VDWRK GAVT +KDQG CGS WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+   
Sbjct  123   VPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-D  779
                GC GG  + A+ FI++N G+T E NYPY G DG C           I+GY  VP  +
Sbjct  183   EDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANN  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  LQ A A QP+A  +DAS  +F+FYS G+F   C   L+HGV  VGYG  ++G  YWL
Sbjct  243   EKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWL  302

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSW T WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  303   VKNSWSTGWGEEGYIRMQRDVTAKEGLCGIAMQASYP  339



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/306 (52%), Positives = 198/306 (65%), Gaps = 6/306 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMTNS  344
             M+++++ W+ + G+ Y+D  E  KR+ I++ NV YIE FN      Y L  NKFAD+TN 
Sbjct  34    MIEKHEQWMAQFGRVYKDDAEKSKRFRIFKENVEYIESFNEAGARPYTLAINKFADLTNE  93

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E+++    YK+  + K S   +     +   P S+DWRK GAVT VKDQG CG  WAF A
Sbjct  94    EFQASRNGYKMGSYPKSSMFSSFRYANVTAVPASMDWRKKGAVTGVKDQGQCGCCWAFSA  153

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             VAA EGINQ+ TGKL+SLSEQ+LVDC+     GC GG  + A++FI  NGGIT E NYPY
Sbjct  154   VAATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTESNYPY  213

Query  696   VGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGI  872
              G DG C T  E S    I+GY  VP + E  L  A A QPV+  +DAS  DF+FYS G+
Sbjct  214   EGVDGTCNTKKESSSAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYSSGV  273

Query  873   FNPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             F   C   L+HGVT VGYG+  +G  YWLVKNSWGT+WGE+GYI+MQR      G CGIA
Sbjct  274   FTGDCGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAPEGLCGIA  333

Query  1050  MMASYP  1067
             M ASYP
Sbjct  334   MQASYP  339



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 213/336 (63%), Gaps = 12/336 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             + F  +L+L +      S + +E       MV++++ W+ + G+ Y D  E  KR +I++
Sbjct  9     LAFVALLVLGMWASQTTSRDLNE-----ASMVQKHEYWMARFGRVYRDDAEKAKRLKIFK  63

Query  258   YNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV YIE  N      YKL  N+FAD+TN E+++ +  YK+  H+K S   +     +  
Sbjct  64    NNVDYIESVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMSSHQKSSKTISFRYENVTA  123

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH-  611
              P ++DWR  GAVT VKDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+   
Sbjct  124   -PATIDWRTKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS  182

Query  612   --GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-E  782
               GCEGG  + A+ FI +N G+T E NYPY G DG C+T  E +H   I+GY  VP + E
Sbjct  183   DMGCEGGLMDDAFTFIIKNHGLTTESNYPYEGTDGTCKTRKESNHVAKITGYEDVPANSE  242

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLV  959
               L +A A QPV+  +DAS  DF+FYS G+F   C   L+HGVT +GYG+  +G  YWLV
Sbjct  243   SALLSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTKYWLV  302

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWGT+WGE+GYI+MQR      G CGIAM ASYP
Sbjct  303   KNSWGTSWGENGYIRMQRDIDAAEGTCGIAMQASYP  338



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 211/337 (63%), Gaps = 14/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++ +L        +   HE       M +R++DW+ ++G+ Y+D DE  KRY+I++
Sbjct  10    ICLALLFVLAAWASQATARXLHE-----ASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  IE FN +M+ SYKL  N+FAD+TN E+++   R+K      E+ +F    V    
Sbjct  65    DNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYENV--TA  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P +VDWRK GAVT +KDQG CGS WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+   
Sbjct  123   VPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-D  779
                GC GG  + A+ FI++N G+T E NYPY G DG C           I+GY  VP  +
Sbjct  183   EDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANN  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  LQ A A QP+A  +DAS  +F+FYS G+F   C   L+HGV  VGYG  ++G  YWL
Sbjct  243   EKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWL  302

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSW T WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  303   VKNSWSTGWGEEGYIRMQRDVTVKEGLCGIAMQASYP  339



>ref|XP_002875897.1| hypothetical protein ARALYDRAFT_347926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52156.1| hypothetical protein ARALYDRAFT_347926 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 220/351 (63%), Gaps = 17/351 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDE  230
             MK  L++    F++++L   C      +E  E++S    + K Y  W + H        E
Sbjct  1     MKQLLLI--FLFSLVILETAC---GFDYEDKEIESEE-GLSKLYDRW-RSHHSVPRSLHE  53

Query  231   WEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH------KK  392
              EKR+ ++++NV+++   N  N SYKL  NKFAD+T  E+K+ Y   KI  H      K+
Sbjct  54    REKRFNVFRHNVMHVHNSNKKNRSYKLKLNKFADLTIHEFKNAYTGSKIKHHRMLQGPKR  113

Query  393   ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLV  572
              S  F      + + P SVDWRK GAVT +K+QG CGS WAF  VAAVEGIN+I+T KLV
Sbjct  114   GSKQFMYDHENVSKLPSSVDWRKKGAVTEIKNQGKCGSCWAFSTVAAVEGINKIKTNKLV  173

Query  573   SLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHT  743
             SLSEQ+LVDC+ +   GC GG  E A++FIK+NGGIT E +YPY G DG+C+   +    
Sbjct  174   SLSEQELVDCDTNQNEGCNGGLMEIAFEFIKKNGGITTEDSYPYEGIDGKCDASKDNGVL  233

Query  744   VTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVV  920
             VTI G+  VPE DE  L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV  V
Sbjct  234   VTIDGHENVPENDENALLKAVANQPVSVAIDAGSSDFQFYSEGVFTGDCGTELNHGVATV  293

Query  921   GYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             GYG + G+ YW+V+NSWGT WGE GYIK++R   +  G+CGIAM ASYP+K
Sbjct  294   GYGSQGGKKYWIVRNSWGTEWGEGGYIKIERGIDEPEGRCGIAMEASYPIK  344



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 209/341 (61%), Gaps = 11/341 (3%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             I K  CF   +L+   L T A +E    +     M  R++ W++ +GK Y D  E E+R+
Sbjct  4     ICKRQCFFAFILI---LGTWA-YEVASRELQEPSMSARHEQWMETYGKVYADAAEKERRF  59

Query  246   EIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             EI++ NV YIE FN+  N  YKL  NKFAD+TN E K     Y+     +     +    
Sbjct  60    EIFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELKVARNGYRRPLQTRPMKVTSFKYE  119

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
              +   P ++DWRK GAVT +KDQG CGS WAF  VAA EGINQ+ TGKLVSLSEQ+LVDC
Sbjct  120   NVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDC  179

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  E  ++FI +N GIT E NYPY   DG C +  E S    I+GY  V
Sbjct  180   DTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSRKEASRIAKITGYESV  239

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQ  944
             P + E  L  A A QP++  +DA   DF+FYS G+F   C   L+HGVT VGYGE  +G 
Sbjct  240   PANSEAALLKAVASQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGT  299

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWGT+WGE+GYI+MQR +  + G CGIAM +SYP
Sbjct  300   KYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYP  340



>ref|XP_011005600.1| PREDICTED: vignain [Populus euphratica]
Length=362

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 214/353 (61%), Gaps = 18/353 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKD  227
             MK FL+       + L L L L    S + HE D      +   Y+ W + H       D
Sbjct  3     MKKFLV-------VALSLALVLGITESLDFHEKDLESEESLWDLYERW-RSHHTVSTSLD  54

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KE  395
             E  KR+ +++ NV+++   N M   YKL  NKFADMTN E++SVY   K+  H+      
Sbjct  55    EKHKRFNVFKENVMHVHKTNKMGKPYKLKLNKFADMTNHEFRSVYAGSKVKHHRMFRGTP  114

Query  396   SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
               N +    ++ + P SVDWRK GAVT VKDQG CGS WAF  + AVEGIN I+T KLVS
Sbjct  115   RGNGSFMYGKVDKVPTSVDWRKKGAVTAVKDQGQCGSCWAFSTIVAVEGINYIKTNKLVS  174

Query  576   LSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC+     GC GG  E A++FIK+ GGIT E  YPY  KDG C+   E +  V
Sbjct  175   LSEQELVDCDTTENQGCNGGLMEYAFEFIKKKGGITTESIYPYKAKDGHCDAAKENNPAV  234

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             +I GY KVPE DE  L  AAA QPV+  +DA   DF+FYSEG+F   C   L+HGV VVG
Sbjct  235   SIDGYEKVPENDEDALLKAAANQPVSVAIDAGGSDFQFYSEGVFTGECRTELDHGVAVVG  294

Query  924   YGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             YG   +G  YW+V+NSWG  WGE GYI+MQR   DK G CGIAM ASYP+K S
Sbjct  295   YGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKEGLCGIAMEASYPIKNS  347



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 211/338 (62%), Gaps = 11/338 (3%)
 Frame = +3

Query  75    NVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIY  254
             N C  I L L + L   +S E        V M  RY+ W+ ++ + Y D DE EKR++I+
Sbjct  5     NHCKCIYLALIIMLGAWSS-EATSRSLQDVIMYGRYEQWMARYERVYSDFDEKEKRFQIF  63

Query  255   QYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLP  431
             + NV ++E  N   N  YKL  N+FAD+TN E+ +   R+K  E   E+ ++    V +P
Sbjct  64    KENVAFVESSNGEANKPYKLSVNRFADLTNEEFTASRNRFKGHECSTETTSYKYENVTVP  123

Query  432   EFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN--  605
                 ++DWR+ GAVT +KDQG CG  WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+  
Sbjct  124   A---TMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVN  180

Query  606   --KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED  779
                 GCEGG  + A+ FI +N G++ E NYPY G DG C    E SH  +I+G+  VP +
Sbjct  181   GEDQGCEGGLMDDAFQFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPAN  240

Query  780   -EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYW  953
              E  L  A A QP++  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  +NG  YW
Sbjct  241   SESALLKAVANQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDNGTKYW  300

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             LVKNSWG  WGE GYI+MQR    + G CGIAM ASYP
Sbjct  301   LVKNSWGAEWGEGGYIRMQRDVDAQEGLCGIAMAASYP  338



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 213/342 (62%), Gaps = 18/342 (5%)
 Frame = +3

Query  72    KNVC--FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             K++C  F+++LL     H  A           + M +R++ W+ + G+ Y D  E E+RY
Sbjct  7     KSLCMGFSVLLLCACASHATAR------TLSEMTMAERHEQWMAQQGRAYRDSAEKERRY  60

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK--KESHNFTLHG  419
             +I++ NV  IE FN+ N  YKL  N+FAD+TN E+K++   +K    K  K ++ F+   
Sbjct  61    QIFKANVELIESFNAGNSKYKLGVNQFADLTNEEFKAMMNGFKPSTLKTLKATNVFSYEN  120

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
             V     P S+DWR  GAVT +KDQG CG  WAF AVAA+EGI +++TGKL+SLSEQ+LVD
Sbjct  121   VT--AVPSSMDWRAKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLKTGKLMSLSEQELVD  178

Query  600   C----NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C    +  GC+GG  + A+ FI  N G+T E NYPY G DG C +    SH  +I GY  
Sbjct  179   CDVASDDQGCDGGLMDNAFKFIINNRGLTTETNYPYKGIDGTCNSKKSASHVASIKGYED  238

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENG  941
             VP + E  L  A A QPV+  ++AS   F+FYS GIF   C   L+HGVT VGYG  ++G
Sbjct  239   VPANSEAALLKAVANQPVSVAIEASSGSFQFYSSGIFTGSCGTDLDHGVTTVGYGTTKDG  298

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWG++WGE GYI+M+R    K G CGIAM ASYP
Sbjct  299   TKYWLVKNSWGSSWGEKGYIRMERDVAAKEGLCGIAMEASYP  340



>ref|NP_680113.3| KDEL-tailed cysteine endopeptidase CEP2 [Arabidopsis thaliana]
 sp|Q9STL4.1|CEP2_ARATH RecName: Full=KDEL-tailed cysteine endopeptidase CEP2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB41164.1| cysteine endopeptidase-like protein [Arabidopsis thaliana]
 gb|AEE78403.1| KDEL-tailed cysteine endopeptidase CEP2 [Arabidopsis thaliana]
Length=361

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 218/351 (62%), Gaps = 17/351 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDE  230
             MK  L++    F++++L   C      ++  E++S    +   Y  W + H       +E
Sbjct  1     MKKLLLI--FLFSLVILQTAC---GFDYDDKEIESEE-GLSTLYDRW-RSHHSVPRSLNE  53

Query  231   WEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH------KK  392
              EKR+ ++++NV+++   N  N SYKL  NKFAD+T +E+K+ Y    I  H      K+
Sbjct  54    REKRFNVFRHNVMHVHNTNKKNRSYKLKLNKFADLTINEFKNAYTGSNIKHHRMLQGPKR  113

Query  393   ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLV  572
              S  F      L + P SVDWRK GAVT +K+QG CGS WAF  VAAVEGIN+I+T KLV
Sbjct  114   GSKQFMYDHENLSKLPSSVDWRKKGAVTEIKNQGKCGSCWAFSTVAAVEGINKIKTNKLV  173

Query  573   SLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHT  743
             SLSEQ+LVDC+     GC GG  E A++FIK+NGGIT E +YPY G DG+C+   +    
Sbjct  174   SLSEQELVDCDTKQNEGCNGGLMEIAFEFIKKNGGITTEDSYPYEGIDGKCDASKDNGVL  233

Query  744   VTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVV  920
             VTI G+  VPE DE  L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV  V
Sbjct  234   VTIDGHEDVPENDENALLKAVANQPVSVAIDAGSSDFQFYSEGVFTGSCGTELNHGVAAV  293

Query  921   GYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             GYG E G+ YW+V+NSWG  WGE GYIK++R   +  G+CGIAM ASYP+K
Sbjct  294   GYGSERGKKYWIVRNSWGAEWGEGGYIKIEREIDEPEGRCGIAMEASYPIK  344



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 215/339 (63%), Gaps = 18/339 (5%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHE--MDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             +C  ++ +L       A++  H    + H   M +R++DW+ ++G+ Y+D  E  KRY+I
Sbjct  10    ICLALLFVL-------AAWASHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRYKI  62

Query  252   YQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV  IE FN +MN SYKL  N+FAD+TN E+++   R+K      E+ +F    V  
Sbjct  63    FKDNVARIESFNKAMNKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYEHVXA  122

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
                P +VDWRK GAVT +KDQG CGS WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+ 
Sbjct  123   --VPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  609   ----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GC GG  + A+ FI++N G+T E NYPY G DG C           I+GY  VP 
Sbjct  181   SGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  777   -DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
              +E  LQ A A QP+A  +DA   +F+FYS G+F   C   L+HGV+ VGYG  ++G  Y
Sbjct  241   NNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKY  300

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWGT WGE+GYI+MQR   +K G CGIAM ASYP
Sbjct  301   WLVKNSWGTGWGEEGYIRMQRDVTEKEGLCGIAMQASYP  339



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 219/336 (65%), Gaps = 15/336 (4%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
             F  +L+L LC+    S   +E       + ++++ W+ ++G+ Y+D  +  KR E ++ N
Sbjct  11    FATLLVLGLCISLVTSRTLYE-----ASITEKHEQWMSQYGRVYKDDTKKAKRLETFKQN  65

Query  264   VLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK-ESHNFTLHGVRLPEF  437
             + YIE  N  +  +YKL  N+FADMTN E+K++   Y+I   +K ++ +F    V +P  
Sbjct  66    LEYIESTNKDVTRTYKLGINQFADMTNEEFKAIRNGYRISSQQKIKNTSFQYENVTVPY-  124

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---K  608
               S+DWRK GAVT +KDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+    
Sbjct  125   --SMDWRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTNSN  182

Query  609   HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EG  785
              GCEGG  + A+ +I +N G+T+E NYPY G DG C+T  E +H   ISGY  VPE+ E 
Sbjct  183   QGCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHIAKISGYKDVPENSES  242

Query  786   FLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLVK  962
              L  A A QPV+  +DAS  DF+FYS GIF   C   L+HGV  VGYG  ++G  YW+VK
Sbjct  243   ALLKAVANQPVSVAIDASGSDFQFYSSGIFTGKCGTELDHGVVAVGYGATKDGTKYWIVK  302

Query  963   NSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
             NSWG +WGE+GYI+M+R    K G CGIAM ASYP+
Sbjct  303   NSWGVSWGENGYIRMKRDIVAKTGLCGIAMKASYPI  338



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 202/310 (65%), Gaps = 6/310 (2%)
 Frame = +3

Query  156   HHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFAD  332
             H   M +R++ W+ K+G+ Y+D  E E+R+EI++ NV +IE FN   N  YKL  N+FAD
Sbjct  30    HDAAMNERHEMWMVKYGRVYKDNSEKERRFEIFRNNVEFIESFNKPGNRPYKLDINEFAD  89

Query  333   MTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSW  512
             +TN E+K+    YK   +   S   +     +   P S+DWR+ GAVT +KDQG CG  W
Sbjct  90    LTNEEFKASRNGYKRSSNVGLSEKSSFRYGNVTAVPTSMDWRQKGAVTPIKDQGQCGCCW  149

Query  513   AFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAE  680
             AF AVAA+EGI ++ TGKL+SLSEQ+LVDC+      GCEGG  + A++FIK+NGG+T E
Sbjct  150   AFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTE  209

Query  681   HNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRF  857
              NYPY G DG C T    +    I+GY  VP + E  L  A A QPV+  +DAS   F+F
Sbjct  210   ANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQF  269

Query  858   YSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGK  1037
             YS G+F   C   L+HGVT VGYG  +G  YWLVKNSWGT+WGEDGYI+M+R    K G 
Sbjct  270   YSGGVFTGDCGTELDHGVTAVGYGTSDGTKYWLVKNSWGTSWGEDGYIRMERDIEAKEGL  329

Query  1038  CGIAMMASYP  1067
             CGIAM +SYP
Sbjct  330   CGIAMQSSYP  339



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 224/357 (63%), Gaps = 17/357 (5%)
 Frame = +3

Query  36    HQKSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR----MVKRYQDWLQKH  203
                S M VFL      F ++ L      +   +++   D    R    ++  Y+ WL KH
Sbjct  5     RSSSSMAVFL------FLLLGLASALDMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKH  58

Query  204   GKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDE  383
             GK Y    E E+R++I++ N+ +I+  N+ N +YK+  N+FAD+TN EY+S+YL  +   
Sbjct  59    GKSYNALGEKERRFQIFKDNLRFIDEHNAENRTYKVGLNRFADLTNEEYRSMYLGTRTAA  118

Query  384   HKKESHNFT-LHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIE  557
              ++ S+  +  +  R+ +  PESVDWRK GAV  VKDQGSCGS WAF  +AAVEGIN+I 
Sbjct  119   KRRSSNKISDRYAFRVGDSLPESVDWRKKGAVVEVKDQGSCGSCWAFSTIAAVEGINKIV  178

Query  558   TGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIA  728
             TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI +E +YPY   DGRC+   
Sbjct  179   TGGLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDSEEDYPYKASDGRCDQYR  238

Query  729   EESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNH  905
             + +  VTI GY  VPE DE  L+ A A QPV+  ++A   +F+ Y  GIF   C   L+H
Sbjct  239   KNAKVVTIDGYEDVPENDEKSLEKAVANQPVSVAIEAGGREFQLYQSGIFTGRCGTALDH  298

Query  906   GVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             GVT VGYG ENG  YW+VKNSWG +WGE+GYI+M+R  +    GKCGIAM ASYP+K
Sbjct  299   GVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATSATGKCGIAMEASYPIK  355



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 214/337 (64%), Gaps = 11/337 (3%)
 Frame = +3

Query  75    NVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIY  254
             N+ F  +L+L        S + +E  S    MV++++ W+   G+ Y+D  E  KR++I+
Sbjct  9     NLAFAALLVLVSFASQATSRDLYEAAS----MVQKHEQWMSHFGRVYKDDVEKAKRFKIF  64

Query  255   QYNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLP  431
             Q+NV YIEF N      YKL  N+FAD++N E++     YK+  H++ S   +     + 
Sbjct  65    QHNVEYIEFVNKAGTRPYKLGINEFADLSNEEFRDTRNGYKMTSHQQLSKTTSFKYANVT  124

Query  432   EFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH  611
               P ++DWR  GAVT +KDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+  
Sbjct  125   A-PATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTS  183

Query  612   ---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GCEGG  + A+ FI +N G+T E NYPY G +  C+T  E +H   I+GY  VP + 
Sbjct  184   SDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTNATCKTGKESNHAAKITGYEDVPANS  243

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWL  956
             E  L  A A QP++  +DAS  DF+FYS G+F   C   L+HGVT +GYG+  +G  YWL
Sbjct  244   ESALLKAVANQPISVAIDASGSDFQFYSTGVFTGECGTELDHGVTAIGYGKTSDGTQYWL  303

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWGT+WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  304   VKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYP  340



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 209/337 (62%), Gaps = 14/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++ +L        +   HE       M +R++DW+ ++G+ Y+D DE  KRY+I++
Sbjct  10    ICLALLFVLAAWASQATARNLHE-----ASMYERHEDWMAQYGRVYKDADEKSKRYKIFK  64

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  IE FN +M+ SYKL  N+FAD+TN E+ +   R+K      E+ +F    V    
Sbjct  65    DNVARIESFNKAMDKSYKLSINEFADLTNEEFGTSRNRFKAHICSTEATSFKYENV--TA  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P ++DWRK GAVT +KDQG CGS WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+   
Sbjct  123   VPSTIDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-D  779
                GC GG  + A+ FIK+N G+T E NYPY G DG C           I+GY  VP  +
Sbjct  183   EDQGCNGGLMDDAFKFIKQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANN  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  LQ A   QP+A  +DA   +F+FYS G+F   C   L+HGV  VGYG  ++G  YWL
Sbjct  243   EKALQKAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWL  302

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  303   VKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYP  339



>ref|XP_008381611.1| PREDICTED: ervatamin-B [Malus domestica]
Length=363

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 227/368 (62%), Gaps = 35/368 (10%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHE-MDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             ++L+    T  ++  LC+ + A  ++++ ++     M  RYQ W  K+G++Y+ ++E   
Sbjct  1     MMLERASLTFFMVCILCISSTACAQEYKPLEGDPKAMRXRYQRWQDKYGRKYKSEEEKAY  60

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+ IY+ N+ +++F NS N SYKL DNKFAD+TN E+ + Y+ ++     K   ++    
Sbjct  61    RFGIYKSNLEFVDFINSQNLSYKLSDNKFADITNIEFTTNYMGFQTRRDLKMRFSYD---  117

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCG------------------------SSWAFCAV  527
              +  + P +VDWRK GAVT +K+QG CG                        S WAF AV
Sbjct  118   -KEEDLPTTVDWRKRGAVTPIKEQGKCGINYVLFLPLFMLLKFHWFYTYNAGSCWAFSAV  176

Query  528   AAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             AAVEGIN+I+TG LVSLSEQ+LVDC+      GC GG  EKA+ FIK NG ++ E +YPY
Sbjct  177   AAVEGINKIKTGNLVSLSEQELVDCDVNSGNQGCSGGFMEKAFSFIKDNG-LSTEEDYPY  235

Query  696   VGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGI  872
              G  G C+    +   V ISGY ++P  +E  LQAA A+QPV+  +DA    F+ YS GI
Sbjct  236   KGLQGTCDEDKLKRRAVNISGYERIPVNNEKSLQAAVARQPVSVAIDAGSYGFQLYSSGI  295

Query  873   FNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
             F   C + LNHGVT VGYGE++G+ YW+VKNSWG +WGE GY+++ R S DK G CGIAM
Sbjct  296   FTGYCGKNLNHGVTAVGYGEDSGKKYWIVKNSWGLDWGESGYVRITRNSADKEGTCGIAM  355

Query  1053  MASYPLKG  1076
              ASYP++ 
Sbjct  356   QASYPVQA  363



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 216/348 (62%), Gaps = 14/348 (4%)
 Frame = +3

Query  42    KSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYED  221
             KS+M+ F     +C  + LL  L    + S  +   D   V M +R++ W+ ++G+ Y+D
Sbjct  24    KSIMR-FTKQSQIC--LALLFVLVAWPSKSVARTLQD---VSMYERHEQWMAQYGRVYKD  77

Query  222   KDEWEKRYEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKES  398
               E E RY I++ NV  I+ FNS    SYKL  N+FAD++N E+K+   R+K      ++
Sbjct  78    DAEKETRYNIFKENVARIDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQA  137

Query  399   HNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSL  578
               F    V     P ++DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL+SL
Sbjct  138   GPFRYENV--SAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISL  195

Query  579   SEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             SEQ++VDC+      GC GG  + A+ FI++N G+T E NYPY G DG C T  E +H  
Sbjct  196   SEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAA  255

Query  747   TISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
              I+G+  VP + E  L  A A+QPV+  +DA   +F+FYS GIF   C   L+HGVT VG
Sbjct  256   KITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTELDHGVTAVG  315

Query  924   YGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YG  +G  YWLVKNSWG  WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  316   YGGSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYP  363



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 210/340 (62%), Gaps = 20/340 (6%)
 Frame = +3

Query  78    VCFTIMLL---LPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             +C  ++LL   +P  L + A             M +RY+ W  ++G+ Y D  E EKR+ 
Sbjct  10    LCLALILLGAWIPQALSSRAL--------QDAAMYERYEQWTARYGRVYRDNAEKEKRFT  61

Query  249   IYQYNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             I++ NV +IE FN  +   YKL  N+FAD+TN E+K    R+K     +++  F    V 
Sbjct  62    IFKQNVAHIEAFNKASKKPYKLAVNEFADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVT  121

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P ++DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL SLSEQ+LVDC+
Sbjct  122   A--VPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GC GG  + A+ F+++N GIT E NYPY G DG+C    E +H   I+G+  VP
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVP  239

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A A QPV+  +DA   DF+FYS G+F   C   L+HGVT VGYG  ++G  
Sbjct  240   ANSETALMNAVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTK  299

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWGT+WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   YWLVKNSWGTSWGEEGYIRMQRDIDAKEGLCGIAMQASYP  339



>ref|XP_008805113.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=359

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 210/345 (61%), Gaps = 12/345 (3%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHG-KRYEDKDEWEKRYEIY  254
             +   I+  L   L  +  F + ++ S        Y+ W   H   R  D DE  KR+ ++
Sbjct  5     ILLAIVSALAFALTESIPFTEKDLASEE-SFRDLYERWRSIHTVSRDLDLDEKHKRFNVF  63

Query  255   QYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKE-----SHNFTLHG  419
             + NV +I  FN  +  YKL  NKF DMT  E+++ +   K+  H+       S   T   
Sbjct  64    KENVKFIHEFNKKDKPYKLKLNKFGDMTKEEFRNTFAGSKVMHHRMRRGSLRSSARTFMY  123

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
              ++ + P SVDWR++GAVT VKDQG CGS WAF AVAAVEGINQI T  LVSLSEQ+LVD
Sbjct  124   EKIADLPPSVDWRQNGAVTGVKDQGQCGSCWAFSAVAAVEGINQIRTKNLVSLSEQELVD  183

Query  600   CNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             C+    +GC+GG  + A++FIK NGGIT E NYPYVGKD  C    E SH V I G+  V
Sbjct  184   CDNKDDNGCDGGLMDHAFEFIKGNGGITTEANYPYVGKDQTCNLSKENSHVVVIDGHEDV  243

Query  771   PE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             PE DE  L  A A QPV+  ++AS   F+FYSEG+F   C   L+HGV +VGYG   +G 
Sbjct  244   PENDEDALMQAVANQPVSVAIEASGSAFQFYSEGVFTGDCGTDLDHGVAIVGYGTTRDGT  303

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
              YW+VKNSWG+ WGE+GY++M+R    K G CGIAM ASYP K S
Sbjct  304   KYWIVKNSWGSTWGENGYVRMERGISAKQGLCGIAMQASYPTKAS  348



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 207/305 (68%), Gaps = 7/305 (2%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y+ WL KHGK Y    E E+R++I++ N+ +I+  N+ N +YK+  N+FAD+TN EY+S+
Sbjct  53    YEAWLAKHGKSYNALGEKERRFQIFKDNLRFIDEHNAENRTYKVGLNRFADLTNEEYRSM  112

Query  360   YLRYKIDEHKKESHNFT-LHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAA  533
             YL  +    ++ S+  +  +  R+ +  PESVDWRK GAV  VKDQGSCGS WAF  +AA
Sbjct  113   YLGTRTAAKRRSSNKISDRYAFRVGDSLPESVDWRKKGAVVEVKDQGSCGSCWAFSTIAA  172

Query  534   VEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGK  704
             VEGIN+I TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI +E +YPY   
Sbjct  173   VEGINKIVTGGLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDSEEDYPYKAS  232

Query  705   DGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNP  881
             DGRC+   + +  VTI GY  VPE DE  L+ A A QPV+  ++A   +F+ Y  GIF  
Sbjct  233   DGRCDQYRKNAXVVTIDGYEDVPENDEKSLEKAVANQPVSVAIEAGGREFQLYQSGIFTG  292

Query  882   ICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMA  1058
              C   L+HGVT VGYG ENG  YW+VKNSWG +WGE+GYI+M+R  +    GKCGIAM A
Sbjct  293   RCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATSATGKCGIAMEA  352

Query  1059  SYPLK  1073
             SYP+K
Sbjct  353   SYPIK  357



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 212/334 (63%), Gaps = 10/334 (3%)
 Frame = +3

Query  87    TIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             +I + LP  L          +D     M+KR+++W+ +HG+ YED  E EKRY I++ N+
Sbjct  7     SIHIFLPFLLILATKIVCRPLDEQEY-MLKRHEEWMAQHGRVYEDMKEKEKRYLIFKENI  65

Query  267   LYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPE  443
               IE FNS  +  YKL  NKFAD+TN E+++++  YK    K  S +F      L   P 
Sbjct  66    ERIEAFNSGSDRGYKLGVNKFADLTNEEFRAMHHGYKRQSSKLMSSSFRHE--NLSAIPP  123

Query  444   SVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KH  611
             S+DWRK+GAVT VKDQGSCG  WAF AVAA+EGI +++TGKL+SL+EQQLVDC+      
Sbjct  124   SMDWRKAGAVTPVKDQGSCGCCWAFSAVAAIEGIIKLKTGKLISLTEQQLVDCDVEGLDQ  183

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGF  788
             GC GG  + A+ FI RNGG+T+E  YPY G DG C++    S    I+GY  VP  +E  
Sbjct  184   GCGGGLMDNAFQFILRNGGLTSEATYPYQGVDGTCKSKKTASIEAKITGYEDVPVNNENA  243

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKN  965
             L  A A+QPV+  V+    DF+FY  G+F   C   L+H VT +GYG   +G  YWLVKN
Sbjct  244   LLQAVAKQPVSVAVEGGGYDFQFYKSGVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKN  303

Query  966   SWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             SWGT+WGE GY++MQR  G + G CG+AM ASYP
Sbjct  304   SWGTSWGESGYMRMQRGIGAREGLCGVAMDASYP  337



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 213/339 (63%), Gaps = 14/339 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K +C  ++LL+     + A+    +       M  RY+ W+ ++G+ Y D +E EKR++I
Sbjct  8     KCLCLALILLMFGAWSSEATSRTLQ----DASMYGRYEQWMARYGRVYNDINEKEKRFQI  63

Query  252   YQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV  +E  N+  +  YKL  N+FAD+TN E+ +   R+K  E   ++ +F    V +
Sbjct  64    FKANVAIVESSNNDASKPYKLSVNQFADLTNEEFITSRNRFKGHECSTKTTSFKYENVTV  123

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN-  605
             P    +VDWR+ GAVT VKDQG CG  WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+ 
Sbjct  124   PA---TVDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDV  180

Query  606   ---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GCEGG  + A+DFI +N G++ E NYPY G DG C    E SH  +I+G+  VP 
Sbjct  181   NGEDQGCEGGLMDNAFDFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPA  240

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
             + E  L  A A QP++  +DAS  DF+ YS G+F   C  +L+HGVT VGYG  ++G  Y
Sbjct  241   NSESALLKAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTQY  300

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWG  WGE+GYI+MQR      G CGIAM ASYP
Sbjct  301   WLVKNSWGAQWGEEGYIRMQRDVTAPEGLCGIAMAASYP  339



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   290 bits (741),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 209/336 (62%), Gaps = 11/336 (3%)
 Frame = +3

Query  81    CFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             C  + L+L +   ++ +  +   D+    M  RY+ WL ++G+ Y + +E E R++I+  
Sbjct  11    CMCLSLILMMGAWSSGATSRTLQDAS---MYGRYEQWLTRYGRVYNNVNEKETRFKIFNE  67

Query  261   NVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
             NV +IE  N   N  YKL  N+FAD+TN E+K+    +K  E   E+ +F    V     
Sbjct  68    NVAFIESSNKYANKPYKLSVNQFADLTNEEFKASRNGFKGHECSTETTSFKYENVT-ASL  126

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---  608
             P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC+    
Sbjct  127   PATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGE  186

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-E  782
               GCEGG  + A+ FI++N GI+ E NYPY G DG C    E SH   I+G+  VP + E
Sbjct  187   DQGCEGGLMDDAFQFIQQNHGISTEANYPYDGVDGACNAKKEASHAAKITGFEDVPANSE  246

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLV  959
               L AA A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  YWLV
Sbjct  247   KALLAAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLV  306

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  307   KNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYP  342



>ref|XP_010441658.1| PREDICTED: senescence-specific cysteine protease SAG12 [Camelina 
sativa]
Length=346

 Score =   290 bits (741),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 208/344 (60%), Gaps = 15/344 (4%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             L  VCF + L+L +C     S     +D+  + M KR+ +W+ KHG+ Y D  E   RY 
Sbjct  5     LMQVCFLVSLILSICFSIALS---RPLDNELI-MQKRHIEWMTKHGRVYADMKEKNNRYA  60

Query  249   IYQYNVLYIEFFNSM--NFSYKLIDNKFADMTNSEYKSVYLRYK-----IDEHKKESHNF  407
             +++ NV  IE  NSM    ++KL  N+FAD+TN E++S+Y  YK         + ++  F
Sbjct  61    VFKSNVERIELLNSMPAGRTFKLAVNQFADLTNDEFRSMYTGYKGVSTLPSLGQTKTRAF  120

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                 V     P SVDWR  GAVT +KDQ SCG  WAF AVAA+EG  QI+ GKL+SLSEQ
Sbjct  121   RYQNVSSGSLPISVDWRTKGAVTPIKDQRSCGCCWAFSAVAAIEGAAQIKKGKLISLSEQ  180

Query  588   QLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             QLVDC  N  GC+GG  + A++ IK  GG+T E NYPY G+DG C +        +I+GY
Sbjct  181   QLVDCDTNDFGCDGGLMDTAFEHIKATGGLTTESNYPYKGEDGTCNSKKTNPKATSITGY  240

Query  762   TKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-  935
               VP  DE  L  A A QPV+  ++    DF+FYS G+F   C   L+H VT +GYGE  
Sbjct  241   EDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAVTAIGYGEST  300

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             NG  YW++KNSWGT WGE GY+++Q+    K G CG+AM ASYP
Sbjct  301   NGSKYWIIKNSWGTKWGESGYMRIQKDVKAKEGLCGLAMKASYP  344



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 206/341 (60%), Gaps = 11/341 (3%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             I K  C    +L+   L T A +E    +     M  R++ W+   GK Y D  E E+R+
Sbjct  4     ICKRQCIIAFILI---LGTWA-YEVASRELQEPSMSARHEQWMATFGKVYADAAEKERRF  59

Query  246   EIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             EI++ NV YIE FN+  N  YKL  NKFAD+T  E K     Y+     +     +    
Sbjct  60    EIFKDNVEYIESFNTAGNKPYKLSVNKFADLTTEELKVARNGYRRPLQTRPMKVTSFEYE  119

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
              +   P ++DWRK GAVT +KDQG CGS WAF  VAA EGINQ+ TGKLVSLSEQ+LVDC
Sbjct  120   NVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDC  179

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  E  ++FI +N GIT+E NYPY   DG C +  E SH   I+GY  V
Sbjct  180   DTQGEDQGCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESV  239

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQ  944
             P + E  L  A A QP++  +DA   DF+FYS G+F   C   L+HGVT VGYGE  +G 
Sbjct  240   PANSEAALLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGT  299

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWGT+WGE+GYI+MQR    + G CGIAM +SYP
Sbjct  300   KYWLVKNSWGTSWGEEGYIRMQRDVDAEEGLCGIAMDSSYP  340



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 212/345 (61%), Gaps = 13/345 (4%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDE  230
             M   +  + +CF  +L+L        +++          M +R+++W+ K+G  Y+D +E
Sbjct  1     MAPTIQCRCICFAFILIL-----VALAYQAEARSLPDASMYERHEEWMAKYGIVYKDANE  55

Query  231   WEKRYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNF  407
              E R++I+  NV  IE+FN + N  YKL  N+FAD+TN E+K+   R+K      ++  F
Sbjct  56    KEMRHKIFNENVERIEYFNRAANKPYKLGINQFADLTNEEFKTSRNRFKGHMCSPQAGPF  115

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                 V     P S+DWRK GAVT +KDQG CGS WAF AVAAVEGI Q+ T KL+SLSEQ
Sbjct  116   RYENVTA--VPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTTQKLISLSEQ  173

Query  588   QLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTIS  755
             +LVDC+      GC+GG  + A+ FI+ N G+T E NYPY G DG C +  E +H   I+
Sbjct  174   ELVDCDTKGEDQGCQGGLMDDAFKFIETNQGLTTEANYPYEGSDGTCNSNKEANHAAKIT  233

Query  756   GYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             GY  VP + E  L  A A+QPV+  +DA   +F+FYS GIF   C   L+HGV  VGYG 
Sbjct  234   GYEDVPANNEAALLKAVAKQPVSVAIDAGGYEFQFYSSGIFTGDCGTELDHGVAAVGYGV  293

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               G  YWLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  294   SQGTNYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYP  338



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 209/337 (62%), Gaps = 13/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C +++L+L        S    +       M  RY+ WL ++G+ Y D +E E R++I++
Sbjct  1     MCLSLILMLGTWSSGATSRTLQD-----APMYGRYEQWLTRYGRVYNDVNEKETRFKIFK  55

Query  258   YNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV +IE  N   N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V    
Sbjct  56    ENVAFIESSNKYANKPYKLSVNQFADLTNEEFKASKNGFKGHECSTKTTSFKYENVT-AS  114

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC+   
Sbjct  115   LPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLMSLSEQELVDCDTAG  174

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GCEGG  + A+ FI++N GI+ E NYPY G DG C T  E SH   I+G+  VP + 
Sbjct  175   EDQGCEGGLMDDAFQFIQQNHGISTEANYPYEGVDGTCNTKKETSHAAKITGFEDVPANS  234

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  L AA A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  YWL
Sbjct  235   EKALLAAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWL  294

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  295   VKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYP  331



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 210/340 (62%), Gaps = 20/340 (6%)
 Frame = +3

Query  78    VCFTIMLL---LPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             +C  ++LL   +P  L + A             M +RY+ W  ++G+ Y D  E EKR+ 
Sbjct  10    LCLALILLGAWIPQALSSRAL--------QDAAMYERYEQWTARYGRVYRDNVEKEKRFT  61

Query  249   IYQYNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             I++ NV +IE FN  +   YKL  N+FAD+TN E+K    R+K     +++  F    V 
Sbjct  62    IFKRNVAHIEAFNKASKKPYKLAVNEFADLTNEEFKVSRNRFKGHMCSEQTGPFKYENV-  120

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P ++DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL SLSEQ+LVDC+
Sbjct  121   -TAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GC GG  + A+ F+++N GIT E NYPY G DG+C    E +H   I+G+  VP
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVP  239

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A A QPV+  +DA   DF+FYS G+F   C   L+HGVT VGYG  ++G  
Sbjct  240   ANSETALMKAVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTK  299

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWGT+WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   YWLVKNSWGTSWGEEGYIRMQRDIDAKEGLCGIAMQASYP  339



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 207/344 (60%), Gaps = 15/344 (4%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             L  + F + L+L  C     S     +D+  V M K + DW+ KHG+ Y D  E + RY 
Sbjct  5     LAQIFFLVSLVLSTCFSITLS---RPLDNELV-MQKMHFDWMTKHGRVYADMKEQKNRYA  60

Query  249   IYQYNVLYIEFFNSM--NFSYKLIDNKFADMTNSEYKSVYLRYK-----IDEHKKESHNF  407
             +++ NV  IE  NSM    +YKL  N+FAD+TN E++S++  YK       + + ++  F
Sbjct  61    VFKSNVERIELLNSMPAGRTYKLAVNQFADLTNDEFRSMHTGYKGVSSLSSQSQTKTTLF  120

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                 V     P S+DWR  GAVT +KDQGSCG  WAF  VAA+EG  QI+ GKL+SLSEQ
Sbjct  121   RYQNVSSGALPTSIDWRTKGAVTPIKDQGSCGCCWAFSVVAAIEGAAQIKKGKLISLSEQ  180

Query  588   QLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             QLVDC  N +GCEGG  + A+  IK  GG+T E NYPY G+D  C +        TI+GY
Sbjct  181   QLVDCDPNDYGCEGGLMDTAFAHIKATGGLTTESNYPYKGEDATCNSKKTSPKATTITGY  240

Query  762   TKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-E  935
               VP  DE  L  A A QPV+  ++     F+FYS G+F+  C   L+H VT VGYGE  
Sbjct  241   EDVPANDESALMKAVAHQPVSVAIEGGGFAFQFYSSGVFSGECTTNLDHAVTAVGYGETT  300

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             NG  YW++KNSWGT WGE GY+++Q+   DK G CG+AM ASYP
Sbjct  301   NGSKYWIIKNSWGTKWGESGYMRIQKDIKDKQGLCGLAMEASYP  344



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   289 bits (739),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 166/342 (49%), Positives = 207/342 (61%), Gaps = 13/342 (4%)
 Frame = +3

Query  66    ILKNVCF-TIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             I K +CF   +L+L +  +  AS E  E       M  R++ W+   GK Y D  E E+R
Sbjct  4     ICKRLCFFAFILILGMWAYEVASRELQEPS-----MSARHEQWMATFGKVYADAAETERR  58

Query  243   YEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             +EI++ NV YIE FN+  N  YKL  NKFAD TN E K     Y+     +     +   
Sbjct  59    FEIFKDNVEYIESFNTTGNKPYKLSVNKFADQTNEELKVARNGYRRPLQTRPMKVTSFKY  118

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P ++DWRK GAVT +KDQG CGS WAF  VAA EGINQ+ TGKLVSLSEQ+LVD
Sbjct  119   ENVTAVPATMDWRKKGAVTLIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVD  178

Query  600   CN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GCEGG  E  ++FI +N GIT E NYPY   DG C +  E S    I+GY  
Sbjct  179   CDIQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKIEASRIAKITGYES  238

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENG  941
             VP + E  L  A A QP++  +DA   DF+FYS G F   C   L+HGVT VGYGE  +G
Sbjct  239   VPANSEAALLKAVANQPISVSIDAGGSDFQFYSSGDFTGQCGTELDHGVTAVGYGETSDG  298

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT+WGE+GYI+MQR +  + G CGIAM +SYP
Sbjct  299   TKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYP  340



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 209/341 (61%), Gaps = 11/341 (3%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             L  ++ C  + L+  L    + +  +   D+    M +R++DW+ ++G+ Y+D +E E R
Sbjct  3     LTTQHQCIFLALIFILAALASQAIARSLQDAS---MYERHEDWMAQNGRVYKDANEKEIR  59

Query  243   YEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             Y+I++ NV  IE FN     SYKL  N+FAD+TN E+K+   R+K      +   F    
Sbjct  60    YKIFKENVERIESFNKAGGKSYKLGINQFADLTNEEFKTSRNRFKGHMCSPQEGPFRYEN  119

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
             V     P S+DWRK GAVT +KDQG CGS WAF AVAAVEGI Q+ + KL+SLSEQ+LVD
Sbjct  120   V--TAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTSHKLISLSEQELVD  177

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GC+GG  + A+ FI+ N G+T E NYPY G DG C    E +H   I+GY  
Sbjct  178   CDTKGEDQGCQGGLMDDAFKFIENNQGLTTETNYPYEGSDGTCNANKEANHAAKITGYED  237

Query  768   VPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP  DE  L  A AQQPV+  +DA    F+FYS GIF   C   L+HGV  VGYG  NG 
Sbjct  238   VPANDEAALLKAVAQQPVSVAIDAGGFQFQFYSSGIFTGDCGTELDHGVAAVGYGVSNGM  297

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWGT WGE GYI+MQR    K G CGIAM ASYP
Sbjct  298   KYWLVKNSWGTQWGEVGYIRMQRDIEAKEGLCGIAMQASYP  338



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score =   293 bits (749),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 224/357 (63%), Gaps = 10/357 (3%)
 Frame = +3

Query  30    KKHQKSVMKVFLILKNVCFTI--MLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKH  203
             +    +V+ V L+    C  +   ++     H + S     M S    ++  ++ WL  H
Sbjct  6     RSSAMAVLTVLLLSAIACSALDNSIISYDNTHPDKSSSSPNMRSDD-EVMSMFESWLVHH  64

Query  204   GKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDE  383
             GK Y    E EKR+++++ N+ +I+  NS   SYKL  NKFAD++N EY++ YL  K D 
Sbjct  65    GKNYNALGEKEKRFQVFKDNLRFIDEHNSEERSYKLGLNKFADLSNEEYRNKYLGAKTDA  124

Query  384   HKKESH-NFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIE  557
              ++ S    + +  R  +  PESVDWRK GAV  VKDQGSCGS WAF  +AAVEG+N+I 
Sbjct  125   RRRLSKKRSSRYAFRAGDSLPESVDWRKEGAVVDVKDQGSCGSCWAFSTIAAVEGVNKIV  184

Query  558   TGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIA  728
             TG L+SLSEQ+LVDC+     GC GG  + A++FI +NGGI +E +YPY   DGRC+   
Sbjct  185   TGDLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDSEDDYPYKAVDGRCDVYR  244

Query  729   EESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNH  905
             + +  VTI  Y  VP  DE  LQ A A QP++  ++A    F+FY  GIF+  C  +L+H
Sbjct  245   KNAKVVTIDSYEDVPVNDEKSLQKAVASQPISVAIEAGGRSFQFYESGIFSGTCGTSLDH  304

Query  906   GVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             GV  VGYG E+G+ YW+V+NSWG +WGEDGYI+M+R  +G  NGKCGIAM ASYP+K
Sbjct  305   GVAAVGYGSEDGKDYWIVRNSWGLSWGEDGYIRMERNLAGTANGKCGIAMEASYPIK  361



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score =   293 bits (750),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 165/354 (47%), Positives = 223/354 (63%), Gaps = 22/354 (6%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASF----EQHEMDS-----HHVRMVKRYQDWLQKHGKRYE  218
             ++  V   + L   + L T+ S     E+H M +       VR +  Y+ WL  HGK Y 
Sbjct  11    MMVAVAALLYLFFAVSLATDMSIVKYDEEHGMKTGWRSDQEVRGL--YESWLVTHGKAYN  68

Query  219   DKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK--  392
                E E+R+EI++ N+ +I+  NS N +YK+  N+FAD+TN EY+++YL  K++ +++  
Sbjct  69    ALGEKERRFEIFKDNLRFIDEHNSGNRTYKVGLNRFADLTNDEYRAMYLGTKLNPNRRAS  128

Query  393   --ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGK  566
               +S+ +          P+SVDWR  GAV  VKDQGSCGS WAF  +AAVEGIN+I TG 
Sbjct  129   RPKSNRYAFQAG--DALPDSVDWRDKGAVVAVKDQGSCGSCWAFSTIAAVEGINKIVTGD  186

Query  567   LVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEES  737
             L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YPY  +DGRC+T  + +
Sbjct  187   LISLSEQELVDCDTSYNQGCNGGLMDYAFEFIISNGGIDTEDDYPYKARDGRCDTYRKNA  246

Query  738   HTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVT  914
             H VTI  Y  VPE DE  L+ A A QPV+  ++A    F+ Y  GIF   C   L+HGVT
Sbjct  247   HVVTIDSYEDVPENDENALKKAVANQPVSVAIEAGGRAFQLYQSGIFTGRCGTALDHGVT  306

Query  915   VVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
              VGYG ENG  YW+VKNSWG +WGE+GYI+M+R  +    GKCGIAM ASYP+K
Sbjct  307   AVGYGSENGVDYWIVKNSWGGSWGEEGYIRMERNLASGLTGKCGIAMQASYPIK  360



>ref|XP_010494742.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=346

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 157/344 (46%), Positives = 209/344 (61%), Gaps = 15/344 (4%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             L  VCF + L+L +C     S     +D+  + M K++ +W+ KHG+ Y D  E   RY 
Sbjct  5     LMQVCFLVSLILSICFSIALS---RPLDNELI-MQKKHIEWMTKHGRVYADMKEKNNRYV  60

Query  249   IYQYNVLYIEFFNSMNF--SYKLIDNKFADMTNSEYKSVYLRYKIDEH-----KKESHNF  407
             +++ NV  IE  NSM    ++KL  N+FAD+TN E++S+Y  YK+        + ++  F
Sbjct  61    VFKSNVERIELLNSMPVGRTFKLAVNQFADLTNDEFRSMYTGYKVVSALSSLGQTKTTAF  120

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                 V     P SVDWR  GAVT +KDQ +CG  WAF AVAA+EG  QI+ GKL+SLSEQ
Sbjct  121   RYQNVSSGGLPISVDWRTKGAVTPIKDQRTCGCCWAFSAVAAIEGAAQIKKGKLISLSEQ  180

Query  588   QLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             QLVDC  N  GCEGG  + A++ IK  GG+T E NYPY G+DG C +        +I+GY
Sbjct  181   QLVDCDTNDFGCEGGLMDTAFEHIKVTGGLTTESNYPYKGEDGTCNSKKTNPKATSITGY  240

Query  762   TKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-  935
               VP  DE  L  A A QPV+  ++    DF+FYS G+F   C   L+H VT +GYGE  
Sbjct  241   EDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAVTAIGYGEST  300

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             NG  YW++KNSWGT WGE GY+++Q+    K G CG+AM ASYP
Sbjct  301   NGSKYWIIKNSWGTKWGESGYMRIQKDVKAKEGLCGLAMKASYP  344



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/336 (47%), Positives = 210/336 (63%), Gaps = 13/336 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++ +L      +A+    +     V M +R++ W+ ++G+ Y+D  E E RY I++
Sbjct  10    ICLALLFVLGAWPSKSAARTLQD-----VSMYERHEQWMAQYGRVYKDDAEKETRYNIFK  64

Query  258   YNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  I+ FNS    SYKL  N+FAD++N E+K+   R+K      ++  F    V    
Sbjct  65    ENVARIDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSA--  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P ++DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL+SLSEQ++VDC+   
Sbjct  123   VPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GC GG  + A+ FI++N G+T E NYPY G DG C T  E +H   I+G+  VP + 
Sbjct  183   EDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEATHAAKITGFEDVPANS  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLV  959
             E  L  A A+QPV+  +DA   +F+FYS GIF   C   L+HGVT VGYG  +G  YWLV
Sbjct  243   EAALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGISDGTKYWLV  302

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWG  WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  303   KNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYP  338



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 202/310 (65%), Gaps = 7/310 (2%)
 Frame = +3

Query  159   HVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMT  338
              V     Y+ WL KHGK Y    E ++R+EI++ N+ +I+  N+ N SY+L   +FAD+T
Sbjct  44    EVDTAALYEAWLVKHGKFYNALGEKDRRFEIFKENLRFIDEHNAKNLSYRLGLTRFADLT  103

Query  339   NSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWA  515
             N EY+S+YL  K   HK+       +  R+ +  P+SVDWRK GAV+ VKDQGSCGS WA
Sbjct  104   NEEYRSMYLGAK--PHKRTLRTSDRYQPRVSDALPDSVDWRKEGAVSDVKDQGSCGSCWA  161

Query  516   FCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHN  686
             F A+ AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  + A+DFI  NGGI  E +
Sbjct  162   FSAIGAVEGINKIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFDFIINNGGIDTEDD  221

Query  687   YPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYS  863
             YPY G DGRC+   + +  VTI  Y  VP  DE  L+ A A QPV+  ++A    F+ Y 
Sbjct  222   YPYKGTDGRCDQNRKNAKVVTIDSYEDVPVNDEKALKKAVANQPVSVAIEAGGRAFQLYD  281

Query  864   EGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCG  1043
              G+F+ IC   L+HGV  VGYG ENG+ YW+V+NSWG NWGE GY++M R      GKCG
Sbjct  282   SGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGKNWGESGYLRMARNIEASTGKCG  341

Query  1044  IAMMASYPLK  1073
             IAM ASYP+K
Sbjct  342   IAMEASYPIK  351



>gb|KHG18408.1| Cysteinease RD21a -like protein [Gossypium arboreum]
 gb|KHG29615.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=367

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 222/343 (65%), Gaps = 17/343 (5%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
              + +  L   L    SF Q+   S    ++  YQ WL KHGK+Y    E E R++I++ N
Sbjct  8     ISTLFFLFFTLSWATSFSQNHWRSDD-EVMSLYQAWLIKHGKQYNGIGEEENRFDIFKDN  66

Query  264   VLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK--ESHN-----FTLHGV  422
             + +I+  NS N +YKL  NKFAD+TN EY+S++L  K D  ++  +S N      +  G 
Sbjct  67    LKFIDQHNSKNTTYKLGLNKFADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGD  126

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
             RLPE   S DWR  GAVT VKDQG CGS WAF  +AAVEGIN+I TG+L+SLSEQ+LVDC
Sbjct  127   RLPE---SFDWRDHGAVTPVKDQGRCGSCWAFSTIAAVEGINKIATGELISLSEQELVDC  183

Query  603   NKH---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKD-GRCETIAEESHTVTISGYTKV  770
             ++    GC+GG  + A+ FI  NGGI +E +YPY+G D  +C+   + +  V+I GY  V
Sbjct  184   DRSYDAGCDGGLMDYAFQFIIDNGGIDSEQDYPYLGADNNQCDPTRKNAKVVSIDGYEDV  243

Query  771   PE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
              + DE  L+ A + QPV+  ++AS   F+ Y  G+F+  C   L+HGV V+GYG +ENGQ
Sbjct  244   VQYDEKALKKAVSHQPVSVAIEASGRAFQLYESGVFSGECGSALDHGVIVIGYGMDENGQ  303

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW V+NSWG+ WGEDGYI+M+R   D+ GKCGIAM ASYP+K
Sbjct  304   EYWTVRNSWGSGWGEDGYIRMERNVDDRAGKCGIAMEASYPVK  346



>ref|XP_006343212.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=366

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 206/311 (66%), Gaps = 13/311 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKS  356
             Y+ WL +HGK Y    E  KR+EI++ N+ +IE  N++ N +Y L  N+FAD+TN EY++
Sbjct  41    YEIWLVEHGKIYNGLGEKGKRFEIFKDNLRFIEEHNNLKNQTYVLGLNRFADLTNEEYRT  100

Query  357   VYL------RYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAF  518
             ++L      R ++ + K  SH +          PESVDWRK GAV  +KDQGSCGS WAF
Sbjct  101   MFLGTRSDARRRLVKSKNASHRYVFRAS--DHVPESVDWRKKGAVAPIKDQGSCGSCWAF  158

Query  519   CAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNY  689
               VAAVEGINQI TG++++LSEQ+LVDC+     GC GG  + A+ FI  NGGI  E +Y
Sbjct  159   STVAAVEGINQISTGEMITLSEQELVDCDTMYNDGCNGGLMDYAFQFIISNGGIDTESHY  218

Query  690   PYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             PY G D +C+ + + +  V+I  Y  VP +E  L+ A A QP++  ++AS   F+ YS G
Sbjct  219   PYKGIDHKCDLVRKNAKVVSIDDYEDVPANENALEKAVAHQPISVAIEASGRVFQLYSSG  278

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGI  1046
             IF   C   L+HGV VVGYG ENG  YW+V+NSWGTNWGEDGYIKM++      +GKCGI
Sbjct  279   IFTGKCGTQLDHGVVVVGYGTENGVDYWIVRNSWGTNWGEDGYIKMEKNIEATNSGKCGI  338

Query  1047  AMMASYPLKGS  1079
             AMMASYP+K +
Sbjct  339   AMMASYPIKNA  349



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 213/341 (62%), Gaps = 11/341 (3%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
               +++ C ++ L+  L    + +  +   D+    + +++++W+ +  + Y D  E E R
Sbjct  3     FTIRHGCISLALIFFLGALASQAIARTLQDAS---IHEKHEEWMTRFKRVYSDAKEKEIR  59

Query  243   YEIYQYNVLYIEFFNSMN-FSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             Y+I++ NV  IE FN  +  SYKL  N+FAD+TN E+K+   R+K   H   S       
Sbjct  60    YKIFKENVQRIESFNKASEKSYKLGINQFADLTNEEFKTSRNRFK--GHMCSSQAGPFRY  117

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P S+DWRK GAVT +KDQG CGS WAF AVAAVEGI Q+ T KL+SLSEQ+LVD
Sbjct  118   ENITAVPSSMDWRKEGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVD  177

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GC+GG  + A+ FI++N G+T E NYPY G DG C T  E +H   I+G+  
Sbjct  178   CDTKGEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFED  237

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + EG L  A A+QPV+  +DA   +F+FYS GIF   C   L+HGV  VGYGE NG 
Sbjct  238   VPANNEGALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGDCGTELDHGVAAVGYGESNGM  297

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWGT WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  298   NYWLVKNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYP  338



>gb|KHG06908.1| Vignain [Gossypium arboreum]
Length=361

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/350 (46%), Positives = 212/350 (61%), Gaps = 17/350 (5%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             ++++C  +++ LP  L     F+ H+ D +    +   Y+ W + H       DE  +R+
Sbjct  1     MRSICVVLLISLPFLLGIAQGFDFHDKDLASEDSLWDLYERW-RSHHTVSRSLDEKHRRF  59

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK------KESHNF  407
              +++ NVL++   N+ +  YKL  NKFADMTN E+++ Y   KI  HK      + + +F
Sbjct  60    NVFKQNVLHVHNTNNKDKPYKLKINKFADMTNHEFRNAYASSKIKHHKMFQGKSRGAGSF  119

Query  408   TLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                 V     P SVDWR+ GAVT VKDQG CGS WAF  V AVEGINQI+T KLVSLSEQ
Sbjct  120   MYENV--DRVPPSVDWRQKGAVTAVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVSLSEQ  177

Query  588   QLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISG  758
             +L+DC+     GC GG  + A++FIK+ GGIT E NYPY   DG C++    S  V I G
Sbjct  178   ELIDCDTEENQGCNGGLMDIAFNFIKKKGGITTESNYPYQANDGSCDSAKVNSPAVAIDG  237

Query  759   YTKVP--EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE  932
             +  VP  +++  L+A A Q    A+   SM DF+FYSEG+F   C   LNHGV  VGYG 
Sbjct  238   HENVPANDEDALLRAVANQPVSVAIDAGSM-DFQFYSEGVFTGECGTELNHGVAAVGYGT  296

Query  933   E-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
               +G  YW+VKNSWG  WGE GYI+M+R   DK G CGIAM ASYP+K S
Sbjct  297   TLDGTKYWIVKNSWGAEWGEKGYIRMERGIRDKQGLCGIAMEASYPIKNS  346



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 198/305 (65%), Gaps = 6/305 (2%)
 Frame = +3

Query  171   VKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSE  347
             V+ ++ W+ + G+ Y+D+ E  KR+ I++ NV YI  FN +    Y+L  NKFAD+TN E
Sbjct  35    VQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEYIRSFNEAAARPYRLAINKFADLTNEE  94

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAV  527
             + +    YK+  + K +   +     +   P S+DWR+ GAVT VKDQG CG  WAF AV
Sbjct  95    FVASRNGYKMGSYMKSTKVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAV  154

Query  528   AAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYV  698
             AA EGINQ+ TGKL+SLSEQ+LVDC+     GC GG  + A++FI  NGGIT E NYPY 
Sbjct  155   AATEGINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDDAFEFIISNGGITTESNYPYE  214

Query  699   GKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             G DG C +  E SH   I+GY  VP + E  L  A A QPV+  +DAS  DF+FYS G+F
Sbjct  215   GVDGTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVF  274

Query  876   NPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
                C   L+HGVT VGYG+  +G  YWLVKNSWG++WGE+GYI+MQR      G CGIAM
Sbjct  275   TGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCGIAM  334

Query  1053  MASYP  1067
              ASYP
Sbjct  335   QASYP  339



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/345 (48%), Positives = 209/345 (61%), Gaps = 13/345 (4%)
 Frame = +3

Query  57    VFLILKNVCF-TIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEW  233
             + LI K  CF   +L+L +     AS E  E       M  R++ W+  +GK Y D  E 
Sbjct  1     MVLICKRQCFFAFILILGMWAFEVASRELQESS-----MSARHEQWMATYGKVYVDAAEI  55

Query  234   EKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFT  410
             E+R++I++ NV YIE FN+  N  YKL  NKFAD TN E+K  +  Y+     +     +
Sbjct  56    ERRFKIFKDNVEYIESFNTAGNKPYKLSVNKFADQTNEEFKGAHNGYRRPFQTRPMKVKS  115

Query  411   LHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQ  590
                  +   P ++DWRK GAVT +KDQG CGS WAF  VAA EGINQ+ TGKLVSLSEQ+
Sbjct  116   FKYENVTAIPAAMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQE  175

Query  591   LVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISG  758
             LVDC+      GCEGG  E  ++FI +N GIT E NYPY   DG C      SH   I+G
Sbjct  176   LVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNPEKRASHIAKITG  235

Query  759   YTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-  932
             Y  VP + E  L  A A QP++  +DA   DF+FYS G+F   C   L+HGVT VGYG+ 
Sbjct  236   YESVPANSEAELLKAVANQPISVSIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGKT  295

Query  933   ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              +G  YWLVKNSWGT+WGE+GYI+MQR    + G CGIAM +SYP
Sbjct  296   SDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAEEGLCGIAMDSSYP  340



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/341 (48%), Positives = 215/341 (63%), Gaps = 17/341 (5%)
 Frame = +3

Query  72    KNVCFTIMLLLPL--CLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             K + F ++ +L    C  T+ S +          M  RY+ W+ ++G+ Y D +E E R+
Sbjct  5     KCIGFGLLFMLGAWSCEATSRSLQD-------ASMYGRYEQWMTRYGRVYNDVNEKENRF  57

Query  246   EIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             +I++ NV +IE  N+ +N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V
Sbjct  58    KIFKENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENV  117

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
             + P  P ++DWRK GAVT VKDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC
Sbjct  118   KAP-VPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDC  176

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  + A+ FI++N G++AE NYPY G DG C T    S    I+GY  V
Sbjct  177   DTSGEDQGCEGGLMDDAFQFIQQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDV  236

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             P + E  L  A A QPV+  +DA   DF+FYS G+F   C  +L+HGVT VGYG  ++G 
Sbjct  237   PANSEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGT  296

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  297   KYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYP  337



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 211/342 (62%), Gaps = 13/342 (4%)
 Frame = +3

Query  60    FLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             F     +C  + LL  L    + S  +   D   V M +R++ W+ ++G+ Y+D  E E 
Sbjct  3     FTKQSQIC--LALLFVLVAWPSKSVARTLQD---VSMYERHEQWMAQYGRVYKDNAEKET  57

Query  240   RYEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLH  416
             RY I++ NV  I+ FNS    SYKL  N+FAD++N E+K+   R+K      ++  F   
Sbjct  58    RYNIFKANVARIDEFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQAGPFRYE  117

Query  417   GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
              V     P+S+DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL+SLSEQ++V
Sbjct  118   NVSA--VPDSMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVV  175

Query  597   DCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             DC+      GC GG  + A+ FI++N G+T E NYPY G DG C T  E +H   I+G+ 
Sbjct  176   DCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFE  235

Query  765   KVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENG  941
              VP + E  L  A A+QPV+  +DA   +F+FYS GIF   C   L+HGVT VGYG  +G
Sbjct  236   DVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGISDG  295

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWG  WGE GYI+MQ+    K G CGIAM ASYP
Sbjct  296   TKYWLVKNSWGAQWGEGGYIRMQKDISAKEGLCGIAMQASYP  337



>ref|XP_004515849.1| PREDICTED: vignain-like [Cicer arietinum]
Length=360

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 212/347 (61%), Gaps = 13/347 (4%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             +K + F + L L L      SF+  E D +    +   Y  W   H       +E  KR+
Sbjct  3     MKKLLF-VSLFLALIFGVAKSFDFQEKDLASDTNIWDLYDRWGSHH-TISRSPNEKNKRF  60

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH----KKESHNFTL  413
               ++ N +++   N +N  YKL  NKFADMTN E+KS+Y    ID H           T 
Sbjct  61    NTFKSNAMHVLNTNKLNKPYKLKLNKFADMTNDEFKSLYANSNIDCHGNIRASPRGKDTF  120

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
                ++   P SVDWRK+GAVT+VK+QG CGS WAF  + AVEGINQI+T KLVSLSEQQL
Sbjct  121   MYDKVSNVPSSVDWRKNGAVTNVKNQGHCGSCWAFSTIVAVEGINQIKTQKLVSLSEQQL  180

Query  594   VDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             VDC+     GC GG  E A++FIK+N GIT E NYPYV KDG C+   +    V+I GY 
Sbjct  181   VDCDIEKNRGCNGGLMENAFEFIKQN-GITTESNYPYVAKDGTCDVAKKNKPAVSIDGYE  239

Query  765   KVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-EN  938
              VP  DE  L  AAA QP++  +DA   DF+ YSEG+F+  C   LNHGV +VGYGE E+
Sbjct  240   NVPTNDEASLLKAAANQPISVAIDAGGSDFQLYSEGVFSGYCGTRLNHGVAIVGYGETED  299

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             G  YW+VKNSWG+ WGE+GYI++QR    K G CGIAM ASYP+K S
Sbjct  300   GTKYWIVKNSWGSQWGEEGYIRIQRDVSQKQGLCGIAMDASYPIKKS  346



>ref|XP_010932269.1| PREDICTED: LOW QUALITY PROTEIN: vignain-like [Elaeis guineensis]
Length=358

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 212/347 (61%), Gaps = 11/347 (3%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             + K + F +++ L   L  +  F++ ++ +    +   Y  W   H     D DE  KR+
Sbjct  1     MAKALLFGVLVALAFALAHSIPFDEKDLRTEE-SLWNLYVRWRGYH-TVSRDLDEKHKRF  58

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
              ++Q NV +I  FN  +  YKL  NKF DMTN E++S Y   K   H+    +    G  
Sbjct  59    NVFQENVKFIHEFNKKDAPYKLALNKFGDMTNQEFRSWYAGSKXQHHRMRRRSPRGAGRF  118

Query  426   LPE----FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
             + E     P  VDWR+ GAVT VKDQG CGS WAF  V AVEGINQI+T KL+SLSEQ+L
Sbjct  119   MHENVHALPALVDWRQKGAVTAVKDQGQCGSCWAFSTVVAVEGINQIKTKKLISLSEQEL  178

Query  594   VDC---NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             +DC   + +GC GG  + A++FI +NGGIT E  YPY   DGRC+   E S  VTI G+ 
Sbjct  179   IDCDNEDNNGCNGGLMDYAFEFIAKNGGITTEAAYPYKADDGRCDVSKENSPVVTIDGHE  238

Query  765   KVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-  938
              VP  DE  L  A A QPV+  ++AS  DF+FYSEG+F   C   L+HGV +VGYG  N 
Sbjct  239   NVPANDEEALMKAVANQPVSVAIEASGLDFQFYSEGVFTGSCGTELDHGVAIVGYGTTNE  298

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             G  YW+VKNSWG+ WGE GYI+M+R   D++GKCGIAM ASYP+K S
Sbjct  299   GTKYWIVKNSWGSGWGESGYIRMERGIQDRHGKCGIAMEASYPIKTS  345



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/339 (47%), Positives = 208/339 (61%), Gaps = 15/339 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K +C  ++L+L        S E          M  RY+ W+ ++G+ Y D DE EKR++I
Sbjct  8     KFICLALILILGAW-----SSEATSRSLQDALMYGRYEQWMIRYGRIYSDTDEKEKRFKI  62

Query  252   YQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV +IE  N   N  YKL  N FAD+TN E+ +   R+K  E   ++ +F      +
Sbjct  63    FKENVAFIESSNDEANKPYKLSVNGFADLTNEEFTASRNRFKGHECSTKTTSFKYENATV  122

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN-  605
             P     +DWR+ GAVT +KDQG CG  WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+ 
Sbjct  123   PT---KMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDV  179

Query  606   ---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GCEGG  + A++FI +N G++ E NYPY G DG C    E SH  +I+G+  VP 
Sbjct  180   NGEDQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPA  239

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
             + E  L  A A QP++  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  ++G  Y
Sbjct  240   NSESALLKAVANQPISVAIDASGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVGDDGTKY  299

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  300   WLVKNSWGAEWGEQGYIRMQRDVDAPEGLCGIAMEASYP  338



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/344 (47%), Positives = 217/344 (63%), Gaps = 11/344 (3%)
 Frame = +3

Query  57    VFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWE  236
             + L L  +C  + L++ L   ++ +  +   D+    M  R++ W+ ++G+ Y D +E E
Sbjct  4     INLQLCRLCTCLALIIMLGAWSSKATSRSLQDAS---MYGRHEQWMVRYGRVYTDNEEKE  60

Query  237   KRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTL  413
             KR++I++ NV YIE  N+  +  YKL  N+F D+TN E+ +   R+K  E   ++ +F  
Sbjct  61    KRFKIFKENVAYIESSNADASKPYKLRVNQFTDLTNEEFIASRNRFKGHECSTKTTSFKY  120

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
               V     P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKLVSLSEQ+L
Sbjct  121   ENV-TASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQEL  179

Query  594   VDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             VDC+      GCEGG  + A+ FI++N G++ E NYPY G DG C T  E +    I+G+
Sbjct  180   VDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGH  239

Query  762   TKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EE  935
               VP  DE  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  +
Sbjct  240   EDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSD  299

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             +G  YWLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   DGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYP  343



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 205/320 (64%), Gaps = 8/320 (3%)
 Frame = +3

Query  129   SFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNS-MNFSY  305
             S E          M  RY+ W+ ++G+ Y D +E E R++I++ NV +IE  N+ +N  Y
Sbjct  6     SCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNKPY  65

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVK  485
             KL  N+FAD+TN E+K+    +K  E   ++ +F    ++ P  P ++DWRK GAVT +K
Sbjct  66    KLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENIKAP-VPATMDWRKKGAVTPIK  124

Query  486   DQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFI  653
             DQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC+      GCEGG  + A+ FI
Sbjct  125   DQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFI  184

Query  654   KRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavv  830
             ++N G++AE NYPY G DG C T    S    I+GY  VP + E  L  A A QPV+  +
Sbjct  185   QQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAI  244

Query  831   daSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKM  1007
             DA   DF+FYS G+F   C  +L+HGVT VGYG  ++G  YWLVKNSWGT WGE+GYI+M
Sbjct  245   DAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRM  304

Query  1008  QRRSGDKNGKCGIAMMASYP  1067
             QR    K G CGIAM ASYP
Sbjct  305   QRDVEAKEGLCGIAMEASYP  324



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 202/311 (65%), Gaps = 7/311 (2%)
 Frame = +3

Query  156   HHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFAD  332
             H   M +R++ W+ K+G+ Y+D  E E+R+EI++ NV +IE FN + N  YKL  N+FAD
Sbjct  30    HDAAMNERHEMWMAKYGRVYKDNSEKERRFEIFRNNVEFIESFNKLGNRPYKLDINEFAD  89

Query  333   MTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSW  512
             +TN E+K     YK       +   +     +   P S+DWR++GAVT +KDQG CG  W
Sbjct  90    LTNEEFKVSKNGYKRSSGVGLTEKSSFRYANVTAVPTSMDWRQNGAVTPIKDQGQCGCCW  149

Query  513   AFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAE  680
             AF AVAA+EGI ++ TGKL+SLSEQ+LVDC+      GCEGG  + A++FIK+NGG+T E
Sbjct  150   AFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTE  209

Query  681   HNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRF  857
              NYPY G DG C T    +    I+GY  VP + E  L  A A QPV+  +DAS   F+F
Sbjct  210   ANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQF  269

Query  858   YSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNG  1034
             YS G+F   C   L+HGVT VGYG  ++G  YWLVKNSWGT+WGEDGYI+M+R    K G
Sbjct  270   YSGGVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMERDIEAKEG  329

Query  1035  KCGIAMMASYP  1067
              CGIAM  SYP
Sbjct  330   LCGIAMQPSYP  340



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 210/311 (68%), Gaps = 13/311 (4%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNS  344
             M+KR+++W  +HG+ Y+D  E +K+Y +++ N+  IE FN+ ++  YKL  NKFAD+T+ 
Sbjct  1     MLKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDE  60

Query  345   EYKSVYLRYKIDEHK----KESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSW  512
             E+++++L YK    K     +S +F    V     P ++DWRK+GAVT VKDQGSCGS W
Sbjct  61    EFQAMHLGYKSPPSKLMSTSKSRSFRYRNV--TSVPTTIDWRKAGAVTPVKDQGSCGSCW  118

Query  513   AFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KHGCEGGNTEKAYDFIKRNGGITAE  680
             AF AVAA+EGI +++TG L+SLSEQ+LVDC+     +GC+GG  + A+ +I +NGG+T+E
Sbjct  119   AFSAVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSE  178

Query  681   HNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRF  857
              NYPY G+DG C      +    I+GY  VP + E  L  A A QPV+  +DAS  DFRF
Sbjct  179   ANYPYQGEDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRF  238

Query  858   YSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNG  1034
             YS G+F   CP  LNH VTV+GYG   +G  YWL+KNSWGT WGE+GY++MQR      G
Sbjct  239   YSSGVFKGDCPTDLNHAVTVIGYGSSSDGTKYWLLKNSWGTGWGENGYMRMQREISANEG  298

Query  1035  KCGIAMMASYP  1067
              CGIAM ASYP
Sbjct  299   LCGIAMKASYP  309



>ref|XP_004505458.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cicer 
arietinum]
Length=341

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 211/343 (62%), Gaps = 21/343 (6%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNA-SFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             K + F++ LL  L   TN  S + HE+ S    + +R++ W+ K+ K Y+D  E EKR+ 
Sbjct  7     KKIIFSLFLLFALGTITNVMSRKLHELSS----LKERHEQWMIKYDKVYKDDAEKEKRFL  62

Query  249   IYQYNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN-FTLHGV  422
             I++ NV +IE FN+ N   YKL  N  AD+T  E+K+    YK     K SH+  T+   
Sbjct  63    IFKDNVEFIESFNADNSKLYKLSVNHLADLTIEEFKASRNGYK-----KRSHDELTITSF  117

Query  423   R---LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
             +   +   P+ VDWR  GAVT +KDQG CGS WAF  VAA EGINQI TGKLVSLSEQ+L
Sbjct  118   KYENVTGVPDDVDWRTKGAVTPIKDQGQCGSCWAFSTVAATEGINQITTGKLVSLSEQEL  177

Query  594   VDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             VDC+      GCEGG  E  ++FI +NGGIT+E  YPY   DG C T AE +    I GY
Sbjct  178   VDCDTKGEDQGCEGGLMENGFEFIIKNGGITSEAKYPYKAADGSCNT-AETTPVAKIKGY  236

Query  762   TKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN  938
              KVP   E  L  A A QPV+  +DAS   F FYS GI+   C   L+HGVT VGYG  N
Sbjct  237   EKVPVNSEDALLKAVAYQPVSVSIDASDSSFMFYSSGIYTGECGTELDHGVTAVGYGSAN  296

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             G  YWLVKNSWGT WGE GYI+MQR    K G CGIAM +SYP
Sbjct  297   GTDYWLVKNSWGTVWGEKGYIRMQRGIASKEGLCGIAMDSSYP  339



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 212/340 (62%), Gaps = 10/340 (3%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             + K++C  + +LL LC  T AS     M S  + M +R++ W+ +HG+ Y D  E E+R+
Sbjct  5     LTKSLCMALFVLL-LC--TFASHATARMLSE-MTMHERHEQWMSQHGRVYGDSAEKERRF  60

Query  246   EIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             +I++ NV  IE FN+ N  YKL  N+FAD+T  E+K++   +K                 
Sbjct  61    QIFKANVELIESFNAGNSKYKLGVNQFADLTIEEFKAMMNGFKPSSVNTFKATNVFRYEN  120

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
             +   P S+DWR  GAVT +KDQG  G  WAF AVAA+EGI +++TGKL+SLSEQ+LVDC+
Sbjct  121   VTAVPTSMDWRAEGAVTPIKDQGDYGCCWAFSAVAAMEGITKLKTGKLISLSEQELVDCD  180

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GCEGG  + A++FI RNGG+T E NYPY G DG C T    SH  +I GY  VP
Sbjct  181   VAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKGIDGTCNTKKSFSHAASIKGYEDVP  240

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A + QPV+  ++AS   F+FYS G+F   C   L+HGVT VGYG   +G  
Sbjct  241   ANSEAALLNAVSNQPVSVAIEASGYSFQFYSSGVFTGSCGTDLDHGVTAVGYGTARDGTK  300

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWG++WGE GY++M+R    K G CGIAM ASYP
Sbjct  301   YWLVKNSWGSSWGESGYVRMERDVAAKEGLCGIAMKASYP  340



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 199/308 (65%), Gaps = 8/308 (3%)
 Frame = +3

Query  162   VRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMT  338
             V M +R++ W+ ++G+ Y+D  E E RY I++ NV  I+ FNS    SY L  N+FAD+T
Sbjct  2     VSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADLT  61

Query  339   NSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAF  518
             N E+K+   R+K      ++  F    V     P ++DWRK GAVT VKDQG CG  WAF
Sbjct  62    NEEFKASRNRFKGHMCSPQAGPFRYENVSA--VPATMDWRKKGAVTPVKDQGQCGCCWAF  119

Query  519   CAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHN  686
              AVAA+EGINQ+ TGKL+SLSEQ++VDC+      GC GG  + A+ FI++N G+T E N
Sbjct  120   SAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEAN  179

Query  687   YPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYS  863
             YPY G DG C T  E SH   I+G+  VP + E  L  A A+QPV+  +DA   +F+FYS
Sbjct  180   YPYTGTDGTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYS  239

Query  864   EGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCG  1043
              GIF   C   L+HGVT VGYG  +G  YWLVKNSWG  WGE+GYI+MQ+    K G CG
Sbjct  240   SGIFTGSCGTELDHGVTAVGYGGSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  299

Query  1044  IAMMASYP  1067
             IAM ASYP
Sbjct  300   IAMQASYP  307



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 157/321 (49%), Positives = 206/321 (64%), Gaps = 11/321 (3%)
 Frame = +3

Query  129   SFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFS-Y  305
             +++    D +   +VKR++ W+ + G+ Y+D  E  KR++I++ N  YI+  N      Y
Sbjct  3     AYQATSRDLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIKPY  62

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHKK--ESHNFTLHGVRLPEFPESVDWRKSGAVTH  479
             KL  N+FAD+TN E++     Y++  HKK  E  +F    V  P    ++DWRK GAVT 
Sbjct  63    KLDVNEFADLTNDEFRVTRNGYRMPSHKKSPEITSFKYENVTAPA---TMDWRKKGAVTG  119

Query  480   VKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDF  650
             +KDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+     GCEGG  + A+ F
Sbjct  120   IKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKF  179

Query  651   IKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaav  827
             I +N G+T E NYPY G D  C+T  E +H   I+ Y  VP + E  L  A A QPV+  
Sbjct  180   IIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVA  239

Query  828   vdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIK  1004
             +DAS  DF+FYS G+F   C   L+HGVT VGYGE  +G  YWLVKNSWGT+WGE+GYI+
Sbjct  240   IDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIR  299

Query  1005  MQRRSGDKNGKCGIAMMASYP  1067
             MQR    + G CGIAM ASYP
Sbjct  300   MQRNVDTEEGLCGIAMEASYP  320



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   286 bits (733),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 161/344 (47%), Positives = 216/344 (63%), Gaps = 11/344 (3%)
 Frame = +3

Query  57    VFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWE  236
             + L L   C  + L++ L   ++ +  +   D+    M  R++ W+ ++G+ Y D +E E
Sbjct  4     INLQLCKFCTCLALIIMLGAWSSEATSRSLQDAS---MYGRHEQWMTRYGRVYTDNEEKE  60

Query  237   KRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTL  413
             KR++I++ NV YIE  N+  +  YKL  N+F D+TN E+ +   R+K  E   ++ +F  
Sbjct  61    KRFKIFKENVAYIESSNADTSKPYKLRVNQFTDLTNEEFIASRNRFKGHECSTKTTSFKY  120

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
               V     P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKLVSLSEQ+L
Sbjct  121   ENV-TTSVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQEL  179

Query  594   VDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             VDC+      GCEGG  + A+ FI++N G++ E NYPY G DG C T  E +    I+G+
Sbjct  180   VDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGH  239

Query  762   TKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EE  935
               VP  DE  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  +
Sbjct  240   EDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSD  299

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             +G  YWLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   DGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYP  343



>ref|XP_006339859.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=361

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 210/307 (68%), Gaps = 9/307 (3%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIE-FFNSMNFSYKLIDNKFADMTNSEYKS  356
             Y+ WL +HGK Y    E EKR+EI++ N+ +IE + NS N +YK+  N+FAD+TN EY++
Sbjct  36    YEKWLAEHGKVYNALGENEKRFEIFKDNLRFIEEYNNSENRTYKVGLNQFADLTNVEYRA  95

Query  357   VYLRYKIDEHKK--ESHNFTLHGVRLPE--FPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             +YL  + D  ++  +S N +      P    P+SVDWRK GAV  +K+QGSCGS WAF  
Sbjct  96    MYLGTRSDARRRLVKSKNTSQRYASRPNELLPQSVDWRKRGAVAPIKNQGSCGSCWAFST  155

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             VAAVEGINQI TG++++LSEQ+LVDC++    GC GG  + A++FI  NGG+  E++YPY
Sbjct  156   VAAVEGINQIITGEMITLSEQELVDCDRAQNVGCNGGLMDYAFEFIISNGGMDTENHYPY  215

Query  696   VGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
              G DGRC+ I + S  V+I  Y  VP +E  LQ A A QPV+  ++AS   F+ Y+ G+F
Sbjct  216   SGVDGRCDPIRKNSKVVSIDDYEDVPRNEKALQKAVAHQPVSVAIEASGRAFQLYTSGVF  275

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGIAM  1052
                C E ++HGV VVGYG E+G+ YWLV+NSWGT WGE GY+KM+R   + + GKCGI  
Sbjct  276   TGECGEKVDHGVVVVGYGSEDGKDYWLVRNSWGTKWGESGYVKMERNVKNGHLGKCGIMT  335

Query  1053  MASYPLK  1073
              ASYP+K
Sbjct  336   EASYPIK  342



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   286 bits (732),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 165/344 (48%), Positives = 205/344 (60%), Gaps = 17/344 (5%)
 Frame = +3

Query  66    ILKNVCF-TIMLLLPL--CLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWE  236
             I K  CF  I L+L    C  T    ++  M + H       + W+   GK Y D  E E
Sbjct  4     ICKRQCFFAIFLILGTWACQVTPRELQEPSMSARH-------EQWMATFGKVYADAAEKE  56

Query  237   KRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTL  413
             +R+EI++ NV YIE FN+  N  YKL  NKFAD+TN E K     Y+     +     + 
Sbjct  57    RRFEIFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELKIARNGYRRPLQTRPMKVTSF  116

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
                 +   P ++DWRK GAVT +KDQG CGS WAF  VAA EGINQ+ TGKLVSLSEQ+L
Sbjct  117   EYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQEL  176

Query  594   VDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             VDC+      GCEGG  E  ++FI +N GIT+E NYPY   DG C +  E SH   I+GY
Sbjct  177   VDCDTQGEDQGCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGY  236

Query  762   TKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-E  935
               VP + E  L  A A QP++  +DA   DF+FYS G+F   C   L+HGVT VGYGE  
Sbjct  237   ESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETS  296

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             +G  YWL KNSWGT+WGE GYI+MQR    + G CGIAM +SYP
Sbjct  297   DGTKYWLFKNSWGTSWGEAGYIRMQRDIDAEEGLCGIAMDSSYP  340



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   286 bits (732),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 163/342 (48%), Positives = 207/342 (61%), Gaps = 13/342 (4%)
 Frame = +3

Query  66    ILKNVCF-TIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             I K  CF   +L+L +     AS E  E       M  R++ W+  +GK Y D  E E+R
Sbjct  4     ICKRQCFFAFILILGMWAFEVASRELQES-----YMSARHEQWMATYGKVYVDAAEKERR  58

Query  243   YEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             ++I++ NV YIE FN+  N  YKL  NKFAD TN ++K     Y+     +     +   
Sbjct  59    FKIFKNNVEYIESFNTAGNKPYKLSVNKFADQTNEKFKGARNGYRRPFQTRPMKVTSFKY  118

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P ++DWRK GAVT +KDQG CGS WAF  VAA EGINQ+ TGKLVSLSEQ+LVD
Sbjct  119   ENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVD  178

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GCEGG  E  ++FI +N GIT E NYPY   DG C +  + SH   I+GY  
Sbjct  179   CDNQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKKQASHIAKITGYES  238

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENG  941
             VP + E  L    A QP++  +DA   DF+FYS G+F   C   L+HGVT VGYGE  +G
Sbjct  239   VPANSEAELLKVVANQPISVSIDAGGSDFQFYSSGVFTGKCGTELDHGVTAVGYGETSDG  298

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT+WGE+GYI+MQR    + G CGIAM +SYP
Sbjct  299   TKYWLVKNSWGTSWGEEGYIRMQRDIDTEEGLCGIAMDSSYP  340



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 207/341 (61%), Gaps = 13/341 (4%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             + K +C  ++L+L        S +          M  RY+ WL ++G+ Y D DE E R+
Sbjct  8     LWKYMCLGLILMLGAW-----SSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRF  62

Query  246   EIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             +I++ NV +IE  N   N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V
Sbjct  63    KIFKENVAFIESSNKDANTPYKLRVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENV  122

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
                  P ++DWRK GAVT VKDQG CG  WAF AVAA EG+ Q+ TGKL+SLSEQ+LVDC
Sbjct  123   T-AALPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDC  181

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  + A+ FI++N GI+ E NYPY G DG C T  E      I+G+  V
Sbjct  182   DTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDV  241

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             P + E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G 
Sbjct  242   PANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGT  301

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  302   KYWLVKNSWGAEWGEAGYIRMQRDVAAPEGLCGIAMSASYP  342



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 212/342 (62%), Gaps = 7/342 (2%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++ KN  + I L L  C+               V M +R+++W+ ++G  Y+D +E EKR
Sbjct  1     MVSKNQFYHISLALLFCMGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYKDPEEREKR  60

Query  243   YEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             + I++ NV YIE FN + N  Y+L  N+FAD+TN E+ +   R+K           T   
Sbjct  61    FRIFKKNVNYIETFNNAANKPYQLGTNQFADLTNEEFIAGRNRFKGHMCSSILRTTTFKY  120

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P +VDWR+ GAVT VKDQG CG  WAF AVAA EGI+ + +GKL+SLSEQ+LVD
Sbjct  121   ENVTTIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVD  180

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GCEGG  + A+ FI +N GI  E NYPY G DG+C   AE  +  TI+GY  
Sbjct  181   CDTKGVDQGCEGGFMDGAFKFIIKNHGINTEVNYPYKGVDGKCNAKAEAVNGATITGYED  240

Query  768   VP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENG  941
             VP  +E  L+ A + QPV+  +DAS  DF+FY  G+F+  C   L+HGVT VGYG  ++G
Sbjct  241   VPVNNESALEKAVSSQPVSVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVSDDG  300

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             + YWLVKNSWGT WGE+GYI+MQR      G CGIAMMASYP
Sbjct  301   KKYWLVKNSWGTEWGEEGYIRMQRDVAAAEGLCGIAMMASYP  342



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 203/305 (67%), Gaps = 7/305 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNS  344
             M+KR+++W+ +HG+ Y D  E EKRY I++ N+  IE FN+  +  YKL  NKFAD+TN 
Sbjct  36    MLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNE  95

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E++++Y  YK    K  S +F      L + P S+DWR  GAVT VKDQG+CG  WAF  
Sbjct  96    EFRAMYHGYKRQSSKLMSSSFRYE--NLSDIPTSMDWRNDGAVTPVKDQGTCGCCWAFST  153

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK--HGCEGGNTEKAYDFIKRNGGITAEHNYPYV  698
             VAA+EGI +++TG L+SLSEQQLVDC     GC+GG+ + A+ +I RNGG+T+E NYPY 
Sbjct  154   VAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQGGHMDTAFQYIIRNGGLTSEDNYPYQ  213

Query  699   GKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             G DG C +    S    I+GY  VP+ +E  L  A A+QPV+  V+    DF+FY  G+F
Sbjct  214   GVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYKSGVF  273

Query  876   NPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
                C   LNH VT +GYG + +G  YWLVKNSWGT+WGE+GY++M+R  G   G CG+AM
Sbjct  274   EGDCGTNLNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGENGYMRMRRGIGSSEGLCGVAM  333

Query  1053  MASYP  1067
              ASYP
Sbjct  334   DASYP  338



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score =   293 bits (751),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 218/353 (62%), Gaps = 26/353 (7%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHH---------VRMVKRYQDWLQKHGKRYEDKDEWE  236
             F +ML   L L +       + D  H          ++ + Y+ WL KHGK Y    E E
Sbjct  119   FFVMLFFSLTLSSALDMSIIDYDLKHGGQQQKRTETQIRRMYETWLVKHGKAYNGLGEKE  178

Query  237   KRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKID--------EHKK  392
             KR+EI++ N+ +IE  NS+N +YK+  N+FAD+TN EYK++YL  ++D          K+
Sbjct  179   KRFEIFKDNLKFIEEHNSVNGTYKVGLNRFADLTNEEYKAMYLGARLDGKTVSHRLAGKE  238

Query  393   ESHNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKL  569
             +S  +    G +LPE   SVDWR+ GAV  VKDQG CGS WAF  VAAVEGINQI TG L
Sbjct  239   KSQRYVFRVGDKLPE---SVDWREKGAVVAVKDQGQCGSCWAFSTVAAVEGINQIVTGDL  295

Query  570   VSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESH  740
             +SLSEQ+LVDC++    GC GG  + A+DFI +NGGI  E +YPY   D  C+   + + 
Sbjct  296   ISLSEQELVDCDRLYNQGCNGGLMDNAFDFITKNGGIDTEEDYPYRASDNTCDPNRKNAR  355

Query  741   TVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTV  917
              V+I GY  VPE DE  L+ A A QPV+  ++A    F+ Y  G+F   C   L+HGV  
Sbjct  356   VVSIDGYEDVPENDENSLKKAVAHQPVSVAIEAGGRPFQLYHSGVFTGHCGTNLDHGVVA  415

Query  918   VGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             VGYG E+G  YW VKNSWG +WGE+GYI+M+R  +G   GKCGIA MASYP+K
Sbjct  416   VGYGTEDGVDYWTVKNSWGPDWGENGYIRMERNVAGTSTGKCGIATMASYPIK  468



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 160/335 (48%), Positives = 214/335 (64%), Gaps = 13/335 (4%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
             F I+L+L LC+    S   +E       + ++++ W+ ++G+ Y D  E  +R E ++ N
Sbjct  11    FAILLVLGLCVSLVTSRALYE-----ASITEKHEQWMTQYGRVYTDDTEKTERLETFKQN  65

Query  264   VLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFP  440
             + YIE  N  +  +YKL  N+FADMTN E+K+    Y+I   +K    F  +      + 
Sbjct  66    LEYIESINKDVTRTYKLGINQFADMTNEEFKASRNGYRISSQQKIKTTFFQYENVTVAY-  124

Query  441   ESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KH  611
              S+DWRK GAVT +KDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+     
Sbjct  125   -SMDWRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSNQ  183

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGF  788
             GCEGG  + A+ +I +N G+T+E NYPY G DG C+T  E +H   I GY  VPE+ E  
Sbjct  184   GCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHVAKIRGYKDVPENSELA  243

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLVKN  965
             L  A A QPV+  +DAS  DF+FYS GIF   C   L+HGVT VGYG  ++G  YW+VKN
Sbjct  244   LLKAVANQPVSVAIDASGSDFQFYSSGIFTGKCGTELDHGVTTVGYGATKDGTKYWIVKN  303

Query  966   SWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
             SWG +WGE+GYI+M+R    K G CGIAM ASYP+
Sbjct  304   SWGVSWGENGYIRMKRDIVAKTGLCGIAMKASYPI  338



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   286 bits (732),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 214/336 (64%), Gaps = 13/336 (4%)
 Frame = +3

Query  81    CFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             C ++ L+L L   ++ +  +   D   V M  RY+ W+ +HG+ +   DE E R++I++ 
Sbjct  9     CISLALILMLGAWSSEATSRTLQD---VTMYGRYEQWMARHGRVFSSIDEKESRFKIFKE  65

Query  261   NVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
             N+ YIE  N+  + +++L  N+FA +TN E+ S+   +K  E   ++ +F    V +P  
Sbjct  66    NLAYIESSNNDASKTFRLGVNQFAHLTNEEFTSLSNGFKGHESSTKTSSFRYENVTVPA-  124

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---  608
               ++DWR  GAVT +K+QG CG  WAF AVAA+EGI Q+  GKL+SLSEQ+LVDC+K   
Sbjct  125   --TMDWRSKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLTMGKLISLSEQELVDCDKSGE  182

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-E  782
               GCEGG  + A++FI +N G++ E NYPY G DG+C    E SH  +I+G+  VP + E
Sbjct  183   DQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVDGKCNARKEASHAASITGHEDVPANSE  242

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLV  959
               L  A A QP++  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  ++G  YWLV
Sbjct  243   SALLKAVASQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLV  302

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWG  WGE+GYI+MQR      G CGIAM ASYP
Sbjct  303   KNSWGAQWGEEGYIRMQRDVDAAEGLCGIAMAASYP  338



>dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis]
Length=431

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  87    TIMLLLPLCLHTNA------SFEQ--HEMDSHH-VRMVKRYQDWLQKHGKRYEDKDEWEK  239
             T++L L + + ++A      S+++  H + S   V + + Y++W+ KHGK      E ++
Sbjct  2     TVILFLAMIVVSSAMDMSIISYDKNHHTVSSRSDVEVSRLYEEWVVKHGKAQNSLTEKDR  61

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+YL  ++   +K +     + 
Sbjct  62    RFEIFKDNLRFIDEHNGKNLSYRLGLTKFADLTNDEYRSMYLGSRL--KRKATKTSLRYE  119

Query  420   VRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
              R+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LV
Sbjct  120   ARVGDAIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELV  179

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  + A++FI +NGGI  E +YPY G DGRC+   + +  VTI  Y  
Sbjct  180   DCDTSYNEGCNGGLMDYAFEFIIKNGGIDTEEDYPYKGVDGRCDQTRKNAKVVTIDSYED  239

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VGYG ENG+
Sbjct  240   VPANSEESLKKALSHQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGK  299

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW+VKNSWGT+WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  300   DYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIK  342



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score =   286 bits (732),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 211/353 (60%), Gaps = 28/353 (8%)
 Frame = +3

Query  51    MKVFL---ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYED  221
             M++FL   I  + CF+I L  PL               + + M KR+ +W+ KHG+ Y D
Sbjct  6     MQIFLFVAIFSSFCFSITLSRPL--------------DNELIMQKRHIEWMTKHGRVYAD  51

Query  222   KDEWEKRYEIYQYNVLYIEFFNSM--NFSYKLIDNKFADMTNSEYKSVYLRYK-----ID  380
               E   RY +++ NV  IE  NS+    ++KL  N+FAD+TN E++S+Y  +K       
Sbjct  52    VKEENNRYVVFKNNVERIEHLNSIPAGRTFKLAVNQFADLTNDEFRSMYTGFKGVSALSS  111

Query  381   EHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIET  560
             + + +   F    V     P SVDWRK GAVT +K+QGSCG  WAF AVAA+EG  QI+ 
Sbjct  112   QSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKK  171

Query  561   GKLVSLSEQQLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEE  734
             GKL+SLSEQQLVDC  N  GCEGG  + A++ IK  GG+T E NYPY G+D  C +    
Sbjct  172   GKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTESNYPYKGEDATCNSKKTN  231

Query  735   SHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGV  911
                 +I+GY  VP  DE  L  A A QPV+  ++    DF+FYS G+F   C   L+H V
Sbjct  232   PKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAV  291

Query  912   TVVGYGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             T +GYGE  NG  YW++KNSWGT WGE GY+++Q+   DK G CG+AM ASYP
Sbjct  292   TAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYP  344



>ref|XP_010929952.1| PREDICTED: vignain isoform X1 [Elaeis guineensis]
Length=359

 Score =   286 bits (733),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 213/353 (60%), Gaps = 18/353 (5%)
 Frame = +3

Query  54    KVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHG-KRYEDKDE  230
             +VFL+       I+  L      +  F + ++ S    +   Y+ W   H   R  D  E
Sbjct  3     RVFLL------AIVFALAFAPTESIPFTEKDLASEE-SLRDLYERWRSIHTVSRDLDLGE  55

Query  231   WEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFT  410
               KR+ +++ NV +I  FN  +  YKL  NKF DMT  E+++ +   K+  H+    +  
Sbjct  56    KHKRFNVFKENVKFIHEFNKKDKPYKLKLNKFGDMTKEEFRNTFAGSKVMHHRIRRGSLR  115

Query  411   LHGVR-----LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
                 R     + + P SVDWR++GAVT VKDQG CGS WAF AVAAVEGINQI T  LVS
Sbjct  116   GSAKRFMYEKMTDLPPSVDWRQNGAVTGVKDQGQCGSCWAFSAVAAVEGINQIRTKNLVS  175

Query  576   LSEQQLVDC---NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+L+DC   + +GC+GG  + A+DFIKRNGG+T E NYPYVGKD +C    E  H V
Sbjct  176   LSEQELIDCDNKDNNGCDGGLMDYAFDFIKRNGGLTTEANYPYVGKDQKCNLSKENVHVV  235

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
              I G   VPE DE  L  A A QPV+  ++AS   F+FYSEG+FN  C   L+HGV VVG
Sbjct  236   GIDGREDVPENDEDALMQAVANQPVSVAIEASGSAFQFYSEGVFNGECGTELDHGVAVVG  295

Query  924   YG-EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             YG   +G  YW+VKNSWG+ WGE+GYI+M+R    K G CGIAM ASYP K +
Sbjct  296   YGTTRDGTKYWIVKNSWGSGWGENGYIRMERGISTKGGLCGIAMEASYPTKAA  348



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score =   290 bits (742),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 165/360 (46%), Positives = 226/360 (63%), Gaps = 25/360 (7%)
 Frame = +3

Query  42    KSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR----MVKRYQDWLQKHGK  209
             +S + +FL++    FT    + + +    S++Q   D    R    ++  Y+ WL KHGK
Sbjct  5     RSSLSLFLLM---IFTASSAVDMSI---VSYDQRHADKSSWRTDDEVMAMYEAWLVKHGK  58

Query  210   RYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK  389
              Y    E EKR+ I++ N+ +I+  NS N +Y+L  N+FAD+TN EY+S+YL  K    +
Sbjct  59    AYNALGEKEKRFGIFKDNLRFIDEHNSQNLTYRLGLNRFADLTNEEYRSMYLGVKPGATR  118

Query  390   ------KESHNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGIN  548
                   ++S  F    G  LP+F   +DWRK GAV  VKDQGSCGS WAF  +AAVEGIN
Sbjct  119   VTRKVSRKSDRFAARVGDALPDF---IDWRKEGAVVGVKDQGSCGSCWAFSTIAAVEGIN  175

Query  549   QIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCE  719
             QI TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI +E +YPY   D +C+
Sbjct  176   QIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDSEEDYPYRAADQKCD  235

Query  720   TIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPET  896
                + ++ V+I GY  VPE DE  L+ A A+QPV+  ++A    F+ Y  G+F   C  +
Sbjct  236   QYRKNANVVSIDGYEDVPENDEAALKKAVAKQPVSVAIEAGGRAFQLYQSGVFTGKCGTS  295

Query  897   LNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             L+HGV  VGYG ENGQ YW+V NSWG NWGEDGYI+M+R  +G  +GKCGIA+  SYP+K
Sbjct  296   LDHGVAAVGYGTENGQDYWIVGNSWGKNWGEDGYIRMERNLAGSSSGKCGIAIGPSYPIK  355



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 204/307 (66%), Gaps = 9/307 (3%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             YQ W+ KHGK Y    E EKR+EI++ N+ +I+  N+ N +YK+  N+FAD+TN EY+++
Sbjct  46    YQWWMAKHGKAYNGLGEKEKRFEIFKDNLKFIDEHNAQNRTYKVGLNRFADLTNEEYRAI  105

Query  360   YLRYKIDEHKK--ESHNFTLHGVRLPE--FPESVDWRKSGAVTHVKDQGSCGSSWAFCAV  527
             YL  + D  ++  +  N +     +P    PESVDWR++GAV  VKDQ SCGS WAF  V
Sbjct  106   YLGTRSDPKRRFAKLKNASPRYAVMPGEVLPESVDWRETGAVNPVKDQRSCGSCWAFSTV  165

Query  528   AAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPYV  698
             AAVEGINQI TG+L+SLSEQ+LVDC+     GC GG  + A+DFI +NGG+  E +YPY 
Sbjct  166   AAVEGINQIVTGELISLSEQELVDCDTEYDMGCNGGLMDYAFDFIIKNGGLDTEKDYPYT  225

Query  699   GKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             G DG C    + S  V+I GY  VP  DE  LQ A A QPV+  V+A     + Y  GIF
Sbjct  226   GFDGECNLSGKSSKVVSIDGYEDVPPFDEKALQKAVAHQPVSVAVEAGGRALQLYVSGIF  285

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDK-NGKCGIAM  1052
                C   L+HG+  VGYG ENG  YW+V+NSWG++WGE+GYI+M+R   D  +GKCGIAM
Sbjct  286   TGECGTALDHGIVAVGYGTENGTDYWIVRNSWGSSWGENGYIRMERNMADAFSGKCGIAM  345

Query  1053  MASYPLK  1073
              ASYP+K
Sbjct  346   EASYPIK  352



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 207/337 (61%), Gaps = 13/337 (4%)
 Frame = +3

Query  78    VCFT-IMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIY  254
             VC   I+++L  C     S E          M  R++ W+ ++G+ Y D  E EKR+ I+
Sbjct  13    VCLALILIMLGAC-----SSEATSRSLQDASMYGRHEQWMARYGRTYNDIREKEKRFNIF  67

Query  255   QYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
             + NV      +  N  YKL  N+FAD+TN E+K+   R+K  E   ++ +F    V    
Sbjct  68    KENVXIESSNDDANKLYKLSVNQFADLTNDEFKASRNRFKGHECSTKTTSFKYENV-TAS  126

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH-  611
              P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC+ + 
Sbjct  127   VPTTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTNG  186

Query  612   ---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GCEGG  + A+ FI++N G++ E NYPY G DG C T  E S    I+GY  VP + 
Sbjct  187   EDQGCEGGLMDDAFQFIQQNHGLSTEANYPYSGVDGTCNTKKEASIAAKITGYEDVPTNS  246

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  ++G  +WL
Sbjct  247   EQALLKAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVGDDGTKFWL  306

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWGT WGE+GYI+MQR      G CGIAM ASYP
Sbjct  307   VKNSWGTEWGEEGYIRMQRDVDAAEGLCGIAMSASYP  343



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 208/307 (68%), Gaps = 11/307 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y+ WL +HGK Y    E EKR+EI++ N+ +I+  NS N +Y+L  N+FAD+TN+EY+++
Sbjct  56    YETWLVRHGKAYNALGEKEKRFEIFKDNLKFIDEHNSQNHTYRLGLNRFADLTNAEYRAL  115

Query  360   YLRYKIDEHKKES----HNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAV  527
             YL  K + +K++S    + +        + P SVDWR+ GAV  VKDQGSCGS WAF  V
Sbjct  116   YLGKKPNPNKRDSRAKSNRYAFQAD--DDLPSSVDWREKGAVVPVKDQGSCGSCWAFSTV  173

Query  528   AAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYV  698
             AAVEGINQI TG+L+SLSEQ+LV+C+     GC GG  + A++FI  NGGI  E +YPY 
Sbjct  174   AAVEGINQIVTGELISLSEQELVECDTSYNQGCNGGLMDYAFEFIIENGGIDTEEDYPYT  233

Query  699   GKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             G+DG+C+T  + +  VTI  Y  VP  DE  LQ A A QPV+  ++A    F+ Y  GIF
Sbjct  234   GRDGQCDTYRKNARVVTIDSYEDVPVNDEKALQKAVAHQPVSVAIEAGGRAFQLYQSGIF  293

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAM  1052
                C   L+HGV  VGYG ENG  YW+V+NSWG++WGE+GYI+M+R  +   NGKCGIAM
Sbjct  294   TGRCGTALDHGVITVGYGSENGVDYWIVRNSWGSSWGEEGYIRMERNLASTDNGKCGIAM  353

Query  1053  MASYPLK  1073
              ASYP+K
Sbjct  354   EASYPIK  360



>ref|XP_010928804.1| PREDICTED: xylem cysteine proteinase 1-like [Elaeis guineensis]
Length=347

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 217/344 (63%), Gaps = 9/344 (3%)
 Frame = +3

Query  57    VFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWE  236
             + L L ++C    L LP        + + ++ SH  R+++ ++ W+ KH K Y+  +E  
Sbjct  6     ITLSLLSMCLITCLALPRDFSI-IGYSEDDLSSHD-RLIELFESWMSKHSKVYKSFEEKL  63

Query  237   KRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYL--RYKIDEHKKESHNFT  410
             +R+E+++ N+ +I+  N    SY L  N+FAD+++ E+K+ YL  R  + E +  S NF 
Sbjct  64    RRFEVFKDNLKHIDETNKKKSSYWLGLNEFADLSHEEFKATYLGLRTALPERRDASSNFR  123

Query  411   LHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQ  590
                    + P+SVDWRK GAVTHVK+QG CGS WAF  VAAVEGINQI TG L SLSEQ+
Sbjct  124   YEDS--TDLPKSVDWRKKGAVTHVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQE  181

Query  591   LVDCN--KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             L+DCN   +GC GG  + A+ FI  NGG+  E +YPY+ K+G CE    +   VTI+GY 
Sbjct  182   LIDCNTDNNGCNGGLMDYAFSFIVSNGGLHTEEDYPYLMKEGTCEEKRAKLEAVTITGYE  241

Query  765   KVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENG  941
              VPE+ E  L  A A QPV+  ++AS  DF+FYS G+F+  C + L+HGV  VGYG   G
Sbjct  242   DVPENSEESLLKALAHQPVSVGIEASGRDFQFYSGGVFDGHCGDELDHGVAAVGYGTSRG  301

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             Q Y +VKNSWG  WGE GYI+M+R +G   G CGI  MASYP K
Sbjct  302   QDYIIVKNSWGPRWGEKGYIRMKRNTGKPEGLCGINKMASYPTK  345



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 204/320 (64%), Gaps = 8/320 (3%)
 Frame = +3

Query  129   SFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNS-MNFSY  305
             S E          M  RY+ W+ ++G+ Y D +E E R++I++ NV +IE  N+ +N  Y
Sbjct  6     SCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNKPY  65

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVK  485
             KL  N+FAD+TN E+K+    +K  E   ++ +F    V+ P  P ++DWRK GAVT +K
Sbjct  66    KLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAP-VPAAMDWRKKGAVTPIK  124

Query  486   DQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFI  653
             DQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC+      GCEGG  + A+ FI
Sbjct  125   DQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFI  184

Query  654   KRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavv  830
             ++N G++ E NYPY G DG C T    S    I+GY  VP + E  L  A A QPV+  +
Sbjct  185   QQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAI  244

Query  831   daSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKM  1007
             DA   DF+FYS G+F   C  +L+HGVT VGYG  ++G  YWLVKNSWGT WGE+GYI+M
Sbjct  245   DAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRM  304

Query  1008  QRRSGDKNGKCGIAMMASYP  1067
             QR    K G CGIAM ASYP
Sbjct  305   QRDVEAKEGLCGIAMEASYP  324



>ref|XP_004231872.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=363

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 208/307 (68%), Gaps = 9/307 (3%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKS  356
             Y+ WL +HGK Y    E EKR+EI++ N+ +IE +N S N ++K+  N+FAD+TN EY++
Sbjct  36    YEKWLAEHGKIYNALGEKEKRFEIFKDNLRFIEEYNASENRTFKVGLNQFADLTNDEYRA  95

Query  357   VYLRYKIDEHKK--ESHNFTLHGVRLPE--FPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             VYL  K D  ++  +S N +      P    P SVDWRK GAV  +K+QGSCGS WAF  
Sbjct  96    VYLGTKSDARRRLVKSKNTSQRYASPPNELLPHSVDWRKKGAVAPIKNQGSCGSCWAFST  155

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             VAAVEGINQI TG++++LSEQ+LVDC++    GC GG  + A++FI  NGG+  E++YPY
Sbjct  156   VAAVEGINQIVTGEMITLSEQELVDCDRSQNGGCNGGLMDYAFEFIISNGGMDTENHYPY  215

Query  696   VGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
              G DGRC+ I + S  V+I  Y  VP +E  LQ A A QPV+  ++AS   F+ Y+ G+F
Sbjct  216   RGVDGRCDPIRKNSKVVSIDDYEDVPRNEKALQKAVAHQPVSVAIEASGKAFQLYTSGVF  275

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGIAM  1052
                C E ++HGV VVGYG E+G  YWLV+NSWGT WGE GY+KM+R   + + GKCGI  
Sbjct  276   TGDCGEKVDHGVVVVGYGSEDGNDYWLVRNSWGTKWGESGYVKMERNVKNGHLGKCGIMT  335

Query  1053  MASYPLK  1073
              ASYP+K
Sbjct  336   EASYPIK  342



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 211/334 (63%), Gaps = 10/334 (3%)
 Frame = +3

Query  87    TIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             +I + LP  L          +D     M+KR+++W+ +HG+ Y D  E EKRY I++ N+
Sbjct  7     SIHIFLPFLLILATKIVCRPLDEQEY-MLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENI  65

Query  267   LYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPE  443
               IE FN+  +  YKL  NKFAD+TN E+++++  YK    K  S +F      L   P 
Sbjct  66    ERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMHHGYKRQSSKLMSSSFRHE--NLSAIPT  123

Query  444   SVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----KH  611
             S+DWRK+GAVT VKDQG+CG  WAF AVAA+EGI +++TGKL+SLSEQQLVDC+      
Sbjct  124   SMDWRKAGAVTPVKDQGTCGCCWAFSAVAAIEGIIKLKTGKLISLSEQQLVDCDVKGVDQ  183

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGF  788
             GC GG  + A+ FI RNGG+T+E  YPY G DG C++    S    I+GY  VP  +E  
Sbjct  184   GCGGGLMDNAFQFILRNGGLTSEATYPYQGVDGTCKSKKTASIEAKITGYEDVPVNNENA  243

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKN  965
             L  A A+QPV+  V+    DF+FY  G+F   C   L+H VT +GYG   +G  YWLVKN
Sbjct  244   LLQAVAKQPVSVAVEGGGYDFQFYKSGVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKN  303

Query  966   SWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             SWGT+WGE GY++MQR  G + G CG+AM ASYP
Sbjct  304   SWGTSWGESGYMRMQRGIGAREGLCGVAMDASYP  337



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 209/336 (62%), Gaps = 13/336 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             VC  + LL  L    + S  +  +D+    M +R++ W+ ++G+ Y+D +E   RY I++
Sbjct  10    VC--LALLFILGAWPSKSTARTLLDAP---MYERHEQWMTQYGRVYKDDNERATRYSIFK  64

Query  258   YNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  I+ FNS    SYKL  N+FAD+TN E+K+   R+K      ++  F    V    
Sbjct  65    ENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVS--A  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P +VDWRK GAVT VKDQG CG  WAF AVAA+EGIN++ TGKL+SLSEQ++VDC+   
Sbjct  123   VPSTVDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GC GG  + A+ FI++N G+T E NYPY G DG C T     H   I+G+  VP + 
Sbjct  183   EDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKSAIHAAKITGFEDVPANS  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLV  959
             E  L  A A+QPV+  +DA   DF+FYS GIF   C   L+HGVT VGYG  +G  YWLV
Sbjct  243   EAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLV  302

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWG  WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  303   KNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYP  338



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/354 (45%), Positives = 213/354 (60%), Gaps = 31/354 (9%)
 Frame = +3

Query  57    VFLILKNV---CFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKD  227
             +FLI+  V   C +I L  PL                 + M KR+ DW+ KHG+ Y D  
Sbjct  1     MFLIVSLVSSFCLSITLSRPL--------------DDELIMQKRHDDWMAKHGRVYADVK  46

Query  228   EWEKRYEIYQYNVLYIEFFNSM---NFSYKLIDNKFADMTNSEYKSVYLRYKID------  380
             E + RY +++ NV  IE  N++     ++KL  N+F+D+TN E++S+Y  YK D      
Sbjct  47    EKDNRYIVFKRNVERIELSNNIFDSKRTFKLAVNQFSDLTNDEFRSMYTGYKGDYVLSSQ  106

Query  381   -EHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIE  557
              + + ++ +F    V     P SVDW+K GAVT +K+QGSCG  WAF AVAA+EG  QI+
Sbjct  107   SQSRSKTTSFRYQNVSSSVLPISVDWKKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIK  166

Query  558   TGKLVSLSEQQLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAE  731
              GKL+SLSEQQLVDC  N +GC GG  + A++ I   GG+T E NYPY G+DG C +   
Sbjct  167   KGKLISLSEQQLVDCDINDYGCRGGLMDTAFEHIIATGGLTTESNYPYKGEDGTCNSKKT  226

Query  732   ESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHG  908
                  +ISGY  VP  DE  L  A A QPV+  ++    DF+FYS G+F   C  +L+H 
Sbjct  227   NPKATSISGYEDVPVNDEKALMKAVAYQPVSVGIEGGGFDFQFYSTGVFTGECTTSLDHA  286

Query  909   VTVVGYGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VT VGYGE  NG  YW++KNSWGT WGE GY+++Q+   DK G CG+AM ASYP
Sbjct  287   VTAVGYGESANGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYP  340



>emb|CDP15086.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 215/353 (61%), Gaps = 18/353 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKD  227
             MK FL+       + L L L L   +SF+ HE +      +   Y+ W + H +     D
Sbjct  1     MKKFLL-------VTLSLALVLEIGSSFDFHEKELETEESLWDLYERW-RSHHRDSTSLD  52

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KE  395
             E  KR+ +++ NVL++  FN  +  YKL  NKFAD+T+ E++S Y   KI  H+    ++
Sbjct  53    EKLKRFNVFKSNVLHVHQFNKKDKPYKLKLNKFADLTSHEFRSFYAGSKIKHHRLLRGQK  112

Query  396   SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
             + N T     +   P SVDWR+ GAV  +KDQG CGS WAF  V +VEGIN I T KLVS
Sbjct  113   ADNGTFMYANVDRAPPSVDWRQKGAVNPIKDQGQCGSCWAFSTVVSVEGINYIRTKKLVS  172

Query  576   LSEQQLVDC---NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC   +  GC GG  + A+ FI++ GGIT+E NYPY   DGRC+T   +   V
Sbjct  173   LSEQELVDCDNTDNQGCNGGLMDLAFQFIRKQGGITSEQNYPYKAADGRCDTRKLKQPVV  232

Query  747   TISGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             +I GY  V P DE  L  AAA QPV+  +DA   DF+FYSEG+F   C   L+HGV +VG
Sbjct  233   SIDGYEDVPPNDEDALLKAAANQPVSVAIDAGGSDFQFYSEGVFTGDCGTELDHGVAIVG  292

Query  924   YGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             YG   +G  YW+V+NSWGT WGE GYI+MQR   DK G CGIAM  SYP+K S
Sbjct  293   YGTTLDGTKYWIVRNSWGTEWGEKGYIRMQRGIDDKEGLCGIAMEPSYPIKNS  345



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 209/336 (62%), Gaps = 13/336 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             VC  + LL  L    + S  +  +D+    M +R++ W+ ++G+ Y+D +E   RY I++
Sbjct  10    VC--LALLFILGAWPSKSTARTLLDAP---MYERHEQWMTQYGRVYKDDNERATRYSIFK  64

Query  258   YNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  I+ FNS    SYKL  N+FAD+TN E+K+   R+K      ++  F    V    
Sbjct  65    ENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVS--A  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P +VDWRK GAVT VKDQG CG  WAF AVAA+EGIN++ TGKL+SLSEQ++VDC+   
Sbjct  123   VPSTVDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-  779
                GC GG  + A+ FI++N G+T E NYPY G DG C T     H   I+G+  VP + 
Sbjct  183   EDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANS  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLV  959
             E  L  A A+QPV+  +DA   DF+FYS GIF   C   L+HGVT VGYG  +G  YWLV
Sbjct  243   EAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLV  302

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWG  WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  303   KNSWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYP  338



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 218/351 (62%), Gaps = 25/351 (7%)
 Frame = +3

Query  69    LKNVCFTIML---LLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             + ++  T +L   L+ L L  + S   +E       ++  Y++WL KH K Y    E ++
Sbjct  1     MASITITSLLFFSLITLSLAMDTSMRSNE------EVMTMYEEWLVKHHKVYNGLGEKDQ  54

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK-------ES  398
             R+EI++ N+ +I+  N+ N++YK+  NKFADMTN EY+++YL  K D  +          
Sbjct  55    RFEIFKDNLGFIDEHNAQNYTYKVGLNKFADMTNEEYRNMYLGTKNDAKRNVMKIKITTG  114

Query  399   HNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
             H +  + G RLP     VDWR  GAV H+KDQGSCGS WAF  +A VE IN+I TGKLVS
Sbjct  115   HRYAFNSGDRLPVH---VDWRSKGAVAHIKDQGSCGSCWAFSTIATVEAINKIVTGKLVS  171

Query  576   LSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC++    GC GG  + A++FI  NGGI  E +YPY G +GRC+   + +  V
Sbjct  172   LSEQELVDCDRAFNEGCNGGLMDYAFEFIVENGGIDTEQDYPYKGFEGRCDPTRKNAKVV  231

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             +I GY  VP  +E  L+ A + QPV+  ++A     + Y  G+F   C   L+HGV VVG
Sbjct  232   SIDGYEDVPAYNENALKKAVSHQPVSVAIEAGGRALQLYQSGVFTGRCGTNLDHGVVVVG  291

Query  924   YGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGIAMMASYPLK  1073
             YG ENG  YWLV+NSWGTNWGEDGY K++R     N GKCGIAM ASYP+K
Sbjct  292   YGSENGVDYWLVRNSWGTNWGEDGYFKLERNVKKINTGKCGIAMQASYPVK  342



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/340 (47%), Positives = 211/340 (62%), Gaps = 20/340 (6%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVR---MVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             +C  ++LL         ++    M S  ++   M +RY+ W  ++G+ Y D  E EKR+ 
Sbjct  10    LCLALILL--------GAWIPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNVEKEKRFT  61

Query  249   IYQYNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             I++ NV +IE FN  +   YKL  N+FAD+TN E+K    R+K     +++  F    V 
Sbjct  62    IFKQNVAHIEAFNKASKKPYKLAVNEFADLTNEEFKVSRNRFKGHMCSEQTGPFKYENV-  120

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P ++DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL SLSEQ+LVDC+
Sbjct  121   -TAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GC GG  + A+ F+++N GIT E NYPY G DG+C    E +H   I+G+  VP
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVP  239

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A A QPV+  +DA   DF+FYS G+F   C   L+HGVT VGYG  ++G  
Sbjct  240   ANSETALMKAVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTK  299

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWGT+WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   YWLVKNSWGTSWGEEGYIRMQRDIDAKQGLCGIAMQASYP  339



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/344 (45%), Positives = 220/344 (64%), Gaps = 16/344 (5%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKR----YQDWLQKHGKRYEDKDEWEKRYEI  251
              TI   + L   T ++ +   + +H  R  ++    Y+ WL KHGK Y    E ++R++I
Sbjct  9     LTIFTTVALIGATQSTHQNDGVPTHGRRTDEQVKGLYESWLAKHGKAYNGIGEKDRRFDI  68

Query  252   YQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKID------EHKKESHNFTL  413
             ++ N+ +++  NS N +Y++  NKFAD+TN EY+S YL  + D      + K  S  + L
Sbjct  69    FKDNLKFVDDHNSGNRTYEVGLNKFADLTNEEYRSTYLGTRSDPTRRFVKSKNPSRRYAL  128

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
                 +   PESVDWR+ GAV+ +K+QG+CGS WAF  VAAVEGIN+I TG+L++LSEQ+L
Sbjct  129   RSGEM--LPESVDWRERGAVSPIKNQGTCGSCWAFSTVAAVEGINKITTGELLTLSEQEL  186

Query  594   VDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             VDC+K    GC GG  + A+ FI  NGG+  E +YPY G DG+C+   + +  V+I GY 
Sbjct  187   VDCDKSENAGCSGGLMDYAFQFIISNGGMDTEDDYPYRGIDGKCDFARKNAKVVSIDGYE  246

Query  765   KVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
              VP+DE  LQ A A QPV+  ++AS    + YS G+F   C + L+HGV  VGYG ENG 
Sbjct  247   DVPQDEKALQKAVAHQPVSVAIEASGRALQLYSSGVFTGECGKQLDHGVVAVGYGTENGV  306

Query  945   PYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
              YW+V+NSWG +WGE+GY +++R  +GD +GKCGI + ASYP K
Sbjct  307   DYWIVRNSWGPDWGENGYFRLERNVAGDPSGKCGIVVEASYPTK  350



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 208/344 (60%), Gaps = 13/344 (4%)
 Frame = +3

Query  57    VFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWE  236
              F  L +    ++++   C     + E +        M +R++ W+  HGK Y D  E E
Sbjct  2     AFKTLFHSTLALVIVFAFC-----ALEANARTLQDASMRERHEQWMVTHGKLYLDSSEKE  56

Query  237   KRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTL  413
             ++Y+I++ NV  IE FN+  N  YKL  N+FAD+TN E+K+   R+K       +   T 
Sbjct  57    QKYQIFKENVQRIEAFNNAGNKPYKLGINQFADLTNEEFKARN-RFKGHICSTITRTPTF  115

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
                 +   P S+DWR+ GAVT +KDQG CGS WAF AVAA EGI ++ TGKL+SLSEQ+L
Sbjct  116   KYEHVTALPTSLDWRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQEL  175

Query  594   VDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             +DC+      GCEGG  + A+ FI  N G+T E  YPY G DG C   AE SH  +I GY
Sbjct  176   IDCDTKGEDQGCEGGLMDDAFKFILNNKGLTTEATYPYEGIDGTCNAKAESSHAASIKGY  235

Query  762   TKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EE  935
               VP + E  L  A A QPV+  +DAS  +F+FY+ G+FN  C   L+HGVT VGYG  +
Sbjct  236   EDVPANSESALLKAVANQPVSVAIDASGYEFQFYAGGVFNGSCDTNLDHGVTAVGYGVSD  295

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             +G  YWLVKNSWG  WGE GYI+MQR    K G CGIAM+ASYP
Sbjct  296   DGSKYWLVKNSWGVKWGEKGYIRMQRDVSAKEGLCGIAMLASYP  339



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  87    TIMLLLPLCLHTNA------SFEQ--HEMDSHH-VRMVKRYQDWLQKHGKRYEDKDEWEK  239
             T++L L + + ++A      S+++  H + S   V + + Y++W+ KHGK      E ++
Sbjct  8     TVILFLAMIVVSSAMDMSIISYDKNHHTVSSRSDVEVSRLYEEWVVKHGKAQNSLTEKDR  67

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+YL  ++   +K +     + 
Sbjct  68    RFEIFKDNLRFIDEHNGKNLSYRLGLTKFADLTNDEYRSMYLGSRL--KRKATKTSLRYE  125

Query  420   VRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
              R+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LV
Sbjct  126   ARVGDAIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAVEGINKIMTGDLISLSEQELV  185

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  + A++FI +NGGI  E +YPY G DGRC+   + +  VTI  Y  
Sbjct  186   DCDTSYNEGCNGGLMDYAFEFIIKNGGIDTEEDYPYKGVDGRCDQTRKNAKVVTIDSYED  245

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VGYG ENG+
Sbjct  246   VPANSEESLKKALSHQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGK  305

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW+VKNSWGT+WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  306   DYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIK  348



>dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica]
Length=441

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  87    TIMLLLPLCLHTNA------SFEQ--HEMDSHHVRMVKR-YQDWLQKHGKRYEDKDEWEK  239
             T++L L + + ++A      S+++  H + S     V R Y++WL KHGK      E ++
Sbjct  2     TVILFLTMIVVSSAMDMSIISYDKNHHTVSSRSDAEVSRLYEEWLVKHGKAQNSLTEKDR  61

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+YL  ++   +K + +   + 
Sbjct  62    RFEIFKDNLRFIDEHNGKNLSYRLGLTKFADLTNDEYRSMYLGSRL--KRKATKSSLRYE  119

Query  420   VRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
             VR+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I TG L++LSEQ+LV
Sbjct  120   VRVGDAIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAVEGINKIVTGDLITLSEQELV  179

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  + A++FI  NGGI  E +YPY G DGRC+   + +  VTI  Y  
Sbjct  180   DCDTSYNEGCNGGLMDYAFEFIINNGGIDTEEDYPYKGVDGRCDQTRKNAKVVTIDLYED  239

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VGYG ENG+
Sbjct  240   VPANSEESLKKALSHQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGK  299

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW+VKNSWGT+WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  300   DYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIK  342



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 211/340 (62%), Gaps = 17/340 (5%)
 Frame = +3

Query  72    KNVCFTIMLLL-PLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             K +CF ++ +L  L  H  +   Q         M  +Y+ W+  +G+ Y + +E EKR+ 
Sbjct  6     KCMCFALIFMLGALSSHATSRTLQDP------SMYGKYEQWMAHYGRVYTNINEKEKRFN  59

Query  249   IYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             I++ NV +IE  N+  N  YKL  N+FAD+TN E+K+   R+   E   ++ +F    V 
Sbjct  60    IFKANVDFIESSNNDANKPYKLKVNQFADLTNEEFKASRNRFMGHECSTKTTSFKYENVT  119

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
              P    +VDWRK GAVT +KDQG CG  WAF AVAA+EGI ++ TGKL+SLSEQ+LVDC+
Sbjct  120   APA---TVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  176

Query  606   K----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GCEGG  + A+ FI +N G++ E NYPY G DG C T  E SH  TI+G+  VP
Sbjct  177   TSGVDQGCEGGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKKEASHAATITGHEDVP  236

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A A QP++  +DA   DF+FYS G+F   C  +L+HGVT VG+G   +G  
Sbjct  237   ANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTK  296

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWG  WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  297   YWLVKNSWGAEWGEEGYIRMQRDVEAKEGLCGIAMEASYP  336



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 194/307 (63%), Gaps = 7/307 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMN-FSYKLIDNKFADMTNS  344
             MV+R++ W+  HG+ Y D  E E+R++I++ NV +IE FN      YKL  N+FAD+TN 
Sbjct  29    MVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQFADLTNE  88

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E+K+    +K     K     +     +   P ++DWRK GAV  +KDQG CGS WAF A
Sbjct  89    EFKASRNGFKASSSLKLIRGASFKYENVTAVPATMDWRKKGAVAPIKDQGQCGSCWAFSA  148

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYP  692
             +AA EGI ++ TGKL+SLSEQ++VDC++     GC GG  E A+ FI +N GI +E  YP
Sbjct  149   IAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKNKGIASEATYP  208

Query  693   YVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y   DG C    E SH   I+GY KVP  +E  L  A A QPV+  +DAS   F+FY+ G
Sbjct  209   YTAADGTCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDASGMAFQFYTSG  268

Query  870   IFNPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGI  1046
             +F   C   L+HGVT VGYG+  NG  YWLVKNSWGT+WGE GYI+MQR    K G CGI
Sbjct  269   VFTGDCGTDLDHGVTAVGYGKASNGTKYWLVKNSWGTSWGESGYIRMQRGISAKEGLCGI  328

Query  1047  AMMASYP  1067
             AM +SYP
Sbjct  329   AMDSSYP  335



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 214/351 (61%), Gaps = 16/351 (5%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKR--------YQDWLQKHGKRY  215
             ++L      I+ L  + + +         D  HHV    R        Y+ WL KHGK Y
Sbjct  1     MVLGKPALAILFLATIAVSSAIDMSIISYDEKHHVSGGGRSEAETEEMYEAWLVKHGKFY  60

Query  216   EDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKE  395
                 E ++R+EI++ N+ +I+  N+ N +Y+L   +FAD+TN EY+S+YL  K   HK+ 
Sbjct  61    NALGEKDRRFEIFKDNLRFIDEHNARNLTYRLGLTRFADLTNDEYRSMYLGAK--PHKRT  118

Query  396   SHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLV  572
                   +  R+ +  P+SVDWRK GAV  VKDQG CGS WAF A+ AVEGIN+I TG L+
Sbjct  119   LRTSDRYLPRVGDAIPDSVDWRKEGAVPEVKDQGGCGSCWAFSAIGAVEGINKIVTGDLI  178

Query  573   SLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHT  743
             SLSEQ+LVDC+     GC GG  + A+DFI  NGGI  + +YPY G DGRC+   + +  
Sbjct  179   SLSEQELVDCDTSYNQGCNGGLMDYAFDFIINNGGIDTDKDYPYKGSDGRCDQNRKNAKV  238

Query  744   VTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVV  920
             VTI  Y  VP  DE  L+ A A QPV+  ++A    F+ Y+ G+F+ IC   L+HGV  V
Sbjct  239   VTIDSYEDVPVNDEQALKKAVANQPVSVAIEAGGRAFQLYNSGVFDGICGTELDHGVVAV  298

Query  921   GYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             GYG ENG+ YW+V+NSWG +WGE GYIKM R      GKCGIAM ASYP+K
Sbjct  299   GYGTENGKDYWIVRNSWGKSWGESGYIKMARNIEASTGKCGIAMEASYPIK  349



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score =   289 bits (739),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 212/328 (65%), Gaps = 17/328 (5%)
 Frame = +3

Query  135   EQH-EMDSHHVRMVKR----YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNF  299
             EQH +M + H R        Y+ WL KHGK Y    E EKR+EI++ N+ +I+  N+ N 
Sbjct  30    EQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIGEKEKRFEIFKDNLRFIDEHNAENR  89

Query  300   SYKLIDNKFADMTNSEYKSVYLRYKIDEHKK-----ESHNFTLHGVRLPEFPESVDWRKS  464
             SYKL  N+F+D+TN EY+++++  ++D   +     +S  +T       + PESVDWR+ 
Sbjct  90    SYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKNPKSDRYTFQAGE--KLPESVDWREK  147

Query  465   GAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTE  635
             GAV  VKDQG CGS WAF  V AVEGIN+I TG+L+SLSEQ+LVDC++    GC GG  +
Sbjct  148   GAVAPVKDQGQCGSCWAFSTVGAVEGINKIVTGELISLSEQELVDCDRSYNQGCNGGLMD  207

Query  636   KAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqq  812
              A+DFIK NGGI    +YPY  +DG C+   + +  V+I GY  VPE DE  L  A A Q
Sbjct  208   YAFDFIKNNGGIDTGDDYPYHAQDGTCDPYRKNARVVSIDGYEDVPENDEKSLMKAVANQ  267

Query  813   pvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGED  992
             PV+  ++A    F+ YS G+F   C   L+HGV VVGYG ENG+ YW+V+NSWG NWGE 
Sbjct  268   PVSVAIEAGGRAFQHYSSGVFTGYCGTQLDHGVVVVGYGTENGEDYWIVRNSWGPNWGES  327

Query  993   GYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             GYIK+QR  +    GKCGIAM ASYPLK
Sbjct  328   GYIKLQRNFANSTTGKCGIAMQASYPLK  355



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 207/341 (61%), Gaps = 13/341 (4%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             + K +CF ++L+L        S +          M  RY+ WL ++G+ Y D DE E R+
Sbjct  8     LWKYMCFGLILMLGAW-----SSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRF  62

Query  246   EIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             +I++ NV +IE  N   N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V
Sbjct  63    KIFKENVAFIESSNKDANKPYKLSVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYKNV  122

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
                  P ++DWR  GAVT VKDQG CG  WAF AVAA EG+ Q+ TG+L+SLSEQ+LVDC
Sbjct  123   T-AALPATMDWRTKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGRLISLSEQELVDC  181

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  + A+ FI++N GI+ E NYPY G DG C T  E      I+G+  V
Sbjct  182   DTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDV  241

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             P + E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G 
Sbjct  242   PANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGT  301

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  302   KYWLVKNSWGXEWGEXGYIRMQRDVAAAEGLCGIAMSASYP  342



>ref|XP_009123448.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Brassica rapa]
Length=461

 Score =   289 bits (739),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  87    TIMLLLPLCLHTNA------SFEQ--HEMDSHH-VRMVKRYQDWLQKHGKRYEDKDEWEK  239
             T++L L + + ++A      S+++  H + S   V + + Y++W+ KHGK      E ++
Sbjct  8     TVILFLAMIVVSSAMDMSIISYDKNHHTVSSRSDVEVSRLYEEWVVKHGKAQNSLTEKDR  67

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+YL  ++   +K +     + 
Sbjct  68    RFEIFKDNLRFIDEHNGKNLSYRLGLTKFADLTNDEYRSMYLGSRL--KRKATKTSLRYE  125

Query  420   VRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
              R+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LV
Sbjct  126   ARVGDAIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELV  185

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  + A++FI +NGGI  E +YPY G DGRC+   + +  VTI  Y  
Sbjct  186   DCDTSYNEGCNGGLMDYAFEFIIKNGGIDTEEDYPYKGVDGRCDQTRKNAKVVTIDSYED  245

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VGYG ENG+
Sbjct  246   VPANSEESLKKALSHQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGK  305

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW+VKNSWGT+WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  306   DYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIK  348



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  87    TIMLLLPLCLHTNA------SFEQ--HEMDSHHVRMVKR-YQDWLQKHGKRYEDKDEWEK  239
             T++L L + + ++A      S+++  H + S     V R Y++WL KHGK      E ++
Sbjct  8     TVILFLTMIVVSSAMDMSIISYDKNHHTVSSRSDAEVSRLYEEWLVKHGKAQNSLTEKDR  67

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+YL  ++   +K + +   + 
Sbjct  68    RFEIFKDNLRFIDEHNGKNLSYRLGLTKFADLTNDEYRSMYLGSRL--KRKATKSSLRYE  125

Query  420   VRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
             VR+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I TG L++LSEQ+LV
Sbjct  126   VRVGDAIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAVEGINKIVTGDLITLSEQELV  185

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  + A++FI  NGGI  E +YPY G DGRC+   + +  VTI  Y  
Sbjct  186   DCDTSYNEGCNGGLMDYAFEFIINNGGIDTEEDYPYKGVDGRCDQTRKNAKVVTIDLYED  245

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VGYG ENG+
Sbjct  246   VPANSEESLKKALSHQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGK  305

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW+VKNSWGT+WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  306   DYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIK  348



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 160/340 (47%), Positives = 209/340 (61%), Gaps = 20/340 (6%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVR---MVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             +C  ++LL         ++    M S  ++   M +RY+ W  ++G+ Y D  E EKR+ 
Sbjct  10    LCLALILL--------GAWSPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNAEKEKRFT  61

Query  249   IYQYNVLYIEFFNSMN-FSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             I++ NV  IE FN  +   YKL  N+FAD+TN E+K+   R+K     +++  F    V 
Sbjct  62    IFKQNVANIEAFNKASEKPYKLAVNEFADLTNEEFKASRNRFKGHMCSEQTGPFKYENVT  121

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P ++DWRK GAVT VKDQG CG  WAF AVAA+EGINQ+ TGKL SLSEQ+LVDC+
Sbjct  122   A--VPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCD  179

Query  606   ----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GC GG  + A+ F+++N GIT E NYPY G DG+C    E +H   I+G+  VP
Sbjct  180   VKGEDEGCNGGLMDNAFQFVQKNKGITTEINYPYKGVDGKCNAKEEANHAAKINGHEDVP  239

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A A QPV+  +DA   DF+FYS G+F   C   L+HGVT VGYG  ++G  
Sbjct  240   ANSETALMKAVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTK  299

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWG  WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   YWLVKNSWGATWGEEGYIRMQRDIDAKQGLCGIAMQASYP  339



>ref|XP_002321654.1| Cys endopeptidase family protein [Populus trichocarpa]
 gb|EEF05781.1| Cys endopeptidase family protein [Populus trichocarpa]
Length=362

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 212/353 (60%), Gaps = 18/353 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKD  227
             MK FL        + L L L L    S + HE D      +   Y+ W + H       D
Sbjct  3     MKKFLF-------VALSLALVLGITESLDFHEKDLESEESLWDLYERW-RSHHTVSTSLD  54

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KE  395
             E  KR+ +++ NV+++   N M   YKL  NKFADMTN E++SVY   K+  H+      
Sbjct  55    EKHKRFNVFKENVMHVHKTNKMGKPYKLKLNKFADMTNHEFRSVYAGSKVKHHRMFRGTT  114

Query  396   SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
               N +    ++ + P SVDWRK GAVT VKDQG CGS WAF  + AVEGIN I+T +LVS
Sbjct  115   RGNGSFMYGKVEKVPTSVDWRKKGAVTAVKDQGQCGSCWAFSTIVAVEGINYIKTNELVS  174

Query  576   LSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC+     GC GG  E A++FIK+  GIT E  YPY  +DG C+   E +  V
Sbjct  175   LSEQELVDCDTTENQGCNGGLMEYAFEFIKKKRGITTESTYPYKAEDGHCDAAKENNPAV  234

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             +I GY KVPE DE  L  AAA QPV+  +DA   DF+FYSEG+F   C   L+HGV VVG
Sbjct  235   SIDGYEKVPENDEDALLKAAANQPVSVAIDAGGSDFQFYSEGVFIGECGTELDHGVAVVG  294

Query  924   YGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             YG   +G  YW+V+NSWG  WGE GYI+MQR   DK G CGIAM ASYP+K S
Sbjct  295   YGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKEGLCGIAMEASYPIKNS  347



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 208/307 (68%), Gaps = 12/307 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y+DWL KHGK Y    E E+R+E+++ N+ +I+  NS N +Y++  N+FAD+TN EY+S+
Sbjct  42    YEDWLVKHGKAYNSLGEKERRFEVFKDNLRFIDEHNSENRTYRVGLNRFADLTNEEYRSM  101

Query  360   YLR----YKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             YL      + ++ +K S  +T    R+ +  P+SVDWRK GAV  VKDQGSCGS WAF A
Sbjct  102   YLGALSGIRRNKLRKISDRYT---PRVGDSLPDSVDWRKEGAVVGVKDQGSCGSCWAFSA  158

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             VAAVEGIN+I TG L+SLSEQ+LVDC+     GC GG  +  ++FI  NGGI +E +YPY
Sbjct  159   VAAVEGINKIVTGDLISLSEQELVDCDNSYNEGCNGGLMDYGFEFIINNGGIDSEEDYPY  218

Query  696   VGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGI  872
             + +DGRC+T  + +  V+I  Y  VP  +E  LQ A A QPV+  ++A   DF+ YS G+
Sbjct  219   LARDGRCDTYRKNARVVSIDSYEDVPVNNEAALQKAVANQPVSVAIEAGGRDFQLYSSGV  278

Query  873   FNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
             F+  C   L+HGV  VGYG ENGQ YW+V+NSWG +WGE GY++M R      G CGIAM
Sbjct  279   FSGRCGTALDHGVVAVGYGTENGQDYWIVRNSWGKSWGESGYLRMARNIRKPTGICGIAM  338

Query  1053  MASYPLK  1073
              ASYP+K
Sbjct  339   EASYPIK  345



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 197/305 (65%), Gaps = 6/305 (2%)
 Frame = +3

Query  171   VKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSE  347
             V+ ++ W+ + G+ Y+D+ E  KR+ I++ NV YI  FN +    Y+L  NKFAD+TN E
Sbjct  35    VQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEYIRSFNEAAARPYRLAINKFADLTNEE  94

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAV  527
             + +    YK+  + K +   +     +   P S+DWR+ GAVT VKDQG CG  WAF AV
Sbjct  95    FVASRNGYKMGSYMKSTKVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAV  154

Query  528   AAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYV  698
             AA EGINQ+ T KL+SLSEQ+LVDC+     GC GG  + A++FI  NGGIT E NYPY 
Sbjct  155   AATEGINQLTTRKLISLSEQELVDCDTSEDEGCNGGLMDDAFEFIISNGGITTESNYPYE  214

Query  699   GKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             G DG C +  E SH   I+GY  VP + E  L  A A QPV+  +DAS  DF+FYS G+F
Sbjct  215   GVDGTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVF  274

Query  876   NPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
                C   L+HGVT VGYG+  +G  YWLVKNSWG++WGE+GYI+MQR      G CGIAM
Sbjct  275   TGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCGIAM  334

Query  1053  MASYP  1067
              ASYP
Sbjct  335   QASYP  339



>ref|XP_010515152.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2 [Camelina 
sativa]
Length=360

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 217/352 (62%), Gaps = 20/352 (6%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDE  230
             MK  L++    F++++L   C      +E  E++S    +   Y  W + H        E
Sbjct  1     MKKLLLI--FLFSLVILQTAC---GFDYEDKEVESEE-GLSNMYDRW-RSHHSVPRSLHE  53

Query  231   WEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH------KK  392
              EKR+ ++++NV+++   N  N SYKL  NKFAD+T +E+K+ Y    I  H      K+
Sbjct  54    REKRFNVFRHNVMHVHNTNKKNKSYKLKLNKFADLTINEFKNAYTGSNIKHHRMLQGLKR  113

Query  393   ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLV  572
              S  F        + P SVDWRK GAVT +K+QG CGS WAF  VAAVEGINQI+T KLV
Sbjct  114   GSKQFMYENA--SKLPSSVDWRKKGAVTEIKNQGRCGSCWAFSTVAAVEGINQIKTNKLV  171

Query  573   SLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHT  743
             SLSEQ+LVDC+ +   GC GG  E A++FIK+NGGIT E +YPY G DG+C+   +    
Sbjct  172   SLSEQELVDCDTNQNEGCNGGLMEIAFEFIKKNGGITTEDSYPYEGIDGKCDASKDNGVL  231

Query  744   VTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVV  920
             VTI G+  VPE DE  L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV  V
Sbjct  232   VTIDGHENVPENDENALLKAVANQPVSVAIDAGSSDFQFYSEGVFTGYCGTELNHGVAAV  291

Query  921   GYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             GYG   NG+ YW+V+NSWG  WGE GYIK++R   +  G+CGIAM ASYP+K
Sbjct  292   GYGSNSNGEKYWIVRNSWGAEWGEGGYIKLERGIDEPEGRCGIAMEASYPIK  343



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 158/342 (46%), Positives = 207/342 (61%), Gaps = 12/342 (4%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++ +       L+L +C+    S + HE       + +R++ W++++G+ Y++  E E R
Sbjct  4     VLPRECIIAFFLILAVCIPNVMSRQLHE-----ASLSQRHEQWMEEYGRVYKNDAETELR  58

Query  243   YEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             + I++ N+ +IE FN+  N  YKL  N+FAD TN E+++    Y   +        +   
Sbjct  59    FSIFKSNLAFIESFNAAGNRPYKLSINEFADQTNEEFRAYRNGYGRAQRLTSRKETSFRY  118

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P SVDWRK GAVT +KDQ  CGS WAF AVAA EGI+Q+ TGKL+SLSEQ+LVD
Sbjct  119   ENVTALPASVDWRKKGAVTPIKDQAQCGSCWAFSAVAATEGIHQLTTGKLISLSEQELVD  178

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GC GG  E A++FI RN GI +E  YPY G DG C    E SH  TI+GY  
Sbjct  179   CDTQGEDQGCAGGEMEDAFEFIIRNHGIASEVTYPYKGDDGTCNKTKEASHAATITGYEV  238

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENG  941
             VP + E  L  A A QPV+  +DA    F+FYS GIF   C   L+HGVT VGYG  E+G
Sbjct  239   VPANSEKALMKAVANQPVSVSIDAGGYAFQFYSSGIFTGDCGTELDHGVTAVGYGTSEDG  298

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT WGE GYI+MQR    K G CGIAM +SYP
Sbjct  299   TMYWLVKNSWGTGWGEKGYIRMQRDIKAKEGLCGIAMDSSYP  340



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 207/309 (67%), Gaps = 9/309 (3%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y+ WL KHGK Y    E ++R++I++ N+ +++  NS N +YK+  N+FAD+TN E++SV
Sbjct  47    YERWLAKHGKAYNGIGEKDRRFQIFKDNLKFVDEHNSGNRTYKVGLNRFADLTNEEFRSV  106

Query  360   YLRYKIDEHKK--ESHNFTL-HGVRL--PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             YL  + D  ++  +S N +  +  R    E PESVDWR+ GAV  +K+QG+CGS WAF  
Sbjct  107   YLGTRTDAKRRFVKSKNASRRYAFRAGDDELPESVDWRERGAVAPIKNQGTCGSCWAFST  166

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             VAAVEGINQI TG++++LSEQ+LVDC+K    GC GG  + A+ FI  NGG+  E +YPY
Sbjct  167   VAAVEGINQIVTGEMITLSEQELVDCDKTENAGCNGGLMDYAFQFIISNGGMDTEADYPY  226

Query  696   VGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
              G DGRC+   + +  V+I G+  VP DE  LQ A A QPV+  ++AS    + YS G+F
Sbjct  227   RGLDGRCDPTRKNAKVVSIDGFEDVPHDERALQKAVAHQPVSVAIEASGRALQLYSSGVF  286

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAM  1052
                C   L+HGV  VGYG E G  YW+V+NSWGT WGEDGY++++R   G+ +GKCGI M
Sbjct  287   TGECGSQLDHGVVAVGYGTEGGVDYWIVRNSWGTEWGEDGYLRLERNVVGNPSGKCGIVM  346

Query  1053  MASYPLKGS  1079
              ASYP K S
Sbjct  347   EASYPTKNS  355



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 206/309 (67%), Gaps = 13/309 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y +WL KHGK Y    E E+R+EI++ N+ +++  NS N SYK+  N+FAD+TN EY+S+
Sbjct  47    YAEWLAKHGKAYNGIGERERRFEIFKDNLKFVDEHNSENRSYKVGLNRFADLTNEEYRSM  106

Query  360   YLRYKID------EHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
             +L  K D      + K  S  + +    +   PESVDWR+SGAV  +KDQGSCGS WAF 
Sbjct  107   FLGTKTDSKRRFMKSKSASRRYAVQDSDM--LPESVDWRESGAVAPIKDQGSCGSCWAFS  164

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYP  692
              VAAVEG+NQI TG+++ LSEQ+LVDC++    GC GG  + A++FI  NGGI  E +YP
Sbjct  165   TVAAVEGVNQIATGEMIQLSEQELVDCDRTYDAGCNGGLMDYAFEFIINNGGIDTEEDYP  224

Query  693   YVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y G DG C+   + +  V+I+ Y  VP  DE  L+ A A QPV+  ++AS   F+ Y  G
Sbjct  225   YRGVDGTCDPERKNTKVVSINDYEDVPPYDEMALKKAVAHQPVSVAIEASGRAFQLYLSG  284

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDK-NGKCGI  1046
             +F   C   L+HGV VVGYG +NG  +W+V+NSWGT+WGE+GYI+M+R   D   GKCGI
Sbjct  285   VFTGECGRALDHGVVVVGYGTDNGADHWIVRNSWGTSWGENGYIRMERNVVDNFGGKCGI  344

Query  1047  AMMASYPLK  1073
             AM ASYP+K
Sbjct  345   AMQASYPIK  353



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 214/341 (63%), Gaps = 17/341 (5%)
 Frame = +3

Query  72    KNVCFTIMLLLP--LCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             K + F ++L+     C  T+ S +          M  RY+ W+ ++G+ Y D +E E R+
Sbjct  5     KCIGFGLILMFGAWCCEATSRSLQD-------ASMYGRYEQWMTRYGRIYNDVNEKENRF  57

Query  246   EIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             +I++ NV +IE  N+ +N  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V
Sbjct  58    KIFKENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENV  117

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
             + P  P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC
Sbjct  118   KAP-VPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDC  176

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  + A+ FI++N G++ E NYPY G DG C T    S    I+GY  V
Sbjct  177   DTSGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDV  236

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             P + E  L  A A QPV+  +DA   DF+FYS G+F   C  +L+HGVT VGYG  ++G 
Sbjct  237   PANSEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGT  296

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              +WLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  297   KFWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYP  337



>gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata]
Length=362

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 203/327 (62%), Gaps = 11/327 (3%)
 Frame = +3

Query  129   SFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSY  305
             SF+ HE D +    +   Y+ W + H        E  KR+ +++ NV+++   N M+  Y
Sbjct  22    SFDFHEKDLASEESLWDLYERW-RSHHTVSRSLTEKHKRFNVFKENVMHVHNTNKMDKPY  80

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPEFPESVDWRKSGAV  473
             KL  NKFADMTN E++S Y   K++ HK     +  N T    ++   P SVDWRK GAV
Sbjct  81    KLKLNKFADMTNHEFRSTYAGSKVNHHKMFRGTQHGNGTFMYEKVGSVPASVDWRKKGAV  140

Query  474   THVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAY  644
             T VKDQG CGS WAF  V AVEGINQI+T KLVSLSEQ+LVDC+K    GC GG  E A+
Sbjct  141   TDVKDQGQCGSCWAFSTVVAVEGINQIKTDKLVSLSEQELVDCDKEENQGCNGGLMESAF  200

Query  645   DFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpva  821
             +FIK+ GGIT E NYPY  ++G C+        V+I G+  VP  DE  L  A A QPV+
Sbjct  201   EFIKQKGGITTESNYPYTAQEGTCDASKVNDLAVSIDGHENVPVNDENALLKAVANQPVS  260

Query  822   avvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLVKNSWGTNWGEDGY  998
               +DA   DF+FYSEG+    C   LNHGV +VGYG   +G  YW+V+NSWG  WGE GY
Sbjct  261   VAIDAGGSDFQFYSEGVLTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGY  320

Query  999   IKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             I+MQR    K G CGIAMMASYP+K S
Sbjct  321   IRMQRNISKKEGLCGIAMMASYPIKNS  347



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 208/333 (62%), Gaps = 8/333 (2%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVL  269
             I L L  CL   A F+          M +R++ W+ ++GK Y+D +E EKR+ +++ NV 
Sbjct  10    ISLALFFCLGFLA-FQVASRTLQDASMYERHEQWMARYGKVYKDPEEKEKRFRVFKENVN  68

Query  270   YIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPES  446
             YIE FN + N  YKL  N+FAD+T+ E+     R+        +   T     +   P+S
Sbjct  69    YIEAFNNAANKPYKLGINQFADLTSEEFIVPRNRFNGHTRSSNTRTTTFKYENVTVLPDS  128

Query  447   VDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HG  614
             +DWR+ GAVT +K+QGSCG  WAF A+AA EGI++I TGKLVSLSEQ++VDC+     HG
Sbjct  129   IDWRQKGAVTPIKNQGSCGCCWAFSAIAATEGIHKISTGKLVSLSEQEVVDCDTKGTDHG  188

Query  615   CEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFL  791
             CEGG  + A+ FI +N GI  E +YPY G DG+C    E  H  TI+GY  VP  +E  L
Sbjct  189   CEGGYMDGAFKFIIQNHGINTEASYPYKGVDGKCNIKEEAVHAATITGYEDVPINNEKAL  248

Query  792   qaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-GQPYWLVKNS  968
             Q A A QPV+  +DAS  DF+FY  GIF   C   L+HGVT VGYGE N G  YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDHGVTAVGYGENNEGTKYWLVKNS  308

Query  969   WGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WGT WGE+GYI MQR      G CGIAMMASYP
Sbjct  309   WGTEWGEEGYIMMQRGVKAVEGICGIAMMASYP  341



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score =   288 bits (737),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 213/326 (65%), Gaps = 15/326 (5%)
 Frame = +3

Query  135   EQHEMDSHHVR----MVKRYQDWLQKHGKRYEDK----DEWEKRYEIYQYNVLYIEFFNS  290
             E+H + + + R    + + Y+ W++KHGK+ +      +E ++R+EI++ N+ +I+  N+
Sbjct  30    EKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNLRFIDEHNN  89

Query  291   MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSG  467
              N SYKL   +FAD+TN EY+S+YL  K    K+       +  R+ +  P+SVDWRK G
Sbjct  90    KNLSYKLGLTRFADLTNEEYRSIYLGAK--SKKRVLKTSDRYQPRVGDAIPDSVDWRKEG  147

Query  468   AVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEK  638
             AV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  + 
Sbjct  148   AVAAVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDY  207

Query  639   AYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqp  815
             A++FI +NGGI  E +YPY   DGRC+   + +  VTI  Y  VPE+ E  L+ A A QP
Sbjct  208   AFEFIIKNGGIDTEEDYPYKAADGRCDQTRKNAKVVTIDAYEDVPENNEAALKKALANQP  267

Query  816   vaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDG  995
             ++  ++A    F+ YS G+F+ IC   L+HGV  VGYG ENG+ YW+V+NSWG +WGE G
Sbjct  268   ISVAIEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESG  327

Query  996   YIKMQRRSGDKNGKCGIAMMASYPLK  1073
             YIKM R   +  GKCGIAM ASYP+K
Sbjct  328   YIKMARNIAEPTGKCGIAMEASYPIK  353



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score =   288 bits (737),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 221/355 (62%), Gaps = 19/355 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNA-SFEQHEMDSHHV-------RMVKR-YQDWLQKH  203
             MK F     + F  M+ +   +  +  S+++    SHH          VKR Y+ WL KH
Sbjct  1     MKFFNPTMAILFLTMIAVSSAMDMSIISYDE----SHHTVSGGRSDAEVKRLYETWLVKH  56

Query  204   GKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDE  383
             GK      E ++R+EI++ N+ +I+  N+ N SY+L   KFAD+TN EY+S+YL  K+ +
Sbjct  57    GKVQNSLVEKDRRFEIFKDNLRFIDDHNAKNLSYRLGLTKFADLTNDEYRSIYLGAKM-Q  115

Query  384   HKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIET  560
               +E    T +  R+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I T
Sbjct  116   KNRERRASTRYEARVGDALPESVDWRKEGAVVEVKDQGSCGSCWAFSTIGAVEGINKIVT  175

Query  561   GKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAE  731
             G L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI +E +YPY G DGRC+   +
Sbjct  176   GDLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDSEEDYPYKGVDGRCDQNRK  235

Query  732   ESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHG  908
              +  VTI  Y   P   E  L+ A + QP++  ++     F+ Y  GIF+ +C   L+HG
Sbjct  236   NAKVVTIDSYEDAPTYSEESLKKALSNQPISVAIEGGGRAFQLYDSGIFDGVCGTQLDHG  295

Query  909   VTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             V  VGYG ENG+ YW+V+NSWGT+WGE GYI+M+R   D +GKCGIA+  SYP+K
Sbjct  296   VVAVGYGTENGKDYWIVRNSWGTSWGESGYIRMERNIKDSSGKCGIAIEPSYPIK  350



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 209/336 (62%), Gaps = 11/336 (3%)
 Frame = +3

Query  81    CFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             C  I+L L   L   +S +          M  RY+ W+ ++G+ Y D +E EKR+ I++ 
Sbjct  9     CKCIILALIFMLGALSS-QATSRTLQDASMYGRYEQWMARYGRVYSDINEKEKRFNIFKE  67

Query  261   NVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
             NV +IE  N+  N  +KL  N+FAD+TN E+K+   R+   E   ++ +F    V  P  
Sbjct  68    NVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHECSAKTTSFKYENVTAPP-  126

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---  608
               ++DWRK GAVT VKDQG CG  WAF AVAA+EGI ++ TGKL+SLSEQ+LVDC+    
Sbjct  127   --TLDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGV  184

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-E  782
               GCEGG  + A+ FI +N G++ E NYPY G DG C T  E +H   I+G+  VP + E
Sbjct  185   DQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSE  244

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLV  959
               L  A A QP++  +DA   DF+FYS G+F   C  +L+HGVT VGYG   +G  YWLV
Sbjct  245   EALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLV  304

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  305   KNSWGTEWGEEGYIRMQRGIKAKEGLCGIAMEASYP  340



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 160/343 (47%), Positives = 215/343 (63%), Gaps = 17/343 (5%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPL--CLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             + K + F ++L+     C  T+ S +          M  +Y+ W+ ++G+ Y D +E E 
Sbjct  3     LWKCIGFGLILMFGAWSCEATSRSLQD-------ASMYGKYEQWMTRYGRVYNDVNEKEN  55

Query  240   RYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLH  416
             R++I++ NV +IE  N+ +N  YKL  N+FAD+TN E+K+    +K  E   ++ +F   
Sbjct  56    RFKIFKENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYE  115

Query  417   GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
              V+ P  P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LV
Sbjct  116   NVKAP-VPAAMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELV  174

Query  597   DCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             DC+      GCEGG  + A+ FI++N G++ E NYPY G DG C T    S    I+GY 
Sbjct  175   DCDTSGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYE  234

Query  765   KVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EEN  938
              VP + E  L  A A QPV+  +DA   DF+FYS G+F   C  +L+HGVT VGYG  ++
Sbjct  235   DVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDD  294

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             G  YWLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  295   GTKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCGIAMEASYP  337



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score =   288 bits (737),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 212/326 (65%), Gaps = 15/326 (5%)
 Frame = +3

Query  135   EQHEMDSHHVR----MVKRYQDWLQKHGKRYEDK----DEWEKRYEIYQYNVLYIEFFNS  290
             E+H + + + R    + + Y+ W++KHGK+ +      +E ++R+EI++ N+ +I+  N+
Sbjct  30    EKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNLRFIDEHNN  89

Query  291   MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSG  467
              N SYKL   +FAD+TN EY+S+YL  K    K+       +  R+ +  P+SVDWRK G
Sbjct  90    KNLSYKLGLTRFADLTNEEYRSIYLGAK--SKKRVLKTSDRYQPRVGDAIPDSVDWRKEG  147

Query  468   AVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEK  638
             AV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  + 
Sbjct  148   AVAAVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDY  207

Query  639   AYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqp  815
             A++FI +NGGI  E +YPY   DGRC+   + +  VTI  Y  VPE+ E  L+   A QP
Sbjct  208   AFEFIIKNGGIDTEEDYPYKAADGRCDQTRKNAKVVTIDAYEDVPENNEAALKKTLANQP  267

Query  816   vaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDG  995
             ++  ++A    F+ YS G+F+ IC   L+HGV  VGYG ENG+ YW+V+NSWG +WGE G
Sbjct  268   ISVAIEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESG  327

Query  996   YIKMQRRSGDKNGKCGIAMMASYPLK  1073
             YIKM R   +  GKCGIAM ASYP+K
Sbjct  328   YIKMARNIAEPTGKCGIAMEASYPIK  353



>ref|XP_006494485.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=372

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 204/311 (66%), Gaps = 13/311 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             YQ WL KHGK        EKR++I++ N+ +I+  NS+N +YK+  NKFAD+TN EY+++
Sbjct  52    YQTWLAKHGKTSNGMGHNEKRFQIFKDNLRFIDEHNSLNRTYKVGLNKFADLTNEEYRAM  111

Query  360   YLRYKIDEHKK------ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
             YL  + D  ++       S  +        E PESVDWR+ GAV  VKDQGSCGS WAF 
Sbjct  112   YLGTRSDAKRRLMKSKVASQRYACKAG--DELPESVDWREKGAVNPVKDQGSCGSCWAFS  169

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDC---NKHGCEGGNTEKAYDFIKRNGGITAEHNYP  692
              VAAVEGIN+I TG+L+SLSEQ+LVDC   N  GC GG  + A+ FI +NGG+ +E +YP
Sbjct  170   TVAAVEGINKIVTGELISLSEQELVDCDRKNNAGCNGGLMDYAFQFIIQNGGMDSEQDYP  229

Query  693   YVGKDGRCETIAEESHTVTISGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y+G + +C+     +  V+I GY  V P DE  L+ A A QPV+  ++A    F+ Y  G
Sbjct  230   YLGAENKCDPSRRNAKVVSIDGYEDVSPFDEMSLKKAVAHQPVSVAIEAGGRAFQHYESG  289

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGI  1046
             +F   C   L+HGV  VGYG ENG  YWLV+NSWG++WGE+GY+K+QR   D N GKCGI
Sbjct  290   VFTGECGSALDHGVVAVGYGTENGVDYWLVRNSWGSDWGENGYVKLQRNLLDTNTGKCGI  349

Query  1047  AMMASYPLKGS  1079
             AM ASYP+K S
Sbjct  350   AMEASYPVKNS  360



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 216/344 (63%), Gaps = 11/344 (3%)
 Frame = +3

Query  57    VFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWE  236
             + L L  +C  + L++ L   ++ +  +   D+    M  R++ W+ ++G+ Y D +E E
Sbjct  4     INLQLCKLCTCLALIIMLGAWSSKATSRSLQDAS---MYGRHEQWMVRYGRVYTDNEEKE  60

Query  237   KRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTL  413
             KR++I++ NV YIE  N+  +  YKL  N+F D+TN E+ +   R+K  E   ++ +F  
Sbjct  61    KRFKIFKENVAYIESSNADSSKPYKLRVNQFTDLTNEEFIASRNRFKGHECSTKTTSFKY  120

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
               V     P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKLVSLSEQ+L
Sbjct  121   ENV-TASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQEL  179

Query  594   VDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             VDC+      GCEGG  + A+ FI++N G++ E NYPY G DG C T  E +    I+ +
Sbjct  180   VDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITDH  239

Query  762   TKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EE  935
               VP  DE  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  +
Sbjct  240   EDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSD  299

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             +G  YWLVKNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  300   DGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYP  343



>ref|XP_003607647.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89844.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   284 bits (726),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/306 (52%), Positives = 198/306 (65%), Gaps = 9/306 (3%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNS  344
             + +R++ W+ ++GK Y+D  E EKR+ I++ NV +IE FN+  N  YKL  N  AD+T  
Sbjct  36    LQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNHLADLTLD  95

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E+K+    YK  + +  + +F    V     PE+VDWR  GAVT +KDQG CGS WAF  
Sbjct  96    EFKASRNGYKKIDREFATTSFKYENVTA--IPEAVDWRVKGAVTPIKDQGQCGSCWAFST  153

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYP  692
             VAA+EGINQI TGKL+SLSEQ+LVDC+      GCEGG  E  ++FI +NGGIT+E NYP
Sbjct  154   VAAIEGINQITTGKLISLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGITSETNYP  213

Query  693   YVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y   DG C T A  +    I+GY KVP   E  L  A A QP++  +DAS   F FYS G
Sbjct  214   YKAADGSCNT-ATTAPVAKITGYEKVPVNSEISLLKAVANQPISVSIDASDSSFMFYSSG  272

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             I+   C   L+HGVT VGYG  NG  YW+VKNSWGT WGE GYI+MQR   DK G CGIA
Sbjct  273   IYTGECGTELDHGVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQRGIADKEGLCGIA  332

Query  1050  MMASYP  1067
             M +SYP
Sbjct  333   MDSSYP  338



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score =   288 bits (737),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 205/307 (67%), Gaps = 5/307 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             ++  Y++WL KHGK Y    E EKR+EI++ N+++I+  NS N +Y +  N+FAD+TN E
Sbjct  47    VMAMYEEWLVKHGKNYNALGEKEKRFEIFKDNLMFIDQHNSENRTYTVGLNRFADLTNEE  106

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             ++S+YL  +    K+       +  R+ +  P+SVDWRK GAV  VKDQG CGS WAF  
Sbjct  107   FRSMYLGTRTGHKKRLPKTSDRYAPRVGDSLPDSVDWRKEGAVAEVKDQGGCGSCWAFST  166

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             +AAVEGIN+I TG L++LSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YPY
Sbjct  167   IAAVEGINKIVTGDLIALSEQELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDTEDDYPY  226

Query  696   VGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGI  872
             +G+DGRC+T  + +  V+I  Y  VPE DE  L+ A A QPV+  ++    +F+ Y+ G+
Sbjct  227   LGRDGRCDTYRKNAKVVSIDSYEDVPENDETALKKAVANQPVSVAIEGGGRNFQLYNSGV  286

Query  873   FNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
             F   C  +L+HGV  VGYG E G+ YW+V+NSWG +WGE GYI+M+R      GKCGIA+
Sbjct  287   FTGECGTSLDHGVAAVGYGTEKGKDYWIVRNSWGKSWGESGYIRMERNIASPTGKCGIAI  346

Query  1053  MASYPLK  1073
               SYP+K
Sbjct  347   EPSYPIK  353



>gb|KDO79088.1| hypothetical protein CISIN_1g017419mg [Citrus sinensis]
Length=372

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 205/311 (66%), Gaps = 13/311 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             YQ WL KHGK        EKR++I++ N+ +I+  NS+N +YK+  NKFAD+TN EY+++
Sbjct  52    YQTWLAKHGKTSNGMGHNEKRFQIFKDNLRFIDEHNSLNRTYKVGLNKFADLTNEEYRAM  111

Query  360   YLRYKIDEHKK------ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
             YL  + D  ++       S  +        E PESVDWR+ GAV  VKDQGSCGS WAF 
Sbjct  112   YLGTRSDAKRRLMKSKVASQRYACKAG--DELPESVDWREKGAVNPVKDQGSCGSCWAFS  169

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYP  692
              VAAVEGIN+I TG+L+SLSEQ+LVDC++    GC GG  + A+ FI +NGG+ +E +YP
Sbjct  170   TVAAVEGINKIVTGELISLSEQELVDCDRKINAGCNGGLMDYAFQFIIQNGGMDSEQDYP  229

Query  693   YVGKDGRCETIAEESHTVTISGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y+G + +C+     +  V+I GY  V P DE  L+ A A QPV+  ++A    F+ Y  G
Sbjct  230   YLGAENKCDPSRRNAKVVSIDGYEDVSPFDEMSLKKAVADQPVSVAIEAGGRAFQHYESG  289

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGI  1046
             +F   C   L+HGV  VGYG ENG  YWLV+NSWG++WGE+GY+K+QR   D N GKCGI
Sbjct  290   VFTGECGSALDHGVVAVGYGTENGVDYWLVRNSWGSDWGENGYVKLQRNLLDTNTGKCGI  349

Query  1047  AMMASYPLKGS  1079
             AM ASYP+K S
Sbjct  350   AMEASYPVKNS  360



>gb|KDP30997.1| hypothetical protein JCGZ_11373 [Jatropha curcas]
Length=360

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 221/353 (63%), Gaps = 18/353 (5%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKD  227
             MK FL+   V F+++L+L +      SF+ HE D +    +   Y+ W + H        
Sbjct  1     MKSFLL---VAFSLVLILGIV----ESFDFHEKDLASDESLWGLYERW-RSHHTVSTSLH  52

Query  228   EWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KE  395
             E  +R+ ++++NV+++   N ++  YKL  NKFAD+T+ E+++ Y   KI  H+      
Sbjct  53    EKHRRFNVFKHNVMHVHNTNKLDKPYKLKLNKFADLTSHEFRNSYAGSKIKHHRMFRGTP  112

Query  396   SHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
               N +     +   P SVDWRK GAVT VKDQG CG+ WAF  V AVEGINQI+T KLVS
Sbjct  113   EGNVSFMYENVDRVPPSVDWRKKGAVTGVKDQGQCGNCWAFSTVVAVEGINQIKTNKLVS  172

Query  576   LSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC+     GC+GG  + A++FIK+ GG+T E NYPY  +DG C++  E S  V
Sbjct  173   LSEQELVDCDTEQDQGCDGGLMDYAFEFIKQKGGLTTEANYPYEAEDGTCDSKKENSPAV  232

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             +I GY KVPE DE  L  A A QPV+  +DA   DF+FYSEG+F   C   L+HGV +VG
Sbjct  233   SIDGYEKVPENDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGSCGTELDHGVAIVG  292

Query  924   YGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             YG   +G  YW+VKNSWG  WGE GYI+M+R   +K G CGIAM ASYP+K S
Sbjct  293   YGTTLDGTKYWIVKNSWGEEWGEKGYIRMKRGISEKEGLCGIAMEASYPIKNS  345



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 207/337 (61%), Gaps = 14/337 (4%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             +C  ++  L        +    E       M +R++DW+ ++G+ Y+D DE  KRY+I++
Sbjct  10    ICLALLFFLAAWASQATARNLLE-----ASMYERHEDWMAQYGRVYKDADEKSKRYKIFK  64

Query  258   YNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE  434
              NV  IE FN +M+ SYKL  N+FAD+TN E+++   R+K      E+ +F    V    
Sbjct  65    DNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYEHV--AA  122

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P +VDWRK GAVT +KDQG CGS WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+   
Sbjct  123   VPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSG  182

Query  609   --HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-D  779
                GC GG  + A+ FI++N G+  E NYPY G DG C           I+GY  VP  +
Sbjct  183   EDQGCNGGLMDDAFKFIEQNHGLATEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANN  242

Query  780   EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWL  956
             E  LQ A A QP+A  +DA   +F+FYS G+F   C   L+HGV  VGYG  ++G  YWL
Sbjct  243   EKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYWL  302

Query  957   VKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             VKNSWGT WGE GYI+MQR    K G CGIAM ASYP
Sbjct  303   VKNSWGTGWGEVGYIRMQRDVTAKEGLCGIAMQASYP  339



>ref|XP_003638507.1| Cysteine proteinase [Medicago truncatula]
 gb|KEH35007.1| KDEL-tailed cysteine endopeptidase CEP1 [Medicago truncatula]
Length=362

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 211/342 (62%), Gaps = 11/342 (3%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
               I+L + L L  + SF+ H+ D S    +   Y+ W + H     + +E +KR+ +++ 
Sbjct  7     LLIVLSIALVLVVSESFDFHDKDVSSDESLWDLYERW-RSHHTVSRNLNEKQKRFNVFKS  65

Query  261   NVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE--  434
             NV+++   N M+  YKL  NKFADMTN E+K+ Y   K++ H+       + G  + E  
Sbjct  66    NVMHVHNTNKMDKPYKLKLNKFADMTNHEFKTTYAGSKVNHHRMFRGTPRVSGTFMYENF  125

Query  435   --FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN-  605
                P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T +LV LSEQ+L+DC+ 
Sbjct  126   TKAPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNRLVPLSEQELIDCDN  185

Query  606   --KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-E  776
                 GC GG  E A+++IK+ GGIT E  YPY   DG C+   E    V+I G+  VP  
Sbjct  186   QENQGCNGGLMEYAFEYIKQKGGITTESYYPYTANDGSCDATKENVPAVSIDGHETVPAN  245

Query  777   DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYW  953
             DE  L  A A QPV+  +DA   DF+FYSEG+F   C + LNHGV +VGYG   +G  YW
Sbjct  246   DEDALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCGKELNHGVAIVGYGTTVDGTNYW  305

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +V+NSWG  WGE GYI+M+R   +K G CGIAM ASYP+K S
Sbjct  306   IVRNSWGAEWGEQGYIRMKRNVSNKEGLCGIAMEASYPVKNS  347



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 156/354 (44%), Positives = 223/354 (63%), Gaps = 13/354 (4%)
 Frame = +3

Query  42    KSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR----MVKRYQDWLQKHGK  209
             +S+M   LI   V FT++ +      +  S+++   D    +    ++  Y++WL KHGK
Sbjct  5     RSLMATILI---VLFTVLAVSSALDMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGK  61

Query  210   RYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK  389
              Y   +E EKR++I++ N+ +IE  N++N +YK+  N+F+D++N EY+S YL  KID  +
Sbjct  62    VYNAVEEKEKRFQIFKDNLNFIEEHNAVNRTYKVGLNRFSDLSNEEYRSKYLGTKIDPSR  121

Query  390   KESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGK  566
               +     +  R+ +  PESVDWRK GAV  VK+Q  C   WAF A+AAVEGIN+I TG 
Sbjct  122   MMARPSRRYSPRVADNLPESVDWRKEGAVVRVKNQSECEGCWAFSAIAAVEGINKIVTGN  181

Query  567   LVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEES  737
             L +LSEQ+L+DC++    GC GG  + A++FI  NGGI  E +YP+ G DG C+     +
Sbjct  182   LTALSEQELLDCDRTVNAGCSGGLVDYAFEFIINNGGIDTEEDYPFQGADGICDQYKINA  241

Query  738   HTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVT  914
               VTI GY +VP  DE  L+ A A QPV+  ++A   +F+ Y  GIF   C  +++HGVT
Sbjct  242   RAVTIDGYERVPAYDELALKKAVANQPVSVAIEAYGKEFQLYESGIFTGTCGTSIDHGVT  301

Query  915   VVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
              VGYG ENG  YW+VKNSWG NWGE GY+ M+R  + D  GKCGIA++  YP+K
Sbjct  302   AVGYGTENGIDYWIVKNSWGENWGEAGYVGMERNIAEDTAGKCGIAILTLYPIK  355



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 203/307 (66%), Gaps = 5/307 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSE  347
             ++  Y++WL KHGK Y    E EKR+EI++ N+++I+  NS N +YK+  N+FAD+TN E
Sbjct  47    VMAMYEEWLVKHGKNYNALGEKEKRFEIFKDNLMFIDQHNSENRTYKVGLNRFADLTNEE  106

Query  348   YKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             Y+S+YL  +    K+       +  R+ +  P+SVDWRK GAV  VKDQG CGS WAF  
Sbjct  107   YRSMYLGTRTGHKKRLPKTSDRYAPRVGDSLPDSVDWRKEGAVAEVKDQGGCGSCWAFST  166

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             +AAVEGIN+I TG L+ LSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YPY
Sbjct  167   IAAVEGINKIVTGDLIVLSEQELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDTEDDYPY  226

Query  696   VGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGI  872
             +G+DGRC+T  + +  V+I  Y  VP  DE  L+ A A QPV+  ++    +F+ Y  G+
Sbjct  227   LGRDGRCDTYRKNAKVVSIDSYEDVPVNDETALKKAVANQPVSVAIEGGGRNFQLYDSGV  286

Query  873   FNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
             F   C  +L+HGV  VGYG E G+ YW+V+NSWG +WGE GYI+M+R      GKCGIA+
Sbjct  287   FTGECGTSLDHGVAAVGYGTEKGKDYWIVRNSWGKSWGESGYIRMERNIASPTGKCGIAI  346

Query  1053  MASYPLK  1073
               SYP+K
Sbjct  347   EPSYPIK  353



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 213/326 (65%), Gaps = 15/326 (5%)
 Frame = +3

Query  135   EQHEMDSHHVR----MVKRYQDWLQKHGKRYEDK----DEWEKRYEIYQYNVLYIEFFNS  290
             E+H + + + R    + + Y+ W++KHGK+ +      +E ++R+EI++ N+ +I+  N+
Sbjct  30    EKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNLRFIDEHNN  89

Query  291   MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSG  467
              N SYKL   +FAD+TN EY+S+YL  K    K+       +  R+ +  P+SVDWRK G
Sbjct  90    KNLSYKLGLTRFADLTNEEYRSIYLGAK--PKKRVLKTSDRYQPRVGDAIPDSVDWRKEG  147

Query  468   AVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEK  638
             AV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  + 
Sbjct  148   AVAAVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDY  207

Query  639   AYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqp  815
             A++FI +NGGI  E +YPY   DGRC+   + +  VTI  Y  VPE+ E  L+ A A QP
Sbjct  208   AFEFIIKNGGIDTEEDYPYKAADGRCDQTRKNAKVVTIDAYEDVPENNEAALKKALANQP  267

Query  816   vaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDG  995
             ++  ++A    F+ YS G+F+ IC   L+HGV  VGYG ENG+ YW+V+NSWG +WGE G
Sbjct  268   ISVAIEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESG  327

Query  996   YIKMQRRSGDKNGKCGIAMMASYPLK  1073
             YIKM R   +  GKCGIAM ASYP+K
Sbjct  328   YIKMARNIAEPTGKCGIAMEASYPIK  353



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score =   288 bits (736),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 210/328 (64%), Gaps = 17/328 (5%)
 Frame = +3

Query  135   EQH-EMDSHHVRMVKR----YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNF  299
             EQH +M + H R        Y+ WL KHGK Y    E E+R+EI+  N+ +I+  N+ N 
Sbjct  30    EQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIGEKERRFEIFNDNLRFIDEHNAENR  89

Query  300   SYKLIDNKFADMTNSEYKSVYLRYKIDEHKK-----ESHNFTLHGVRLPEFPESVDWRKS  464
              YKL  N+F+D+TN EY+++++  ++D   +     +S+ +        + PESVDWR+ 
Sbjct  90    PYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKSPKSNRYAFQAGE--KLPESVDWREK  147

Query  465   GAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTE  635
             GAV  VKDQG CGS WAF  V AVEGIN+I TG+L+SLSEQ+LVDC++    GC GG  +
Sbjct  148   GAVAPVKDQGQCGSCWAFSTVGAVEGINKIVTGELISLSEQELVDCDRSYNQGCNGGLMD  207

Query  636   KAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqq  812
              A+DFIK NGGI  E +YPY  +DG C+   + +  V+I GY  VPE DE  L  A A Q
Sbjct  208   YAFDFIKNNGGIDTEDDYPYHAQDGTCDPYRKNARVVSIEGYEDVPENDEKSLMKAVANQ  267

Query  813   pvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGED  992
             PV+  ++     F+ YS G+F   C   L+HGV VVGYG ENG+ YW+V+NSWG NWGE 
Sbjct  268   PVSVAIEGGGRAFQHYSSGVFTGYCGTQLDHGVVVVGYGTENGEDYWIVRNSWGANWGES  327

Query  993   GYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             GYIK+QR  +    GKCGIAM ASYPLK
Sbjct  328   GYIKLQRNFANSTTGKCGIAMQASYPLK  355



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score =   288 bits (736),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 213/326 (65%), Gaps = 15/326 (5%)
 Frame = +3

Query  135   EQHEMDSHHVR----MVKRYQDWLQKHGKRYEDK----DEWEKRYEIYQYNVLYIEFFNS  290
             E+H + + + R    + + Y+ W++KHGK+ +      +E ++R+EI++ N+ +I+  N+
Sbjct  30    EKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNLRFIDEHNN  89

Query  291   MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE-FPESVDWRKSG  467
              N SYKL   +FAD+TN EY+S+YL  K    K+       +  R+ +  P+SVDWRK G
Sbjct  90    KNLSYKLGLTRFADLTNEEYRSIYLGAK--PKKRVLKTSDRYQPRVGDAIPDSVDWRKEG  147

Query  468   AVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEK  638
             AV  VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  + 
Sbjct  148   AVAAVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDY  207

Query  639   AYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqp  815
             A++FI +NGGI  E +YPY   DGRC+   + +  VTI  Y  VPE+ E  L+ A A QP
Sbjct  208   AFEFIIKNGGIDTEEDYPYKAADGRCDQTRKNAKVVTIDAYEDVPENNEAALKKALANQP  267

Query  816   vaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDG  995
             ++  ++A    F+ YS G+F+ IC   L+HGV  VGYG ENG+ YW+V+NSWG +WGE G
Sbjct  268   ISVAIEAGGRAFQLYSSGVFDGICGTELDHGVVAVGYGTENGKDYWIVRNSWGGSWGESG  327

Query  996   YIKMQRRSGDKNGKCGIAMMASYPLK  1073
             YIKM R   +  GKCGIAM ASYP+K
Sbjct  328   YIKMARNIAEPTGKCGIAMEASYPIK  353



>ref|XP_004234718.1| PREDICTED: cysteine proteinase COT44-like [Solanum lycopersicum]
Length=379

 Score =   285 bits (729),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 207/315 (66%), Gaps = 14/315 (4%)
 Frame = +3

Query  171   VKR-YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIE-FFNSMNFSYKLIDNKFADMTNS  344
             VKR Y+ WL +HGK Y    E  KR+EI++ N+ +IE   NS N +Y L  N+FAD+TN 
Sbjct  38    VKRIYEIWLAEHGKIYNGLGEQGKRFEIFKDNLRFIEEHNNSKNQTYVLGLNRFADLTNE  97

Query  345   EYKSVYL------RYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGS  506
             EY++++L      R ++ E K  SH++          P+SVDWRK GAV  +KDQG+CGS
Sbjct  98    EYRTIFLGTKSDARRRLVESKNASHHYDFRAS--DSVPKSVDWRKKGAVAPIKDQGTCGS  155

Query  507   SWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITA  677
              WAF  VAAVEGINQI TG++++LSEQ+L+DC++    GC GG  + A+ FI  NGGI  
Sbjct  156   CWAFSTVAAVEGINQIATGEMITLSEQELIDCDRMYNDGCNGGLMDYAFQFIISNGGINT  215

Query  678   EHNYPYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRF  857
             E +YPY G D  C+ + + +  V+I  Y  V  +E  L+ A A QP++  ++AS   F+ 
Sbjct  216   ESHYPYNGIDHICDLVQKNAKVVSIDDYEVVAANEKALKKAVAHQPISVAIEASGRAFQL  275

Query  858   YSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-G  1034
             YS GIF   C   L+HGV VVGYG ENG  YW+V+NSWGTNWGEDGYIKM+R   D N G
Sbjct  276   YSSGIFTGNCGTQLDHGVVVVGYGTENGVDYWIVRNSWGTNWGEDGYIKMERNIEDTNSG  335

Query  1035  KCGIAMMASYPLKGS  1079
             KCGIAM  SYP+K +
Sbjct  336   KCGIAMEGSYPIKNA  350



>ref|NP_001148706.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG32602.1| cysteine protease 1 precursor [Zea mays]
Length=463

 Score =   288 bits (736),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 198/308 (64%), Gaps = 8/308 (3%)
 Frame = +3

Query  174   KRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMN----FSYKLIDNKFADMTN  341
             + Y +W+  HG+ Y    E E+RY++++ N+ YI+  N+       S++L  N+FAD+TN
Sbjct  39    RMYAEWMAAHGRTYNAVGEEERRYQVFRDNLRYIDAHNAAADAGVHSFRLGLNRFADLTN  98

Query  342   SEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
              EY++ YL  +    ++       H     + PESVDWR  GAV  VKDQGSCGS WAF 
Sbjct  99    DEYRATYLGARTRPQRERKLGARYHAADNEDLPESVDWRAKGAVAEVKDQGSCGSCWAFS  158

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYP  692
              +AAVEGINQI TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YP
Sbjct  159   TIAAVEGINQIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIINNGGIDTEKDYP  218

Query  693   YVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y G DGRC+   + +  VTI  Y  VP  DE  LQ A A QPV+  ++A+   F+ YS G
Sbjct  219   YKGTDGRCDVNRKNAKVVTIDSYEDVPANDEKSLQKAVANQPVSVAIEAAGTAFQLYSSG  278

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             IF   C   L+HGVT VGYG ENG+ YW+VKNSWG++WGE GY++M+R     +GKCGIA
Sbjct  279   IFTGSCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIA  338

Query  1050  MMASYPLK  1073
             +  SYPLK
Sbjct  339   VEPSYPLK  346



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score =   288 bits (736),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 210/307 (68%), Gaps = 12/307 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y++WL+K+GK Y    E E+R++I++ N+ +I+  NS N +YK+  N+FAD++N EY+S+
Sbjct  51    YEEWLEKNGKAYNALGEKERRFQIFKDNLRFIDEHNSENRAYKVALNRFADISNEEYRSL  110

Query  360   YLRYKI----DEHKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             YL  +     ++ +K S  +T    R+ E  P+SVDWRK GAV  VKDQGSCGS WAF  
Sbjct  111   YLGAQAGVRRNKLRKSSDRYT---PRVGESLPDSVDWRKEGAVAEVKDQGSCGSCWAFST  167

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPY  695
             ++AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  +  + FI  NGGI  E +YPY
Sbjct  168   ISAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYGFQFIINNGGIDTEEDYPY  227

Query  696   VGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGI  872
             + +DGRC+T  + +  VTI  Y  VP  +E  L+ A A QPV+  ++A   +F+FYS GI
Sbjct  228   LARDGRCDTYRKNAKVVTIDDYEDVPVNNEEALKKAVANQPVSIAIEAGGREFQFYSSGI  287

Query  873   FNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
             F   C  +L+HGV  VGYG ENG+ +W+V+NSWG +WGEDGY++M+R      GKCGIAM
Sbjct  288   FTGKCGTSLDHGVVAVGYGTENGKDFWIVRNSWGKSWGEDGYLRMERNIQSPTGKCGIAM  347

Query  1053  MASYPLK  1073
              ASYP+K
Sbjct  348   EASYPIK  354



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   283 bits (725),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 210/336 (63%), Gaps = 13/336 (4%)
 Frame = +3

Query  81    CFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             C  + L+  L   ++ +  +   D+    M  RY+ W+  +G+ Y D +E EKR+ I++ 
Sbjct  11    CIILALIFMLGALSSQATSRTLQDA---SMYGRYEQWMAHYGRVYSDINEKEKRFNIFKE  67

Query  261   NVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
             NV +IE  N+  N  +KL  N+FAD+TN E+K+   R+   E   ++ +F    V  P  
Sbjct  68    NVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHECSAKTTSFKYENVTAPP-  126

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---  608
               +VDWRK GAVT VKDQG CG  WAF AVAA+EGI ++ TGKL+SLSEQ+LVDC+    
Sbjct  127   --TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGV  184

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-E  782
               GCEGG  + A+ FI +N G++ E NYPY G DG C T  E +H   I+G+  VP + E
Sbjct  185   DQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSE  244

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLV  959
               L  A A QP++  +DA   DF+FYS G+F   C  +L+HGVT VGYG   +G  YWLV
Sbjct  245   EALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLV  304

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWGT WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  305   KNSWGTEWGEEGYIRMQRGIKAKEGLCGIAMEASYP  340



>emb|CDY63586.1| BnaCnng42340D [Brassica napus]
Length=459

 Score =   287 bits (735),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 213/350 (61%), Gaps = 17/350 (5%)
 Frame = +3

Query  69    LKNVCFTIMLLLPLCLHTNASFEQHEMDSHH----------VRMVKRYQDWLQKHGKRYE  218
             L N    I+L   + + +         D +H            + K Y++WL KHGK   
Sbjct  3     LLNTALVILLQTMIAVSSAIDMSIISYDKNHHTISAGSRSDAEVYKLYEEWLVKHGKVQN  62

Query  219   DKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKES  398
                E ++R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+Y+  ++   +K +
Sbjct  63    SLTEKDRRFEIFKDNLRFIDDHNGKNLSYRLGLTKFADLTNDEYRSMYVGSRL--KRKST  120

Query  399   HNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
                  +  R+ +  PESVDWRK GAV  VKDQGSCGS WAF A+ AVEGIN+I TG L+S
Sbjct  121   RTSLRYEARVGDALPESVDWRKEGAVAEVKDQGSCGSCWAFSAIGAVEGINKIVTGDLIS  180

Query  576   LSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YPY G DGRC+   + +  V
Sbjct  181   LSEQELVDCDTSYNEGCNGGLMDYAFEFIMNNGGIDTEEDYPYKGVDGRCDQTRKNAKVV  240

Query  747   TISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             TI  Y  VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VG
Sbjct  241   TIDSYEDVPANSEESLKKALSNQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVLAVG  300

Query  924   YGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             YG ENG+ YW+VKNSWG++WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  301   YGTENGKDYWIVKNSWGSSWGESGYIRMERNIAASAGKCGIAVEPSYPIK  350



>ref|XP_006376886.1| hypothetical protein POPTR_0012s09270g [Populus trichocarpa]
 gb|ERP54683.1| hypothetical protein POPTR_0012s09270g [Populus trichocarpa]
Length=363

 Score =   284 bits (727),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 207/343 (60%), Gaps = 12/343 (3%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
               + L L L L    S + H  D      +   Y+ W + H       DE  KR+ +++ 
Sbjct  7     LPVALSLALVLGITESLDFHGKDLESEESLWDLYERW-RSHHTVSTSLDEKHKRFNVFKE  65

Query  261   NVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK-----KESHNFTLHGVR  425
             NV+++   N M+  YKL  NKFADMTN E++SVY   K+  HK         N +    +
Sbjct  66    NVIHVHKTNKMDKPYKLKLNKFADMTNHEFRSVYAGSKVKRHKMFCGTTPRGNGSFMYEK  125

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
             + E P SVDWRK GAVT VKDQG CGS WAF  + AVEGIN I+T KLVSLSEQ+LVDC+
Sbjct  126   VDEVPSSVDWRKKGAVTAVKDQGQCGSCWAFSTIVAVEGINYIKTNKLVSLSEQELVDCD  185

Query  606   ---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GC GG  E A++FIK+ GG+T E  YPY  +DG C+        V+I GY KVPE
Sbjct  186   TTENQGCNGGLMEYAFEFIKKKGGVTTESTYPYQAEDGTCDVEKVNKPVVSIDGYEKVPE  245

Query  777   -DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPY  950
              DE  L  AAA QP++  +DA   DF+FYSEG+F   C   L+HGV +VGYG   +G  Y
Sbjct  246   NDEDALLKAAANQPISVAIDAGGSDFQFYSEGVFTGKCGTELDHGVAIVGYGTTLDGTKY  305

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             W+V+NSWG  WGE GYI+MQR   DK G CGIAM AS+P+K S
Sbjct  306   WVVRNSWGPEWGEKGYIRMQRGISDKEGLCGIAMEASFPIKNS  348



>tpg|DAA35682.1| TPA: cysteine proteinase Mir3 [Zea mays]
Length=468

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 198/308 (64%), Gaps = 8/308 (3%)
 Frame = +3

Query  174   KRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMN----FSYKLIDNKFADMTN  341
             + Y +W+  HG+ Y    E E+RY++++ N+ YI+  N+       S++L  N+FAD+TN
Sbjct  44    RMYAEWMAAHGRTYNAVGEEERRYQVFRDNLRYIDAHNAAADAGVHSFRLGLNRFADLTN  103

Query  342   SEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
              EY++ YL  +    ++       H     + PESVDWR  GAV  VKDQGSCGS WAF 
Sbjct  104   DEYRATYLGARTRPQRERKLGARYHAADNEDLPESVDWRAKGAVAEVKDQGSCGSCWAFS  163

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYP  692
              +AAVEGINQI TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YP
Sbjct  164   TIAAVEGINQIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIINNGGIDTEKDYP  223

Query  693   YVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y G DGRC+   + +  VTI  Y  VP  DE  LQ A A QPV+  ++A+   F+ YS G
Sbjct  224   YKGTDGRCDVNRKNAKVVTIDSYEDVPANDEKSLQKAVANQPVSVAIEAAGTAFQLYSSG  283

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             IF   C   L+HGVT VGYG ENG+ YW+VKNSWG++WGE GY++M+R     +GKCGIA
Sbjct  284   IFTGSCGTALDHGVTAVGYGTENGKDYWIVKNSWGSSWGESGYVRMERNIKASSGKCGIA  343

Query  1050  MMASYPLK  1073
             +  SYPLK
Sbjct  344   VEPSYPLK  351



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  87    TIMLLLPLCLHTNA------SFEQ--HEMDSHHVRMVKR-YQDWLQKHGKRYEDKDEWEK  239
             T++L L + + ++A      S+++  H + S     V R Y++WL KHGK      E ++
Sbjct  8     TVILFLTMIVVSSAMDMSIISYDKNHHTVSSRSDAEVSRLYEEWLVKHGKAQNSLTEKDR  67

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             R+EI++ N+ +I+  N  N SY+L   KFAD+TN EY+S+YL  ++   +K + +   + 
Sbjct  68    RFEIFKDNLRFIDEHNGKNLSYRLGLTKFADLTNDEYRSMYLGSRL--KRKATKSSLRYE  125

Query  420   VRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
             VR+ +  PESVDWRK GAV  VKDQGSCGS WAF  + AVEGIN+I TG L++LSEQ+LV
Sbjct  126   VRVGDAIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAVEGINKIVTGDLITLSEQELV  185

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  + A++FI  NGGI  E +YPY G DGRC+   + +  VTI  Y  
Sbjct  186   DCDTSYNEGCNGGLMDYAFEFIINNGGIDTEEDYPYKGVDGRCDQTRKNAKVVTIDLYED  245

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQ  944
             VP + E  L+ A + QP++  ++     F+ Y  GIF+ IC   L+HGV  VGYG ENG+
Sbjct  246   VPANSEESLKKALSHQPISVAIEGGGRAFQLYDSGIFDGICGTDLDHGVVAVGYGTENGK  305

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              YW+VKNSWGT+WGE GYI+M+R      GKCGIA+  SYP+K
Sbjct  306   DYWIVKNSWGTSWGESGYIRMERNIASSAGKCGIAVEPSYPIK  348



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/343 (47%), Positives = 209/343 (61%), Gaps = 14/343 (4%)
 Frame = +3

Query  60    FLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
              L  K +C +++L+L        S    +      RM  RY+ WL ++G+ Y D +E E 
Sbjct  6     LLPWKYMCLSLILMLGAWSSGATSRTLQD-----ARMYGRYEQWLTRYGRIYNDVNEKET  60

Query  240   RYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLH  416
             R++I++ NV +IE  N   N  Y+L  N+FAD+TN E+K+    +K  E   ++ +F   
Sbjct  61    RFKIFKENVAFIESSNKDANKPYRLSVNQFADLTNEEFKTSRNGFKGHECSTKT-SFKYE  119

Query  417   GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
              +     P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LV
Sbjct  120   NL-TASLPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELV  178

Query  597   DCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             DC+      GCEGG  + A+ FI++N GI+ E NYPY G DG C    E S    I+G+ 
Sbjct  179   DCDTAGEDQGCEGGLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFE  238

Query  765   KVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EEN  938
              VP + E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+
Sbjct  239   DVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSED  298

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             G  YWLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  299   GTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYP  341



>ref|NP_001237379.1| cysteine proteinase precursor [Glycine max]
 dbj|BAC77521.1| cysteine proteinase [Glycine max]
 dbj|BAC77522.1| cysteine proteinase [Glycine max]
Length=362

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 201/327 (61%), Gaps = 11/327 (3%)
 Frame = +3

Query  129   SFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSY  305
             SF+ H+ D +        Y+ W   H       D+  KR+ +++ NV+++   N M+  Y
Sbjct  22    SFDFHDKDLASEESFWDLYERWRSHHTVSRSLGDK-HKRFNVFKANVMHVHNTNKMDKPY  80

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPEFPESVDWRKSGAV  473
             KL  NKFADMTN E++S Y   K++ H+        N T    ++   P SVDWRK+GAV
Sbjct  81    KLKLNKFADMTNHEFRSTYAGSKVNHHRMFQGTPRGNGTFMYEKVGSVPPSVDWRKNGAV  140

Query  474   THVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAY  644
             T VKDQG CGS WAF  V AVEGINQI+T KLVSLSEQ+LVDC+     GC GG  E A+
Sbjct  141   TGVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVSLSEQELVDCDTKKNAGCNGGLMESAF  200

Query  645   DFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpva  821
             +FIK+ GGIT E NYPY  +DG C+        V+I G+  VP  DE  L  A A QPV+
Sbjct  201   EFIKQKGGITTESNYPYTAQDGTCDASKANDLAVSIDGHENVPANDENALLKAVANQPVS  260

Query  822   avvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLVKNSWGTNWGEDGY  998
               +DA   DF+FYSEG+F   C   LNHGV +VGYG   +G  YW V+NSWG  WGE GY
Sbjct  261   VAIDAGGSDFQFYSEGVFTGDCSTELNHGVAIVGYGTTVDGTNYWTVRNSWGPEWGEQGY  320

Query  999   IKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             I+MQR    K G CGIAMMASYP+K S
Sbjct  321   IRMQRSISKKEGLCGIAMMASYPIKNS  347



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 196/307 (64%), Gaps = 7/307 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNS  344
             MV+RY+ W+  HG+ Y+D  E E+R++I++ NV +IE FN + N  YKL  N+FAD+TN 
Sbjct  28    MVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEFIESFNRAGNRPYKLGINQFADLTNE  87

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E+ + +   K+    +   + +     +   P +VDWR  GAVT +KDQG CGS WAF A
Sbjct  88    EFVASHNGLKMSSSPRLFMSTSFKYENVTAVPATVDWRTKGAVTPIKDQGQCGSCWAFSA  147

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYP  692
             +AA EGI ++ TGKL+SLSEQ++VDC++     GC GG  E A++FI +N GI  E  YP
Sbjct  148   IAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCSGGYMEDAFEFIVKNKGIATETTYP  207

Query  693   YVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y   DG C    E SH   I+ Y KVP + E  L  A A QPV+  +DA    F+FYS G
Sbjct  208   YTAADGTCSKTKEASHAAKIASYEKVPANSEAALLKAVANQPVSVSIDAGGMAFQFYSSG  267

Query  870   IFNPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGI  1046
             +F   C   L+HGVT VGYG+  NG  YWLVKNSWGT+WGE GYIKM+R    K G CGI
Sbjct  268   VFTGDCGTDLDHGVTAVGYGKTSNGTKYWLVKNSWGTSWGESGYIKMKRGIAAKEGLCGI  327

Query  1047  AMMASYP  1067
             AM +SYP
Sbjct  328   AMDSSYP  334



>ref|XP_007226517.1| hypothetical protein PRUPE_ppa025615mg [Prunus persica]
 gb|EMJ27716.1| hypothetical protein PRUPE_ppa025615mg [Prunus persica]
Length=361

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 209/346 (60%), Gaps = 23/346 (7%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             + L L L +    SFE  E D +    +   Y+ W   H   + D  E EKR+ +++ NV
Sbjct  7     VALFLALVIGLAESFEFQEKDLASEESLWGLYEGWRSHHTISH-DLGEKEKRFNVFKENV  65

Query  267   LYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR-------  425
              ++   N M+  YKL  NKFADMTN E+ S Y   K+      SH  +LHG R       
Sbjct  66    KHVHKVNQMSKPYKLKLNKFADMTNHEFVSSYAGSKV------SHYRSLHGSRRETAFTH  119

Query  426   --LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
                   P +VDWRK+GAVT VKDQG CGS WAF  V AVEGINQI+T  LVSLSEQ+LVD
Sbjct  120   ENTDNLPPNVDWRKNGAVTGVKDQGKCGSCWAFSTVVAVEGINQIKTKALVSLSEQELVD  179

Query  600   CNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCE-TIAEESHTVTISGYTK  767
             CN+    GC+GG  EKA+DFIK+NGGIT E NYPY   DG C+ T    +  V I GY  
Sbjct  180   CNRDPNEGCDGGLMEKAFDFIKKNGGITTEQNYPYRASDGPCDSTKMMNAPLVQIDGYEN  239

Query  768   VPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NG  941
             VPE +E  L  A A QPV+  +DA   DF+FYSEG+FN  C   LNHGV VVGYG   +G
Sbjct  240   VPENNENALMKAVANQPVSVAIDAGGRDFQFYSEGVFNGDCGTELNHGVAVVGYGATLDG  299

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
               YW+VKNSWG  WGE GYI++QR    + G CGIA   SYP+K S
Sbjct  300   TKYWIVKNSWGEEWGEKGYIRIQRGVDAEEGLCGIAKDPSYPMKSS  345



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 207/341 (61%), Gaps = 13/341 (4%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRY  245
             + K +C  ++L+L        S E          M  RY+ WL  +G+ + D +E E R+
Sbjct  8     LWKYMCLGLILMLGAW-----SSEATSRSLKDASMYGRYEQWLALYGRVHNDINEKETRF  62

Query  246   EIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             +I++ NV +IEF N   +  YKL  N+FAD+TN E+K+    +K  E   ++ +F    V
Sbjct  63    KIFKENVAFIEFSNKDAHKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKASSFKYENV  122

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
              +P  P ++DWRK GAVT VKD G CG  WAF AVAA EGI Q+ TG L+SLSEQ+LVDC
Sbjct  123   TVP-LPATMDWRKKGAVTPVKDXGQCGCCWAFSAVAATEGITQLTTGNLISLSEQELVDC  181

Query  603   NK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GCEGG  + A+ FI++N GI+ E NYPY G DG C T  E      I+G+  V
Sbjct  182   DTAGEDQGCEGGLMDDAFQFIQQNHGISTEXNYPYNGVDGTCNTKKEAIIAAKITGFEDV  241

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             P + E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G 
Sbjct  242   PANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGT  301

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  302   KYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMSASYP  342



>ref|NP_001237199.1| cysteine proteinase precursor [Glycine max]
 dbj|BAC77523.1| cysteine proteinase [Glycine max]
 dbj|BAC77524.1| cysteine proteinase [Glycine max]
Length=362

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 205/340 (60%), Gaps = 11/340 (3%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             ++L L L L    SF+ H+ D      +   Y+ W   H       D+  KR+ +++ N+
Sbjct  9     VVLSLSLVLGVANSFDFHDKDLESEESLWDLYERWRSHHTVSRSLGDK-HKRFNVFKANM  67

Query  267   LYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK----ESHNFTLHGVRLPE  434
             +++   N M+  YKL  NKFADMTN E++S Y   K++ H+        N T    ++  
Sbjct  68    MHVHNTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRDMPRGNGTFMYEKVGS  127

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH-  611
              P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T KLVSLSEQ+LVDC+   
Sbjct  128   VPASVDWRKKGAVTDVKDQGHCGSCWAFSTVVAVEGINQIKTNKLVSLSEQELVDCDTEE  187

Query  612   --GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDE  782
               GC GG  E A+ FIK+ GGIT E  YPY  +DG C+        V+I G+  VP  DE
Sbjct  188   NAGCNGGLMESAFQFIKQKGGITTESYYPYTAQDGTCDASKANDLAVSIDGHENVPGNDE  247

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLV  959
               L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV +VGYG   +G  YW+V
Sbjct  248   NALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTELNHGVAIVGYGATVDGTSYWIV  307

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +NSWG  WGE GYI+MQR    K G CGIAM+ASYP+K S
Sbjct  308   RNSWGPEWGELGYIRMQRNISKKEGLCGIAMLASYPIKNS  347



>ref|XP_003599736.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003607644.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89841.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 196/310 (63%), Gaps = 9/310 (3%)
 Frame = +3

Query  156   HHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFAD  332
               + + +R++ W+ +HGK YED  E EKR+ I++ NV +IE FN+  N  YKL  N  AD
Sbjct  32    ESLSLQERHEQWMTEHGKVYEDAIEKEKRFMIFKDNVEFIESFNAADNQPYKLSVNHLAD  91

Query  333   MTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSW  512
             +T  E+K+    YK  + +  + +F    V     P +VDWR  GAVT +KDQG CGS W
Sbjct  92    LTLDEFKASRNGYKKIDREFTTTSFKYENVTA--IPAAVDWRVKGAVTPIKDQGQCGSCW  149

Query  513   AFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAE  680
             AF  VAA EGINQI TGKLVSLSEQ+LVDC+      GCEGG  E  ++FI +NGGIT+E
Sbjct  150   AFSTVAATEGINQITTGKLVSLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGITSE  209

Query  681   HNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRF  857
              NYPY   DG C T A  +    I+GY KVP   E  L  A A QP++  +DAS   F F
Sbjct  210   TNYPYKAADGSCNT-ATTTPVAKITGYEKVPVNSEKSLLKAVANQPISVSIDASDSSFMF  268

Query  858   YSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGK  1037
             YS GI+   C   L+HGVT VGYG  NG  YW+VKNSWGT WGE GYI+MQR    K G 
Sbjct  269   YSSGIYTGECGTELDHGVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQRGIAAKEGL  328

Query  1038  CGIAMMASYP  1067
             CGIAM +SYP
Sbjct  329   CGIAMDSSYP  338



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 206/332 (62%), Gaps = 11/332 (3%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVL  269
             + LL  L    + S  +  +D+    M +R++ W+ ++G+ Y+D  E   RY I++ NV 
Sbjct  12    LALLFILGAWPSKSTARTLLDAP---MYERHEQWMTQYGRVYKDDTERATRYSIFKENVA  68

Query  270   YIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPES  446
              I+ FNS    SYKL  N+FAD+TN E+K+   R+K      ++  F    V     P +
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVS--AVPST  126

Query  447   VDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HG  614
             +DWRK GAVT VKDQG CG  WAF AVAA+EGIN++ TGKL+SLSEQ++VDC+      G
Sbjct  127   MDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQG  186

Query  615   CEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFL  791
             C GG  + A+ FI++N G+T E NYPY G DG C T     H   I+G+  VP + E  L
Sbjct  187   CNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAAL  246

Query  792   qaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSW  971
               A A+QPV+  +DA   DF+FYS GIF   C   L+HGVT VGYG  +G  YWLVKNSW
Sbjct  247   MKAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSW  306

Query  972   GTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             G  WGE+GYI+MQ+    K G CGIAM ASYP
Sbjct  307   GAQWGEEGYIRMQKDISAKEGLCGIAMQASYP  338



>ref|XP_010245279.1| PREDICTED: vignain-like [Nelumbo nucifera]
Length=361

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 216/346 (62%), Gaps = 12/346 (3%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K V F + L L L L  +  + + E+ S    +   Y+ W + H     D  E +KR+ +
Sbjct  5     KIVLFGLSLALVLGLAKSFDYHEKELASEE-SLWDLYERW-RSHYTVSRDLTEKKKRFNV  62

Query  252   YQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK--KESHNFTLHGVR  425
             ++ N+ YI  FN  +  YKL  NKFAD+TN E++S+Y   K++ H+  + S      G R
Sbjct  63    FKENLKYIHEFNKKDHPYKLKLNKFADLTNHEFRSLYAGSKVNHHRMLRGSQRGGTEGFR  122

Query  426   LPE---FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
               +    P SVDWRK+GAVT VK+QG CGS WAF  VAAVEGINQI+T  LVSLSEQ+LV
Sbjct  123   YEKESNLPASVDWRKNGAVTDVKNQGQCGSCWAFSTVAAVEGINQIKTNNLVSLSEQELV  182

Query  597   DCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             DC+     GC GG  E A++FIK+ GGIT E NYPY  K G C+   + +  VTI G+  
Sbjct  183   DCDTTYNQGCNGGLMEYAFEFIKKTGGITTEKNYPYTAKQGTCKEAKKNAPVVTIDGHEN  242

Query  768   VPEDEGF-LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NG  941
             VP +  + L+ A A QPV+  ++AS  DF+FYSEG+F   C   L+HGV +VGYG   +G
Sbjct  243   VPANNEYALKKAVANQPVSVAIEASGTDFQFYSEGVFTGKCGTELDHGVAIVGYGTTIDG  302

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
               YW+VKNSWG +WGE GYI+M+R    K G CGIAM ASYP+K S
Sbjct  303   TKYWIVKNSWGPDWGEKGYIRMERSISSKEGLCGIAMEASYPIKFS  348



>sp|P12412.1|CYSEP_VIGMU RecName: Full=Vignain; AltName: Full=Bean endopeptidase; AltName: 
Full=Cysteine proteinase; AltName: Full=Sulfhydryl-endopeptidase; 
Short=SH-EP; Contains: RecName: Full=Vignain-1; Contains: 
RecName: Full=Vignain-2; Flags: Precursor [Vigna mungo]
 emb|CAA33753.1| sulfhydryl-pre-endopeptidase (AA -20 to 342) [Vigna mungo]
 emb|CAA36181.1| sulfhydryl-endopeptidase [Vigna mungo]
Length=362

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 203/327 (62%), Gaps = 11/327 (3%)
 Frame = +3

Query  129   SFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSY  305
             SF+ HE D      +   Y+ W + H        E  KR+ +++ NV+++   N M+  Y
Sbjct  22    SFDFHEKDLESEESLWDLYERW-RSHHTVSRSLGEKHKRFNVFKANVMHVHNTNKMDKPY  80

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPEFPESVDWRKSGAV  473
             KL  NKFADMTN E++S Y   K++ HK     +  + T    ++   P SVDWRK GAV
Sbjct  81    KLKLNKFADMTNHEFRSTYAGSKVNHHKMFRGSQHGSGTFMYEKVGSVPASVDWRKKGAV  140

Query  474   THVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAY  644
             T VKDQG CGS WAF  + AVEGINQI+T KLVSLSEQ+LVDC+K    GC GG  E A+
Sbjct  141   TDVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDKEENQGCNGGLMESAF  200

Query  645   DFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpva  821
             +FIK+ GGIT E NYPY  ++G C+        V+I G+  VP  DE  L  A A QPV+
Sbjct  201   EFIKQKGGITTESNYPYTAQEGTCDESKVNDLAVSIDGHENVPVNDENALLKAVANQPVS  260

Query  822   avvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLVKNSWGTNWGEDGY  998
               +DA   DF+FYSEG+F   C   LNHGV +VGYG   +G  YW+V+NSWG  WGE GY
Sbjct  261   VAIDAGGSDFQFYSEGVFTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGY  320

Query  999   IKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             I+MQR    K G CGIAMMASYP+K S
Sbjct  321   IRMQRNISKKEGLCGIAMMASYPIKNS  347



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 216/353 (61%), Gaps = 12/353 (3%)
 Frame = +3

Query  33    KHQKSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKR  212
             +   ++   FLI     FT+   L + + +    +Q    +    M   Y+ WL KHGK 
Sbjct  5     RSSSAISMAFLIF--AIFTLSSALDMSIVSYNLVDQSSSRTDDEVMAI-YEAWLVKHGKV  61

Query  213   YEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK  392
             Y    E EKR++I++ N+ +I+  N+ +  YKL  N+FAD+TN EY+S YL  KI   KK
Sbjct  62    YNALGEKEKRFQIFKDNLRFIDEHNAQDRPYKLGLNRFADLTNEEYRSTYLGTKIRGQKK  121

Query  393   ESHNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKL  569
              S  +    G  LP F   VDWRK GAV  VKDQGSCGS WAF  +AAVEGI++I TG L
Sbjct  122   VSQRYAPRVGDDLPSF---VDWRKEGAVVGVKDQGSCGSCWAFSTIAAVEGISKIVTGDL  178

Query  570   VSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESH  740
             VSLSEQ+LVDC+     GC GG  + A++FI +NGGI +E +YPY G D RC+   + + 
Sbjct  179   VSLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDSEEDYPYKGYDSRCDQYRKNAK  238

Query  741   TVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTV  917
              V+I  Y  VP  DE  L  A A QPVA  ++     F+ Y  GIF   C  +L+HGV V
Sbjct  239   VVSIDDYEDVPANDEKALLKAVANQPVAVAIEGGGRAFQLYVSGIFTETCGTSLDHGVAV  298

Query  918   VGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             VGYG ENG  YW+V+NSWG+NWGEDGYI+M+R  +    GKCGIA+  SYP+K
Sbjct  299   VGYGTENGLDYWIVRNSWGSNWGEDGYIRMERNLASTPTGKCGIAIEPSYPIK  351



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 206/339 (61%), Gaps = 13/339 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K  C +++L+L        S    +       +  RY+ WL ++G+ Y D +E E R++I
Sbjct  10    KYTCLSLILMLGAWSXGATSRTLQD-----ASIYGRYEQWLTRYGRVYNDVNEKETRFKI  64

Query  252   YQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV +IE  N   N  YKL  N+FAD+TN E+K     +K  E   ++ +F    V  
Sbjct  65    FKENVAFIESSNXDANKPYKLSVNQFADLTNEEFKVSRNGFKGHECSTKTTSFKYENVT-  123

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
                P ++DWRK GAVT VKDQG CG  WAF AVAA EGI Q+ TG L+SLSEQ+LVDC+ 
Sbjct  124   ASLPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCDT  183

Query  609   ----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GCEGG  + A+ FI++N GI  E NYPY G DG C +  E SH   I+G+  VP 
Sbjct  184   ASEDQGCEGGLMDDAFQFIQQNHGIGTEANYPYEGVDGTCNSKKEASHAAKITGFEDVPA  243

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
             + E  L AA A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  Y
Sbjct  244   NSEKDLLAAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKY  303

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  304   WLVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYP  342



>ref|XP_004496965.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Cicer arietinum]
Length=472

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 211/329 (64%), Gaps = 17/329 (5%)
 Frame = +3

Query  123   NASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NF  299
             +A  E  + D H   ++K Y+ WL KHGK Y    E E R+EI++ N+ +I+  N+M N 
Sbjct  34    DAKLEAAKTDIH---LMKIYESWLLKHGKVYNALGEKEHRFEIFKDNLQFIQNHNNMENQ  90

Query  300   SYKLIDNKFADMTNSEYKSVYLRYKIDEHK------KESHNFTLHGVRLPEFPESVDWRK  461
             S+KL   KFAD+TN EY+S++L  +    K      K+S+ +  H     E P SVDWR+
Sbjct  91    SFKLGLTKFADLTNEEYRSMFLGTRSRNSKGLLSGSKKSNRYAFHDT--DELPGSVDWRE  148

Query  462   SGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNT  632
              GAVT VKDQG CGS WAF  V AVEGINQI TG L+SLSEQ+LVDC+K    GC GG  
Sbjct  149   KGAVTPVKDQGQCGSCWAFSTVGAVEGINQIVTGDLISLSEQELVDCDKGFNMGCNGGLM  208

Query  633   EKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaq  809
             + A++FI +NGGI  E +YPY  +D  C++  + +  VTI GY  VPE DE  L  A A 
Sbjct  209   DHAFEFIMKNGGIDTEEDYPYRARDNTCDSNKKNARVVTIDGYEDVPENDEKSLMKAVAN  268

Query  810   qpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGE  989
             QPV+  ++A    F+ Y  G+F  +C   L+HGV  VGYG ENG  YWLV+NSWG +WGE
Sbjct  269   QPVSVAIEAGGRAFQLYHSGVFTGLCGTELDHGVVAVGYGTENGTDYWLVRNSWGPSWGE  328

Query  990   DGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             +GYIK++R     K GKCGIAM ASYP+K
Sbjct  329   NGYIKLERNLLTSKTGKCGIAMEASYPIK  357



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 205/308 (67%), Gaps = 13/308 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             Y+ WL KHGK Y    E ++R++I++ N+ +I+  NS + +YKL  NKFAD+TN EY+  
Sbjct  52    YESWLVKHGKTYNALGEKDRRFQIFKDNLRFIDEHNSGDHTYKLGLNKFADLTNEEYRMT  111

Query  360   YLRYK-IDEHKK----ESHNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
             Y   K ID+ KK    +S  +    G  LPE+   VDWR+ GAVT VKDQGSCGS WAF 
Sbjct  112   YTGIKTIDDKKKLSKMKSDRYAYRSGDSLPEY---VDWREQGAVTDVKDQGSCGSCWAFS  168

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYP  692
                +VEG+N+I TG L+S+SEQ+LV+C+     GC GG  + A++FI +NGGI  E +YP
Sbjct  169   TTGSVEGVNKIVTGDLISVSEQELVNCDTSYNQGCNGGLMDYAFEFIIKNGGIDTEEDYP  228

Query  693   YVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y GKDG+C+   + +  VTI  Y  VP  DE  L+ A + QPVA  ++A   DF+FY+ G
Sbjct  229   YTGKDGKCDKNKKNAKVVTIDSYEDVPVNDESSLKKAVSNQPVAVAIEAGGRDFQFYTSG  288

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             IF   C   L+HGV   GYG E+G+ YWLVKNSWG  WGE GY+KM+R   DK+GKCGIA
Sbjct  289   IFTGSCGTALDHGVLAAGYGTEDGKDYWLVKNSWGAEWGEGGYLKMERNIADKSGKCGIA  348

Query  1050  MMASYPLK  1073
             M ASYP+K
Sbjct  349   MEASYPIK  356



>ref|XP_006341791.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=357

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 205/346 (59%), Gaps = 22/346 (6%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             F I+L L +      S E  E D +    +   YQ W + H     D  E +KR+ +++ 
Sbjct  7     FLILLSLAMVFGLVNSLEFTEKDIASEENLWDLYQKW-RSHHTVSRDLTEKQKRFNVFKV  65

Query  261   NVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR-----  425
             NV++I   N M+  YKL  NKFADMTN E+++ Y         K  H   LHG R     
Sbjct  66    NVMHIHNVNKMDRPYKLKLNKFADMTNHEFRNFY-------SSKIKHFRMLHGPRPTTGF  118

Query  426   ----LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
                     P SVDWRK GAVT VKDQG CGS WAF  +  VEGIN+I+TGKLVSLSEQ+L
Sbjct  119   MHEKADNLPASVDWRKKGAVTGVKDQGKCGSCWAFSTIVGVEGINKIKTGKLVSLSEQEL  178

Query  594   VDCNK--HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             VDC K   GC GG  E AY+FIK+NGG+T E  YPY   D RC++    S  V I G+  
Sbjct  179   VDCEKDNEGCNGGLMENAYEFIKKNGGVTTEKIYPYKASDSRCDSSKRNSPVVNIDGHEM  238

Query  768   VPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENG  941
             VPE DE  L  A A QP++  +DAS  D +FYSEG+FN  C   L+HGV VVGYG   +G
Sbjct  239   VPEKDEDALMKAVANQPISVAIDASGSDLQFYSEGVFNGNCGTELDHGVAVVGYGSTHDG  298

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
               YW+VKNSWGT WGE GY +MQR    + G CGI M ASYP+K S
Sbjct  299   TKYWIVKNSWGTEWGEQGYFRMQRGIDAEEGLCGITMEASYPVKLS  344



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 208/313 (66%), Gaps = 9/313 (3%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNS  344
             +V+ Y+ WL +HGK Y    E E R+++++ N+ +I+  NS  N +Y L  NKFAD+TN 
Sbjct  48    VVEMYELWLARHGKAYNGLGEREMRFQVFKDNLRFIDEHNSSQNRTYTLGLNKFADLTND  107

Query  345   EYKSVYLRYKIDEHKK--ESHNFTL-HGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSW  512
             EY+++YL  + +  ++  +S N +  + VR  +  PE+VDWR  GAV  VKDQG+CGS W
Sbjct  108   EYRAMYLGTRSEAKRRVMKSRNASRRYAVRAGDRLPEAVDWRLKGAVNPVKDQGTCGSCW  167

Query  513   AFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEH  683
             AF  VAAVEGINQI TG+L+SLSEQ+LVDC++    GC GG  + A++FI +NGG+  E 
Sbjct  168   AFSTVAAVEGINQIVTGELISLSEQELVDCDRKHNSGCNGGLMDYAFEFIIKNGGMDTEQ  227

Query  684   NYPYVGKDGRCETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSMDDFRFYS  863
             +YPY G  G+C+     S  VTI GY  VP  E  L+ A A QPV+  ++AS   F+ Y 
Sbjct  228   DYPYNGIGGKCDASRVNSKVVTIDGYEDVPPYESALKKAVAHQPVSIAIEASGRAFQLYQ  287

Query  864   EGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDK-NGKC  1040
              G+F   C  +L+HGV VVGYG ENG  YW+V+NSWGTNWGEDGYI+M+R   D   GKC
Sbjct  288   SGVFTGECGISLDHGVIVVGYGSENGVDYWIVRNSWGTNWGEDGYIRMERNVVDNFFGKC  347

Query  1041  GIAMMASYPLKGS  1079
             GI M  SYP K S
Sbjct  348   GIVMEPSYPTKTS  360



>gb|AFK44139.1| unknown [Medicago truncatula]
Length=340

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 198/306 (65%), Gaps = 9/306 (3%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNS  344
             + +R++ W+ ++GK Y+D  E EKR+ I++ NV +IE FN+  N  YKL  N  AD+T  
Sbjct  36    LQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNHLADLTLD  95

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E+K+    YK  + +  + +F    V     PE+VDWR  GAVT +KDQG CGS WAF  
Sbjct  96    EFKASRNGYKKIDREFATTSFKYENVTA--IPEAVDWRVKGAVTPIKDQGQCGSCWAFST  153

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK----HGCEGGNTEKAYDFIKRNGGITAEHNYP  692
             VAA+EGINQI TGKL+SLSEQ+LVDC+      GCEGG  E  ++FI +NGGIT+E NYP
Sbjct  154   VAAIEGINQITTGKLISLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGITSETNYP  213

Query  693   YVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y   DG C + A  +    I+GY KVP   E  L  A A QP++  +DAS   F FYS G
Sbjct  214   YKAADGSC-SAATTAPVAKITGYEKVPVNSEISLLKAVANQPISVSIDASDSSFMFYSSG  272

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIA  1049
             I+   C   L+HGVT VGYG  NG  YW+VKNSWGT WGE GYI+MQR   DK G CGIA
Sbjct  273   IYTGECGTELDHGVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQRGIADKEGLCGIA  332

Query  1050  MMASYP  1067
             M +SYP
Sbjct  333   MDSSYP  338



>ref|XP_008374352.1| PREDICTED: vignain [Malus domestica]
Length=362

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 210/347 (61%), Gaps = 10/347 (3%)
 Frame = +3

Query  66    ILKNVCFTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             + K V   + L L L +  + SF+ HE D +    +   Y+ W + H       DE  KR
Sbjct  1     MTKFVWVALALSLALVMGVSESFDYHEKDLASEESLWGLYERW-RSHHTVSRSLDEKNKR  59

Query  243   YEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGV  422
             + +++ NV ++   N  +  YKL  NKFADMTN E++SVY   K+  H+         G 
Sbjct  60    FNVFKENVKHVHNTNKGDKPYKLKLNKFADMTNHEFRSVYAGSKVKHHRMFQGQRADTGF  119

Query  423   R---LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
             R   +   P SVDWRK+GAVT VKDQG CGS WAF  V AVEG NQI+T  LVSLSEQ+L
Sbjct  120   RYGNVGSVPPSVDWRKNGAVTPVKDQGHCGSCWAFSTVVAVEGXNQIKTKNLVSLSEQEL  179

Query  594   VDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYT  764
             VDC+    HGC GG  E A +FIK+ GG+TAE NYPY   D  C    E +  V+I G+ 
Sbjct  180   VDCDTEQNHGCNGGLMELAMEFIKQXGGLTAETNYPYRAADSTCNVAKENAPAVSIDGHE  239

Query  765   KVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-N  938
              VP  DE  L  AAA QP++  +DA   DF+FY EG+F+  C   L+HGV VVGYG   +
Sbjct  240   SVPANDEDALLKAAANQPISVAIDAGGSDFQFYHEGVFDGKCGTELDHGVAVVGYGTTLD  299

Query  939   GQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             G  YW+VKNSWGT WGE+GYI+MQR    K G CGIAM ASYP+K S
Sbjct  300   GTKYWIVKNSWGTEWGEEGYIRMQRGVSAKEGICGIAMEASYPVKNS  346



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 209/342 (61%), Gaps = 8/342 (2%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++ KN    I L + LC+   A F+          M +R++ W+ ++GK Y+D  E EKR
Sbjct  1     MVAKNHFCHISLAMLLCMAFLA-FQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKR  59

Query  243   YEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             + I++ NV YIE FN + N  YKL  N+FAD+TN E+ +   R+K           T   
Sbjct  60    FRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKY  119

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P +VDWR+ GAVT +KDQG CG  WAF AVAA EGI+ + +GKL+SLSEQ+LVD
Sbjct  120   ENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVD  179

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GCEGG  + A+ F+ +N G+  E NYPY G DG+C      +  VTI+GY  
Sbjct  180   CDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNANEAANDVVTITGYED  239

Query  768   VPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-G  941
             VP  +E  LQ A A QPV+  +DAS  DF+FY  G+F   C   L+HGVT VGYG  N G
Sbjct  240   VPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDG  299

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  300   TEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYP  341



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/306 (52%), Positives = 206/306 (67%), Gaps = 8/306 (3%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKS  356
             ++ WL KHGK Y   DE +KR++I++ N+ YI+  NS+ N SYKL  N+FAD+TN EY++
Sbjct  50    FESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRT  109

Query  357   VYLRYKIDEHKK--ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVA  530
              YL  K D  +   +S +     V     P+S+DWR+ GAVT VKDQGSCGS WAF  +A
Sbjct  110   GYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIA  169

Query  531   AVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVG  701
             AVEG+NQ+ TG L+SLSEQ+LVDC++    GC GG+   A+ FI +NGGI +E +YPY G
Sbjct  170   AVEGVNQLATGNLISLSEQELVDCDRKINQGCNGGDMGYAFQFIIKNGGIDSEEDYPYTG  229

Query  702   KDGRCETIAEESHTV-TISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             KDG+C++  + +  V +I GY +VP  +E  LQ A A QPV+  ++A   DF+ YS GIF
Sbjct  230   KDGKCDSYRQNNAKVASIDGYEEVPVNNEKSLQKAVANQPVSVAIEAGGYDFQLYSSGIF  289

Query  876   NPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMM  1055
                C   L+HGV  VGYG ENG  YW+VKNSWG  WGE GY++MQR    K G CGIAM 
Sbjct  290   TGSCGTDLDHGVAAVGYGTENGVDYWIVKNSWGDYWGEKGYVRMQRNVKAKTGLCGIAME  349

Query  1056  ASYPLK  1073
             ASYP K
Sbjct  350   ASYPTK  355



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 212/338 (63%), Gaps = 16/338 (5%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             + F  +L+L +      S   +E       MV+++  W+ + G+ Y+D  E  KR++I++
Sbjct  9     LAFIALLVLVMQASQATSRGLYE-----TSMVQKHDQWMTRFGRVYKDDVEKAKRFKIFK  63

Query  258   YNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKK--ESHNFTLHGVRL  428
              N  YI+ FN      YKL  N+FAD+TN E+++ +  Y++   KK  E  +F    V  
Sbjct  64    DNTEYIDSFNKAGTKPYKLDINEFADLTNEEFRATHNGYRMPSQKKSPEITSFKYENVTA  123

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
             P    ++DWRK GAVT +KDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+ 
Sbjct  124   PA---TMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDT  180

Query  609   H---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED  779
                 GCEGG  + A+ FI +N G+T E NYPY G D  C+T  E +H   I+ Y  VP +
Sbjct  181   SSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPAN  240

Query  780   -EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYW  953
              E  L  A A QPV+  +DAS  DF+FYS G+F   C   L+HGVT VGYG+  +G  YW
Sbjct  241   SESDLLKAVANQPVSVAIDASASDFQFYSSGVFTGECGTELDHGVTAVGYGKASDGTKYW  300

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             LVKNSWGT+WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  301   LVKNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYP  338



>ref|XP_008782844.1| PREDICTED: xylem cysteine proteinase 1-like [Phoenix dactylifera]
Length=347

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 217/346 (63%), Gaps = 6/346 (2%)
 Frame = +3

Query  45    SVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDK  224
             S +K+ L+L ++C    L LP       S+ + +++SH  ++++ ++ W+ KH K Y+  
Sbjct  4     STIKLSLLL-SMCLITCLALPRDFSI-ISYTEDDLNSHD-KLIELFESWMSKHSKVYKSF  60

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHN  404
             +E  +R+E+++ N+ +I+  N    SY L  N+FAD+++ E+K+ YL    D  +K    
Sbjct  61    EEKLRRFEVFKDNLKHIDETNKKRSSYWLGLNEFADLSHGEFKATYLGLTTDLPEKRDAG  120

Query  405   FTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSE  584
                      + P+SVDWRK GAVT VK+QG CGS WAF  VAAVEGINQI TG L SLSE
Sbjct  121   SNFRYEDSTDLPKSVDWRKKGAVTPVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSE  180

Query  585   QQLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISG  758
             Q+L+DC  + +GC GG  + A+ FI  NGG+  E  YPY+ K+G CE    E   VTI+G
Sbjct  181   QELIDCSTDNNGCNGGLMDYAFSFIVSNGGLHTEEAYPYLMKEGTCEEKRAEVEVVTIAG  240

Query  759   YTKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE  935
             Y  VPE+ E  L  A A QPV+  ++AS  DF+FYS G+F+  C + L+HGV  VGYG  
Sbjct  241   YEDVPENSEESLLKALAHQPVSVAIEASGRDFQFYSGGVFDGPCGDALDHGVAAVGYGTS  300

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
              GQ Y +V+NSWG  WGE GYI+M+R +G   G CGI  MASYP K
Sbjct  301   KGQDYIIVRNSWGPRWGEKGYIRMKRNTGKPEGPCGINKMASYPTK  346



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 201/305 (66%), Gaps = 7/305 (2%)
 Frame = +3

Query  168   MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNS  344
             M+KR+++W+ +HG+ Y D  E EKRY I++ N+  IE FN+  +  YKL  NKFAD+TN 
Sbjct  36    MLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNE  95

Query  345   EYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCA  524
             E++++Y  YK    K  S +F      L + P S+DWR  GAVT VKDQG+CG  WAF  
Sbjct  96    EFRAMYHGYKRQSSKLMSSSFRYE--NLSDIPTSMDWRNDGAVTPVKDQGTCGCCWAFST  153

Query  525   VAAVEGINQIETGKLVSLSEQQLVDCNK--HGCEGGNTEKAYDFIKRNGGITAEHNYPYV  698
             VAA+EGI +++TG L+SLSEQQLVDC     GC+GG  + A+ +I RNGG+T+E NYPY 
Sbjct  154   VAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQGGLMDTAFQYIIRNGGLTSEDNYPYQ  213

Query  699   GKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIF  875
             G DG C +    S    I+GY  VP+ +E  L  A A+QPV+  V+    DF+FY  G+F
Sbjct  214   GVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYKSGVF  273

Query  876   NPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAM  1052
                C   LNH VT +GYG + +G  YWLVKNSWGT+WGE+GY++M+R  G   G CG+A 
Sbjct  274   EGDCGTNLNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGENGYMRMRRGIGSSEGLCGVAK  333

Query  1053  MASYP  1067
              ASYP
Sbjct  334   DASYP  338



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 214/346 (62%), Gaps = 21/346 (6%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMDSHHV---------RMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++L L   L + +       D  H           ++  Y++WL K GK Y    E EKR
Sbjct  13    VLLFLSFTLSSASDMSIISYDQTHATKSSWRTDDEVMAIYEEWLVKQGKVYNALGEREKR  72

Query  243   YEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLR----YKIDEHKKESHNFT  410
             +++++ N+ +I+  NS N +YKL  N FAD+TN EY+S YL      K +  +K S  + 
Sbjct  73    FQVFKDNLRFIDEHNSENRTYKLGLNGFADLTNEEYRSTYLGARGGMKRNRLRKTSDRYA  132

Query  411   LHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQ  587
                 R+ E  P+SVDWRK GAV  VKDQGSCGS WAF  +AAVEGIN+I TG L+SLSEQ
Sbjct  133   ---PRVGESLPDSVDWRKEGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGDLISLSEQ  189

Query  588   QLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISG  758
             +LVDC+     GC GG  + A++FI  NGGI  E +YPY+ +DGRC+T  + +  VTI  
Sbjct  190   ELVDCDTSYNEGCNGGLMDYAFEFIINNGGIDTEEDYPYLARDGRCDTYRKNAKVVTIDD  249

Query  759   YTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE  935
             Y  VP   E  LQ A A QPV+  ++A   DF+FY+ GIF+  C   L+HGV  VGYG E
Sbjct  250   YEDVPVNSETALQKAVANQPVSVAIEAGGRDFQFYASGIFSGRCGTQLDHGVAAVGYGTE  309

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             NG+ YW+V+NSWG +WGE+GY++M R      G CGIAM ASYP+K
Sbjct  310   NGKDYWIVRNSWGKSWGENGYLRMARSINSPTGICGIAMEASYPIK  355



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 208/320 (65%), Gaps = 7/320 (2%)
 Frame = +3

Query  135   EQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKL  311
             + H + S    ++  Y+ WL KHGK Y    E E+R++I++ N LYI+  N+  + S+KL
Sbjct  29    QTHAVGSTDDVIMAAYESWLVKHGKSYNALGEKEQRFQIFKDNFLYIDEQNAAKDRSFKL  88

Query  312   IDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLP--EFPESVDWRKSGAVTHVK  485
               N+FAD+TN EY+S Y   +  + +K+    +     L     PESVDWR+ GAV  VK
Sbjct  89    GLNRFADLTNEEYRSKYTGIRTKDSRKKVSGKSQRYASLAGESLPESVDWREHGAVASVK  148

Query  486   DQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIK  656
             DQG CGS WAF  ++AVEGINQI TGKL++LSEQ+LVDC++    GC GG  + A+ FI 
Sbjct  149   DQGQCGSCWAFSTISAVEGINQIATGKLITLSEQELVDCDRSYNEGCNGGLMDDAFQFII  208

Query  657   RNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvd  833
              NGGI ++ +YPY G+DG+C+   + +  VTI  Y  VPE DE  LQ AAA QP++  ++
Sbjct  209   NNGGIDSDADYPYTGRDGQCDQYRKNAKVVTIDSYEDVPEYDEKALQKAAANQPISVAIE  268

Query  834   aSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQR  1013
             AS  DF+FY  GIF   C   L+HGV VVGYG ENG+ YW+V+NSWG +WGE GY++M+R
Sbjct  269   ASGRDFQFYDSGIFTGKCGTDLDHGVVVVGYGTENGKDYWIVRNSWGADWGEKGYLRMER  328

Query  1014  RSGDKNGKCGIAMMASYPLK  1073
                 K G CGI    SYP+K
Sbjct  329   GISSKAGICGITSEPSYPVK  348



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/351 (44%), Positives = 221/351 (63%), Gaps = 13/351 (4%)
 Frame = +3

Query  51    MKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR----MVKRYQDWLQKHGKRYE  218
             M   LI   V FT++ +      +  S+++   D    +    ++  Y++WL KHGK Y 
Sbjct  1     MATILI---VFFTVLAVSSALDMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYN  57

Query  219   DKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKES  398
               +E EKR++I++ N+ +IE  N++N +YK+  N+F+D++N EY+S YL  KID  +  +
Sbjct  58    AVEEKEKRFQIFKDNLNFIEEHNAVNRTYKVGLNRFSDLSNEEYRSKYLGTKIDPRRMMA  117

Query  399   HNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
                  +  R+ +  PESVDWRK GAV  VK+Q  C   WAF A+AAVEGIN+I TG L +
Sbjct  118   RPSRRYSPRVADNLPESVDWRKEGAVVRVKNQSECEGCWAFSAIAAVEGINKIVTGNLTA  177

Query  576   LSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+L+DC++    GC GG  + A++FI  NGGI  E +YP+ G DG C+     +  V
Sbjct  178   LSEQELLDCDRTVNAGCSGGLVDYAFEFIINNGGIDTEEDYPFQGADGICDQYKINARAV  237

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             TI GY +VP  DE  L+ A A QPV+  ++A   +F+ Y  GIF   C  +++HGVT VG
Sbjct  238   TIDGYERVPAYDELALKKAVANQPVSVAIEAYGKEFQLYESGIFTGTCGTSIDHGVTAVG  297

Query  924   YGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             YG ENG  YW+VKNSWG NWGE GY++M+R  + D  GKCGIA++  YP+K
Sbjct  298   YGTENGIDYWIVKNSWGENWGEAGYVRMERNIAEDTAGKCGIAILTLYPIK  348



>gb|AAC49135.1| SAG12 protein [Arabidopsis thaliana]
Length=346

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 210/353 (59%), Gaps = 28/353 (8%)
 Frame = +3

Query  51    MKVFL---ILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYED  221
             M++FL   I  + CF+I L  PL               + + M KR+ +W+ KHG+ Y D
Sbjct  6     MQIFLFVAIFSSFCFSITLSRPL--------------DNELIMQKRHIEWMTKHGRVYAD  51

Query  222   KDEWEKRYEIYQYNVLYIEFFNSM--NFSYKLIDNKFADMTNSEYKSVYLRYK-----ID  380
               E   RY +++ NV  IE  NS+    ++KL  N+FAD+TN E+ S+Y  +K       
Sbjct  52    VKEENNRYVVFKNNVERIEHLNSIPAGRTFKLAVNQFADLTNDEFCSMYTGFKGVSALSS  111

Query  381   EHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIET  560
             + + +   F    V     P SVDWRK GAVT +K+QGSCG  WAF AVAA+EG  QI+ 
Sbjct  112   QSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKK  171

Query  561   GKLVSLSEQQLVDC--NKHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEE  734
             GKL+SLSEQQLVDC  N  GCEGG  + A++ IK  GG+T E +YPY G+D  C +    
Sbjct  172   GKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTESDYPYKGEDATCNSKKTN  231

Query  735   SHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGV  911
                 +I+GY  VP  DE  L  A A QPV+  ++    DF+FYS G+F   C   L+H V
Sbjct  232   PKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAV  291

Query  912   TVVGYGEE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             T +GYGE  NG  YW++KNSWGT WGE GY+++Q+   DK G CG+AM ASYP
Sbjct  292   TAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYP  344



>prf||1910332A Cys endopeptidase
Length=362

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 203/327 (62%), Gaps = 11/327 (3%)
 Frame = +3

Query  129   SFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSY  305
             SF+ HE D      +   Y+ W + H        E  KR+ +++ NV+++   N M+  Y
Sbjct  22    SFDFHEKDLESEESLWDLYERW-RSHHTVSRSLGEKHKRFNVFKANVMHVHNTNKMDKPY  80

Query  306   KLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPEFPESVDWRKSGAV  473
             KL  NKFADMTN E++S Y   K++ HK     +  + T    ++   P SVDWRK GAV
Sbjct  81    KLKLNKFADMTNHEFRSTYAGSKVNHHKMFRGSQHGSGTFMYEKVGSVPASVDWRKKGAV  140

Query  474   THVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAY  644
             T VKDQG CGS WAF  + AVEGINQI+T KLVSLSEQ+LVDC+K    GC GG  E A+
Sbjct  141   TDVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDKEENQGCNGGLMESAF  200

Query  645   DFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDEGFLqaaaaqqpva  821
             +FIK+ GGIT E NYPY  ++G C+        V+I G+  VP  DE  L  A A QPV+
Sbjct  201   EFIKQKGGITTESNYPYKAQEGTCDESKVNDLAVSIDGHENVPVNDENALLKAVANQPVS  260

Query  822   avvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLVKNSWGTNWGEDGY  998
               +DA   DF+FYSEG+F   C   LNHGV +VGYG   +G  YW+V+NSWG  WGE GY
Sbjct  261   VAIDAGGSDFQFYSEGVFTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGY  320

Query  999   IKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             I+MQR    K G CGIAMMASYP+K S
Sbjct  321   IRMQRNISKKEGLCGIAMMASYPIKNS  347



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 205/312 (66%), Gaps = 10/312 (3%)
 Frame = +3

Query  159   HVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFN-SMNFSYKLIDNKFADM  335
             H  M+++++ W+ ++G+ Y+D  E   RY+I++ NV YI+  + + N +YKL  NKFAD+
Sbjct  13    HKSMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRTYKLAINKFADL  72

Query  336   TNSEYKSVYLRYKIDEHKKESHNFTLHGVR---LPEFPESVDWRKSGAVTHVKDQGSCGS  506
             T+ E+K+    +K+     +S +F +   R   +   P S+DW K GAVT VKDQG CG 
Sbjct  73    TSDEFKASRNGFKMGSQSIKS-SFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQCGC  131

Query  507   SWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITA  677
              WAF AVAA EG+NQ++TGKL+SLSEQ+LVDC+     GC GG  + A++FI  N G+T 
Sbjct  132   CWAFSAVAATEGLNQLKTGKLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTT  191

Query  678   EHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaavvdaSMDDFR  854
             E NYPY G DG C +  E SH   I+GY  VP + E  L  A A QP++  +DAS  DF+
Sbjct  192   ESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQ  251

Query  855   FYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN  1031
             FYS G+F+  C   L+HGVT VGYG   +G  YWLVKNSWG++WGE+GYI+MQR      
Sbjct  252   FYSGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAE  311

Query  1032  GKCGIAMMASYP  1067
             G CGIAM ASYP
Sbjct  312   GLCGIAMQASYP  323



>ref|XP_010503462.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Camelina 
sativa]
Length=360

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 207/341 (61%), Gaps = 13/341 (4%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
               I L   + L T   F+  + +      +    D  + H        E EKR+ I+++N
Sbjct  5     LLIFLFSLVILQTACGFDYQDKEVESEEGLSNMYDRWRSHHSVPRSLHEREKRFNIFRHN  64

Query  264   VLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEH------KKESHNFTLHGVR  425
             V+++   N  N SYKL  NKFAD+T +E+K+ Y   KI  H      K+ S  F      
Sbjct  65    VMHVHNTNKKNKSYKLKLNKFADLTINEFKNAYTGSKIKHHRMLQGLKRGSKQFMYENA-  123

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
                 P SVDWRK GAV+ +K+QG CGS WAF  VAAVEGINQI+T KLVSLSEQ+LVDC+
Sbjct  124   -SGLPASVDWRKKGAVSEIKNQGRCGSCWAFSTVAAVEGINQIKTNKLVSLSEQELVDCD  182

Query  606   KH---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
              +   GC GG  E A++FIK+NGGIT E +YPY G DG+C+   +    VTI G+  VPE
Sbjct  183   TNQNEGCNGGLMEIAFEFIKKNGGITTEDSYPYEGIDGKCDASKDNGVLVTIDGHENVPE  242

Query  777   -DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-GQPY  950
              DE  L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV  VGYG ++ G  Y
Sbjct  243   NDENALLKAVANQPVSVAIDAGSSDFQFYSEGVFTGYCGTELNHGVAAVGYGSDSKGNKY  302

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLK  1073
             W+V+NSWG  WGE GYIK++R   +  G+CGIAM ASYP+K
Sbjct  303   WIVRNSWGAEWGEGGYIKLERGIDESEGRCGIAMEASYPIK  343



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score =   286 bits (732),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 224/358 (63%), Gaps = 19/358 (5%)
 Frame = +3

Query  39    QKSVMKVFLILKNVCFTIMLLLPLCLHTNASFEQ-HEMDSHHVR----MVKRYQDWLQKH  203
             +   M +FL+     FT+   L + +    S+++ HE  S   R    ++  ++ WL KH
Sbjct  5     RSPTMAMFLLFL---FTVSSALDMSI---VSYDKTHESKSSSWRTDDEVMAMFEAWLVKH  58

Query  204   GKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYL--RYKI  377
             GK Y    E EKR+EI++ N+ +I+  NS N +YK+  N+FAD+TN EY+S++L  R+  
Sbjct  59    GKAYNALGEKEKRFEIFKENLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMHLGARFGA  118

Query  378   DEHKKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQI  554
                  +S     +  R+ E  P+SVDWRK GAV  VKDQGSCGS WAF  +AAVEGIN+I
Sbjct  119   KRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKI  178

Query  555   ETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETI  725
              TG L+SLSEQ+LVDC+     GC GG  + A++FI  NGGI  E +YPY   DG C+T 
Sbjct  179   VTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTY  238

Query  726   AEESHTVTISGYTKVP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLN  902
              + +  VTI  Y  VP  DE  LQ A A QPV+  ++     F+ Y  GIF   C  +L+
Sbjct  239   RKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLD  298

Query  903   HGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
             HGVT VGYG ENG  YW+VKNSWG++WGE GYI+M+R  +G   GKCGIAM ASYP+K
Sbjct  299   HGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIK  356



>gb|AAC35211.1| cysteine proteinase [Hemerocallis hybrid cultivar]
Length=359

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 162/345 (47%), Positives = 217/345 (63%), Gaps = 23/345 (7%)
 Frame = +3

Query  87    TIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
              +++L  + L  +  F++ ++ S    +   Y+ W   H     D D+ +KR+ +++ NV
Sbjct  11    VVLVLGSVALAQSIPFDEKDLASEE-SLWSLYEKWRAHHAVS-RDLDDTDKRFNVFKENV  68

Query  267   LYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR------  425
              +I  FN   + +YKL  NKF DMTN E++S Y   KID      H+ TL GV+      
Sbjct  69    KFIHEFNQKKDATYKLALNKFGDMTNQEFRSTYAGSKID------HHMTLRGVKDAGEFS  122

Query  426   ---LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLV  596
                  + P SVDWR+ GAVT VKDQG CGS WAF  V AVEGINQI+T +LVSLSEQQLV
Sbjct  123   YEKFHDLPTSVDWREKGAVTGVKDQGQCGSCWAFSTVVAVEGINQIKTNELVSLSEQQLV  182

Query  597   DCN--KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             DC+    GC GG  + A+DFIK NGG+++E +YPY+ +   C + A  S  VTI GY  V
Sbjct  183   DCDTKNSGCNGGLMDYAFDFIKNNGGLSSEDSYPYLAEQKSCGSEA-NSAVVTIDGYQDV  241

Query  771   PE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQ  944
             P  +E  L  A A QPV+  ++AS   F+FYS+G+F+  C   L+HGV  VGYG +++G+
Sbjct  242   PRNNEAALMKAVANQPVSVAIEASGYAFQFYSQGVFSGHCGTELDHGVAAVGYGVDDDGK  301

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
              YW+VKNSWG  WGE GYI+M+R   DK GKCGIAM ASYP+K S
Sbjct  302   KYWIVKNSWGEGWGESGYIRMERGIKDKRGKCGIAMEASYPIKSS  346



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 207/339 (61%), Gaps = 13/339 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K  C +++L+L        S    +       +  RY+ WL ++G+ Y D +E E R++I
Sbjct  10    KYTCLSLILMLGAWSSGATSRTLQD-----ASIYGRYEQWLTRYGRVYNDVNEKETRFKI  64

Query  252   YQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV +IE  N   N   +L  N+FAD+TN E+K+    +K  E   ++ +F    V  
Sbjct  65    FKENVAFIESSNKDANKPCRLSVNQFADLTNEEFKASRNGFKGHECSTKTSSFKYENVT-  123

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
                P ++DWRK GAVT VKDQG CG  WAF AVAA EGI Q+ TG L+SLSEQ+LVDC+ 
Sbjct  124   ASLPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCDT  183

Query  609   ----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GCEGG  + A+ FI++N GI+ E NYPY G DG C    E SH   I+G+  VP 
Sbjct  184   ASEDQGCEGGLMDDAFQFIQQNHGISTEANYPYEGVDGTCNAKKEASHAAKITGFEDVPA  243

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
             + E  L AA A QPV+  +DAS  DF+FYS G+F+  C  +L+HGVT VGYG  E+G  Y
Sbjct  244   NSEKDLLAAVAHQPVSVAIDASGSDFQFYSSGVFSGTCGTSLDHGVTAVGYGVSEDGTKY  303

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWG  WGE GYI+MQR      G CGIAM ASYP
Sbjct  304   WLVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYP  342



>ref|XP_006425969.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
 gb|ESR39209.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
Length=372

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 204/311 (66%), Gaps = 13/311 (4%)
 Frame = +3

Query  180   YQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSV  359
             YQ WL K GK        EKR++I++ N+ +I+  NS+N +YK+  NKFAD+TN EY+++
Sbjct  52    YQTWLAKRGKTSNGMGHNEKRFQIFKDNLRFIDEHNSLNRTYKVGLNKFADLTNEEYRAM  111

Query  360   YLRYKIDEHKK------ESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFC  521
             YL  + D  ++       S  +        E PESVDWR+ GAV  VKDQGSCGS WAF 
Sbjct  112   YLGTRSDAKRRLMKSKVASQRYAFKAG--DELPESVDWREKGAVNPVKDQGSCGSCWAFS  169

Query  522   AVAAVEGINQIETGKLVSLSEQQLVDCNKH---GCEGGNTEKAYDFIKRNGGITAEHNYP  692
              VAAVEGIN+I TG+L+SLSEQ+LVDC++    GC GG  + A+ FI +NGG+ +E +YP
Sbjct  170   TVAAVEGINKIVTGELISLSEQELVDCDRKINAGCNGGLMDYAFQFIIQNGGMDSEQDYP  229

Query  693   YVGKDGRCETIAEESHTVTISGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEG  869
             Y+G + +C+     +  V+I GY  V P DE  L+ A A QPV+  ++A    F+ Y  G
Sbjct  230   YLGAENKCDPSRRNAKVVSIDGYEDVSPFDEMSLKKAVADQPVSVAIEAGGRAFQHYESG  289

Query  870   IFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGI  1046
             +F   C   L+HGV  VGYG ENG  YWLV+NSWG++WGE+GY+K+QR   D N GKCGI
Sbjct  290   VFTGECGSALDHGVVAVGYGTENGVDYWLVRNSWGSDWGENGYVKLQRNLLDTNTGKCGI  349

Query  1047  AMMASYPLKGS  1079
             AM ASYP+K S
Sbjct  350   AMEASYPVKNS  360



>gb|AFK46775.1| unknown [Medicago truncatula]
Length=362

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 211/342 (62%), Gaps = 11/342 (3%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
               I+L + L L  + SF+ H+ D S    +   Y+ W + H     + +E +KR+ +++ 
Sbjct  7     LLIVLSIALVLVVSESFDFHDKDVSSDESLWDLYERW-RSHHTVSRNLNEKQKRFNVFKS  65

Query  261   NVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE--  434
             NV+++   N M+  YKL  NKFADMTN E+K+ Y   K++ H+       + G  + E  
Sbjct  66    NVMHVHNTNKMDKPYKLKLNKFADMTNHEFKTTYAGTKVNHHRMFRGTPRVSGTFMYENF  125

Query  435   --FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN-  605
                P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T +LV LSEQ+L+DC+ 
Sbjct  126   TKAPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNRLVPLSEQELIDCDN  185

Query  606   --KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-E  776
                 GC GG  E A+++IK+ GG+T E  YPY   DG C+   E   TV+I G+  VP  
Sbjct  186   QENQGCNGGLMEYAFEYIKQKGGVTTESYYPYTANDGSCDATKENVPTVSIDGHETVPAN  245

Query  777   DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYW  953
             DE  L  A A QPV+  +DA   DF+FYSEG+F   C + LNHGV +VGYG   +G  YW
Sbjct  246   DEDALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCGKELNHGVAIVGYGTTVDGTNYW  305

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +V+NSWG  WGE G I+M+R   +K G CGIAM ASYP+K S
Sbjct  306   IVRNSWGAEWGEQGCIRMKRNVSNKEGLCGIAMEASYPVKNS  347



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 156/336 (46%), Positives = 210/336 (63%), Gaps = 12/336 (4%)
 Frame = +3

Query  81    CFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             CF + L++ L +  + +  +   D   V M  R++ W+ ++G+ Y+D  E E+R++I++ 
Sbjct  7     CFVLKLIV-LGVWVSGATARGIAD---VPMSTRHEQWMAQYGRVYKDAVEKERRFQIFKD  62

Query  261   NVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
             N  YIE  N + N  YKL  N+FADMTN E+K+ +L +K     K S   +     L + 
Sbjct  63    NSNYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLGFKPMRLTK-STTGSFQYANLTDV  121

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN----  605
              +S+DWR  GAVT VKDQGSCG  WAF ++AA+EGI QI TG LVSLSEQQLVDC+    
Sbjct  122   SDSMDWRTRGAVTPVKDQGSCGCCWAFSSIAAIEGITQINTGNLVSLSEQQLVDCDVKDG  181

Query  606   KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDE  782
              +GC GG   +A+ ++  NGGIT E+NYPY+  DG C+T    S   TISGY  VP  DE
Sbjct  182   NNGCNGGLMTRAFQYVIDNGGITTENNYPYMAADGTCDTDRASSSAATISGYENVPVNDE  241

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLV  959
               L  A + QPV+  +D    DF+ YS GIF   C   ++H VT +GYG  E+G  YWL+
Sbjct  242   SSLLQAVSNQPVSVGIDGGGQDFQHYSSGIFTGPCKTNMDHAVTAIGYGTAEDGTKYWLI  301

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWGT WGE GY+++QR  G   G CGIA +ASYP
Sbjct  302   KNSWGTTWGEKGYMRIQRDVGAPEGLCGIAKLASYP  337



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 208/339 (61%), Gaps = 14/339 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K +C +++L+L        S    +       M  RY+ WL ++G+ Y D +E E R++I
Sbjct  10    KYMCLSLILMLGAWSSGATSRTLQD-----ASMYGRYEQWLTRYGRVYNDVNEKETRFKI  64

Query  252   YQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV +IE  N   N  Y+L  N+FAD+TN E+K+    +K  E   ++ +F    +  
Sbjct  65    FKENVAFIESSNKDANKPYRLSVNQFADLTNEEFKASRNGFKGHECSTKT-SFKYENL-T  122

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
                P ++DWRK GAVT +KDQG CG  WAF AVAA EGI Q+ TGKL+SLSEQ+LVDC+ 
Sbjct  123   ASLPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDT  182

Query  609   ----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GCEGG  + A+ FI++N GI+ E NYPY G DG C    E S    I+G+  VP 
Sbjct  183   AGEDQGCEGGLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPA  242

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
             + E  L  A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  Y
Sbjct  243   NSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKY  302

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWGT WGE GYI+MQR      G CGIAM ASYP
Sbjct  303   WLVKNSWGTEWGEAGYIRMQRDVAAGEGLCGIAMAASYP  341



>gb|ACJ85307.1| unknown [Medicago truncatula]
 gb|AFK41815.1| unknown [Medicago truncatula]
Length=362

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 211/342 (62%), Gaps = 11/342 (3%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
               I+L + L L  + SF+ H+ D S    +   Y+ W + H     + +E +KR+ +++ 
Sbjct  7     LLIVLSIALVLVVSESFDFHDKDVSSDESLWDLYERW-RSHHTVSRNLNEKQKRFNVFKS  65

Query  261   NVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPE--  434
             NV+++   N M+  YKL  NKFADMTN E+K+ Y   K++ H+       + G  + E  
Sbjct  66    NVMHVHNTNKMDKPYKLKLNKFADMTNHEFKTTYAGSKVNHHRMFRGTPRVSGTFMYENF  125

Query  435   --FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN-  605
                P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T +LV LSEQ+L+DC+ 
Sbjct  126   TKAPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNRLVPLSEQELIDCDN  185

Query  606   --KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-E  776
                 GC GG  E A+++IK+ GG+T E  YPY   DG C+   E   TV+I G+  VP  
Sbjct  186   QENQGCNGGLMEYAFEYIKQKGGVTTESYYPYTANDGSCDATKENVPTVSIDGHETVPAN  245

Query  777   DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYW  953
             DE  L  A A QPV+  +DA   DF+FYSEG+F   C + LNHGV +VGYG   +G  YW
Sbjct  246   DEDALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCGKELNHGVAIVGYGTTVDGTNYW  305

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +V+NSWG  WGE G I+M+R   +K G CGIAM ASYP+K S
Sbjct  306   IVRNSWGAEWGEQGCIRMKRNVSNKEGLCGIAMEASYPVKNS  347



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 210/342 (61%), Gaps = 8/342 (2%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++ KN  + I L + LC+   A F+          M +R++ W+ ++GK Y+D  E EKR
Sbjct  1     MVAKNHFYHISLAMLLCMAFLA-FQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKR  59

Query  243   YEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             + I++ NV YIE FN + N  YKL  N+FAD+TN E+ +   R+K           T   
Sbjct  60    FRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKY  119

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P +VDWR+ GAVT +KDQG CG  WAF AVAA EGI+ + +GKL+SLSEQ+LVD
Sbjct  120   ENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVD  179

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GCEGG  + A+ F+ +N G+  E NYPY G DG+C      ++  TI+GY  
Sbjct  180   CDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNANEAANNAATITGYED  239

Query  768   VPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-G  941
             VP  +E  LQ A A QPV+  +DAS  DF+FY  G+F   C   L+HGVT VGYG  N G
Sbjct  240   VPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDG  299

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  300   TEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYP  341



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 208/342 (61%), Gaps = 8/342 (2%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             ++ KN    I L + LC+   A F+          M +R++ W+ ++GK Y+D  E EKR
Sbjct  1     MVAKNHFCHISLAMLLCMAFLA-FQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKR  59

Query  243   YEIYQYNVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             + I++ NV YIE FN + N  YKL  N+FAD+TN E+ +   R+K           T   
Sbjct  60    FRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKY  119

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P +VDWR+ GAVT +KDQG CG  WAF AVAA EGI+ + +GKL+SLSEQ+LVD
Sbjct  120   ENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVD  179

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+      GCEGG  + A+ F+ +N G+  E NYPY G DG+C      +   TI+GY  
Sbjct  180   CDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNVNEAANDAATITGYED  239

Query  768   VP-EDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEEN-G  941
             VP  +E  LQ A A QPV+  +DAS  DF+FY  G+F   C   L+HGVT VGYG  N G
Sbjct  240   VPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDG  299

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  300   TEYWLVKNSWGTEWGEEGYIRMQRGVNSEEGLCGIAMQASYP  341



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 212/339 (63%), Gaps = 14/339 (4%)
 Frame = +3

Query  72    KNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEI  251
             K +C  ++L++    ++ A+    +       M  RY+ W+ ++G+ Y D +E EKR++I
Sbjct  8     KCLCLALILMMFGGWYSEATSRTLQ----DASMYGRYEQWMARYGRVYNDINEKEKRFQI  63

Query  252   YQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRL  428
             ++ NV  +E  N+  +  Y L  N+FAD+TN E+ +   R+K  E   ++ +F      +
Sbjct  64    FKENVAIVESSNNDASKPYTLSVNQFADLTNEEFIASRNRFKGHECSTKTMSFKYENFTV  123

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN-  605
             P    +VDWR+ GAVT VKDQG CG  WAF AVAA+EGI Q+ TGKL+SLSEQ+LVDC+ 
Sbjct  124   PA---TVDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDV  180

Query  606   ---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE  776
                  GCEGG  + A+DFI +N G++ E +YPY G DG C    E SH  +I+G+  VP 
Sbjct  181   NGEDQGCEGGLMDNAFDFINQNHGLSTEAHYPYTGVDGTCNAQKEASHAASITGHEDVPA  240

Query  777   D-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPY  950
             + E  L  A A QP++  +DAS  DF+ YS G+F   C  +L+HGVT VGYG  ++G  Y
Sbjct  241   NSESALLKAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGISDDGTKY  300

Query  951   WLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WLVKNSWG  WGE+GYI+MQR      G CGIAM ASYP
Sbjct  301   WLVKNSWGAQWGEEGYIRMQRDVDAPEGLCGIAMAASYP  339



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 203/332 (61%), Gaps = 9/332 (3%)
 Frame = +3

Query  96    LLLPLCLHTNASFEQHEMDS-HHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLY  272
             + L L L   A   Q    S     +  RY+ WL ++G+ Y D DE E R++I++ NV +
Sbjct  1     MCLGLILMLGAWSSQATSRSLQDASIYARYEQWLARYGRVYNDVDEKEIRFKIFKENVAF  60

Query  273   IEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESV  449
             IE  N   N  +KL  N+FAD+TN E+K+    +K  E   ++ +F    V     P ++
Sbjct  61    IESSNKDANKPHKLSVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVT-AALPATM  119

Query  450   DWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGC  617
             DWRK GAVT VKDQG CG  WAF AVAA EG+ Q+ TGKL+SLSEQ+LVDC+      GC
Sbjct  120   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGC  179

Query  618   EGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLq  794
             EGG  + A+ FI++N GI+ E NYPY G DG C T  E      I+G+  VP + E  L 
Sbjct  180   EGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  239

Query  795   aaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLVKNSW  971
              A A QPV+  +DAS  DF+FYS G+F   C  +L+HGVT VGYG  E+G  YWLVKNSW
Sbjct  240   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  972   GTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             G  WGE GYI+MQR      G CGIAM ASYP
Sbjct  300   GAEWGEAGYIRMQRDVAAPEGLCGIAMSASYP  331



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score =   281 bits (719),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 198/333 (59%), Gaps = 7/333 (2%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVL  269
             I LL+ L L    S        + + M KR+ +W+ KHG+ Y D  E   RY +++ NV 
Sbjct  8     ICLLVSLILSIWFSIALSRPLENELIMQKRHIEWMTKHGRVYADMKEKNNRYVVFKSNVE  67

Query  270   YIEFFNSMNFS--YKLIDNKFADMTNSEYKSVYLRYK-IDEHKKESHNFTLHGVRLPEFP  440
              IE  NSM+    +KL  N+FAD+TN E++S Y  YK +         F    V     P
Sbjct  68    RIELLNSMSAGRPFKLAVNQFADLTNDEFRSTYTGYKGLSTLSSLGQTFRYQNVSSGGLP  127

Query  441   ESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC--NKHG  614
              SVDWR  GAVT +KDQ SCG  WAF AVAA+EG  QI+ GKL+SLSEQQLVDC  N  G
Sbjct  128   ISVDWRTKGAVTPIKDQRSCGCCWAFSAVAAIEGAAQIKKGKLISLSEQQLVDCDTNNFG  187

Query  615   CEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DEGFL  791
             CEGG  + A++ IK  GG+T E NYPY G+DG C +        +I+GY  VP  DE  L
Sbjct  188   CEGGLMDTAFEHIKATGGLTTESNYPYKGEDGSCNSKKTNPKATSITGYEDVPANDENAL  247

Query  792   qaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLVKNS  968
               A A QPV+  ++    DF+FYS G+F   C   L+H VT +GYGE  NG  YW++KNS
Sbjct  248   MKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNS  307

Query  969   WGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WG  WGE GY+++Q+    K G CG+AM ASYP
Sbjct  308   WGKKWGESGYMRIQKDVKAKEGLCGLAMKASYP  340



>ref|XP_009774957.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=362

 Score =   282 bits (721),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 168/351 (48%), Positives = 216/351 (62%), Gaps = 17/351 (5%)
 Frame = +3

Query  54    KVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEW  233
             K+FL+L    F++ L+L L    +  F++ E+++    + + Y+ W + H       DE 
Sbjct  5     KIFLVL----FSLALVLRLGEAFD--FQEKELETEE-SLWELYERW-RSHHTVSRSLDEK  56

Query  234   EKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK----ESH  401
              KR+ +++ NV Y+  FN  +  YKL  NKFADMTN E++S Y   K+  ++      S 
Sbjct  57    HKRFNVFKANVHYVHDFNKKDKPYKLKLNKFADMTNHEFRSHYAGSKVKHYRALQGTPSG  116

Query  402   NFTLHGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLS  581
             N +     +   P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T KL+SLS
Sbjct  117   NGSFMYANVNNVPPSVDWRKKGAVTPVKDQGQCGSCWAFSTVVAVEGINQIKTNKLISLS  176

Query  582   EQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTI  752
             EQ+LVDC+     GC GG  + A+DFIK+ GGIT E NYPY   DG+C    E S  V+I
Sbjct  177   EQELVDCDTRQNQGCNGGLMDLAFDFIKKKGGITTEDNYPYRAADGKCNIQKENSPAVSI  236

Query  753   SGYTKV-PEDEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG  929
              G+  V P +E  L  AAA QP+A  +DAS  DF+FYSEG++   C   L+HGV VVGYG
Sbjct  237   DGHEDVPPNNEDALLKAAANQPIAVAIDASGSDFQFYSEGVYTGDCGTELDHGVAVVGYG  296

Query  930   EE-NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
                +G  YW VKNSWG  WGE GYI+MQR    K G CGIAM  SYP+K S
Sbjct  297   TTVDGTKYWTVKNSWGAEWGEKGYIRMQRGIDAKEGLCGIAMEPSYPIKTS  347



>ref|XP_004239155.1| PREDICTED: vignain-like [Solanum lycopersicum]
Length=358

 Score =   281 bits (720),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 210/355 (59%), Gaps = 28/355 (8%)
 Frame = +3

Query  54    KVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEW  233
             K+FLI      ++ L +   L  +  F + ++ S    +   YQ W + H     D  E 
Sbjct  6     KIFLI------SLSLAMIFGLVNSLEFTEKDIASEE-NLWDLYQKW-RSHHTVSRDLTEK  57

Query  234   EKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTL  413
             +KR+ +++ NV++I   N M+  YKL  NKFADMTN E+++ Y         K  H   L
Sbjct  58    QKRFNVFKANVMHIHNVNKMDRPYKLKLNKFADMTNHEFRNFY-------SSKIKHFRML  110

Query  414   HGVR---------LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGK  566
             HG R             P SVDWRK GAVT VKDQG CGS WAF  +  VEGIN+I+TGK
Sbjct  111   HGPRPTTGFMHDKADNLPASVDWRKKGAVTGVKDQGKCGSCWAFSTIVGVEGINKIKTGK  170

Query  567   LVSLSEQQLVDCNK--HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESH  740
             LVSLSEQ+LVDC K   GC GG  E AY+FIK+NGGIT E  YPY   D RC+++   S 
Sbjct  171   LVSLSEQELVDCEKDNEGCNGGLMENAYEFIKKNGGITTERIYPYKASDSRCDSLKRNSP  230

Query  741   TVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTV  917
              V I G+  VPE DE  L  A A QP++  +DAS  D +FYSEG+F   C   L+HGV V
Sbjct  231   VVNIDGHEMVPEKDEDALMKAVANQPISVAIDASGSDLQFYSEGVFTGNCGTELDHGVAV  290

Query  918   VGYGE-ENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             VGYG   +G  YW+VKNSWGT WGE GY +MQR    + G CGI M ASYP+K S
Sbjct  291   VGYGSTHDGTKYWIVKNSWGTEWGEQGYFRMQRGIDAEEGLCGITMEASYPVKLS  345



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 214/338 (63%), Gaps = 16/338 (5%)
 Frame = +3

Query  78    VCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQ  257
             V F  +L+L + +    S      D +   + ++++ W+   G+ Y+D  E  KR++I++
Sbjct  10    VAFGALLVLEMFVSQATS-----RDLYEASIFQKHKQWMSLFGRVYKDDIEKAKRFKIFK  64

Query  258   YNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKIDEHKK--ESHNFTLHGVRL  428
              N  YIEF N +    Y L  N+FAD++N E+K+    YK+  H++  +S +F    V  
Sbjct  65    DNFEYIEFVNKVGTRPYILGINEFADLSNEEFKASRNGYKMYSHQQLSKSTSFKYENVTA  124

Query  429   PEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK  608
             P    ++DWR  GAVT +KDQG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+ 
Sbjct  125   PA---TMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDT  181

Query  609   H---GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED  779
                 GCEGG  + A+ FI +N G+T E NYPY G D  C+T  E +H   I+GY  VP++
Sbjct  182   RSDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTDATCKTGKESNHAAKITGYEDVPDN  241

Query  780   -EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYW  953
              E  L  A A QP++  +DAS  DF+FYS G+F   C   L+HGVT VGYG+  +G  YW
Sbjct  242   SESALLKAVANQPISVAIDASGSDFQFYSSGVFTGKCGTELDHGVTAVGYGKIGDGTKYW  301

Query  954   LVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             LVKNSWGT+WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  302   LVKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYP  339



>gb|AFK47737.1| unknown [Medicago truncatula]
Length=359

 Score =   281 bits (720),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 160/351 (46%), Positives = 216/351 (62%), Gaps = 25/351 (7%)
 Frame = +3

Query  69    LKNVCFTIML---LLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEK  239
             + ++  T +L   L+ L L  + S   +E       ++  Y++WL KH K Y    E ++
Sbjct  1     MASITITSLLFFSLITLSLAMDTSMRSNE------EVMTMYEEWLVKHHKVYNGLGEKDQ  54

Query  240   RYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKK-------ES  398
             R+EI++ N+ +I+  N+ N++YK+  NKFAD TN EY+++YL  K D  +          
Sbjct  55    RFEIFKDNLGFIDEHNAQNYTYKVGLNKFADTTNEEYRNMYLGTKNDAKRNVMKIKITTG  114

Query  399   HNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVS  575
             H +  + G RLP     VDWR  GAV H+KDQGSCGS WAF  +A VE IN+I TGKLVS
Sbjct  115   HRYAFNSGDRLPV---HVDWRSKGAVAHIKDQGSCGSCWAFSTIATVEAINKIVTGKLVS  171

Query  576   LSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTV  746
             LSEQ+LVDC++    GC GG  + A++FI  NGGI  E +YPY G +GRC+   + +  V
Sbjct  172   LSEQELVDCDRAFNEGCNGGLMDYAFEFIVENGGIDTEQDYPYKGFEGRCDPTRKNAKVV  231

Query  747   TISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVG  923
             +I GY  VP  +E  L+ A   QPV+  ++A     + Y  G+F   C   L+HGV VVG
Sbjct  232   SIDGYEDVPAYNENALKKAVFHQPVSVAIEAGGRALQLYQSGVFTGRCGTNLDHGVVVVG  291

Query  924   YGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKN-GKCGIAMMASYPLK  1073
             YG ENG  YWLV+NSWGTNWGEDGY K++R     N GKCGIAM ASYP+K
Sbjct  292   YGFENGVDYWLVRNSWGTNWGEDGYFKLERNVKKINTGKCGIAMQASYPVK  342



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 215/343 (63%), Gaps = 13/343 (4%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             L +  +   I+L+L L  +   S     +    + M++R+++W++++G+ Y++++E   R
Sbjct  3     LSIAKISVFIVLILTLWAYQTTS----RLVPERLAMLERHEEWMERYGRVYKNEEEKMMR  58

Query  243   YEIYQYNVLYIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             Y+I++ NV +IE FN+     YKL  N FAD TN E+K+   R  + + +K S       
Sbjct  59    YKIFKDNVEFIEAFNAAGTRPYKLGINAFADQTNEEFKAA--RNGLFKVQKLSKATPFKY  116

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               +   P S+DWRK GAVT VKDQG CGS WAF A+AA EGINQI TGKL+SLSEQ++VD
Sbjct  117   ENVSALPSSMDWRKKGAVTPVKDQGQCGSCWAFSAIAATEGINQISTGKLISLSEQEIVD  176

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+K     GCEGG  E A++FI  N GI +E  YPY   DG C    E      I+ Y K
Sbjct  177   CDKTSQDQGCEGGYMEDAFEFIIDNKGIASESTYPYSATDGTCNKKEESPIAAKITSYEK  236

Query  768   VPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENG  941
             VPE +E  L  A A+QPV+  +DA   +F+FYS G+F   C   L+HGVT VGYG+  +G
Sbjct  237   VPENNEKALLKAVAKQPVSVSIDAGGMEFQFYSSGVFTGDCGTDLDHGVTAVGYGKTSDG  296

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPL  1070
               YWLVKNSWGT+WGE+GYI M+R    K G CGIAM +SYP+
Sbjct  297   TKYWLVKNSWGTSWGEEGYIMMERDVAAKEGLCGIAMDSSYPI  339



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 225/355 (63%), Gaps = 16/355 (5%)
 Frame = +3

Query  48    VMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVR----MVKRYQDWLQKHGKRY  215
             + K+ ++   + FT+ L L +C+    S+++   D    R    ++  Y++WL KHGK Y
Sbjct  2     LSKLTILFITLTFTLSLALDMCI---ISYDKTHPDKSTPRTNDQVLTMYEEWLVKHGKNY  58

Query  216   EDKDEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKID---EH  386
                 E EKR+EI++ N+ +I+  NS N S++L  N+FAD+TN EY++ +L  +I+    +
Sbjct  59    NALGEKEKRFEIFKDNLGFIDEHNSKNLSFRLGLNRFADLTNEEYRTRFLGTRINPNRRN  118

Query  387   KKESHNFTLHGVRLPE-FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETG  563
             +K +     +  R+ +  PESVDWRK GAV  VKDQGSCGS WAF A+AAVEG+N++ TG
Sbjct  119   RKVNSQTNRYATRVGDKLPESVDWRKEGAVVGVKDQGSCGSCWAFSAIAAVEGVNKLATG  178

Query  564   KLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEE  734
              L+SLSEQ+LVDC+     GC GG  + A++FI     +T E +YPY   DGRC+   + 
Sbjct  179   DLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIINMVALTPEEDYPYRAIDGRCDQNRKN  238

Query  735   SHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGV  911
             +  V+I  Y  VP  DEG L+ A A Q +A  V+    +F+ Y  G+F   C   L+HGV
Sbjct  239   AKVVSIDQYEDVPAYDEGALKKAVANQVIAVAVEGGGREFQLYDSGVFTGRCGTALDHGV  298

Query  912   TVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
               VGYG ENG+ YW+V+NSWG +WGE GYI+++R  +  K+GKCGIA+  SYP+K
Sbjct  299   AAVGYGTENGKDYWIVRNSWGGSWGEAGYIRLERNLATSKSGKCGIAIEPSYPIK  353



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 158/342 (46%), Positives = 209/342 (61%), Gaps = 10/342 (3%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             L  +++C   ++ L L +   A+ +          + ++++ W+ K+GK Y++ +E EKR
Sbjct  3     LRCQSLCKLALIFLILAI---AASQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKR  59

Query  243   YEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHG  419
             + I++ NV +IE  N+  N  YKL  N+FAD TN E+K+    Y+  +        +   
Sbjct  60    FRIFKDNVEFIESLNAAGNKPYKLSINEFADQTNQEFKAFRNGYRRPDGLTSRKGTSFKY  119

Query  420   VRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVD  599
               + + P ++DWRK+GAVT +K+QG CGS WAF AVAA EGI Q+ TGKL+SLSEQ+LV 
Sbjct  120   ENVIDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVS  179

Query  600   CNK----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTK  767
             C+     HGCEGG  E A+ FI  N GIT E NYPY   DG C    E SH   I GY  
Sbjct  180   CDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAVDGTCNKTNEASHVAKIKGYET  239

Query  768   VPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENG  941
             VP + E  L  A A QPVA  +DAS   F+FYS G+F   C   L+HGVT VGYG   NG
Sbjct  240   VPANSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANG  299

Query  942   QPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
               YWLVKNSWGT+WGE+GYI+M+R    K G CGIAM +SYP
Sbjct  300   TKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYP  341



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 156/334 (47%), Positives = 211/334 (63%), Gaps = 11/334 (3%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVL  269
             +  +  L +     F+      +   MV++++ W+ + G+ Y++  E  KR++I++ N+ 
Sbjct  9     LAFVAALLVFGMQDFQATSRGLYETSMVQKHEQWMTRFGRVYKNDVEKAKRFKIFKDNID  68

Query  270   YIEFFNSMNF-SYKLIDNKFADMTNSEYKSVYLRYKIDEHKK--ESHNFTLHGVRLPEFP  440
             YI+ FN     SYKL  N+FAD+TN E+++ +  YK+   KK  E  +F    V  P   
Sbjct  69    YIDSFNKAGTKSYKLDINEFADLTNDEFRATHNGYKMPFQKKSPEITSFKYENVTAPA--  126

Query  441   ESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNKH---  611
              ++DWR  GAVT +K+QG CG  WAF AVAA EGIN+I+TGKL+SLSEQ+LVDC+     
Sbjct  127   -TMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDM  185

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGF  788
             GCEGG  + A+ FI +N G+T E NYPY G D  C+T  E +H   I+ Y  VP + E  
Sbjct  186   GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESS  245

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLVKN  965
             L  A A QPV+  +DAS  DF+FYS G+F   C   L+HGVT VGYGE  +G  YWLVKN
Sbjct  246   LLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKN  305

Query  966   SWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             SWGT+WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  306   SWGTSWGENGYIRMQRNVDAEEGLCGIAMEASYP  339



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 213/344 (62%), Gaps = 15/344 (4%)
 Frame = +3

Query  63    LILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKR  242
             L+ K     I L   L +  +   +    + H   MV+R++ W+ KHGK Y+D +E  +R
Sbjct  3     LLCKGQFLLIALFFVLAMWAD---QASTRELHESTMVERHEKWMAKHGKVYKDDEEKLRR  59

Query  243   YEIYQYNVLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYK--IDEHKKESHNFTL  413
             ++I++ NV +IE  N+  N SY L  N+FAD+TN E+++ +  YK  +D  +  +  F  
Sbjct  60    FQIFKNNVEFIESSNAAGNNSYMLGINRFADLTNEEFRASWNGYKRPLDASRIVTP-FKY  118

Query  414   HGVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQL  593
               V     P S+DWR+ GAVT +KDQ  CGS WAF AVAA EG++++ TGKLVSLSEQ+L
Sbjct  119   ENV--TALPYSMDWRRKGAVTSIKDQRECGSCWAFSAVAATEGVHKLRTGKLVSLSEQEL  176

Query  594   VDCN----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGY  761
             VDC+      GC+GG  E A+ FIKRNGGIT E NY Y G+DG+C+T  E SH   I+GY
Sbjct  177   VDCDVKGEDKGCQGGLMEDAFKFIKRNGGITTEANYAYRGRDGKCDTKKEASHVAKITGY  236

Query  762   TKVPED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EE  935
               VPE+ E  L  A A QPV+  +DA    F+FY  GI+   C   LNHGV  VGYG   
Sbjct  237   QVVPENSEAALLKAVAHQPVSVSIDAGSMSFQFYQSGIYAGSCGSDLNHGVAAVGYGTSS  296

Query  936   NGQPYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             +G  YW+VKNSWG  WGE GY++M+R    + G CGIAM  SYP
Sbjct  297   SGSKYWIVKNSWGPEWGERGYVRMKRDITSRKGLCGIAMDCSYP  340



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/340 (47%), Positives = 213/340 (63%), Gaps = 17/340 (5%)
 Frame = +3

Query  72    KNVCFTIMLLL-PLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYE  248
             K +CF ++ +L  L  H  +   Q         M  +Y+ W+ ++G+ Y D +E EKR+ 
Sbjct  210   KCMCFALIFMLGALSSHATSRTLQD------ASMYGKYEQWMARYGRVYTDINEKEKRFN  263

Query  249   IYQYNVLYIEFFNS-MNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVR  425
             I++ NV +IE  N+  N  YKL  N+FAD+TN E+K+   R+   E   ++ +F    V 
Sbjct  264   IFKANVDFIESSNNDANKPYKLKVNQFADLTNEEFKTSRNRFMGHECSTKTTSFKYENVT  323

Query  426   LPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN  605
              P    +VDWRK GAVT +KDQG CG  WAF AVAA++GI ++ TGKL+SLSEQ+LVDC+
Sbjct  324   APA---TVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMKGITKLTTGKLISLSEQELVDCD  380

Query  606   K----HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP  773
                   GCEGG  + A+ FI +N G++ E NYPY G DG C T  E SH  TI+G+  VP
Sbjct  381   TSSVDQGCEGGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKNEASHAATITGHEDVP  440

Query  774   ED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQP  947
              + E  L  A A QP++ V+DA   DF+FYS G+F   C  +L+HGVT VG+G   +G  
Sbjct  441   ANSEAALLKAVANQPISVVIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTK  500

Query  948   YWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             YWLVKNSWG  WGE+GYI+MQR    K G CGIAM ASYP
Sbjct  501   YWLVKNSWGAEWGEEGYIRMQRDVEVKEGLCGIAMEASYP  540



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 205/333 (62%), Gaps = 13/333 (4%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
               ++LLL +C     S   HE       M +R++ W++K+GK Y+D  E +KR  I++ N
Sbjct  11    LALVLLLSICTSQVMSRNLHE-----ASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDN  65

Query  264   VLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFP  440
             V +IE FN+  N  YKL  N  AD TN E+ + +  YK   HK            +   P
Sbjct  66    VEFIESFNAAGNRPYKLSINHLADQTNEEFVASHNGYK---HKGSHSQTPFKYENVTGVP  122

Query  441   ESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--HG  614
              +VDWR++GAVT VKDQG CGS WAF  VAA EGI QI T  L+SLSEQ+LVDC+   HG
Sbjct  123   NAVDWRENGAVTAVKDQGQCGSCWAFSTVAATEGIYQITTSMLMSLSEQELVDCDSVDHG  182

Query  615   CEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFL  791
             C+GG  E  ++FI +NGGI++E NYPY   DG C+   E S    I GY  VP + E  L
Sbjct  183   CDGGYMEGGFEFIIKNGGISSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANSEDAL  242

Query  792   qaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLVKNS  968
             Q A A QPV+  +DA    F+FYS G+F   C   L+HGVT VGYG  ++G  YW+VKNS
Sbjct  243   QKAVANQPVSVTIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNS  302

Query  969   WGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             WGT WGE+GYI+MQR +  + G CGIAM ASYP
Sbjct  303   WGTQWGEEGYIRMQRGTDAQEGLCGIAMDASYP  335



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/336 (46%), Positives = 208/336 (62%), Gaps = 14/336 (4%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMDSHHVR---MVKRYQDWLQKHGKRYEDKDEWEKRYEIYQY  260
             I L +  C+    +F   ++ S  ++   + +R+++W+ ++ + Y+D  E EKR+ I++ 
Sbjct  10    ISLAMLFCM----AFWALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFRIFKQ  65

Query  261   NVLYIEFFN-SMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEF  437
             N+ YIE FN + N  YKL  N+FAD+TN E+ +   R+K           T     +   
Sbjct  66    NMNYIEAFNNAANKPYKLAINQFADLTNEEFIAPRNRFKGHMRSSIIKTTTFKYENVTSV  125

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK---  608
             P +VDWR+ GAVT VKDQG CG  WAF AVA+ EGI+Q+ TGKL+SLSEQ+LVDC+    
Sbjct  126   PSTVDWRQKGAVTPVKDQGQCGCCWAFSAVASAEGIHQLTTGKLISLSEQELVDCDTKGV  185

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPE-DE  782
               GCEGG  + A+ FI +N G+  E NYP+ G DG C   A  SH  TI GY  VP  +E
Sbjct  186   DQGCEGGLMDDAFKFIIQNNGLNTEANYPFKGVDGTCNAKAASSHAATIRGYEDVPANNE  245

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG-EENGQPYWLV  959
               LQ A   QPV+  +DAS  DF+FY  G+F   C   L+HGVT VGYG  ++G  YWLV
Sbjct  246   KALQKAVTNQPVSVAIDASGSDFKFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLV  305

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             KNSWGT WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  306   KNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYP  341



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/335 (49%), Positives = 209/335 (62%), Gaps = 16/335 (5%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
               ++LLL +C     S   HE       M +R++ W++K+GK Y+D  E +KR  I++ N
Sbjct  11    LALVLLLSICTSQVMSRNLHE-----ASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDN  65

Query  264   VLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFT-LHGVRLPEF  437
             V +IE FN+  N  YKL  N  AD TN E+ + +  YK     K SH+ T      + + 
Sbjct  66    VEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKY----KGSHSQTPFKYGNVTDI  121

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--H  611
             P +VDWR++GAVT VKDQG CGS WAF  VAA EGI QI TG L+SLSEQ+LVDC+   H
Sbjct  122   PTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSVDH  181

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGF  788
             GC+GG  E  ++FI +NGGI++E NYPY   DG C+   E S    I GY  VP + E  
Sbjct  182   GCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEA  241

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG--EENGQPYWLVK  962
             LQ A A QPV+  +DA    F+FYS G+F   C   L+HGVTVVGYG  ++    YW+VK
Sbjct  242   LQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVK  301

Query  963   NSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             NSWGT WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  302   NSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYP  336



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 201/331 (61%), Gaps = 7/331 (2%)
 Frame = +3

Query  96    LLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYI  275
             L L   +   A+ +          + ++++ W+ K+GK Y++ +E EKR+ I++ NV +I
Sbjct  11    LALIFLIFATATSQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFI  70

Query  276   EFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVD  452
             E  N+  N  YKL  N+FAD TN E+K+    Y+           +     + + P ++D
Sbjct  71    ESLNAAGNKPYKLSVNEFADQTNQEFKAFRNGYRRPNGLASRKGTSFKYENVIDVPATMD  130

Query  453   WRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK----HGCE  620
             WRK+GAVT +K+QG CGS WAF AVAA EGI Q+ TGKL+SLSEQ+LV C+     HGCE
Sbjct  131   WRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCE  190

Query  621   GGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqa  797
             GG  E A+ FI  N GIT E NYPY   DG C    E SH   I GY  VP + E  L  
Sbjct  191   GGEMEDAFKFIIHNDGITTEANYPYQAADGTCNKTKEASHVAKIKGYETVPANSEEALLK  250

Query  798   aaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQPYWLVKNSWG  974
             A A QPVA  +DAS   F+FYS G+F   C   L+HGVT VGYG   NG  YWLVKNSWG
Sbjct  251   AVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWG  310

Query  975   TNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             T+WGE+GYI+M+R    K G CGIAM +SYP
Sbjct  311   TSWGEEGYIRMKRDIDAKEGLCGIAMDSSYP  341



>ref|XP_007137980.1| hypothetical protein PHAVU_009G170800g [Phaseolus vulgaris]
 gb|ESW09974.1| hypothetical protein PHAVU_009G170800g [Phaseolus vulgaris]
Length=362

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 206/340 (61%), Gaps = 11/340 (3%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             ++L   L L    SF+ H+ D +    +   Y+ W + H        E  KR+ +++ N+
Sbjct  9     VVLSFSLVLGVANSFDFHDKDLASEESLWDLYERW-RSHHTVSRSLGEKHKRFNVFKANL  67

Query  267   LYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPE  434
             +++   N M+  YKL  NKFADMTN E++S Y   K++ H+        N      ++  
Sbjct  68    MHVHNTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRGTPHENGAFMYEKVVS  127

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T KLV+LSEQ+LVDC+K  
Sbjct  128   VPPSVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVALSEQELVDCDKEE  187

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDE  782
               GC GG  E A++FIK+ GGIT E NYPY  ++G C+        V+I G+  VP  DE
Sbjct  188   NQGCNGGLMESAFEFIKQKGGITTESNYPYKAQEGTCDASKVNDLAVSIDGHENVPANDE  247

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLV  959
               L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV +VGYG   +G  YW+V
Sbjct  248   DALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTDLNHGVAIVGYGTTVDGTNYWIV  307

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +NSWG  WGE GYI+MQR    K G CGIAM+ SYP+K S
Sbjct  308   RNSWGPEWGEHGYIRMQRNISKKEGLCGIAMLPSYPIKNS  347



>emb|CAA40073.1| endopeptidase (EP-C1) [Phaseolus vulgaris]
Length=361

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 206/340 (61%), Gaps = 11/340 (3%)
 Frame = +3

Query  90    IMLLLPLCLHTNASFEQHEMD-SHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNV  266
             ++L   L L    SF+ H+ D +    +   Y+ W + H        E  KR+ +++ N+
Sbjct  8     VVLSFSLVLGVANSFDFHDKDLASEESLWDLYERW-RSHHTVSRSLGEKHKRFNVFKANL  66

Query  267   LYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYLRYKIDEHK----KESHNFTLHGVRLPE  434
             +++   N M+  YKL  NKFADMTN E++S Y   K++ H+        N      ++  
Sbjct  67    MHVHNTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRGTPHENGAFMYEKVVS  126

Query  435   FPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--  608
              P SVDWRK GAVT VKDQG CGS WAF  V AVEGINQI+T KLV+LSEQ+LVDC+K  
Sbjct  127   VPPSVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVALSEQELVDCDKEE  186

Query  609   -HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVP-EDE  782
               GC GG  E A++FIK+ GGIT E NYPY  ++G C+        V+I G+  VP  DE
Sbjct  187   NQGCNGGLMESAFEFIKQKGGITTESNYPYKAQEGTCDASKVNDLAVSIDGHENVPANDE  246

Query  783   GFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEE-NGQPYWLV  959
               L  A A QPV+  +DA   DF+FYSEG+F   C   LNHGV +VGYG   +G  YW+V
Sbjct  247   DALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTDLNHGVAIVGYGTTVDGTNYWIV  306

Query  960   KNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYPLKGS  1079
             +NSWG  WGE GYI+MQR    K G CGIAM+ SYP+K S
Sbjct  307   RNSWGPEWGEHGYIRMQRNISKKEGLCGIAMLPSYPIKNS  346



>emb|CAA53377.1| cysteine protease [Vicia sativa]
Length=368

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 224/355 (63%), Gaps = 26/355 (7%)
 Frame = +3

Query  45    SVMKVFLILKNVCFTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDK  224
             +++  FL    + F+  L L + L T  S ++         ++  Y++WL KH K Y   
Sbjct  5     TILPFFLFFSLITFS--LALDIQLPTGRSNDE---------VMTMYEEWLVKHQKVYNGL  53

Query  225   DEWEKRYEIYQYNVLYIEFFNSMNFSYKLIDNKFADMTNSEYKSVYL------RYKIDEH  386
              E ++R++I++ N+ +I+  N+ N++Y +  NKFADMTN EY+ +YL      + +I ++
Sbjct  54    REKDQRFQIFKDNLNFIDEHNAQNYTYIVGLNKFADMTNEEYRDMYLGTRSDIKRRIMKN  113

Query  387   KKESHNFTLH-GVRLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETG  563
             K   H +  + G RLP     VDWR  GA+TH+KDQGSCGS WAF  +A VE IN+I TG
Sbjct  114   KITGHRYAYNSGDRLPV---HVDWRLKGAITHIKDQGSCGSCWAFSTIATVEAINKIVTG  170

Query  564   KLVSLSEQQLVDCNK---HGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEE  734
             KLVSLSEQ+LVDC++    GC GG  + A++FI  NGGI  + +YPY G +GRC+   ++
Sbjct  171   KLVSLSEQELVDCDRAFNEGCNGGLMDYAFEFIIGNGGIDTDQHYPYKGFEGRCDPTRKK  230

Query  735   SHTVTISGYTKVPE-DEGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGV  911
             +  V+I GY  VP  +E  L+ A A QPV+  ++AS    + Y  G+F   C  +L+H V
Sbjct  231   AKIVSIDGYEDVPSNNENALKKAVAHQPVSVAIEASGRALQLYQSGVFTGKCGTSLDHAV  290

Query  912   TVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRR-SGDKNGKCGIAMMASYPLK  1073
              +VGYG ENG  YWLV+NSWGTNWGEDGY KM+R   G   GKCGIA+ ASYP+K
Sbjct  291   VIVGYGSENGLDYWLVRNSWGTNWGEDGYFKMERNVKGTHTGKCGIAVEASYPVK  345



>ref|XP_009145796.1| PREDICTED: probable cysteine proteinase At3g19400 [Brassica rapa]
Length=450

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 206/319 (65%), Gaps = 13/319 (4%)
 Frame = +3

Query  150   DSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYNVLYIEFFNSM-NFSYKLIDNKF  326
             D  +   VK ++ WL ++ K Y    E +KR+EI+  NV +++  NS+ N SY+L   +F
Sbjct  32    DHRNSEEVKMFERWLVENHKNYNGLGEKDKRFEIFMDNVKFVQEHNSVPNQSYELGLTRF  91

Query  327   ADMTNSEYKSVYLRYKI----DEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTHVKDQG  494
             AD+TN E++++YLR K+    D  K E +   LH V   + P+ VDWR  GAV  VKDQG
Sbjct  92    ADLTNEEFRAIYLRSKMERTRDSVKSERY---LHNVG-DKLPDEVDWRAKGAVVPVKDQG  147

Query  495   SCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDFIKRNG  665
             SCGS WAF A+ AVEGINQI+TG+LVSLSEQ+LVDC+    +GC GG  + A+ FI  NG
Sbjct  148   SCGSCWAFSAIGAVEGINQIKTGELVSLSEQELVDCDTSYNNGCGGGLMDYAFQFIISNG  207

Query  666   GITAEHNYPYVGKDGR-CETIAEESHTVTISGYTKVPEDEGFLqaaaaqqpvaavvdaSM  842
             GI  E +YPY   D   C T  + +  VTI GY  VPE+E  L+ A A QP++  ++A  
Sbjct  208   GIDTEEDYPYTATDDNICNTDKKNTRVVTIDGYEDVPENENSLKKALANQPISVAIEAGG  267

Query  843   DDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKMQRRSG  1022
               F+ Y  G+F   C   L+HGV  VGYG   GQ YW+++NSWG+NWGE GYIK++R   
Sbjct  268   RAFQLYKSGVFTGTCGTALDHGVVAVGYGTSEGQDYWIIRNSWGSNWGESGYIKLERNIK  327

Query  1023  DKNGKCGIAMMASYPLKGS  1079
             D +GKCG+AMMASYP K S
Sbjct  328   DSSGKCGVAMMASYPTKSS  346



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/335 (49%), Positives = 209/335 (62%), Gaps = 16/335 (5%)
 Frame = +3

Query  84    FTIMLLLPLCLHTNASFEQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIYQYN  263
               ++LLL +C     S   HE       M +R++ W++K+GK Y+D  E +KR  I++ N
Sbjct  8     LALVLLLSICTSQVMSRNLHE-----ASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDN  62

Query  264   VLYIEFFNSM-NFSYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFT-LHGVRLPEF  437
             V +IE FN+  N  YKL  N  AD TN E+ + +  YK     K SH+ T      + + 
Sbjct  63    VEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKY----KGSHSQTPFKYGNVTDI  118

Query  438   PESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCNK--H  611
             P +VDWR++GAVT VKDQG CGS WAF  VAA EGI QI TG L+SLSEQ+LVDC+   H
Sbjct  119   PTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSVDH  178

Query  612   GCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGF  788
             GC+GG  E  ++FI +NGGI++E NYPY   DG C+   E S    I GY  VP + E  
Sbjct  179   GCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEA  238

Query  789   LqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYG--EENGQPYWLVK  962
             LQ A A QPV+  +DA    F+FYS G+F   C   L+HGVTVVGYG  ++    YW+VK
Sbjct  239   LQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVK  298

Query  963   NSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
             NSWGT WGE+GYI+MQR    + G CGIAM ASYP
Sbjct  299   NSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYP  333



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 210/341 (62%), Gaps = 19/341 (6%)
 Frame = +3

Query  90    IMLLLPLCLHTNASF-----EQHEMDSHHVRMVKRYQDWLQKHGKRYEDKDEWEKRYEIY  254
             + L L + L T A +      +   D+  +++  R+++W+ +HG  Y+D DE  KR+EI+
Sbjct  10    VYLALVISLGTWAKYNVEATSRSLQDASTLKI--RHEEWMSRHGIVYKDADEKAKRFEIF  67

Query  255   QYNVLYIEFFNSMNFS-YKLIDNKFADMTNSEYKSVYLRYKI---DEHKKESHNFTLHGV  422
             + NV  IE FN      YKL  NKFAD+TN E+ +   ++K    D  +  S +F    V
Sbjct  68    KENVARIEAFNRAAIKPYKLGINKFADLTNEEFITKRNKFKAHVCDSGRAISTSFKYENV  127

Query  423   RLPEFPESVDWRKSGAVTHVKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDC  602
                  P ++DWRK GAVT VKDQG CG  WAF  VAA+EGI ++ TGKL+SLSEQ+LVDC
Sbjct  128   --TSVPSALDWRKKGAVTPVKDQGQCGCCWAFSTVAAMEGITKLSTGKLLSLSEQELVDC  185

Query  603   N----KHGCEGGNTEKAYDFIKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKV  770
             +      GC GG  ++A+ FI+ NGG+T E NYPY G DG C    E +H   I+GY  V
Sbjct  186   DVKGEDQGCNGGLMDEAFKFIQHNGGLTTEANYPYEGVDGTCNAKKEATHAAKITGYEDV  245

Query  771   PED-EGFLqaaaaqqpvaavvdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGE-ENGQ  944
             P + E  L  A   QPV+  +DAS  +F+FYS G+F   C   L+HGVT VGYG  ++G 
Sbjct  246   PANSEKDLLKAVTHQPVSVAIDASGFEFQFYSGGVFTGACGTNLDHGVTAVGYGATKDGT  305

Query  945   PYWLVKNSWGTNWGEDGYIKMQRRSGDKNGKCGIAMMASYP  1067
              YWLVKNSWG  WGE GYI+MQR    K G CGIAMMASYP
Sbjct  306   KYWLVKNSWGKQWGEKGYIRMQRDVDAKEGLCGIAMMASYP  346



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 212/322 (66%), Gaps = 10/322 (3%)
 Frame = +3

Query  135   EQHEMDSHHVR----MVKRYQDWLQKHGKRYEDKDEWEK-RYEIYQYNVLYIEFFNSMNF  299
             E+H + + + R    + K Y++W+ KHGK+ ++    E  R+EI++ N+ +I+  N+ N 
Sbjct  30    EKHHISAVNGRSEAEVAKIYEEWMAKHGKKTQNGLLGEDHRFEIFKDNLRFIDEHNTKNL  89

Query  300   SYKLIDNKFADMTNSEYKSVYLRYKIDEHKKESHNFTLHGVRLPEFPESVDWRKSGAVTH  479
             SYKL   +FAD+TN EY+S+YL  K  +   ++ +  L  V     P+SVDWRK GAV  
Sbjct  90    SYKLGLTRFADLTNDEYRSIYLGAKPKKSVLKTSDRYLPRVG-DALPDSVDWRKEGAVAA  148

Query  480   VKDQGSCGSSWAFCAVAAVEGINQIETGKLVSLSEQQLVDCN---KHGCEGGNTEKAYDF  650
             VKDQGSCGS WAF  + AVEGIN+I TG L+SLSEQ+LVDC+     GC GG  + A++F
Sbjct  149   VKDQGSCGSCWAFSTIGAVEGINKIVTGHLISLSEQELVDCDTSYNQGCNGGLMDYAFEF  208

Query  651   IKRNGGITAEHNYPYVGKDGRCETIAEESHTVTISGYTKVPED-EGFLqaaaaqqpvaav  827
             I +NGGI  E +YPY   DGRC+   + +  VTI  Y  VPE+ E  L+ A A QP++  
Sbjct  209   IIKNGGIDTEEDYPYKAADGRCDQNRKNAKVVTIDDYEDVPENSEAALKKALAHQPISVA  268

Query  828   vdaSMDDFRFYSEGIFNPICPETLNHGVTVVGYGEENGQPYWLVKNSWGTNWGEDGYIKM  1007
             ++A    F+ YS G+F+ IC   L+HGV  VGYG ENG+ YW+V+NSWG +WGE GYIKM
Sbjct  269   IEAGGRAFQLYSSGVFDGICGTDLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYIKM  328

Query  1008  QRRSGDKNGKCGIAMMASYPLK  1073
             +R   +  GKCGIA+ ASYP+K
Sbjct  329   ERNIAEPTGKCGIAVEASYPIK  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3685527018540