BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31440_g1_i1 len=893 path=[871:0-892]

Length=893
                                                                      Score     E

emb|CDP02714.1|  unnamed protein product                                218   8e-67   
ref|XP_009629230.1|  PREDICTED: uncharacterized protein At1g66480...    207   1e-62   
ref|XP_007033077.1|  Plastid movement impaired 2                        207   4e-62   
ref|XP_009794002.1|  PREDICTED: uncharacterized protein At1g66480...    205   3e-61   
ref|XP_002284189.1|  PREDICTED: uncharacterized protein At1g66480       205   3e-61   Vitis vinifera
ref|XP_011023151.1|  PREDICTED: uncharacterized protein At1g66480...    202   4e-60   
ref|XP_002311497.1|  hypothetical protein POPTR_0008s12770g             202   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002315887.1|  hypothetical protein POPTR_0010s12400g             201   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_007216442.1|  hypothetical protein PRUPE_ppa021996mg             199   1e-59   
ref|XP_011038667.1|  PREDICTED: uncharacterized protein At1g66480...    200   5e-59   
ref|XP_008381317.1|  PREDICTED: uncharacterized protein At1g66480       198   2e-58   
ref|XP_010032667.1|  PREDICTED: uncharacterized protein At1g66480...    197   4e-58   
ref|XP_006372587.1|  hypothetical protein POPTR_0017s03000g             196   4e-58   
emb|CDP00754.1|  unnamed protein product                                197   5e-58   
ref|XP_006357781.1|  PREDICTED: uncharacterized protein At1g66480...    195   5e-58   
ref|XP_004231997.1|  PREDICTED: uncharacterized protein At1g66480       195   6e-58   
ref|XP_006372588.1|  hypothetical protein POPTR_0017s03000g             196   6e-58   
ref|XP_008229230.1|  PREDICTED: uncharacterized protein At1g66480...    196   8e-58   
ref|XP_011001505.1|  PREDICTED: uncharacterized protein At1g66480...    196   1e-57   
gb|KDP22653.1|  hypothetical protein JCGZ_02495                         195   2e-57   
ref|XP_009371801.1|  PREDICTED: uncharacterized protein At1g66480       195   2e-57   
ref|XP_008243347.1|  PREDICTED: uncharacterized protein At1g66480...    195   4e-57   
ref|XP_007227565.1|  hypothetical protein PRUPE_ppa010741mg             195   4e-57   
ref|XP_011001592.1|  PREDICTED: uncharacterized protein At1g66480...    194   5e-57   
ref|XP_006482147.1|  PREDICTED: uncharacterized protein At1g66480...    194   9e-57   
ref|XP_006430644.1|  hypothetical protein CICLE_v10012690mg             193   1e-56   
ref|XP_010259616.1|  PREDICTED: uncharacterized protein At1g66480...    191   7e-56   
ref|XP_004297360.1|  PREDICTED: uncharacterized protein At1g66480...    191   7e-56   
ref|XP_010274640.1|  PREDICTED: uncharacterized protein At1g66480...    191   9e-56   
ref|XP_009789651.1|  PREDICTED: uncharacterized protein At1g66480...    191   2e-55   
ref|XP_004297359.1|  PREDICTED: uncharacterized protein At1g66480...    190   4e-55   
emb|CAN65027.1|  hypothetical protein VITISV_028979                     187   7e-55   Vitis vinifera
ref|XP_009356153.1|  PREDICTED: uncharacterized protein At1g66480...    188   2e-54   
ref|XP_002305871.1|  hypothetical protein POPTR_0004s08660g             187   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009608883.1|  PREDICTED: uncharacterized protein At1g66480...    188   2e-54   
ref|XP_002271689.1|  PREDICTED: uncharacterized protein At1g66480       186   2e-54   Vitis vinifera
ref|XP_002278115.1|  PREDICTED: uncharacterized protein At1g66480       186   4e-54   Vitis vinifera
gb|EPS72336.1|  hypothetical protein M569_02423                         185   5e-54   
ref|XP_011006437.1|  PREDICTED: uncharacterized protein At1g66480...    186   7e-54   
ref|XP_009592681.1|  PREDICTED: uncharacterized protein At1g66480...    186   8e-54   
ref|XP_011006438.1|  PREDICTED: uncharacterized protein At1g66480...    186   8e-54   
ref|XP_010681969.1|  PREDICTED: uncharacterized protein At1g66480       186   9e-54   
ref|XP_008389224.1|  PREDICTED: uncharacterized protein At1g66480       185   2e-53   
ref|XP_011075706.1|  PREDICTED: uncharacterized protein At1g66480...    185   2e-53   
ref|XP_007045105.1|  Encodes a protein whose expression is respon...    183   9e-53   
ref|XP_009789650.1|  PREDICTED: uncharacterized protein At1g66480...    184   1e-52   
ref|XP_006344227.1|  PREDICTED: uncharacterized protein At1g66480...    183   2e-52   
ref|XP_004238848.1|  PREDICTED: uncharacterized protein At1g66480...    182   3e-52   
ref|XP_004238847.1|  PREDICTED: uncharacterized protein At1g66480...    182   3e-52   
ref|XP_006344228.1|  PREDICTED: uncharacterized protein At1g66480...    182   8e-52   
ref|XP_002526007.1|  conserved hypothetical protein                     181   1e-51   Ricinus communis
gb|KDP38041.1|  hypothetical protein JCGZ_04684                         178   5e-51   
ref|XP_003555905.1|  PREDICTED: uncharacterized protein At1g66480...    178   6e-51   
gb|KEH40549.1|  plastid movement impaired protein                       178   8e-51   
ref|XP_008339566.1|  PREDICTED: uncharacterized protein At1g66480...    178   1e-50   
ref|NP_001236455.1|  uncharacterized protein LOC547691                  177   1e-50   
ref|XP_010066633.1|  PREDICTED: uncharacterized protein At1g66480       178   2e-50   
ref|XP_003544245.1|  PREDICTED: uncharacterized protein At1g66480...    177   2e-50   
ref|XP_003519341.1|  PREDICTED: uncharacterized protein At1g66480...    177   2e-50   
gb|KHG02457.1|  hypothetical protein F383_25869                         176   6e-50   
ref|XP_008348593.1|  PREDICTED: uncharacterized protein At1g66480...    175   7e-50   
gb|KCW69333.1|  hypothetical protein EUGRSUZ_F02820                     175   1e-49   
gb|KHN04248.1|  Hypothetical protein glysoja_049449                     174   1e-49   
ref|XP_010109016.1|  hypothetical protein L484_027215                   175   2e-49   
ref|XP_010062234.1|  PREDICTED: uncharacterized protein At1g66480...    175   2e-49   
ref|XP_004253408.1|  PREDICTED: uncharacterized protein At1g66480...    175   2e-49   
ref|XP_009596673.1|  PREDICTED: uncharacterized protein At1g66480...    175   3e-49   
gb|EYU30052.1|  hypothetical protein MIMGU_mgv1a023844mg                173   6e-49   
ref|XP_004498324.1|  PREDICTED: uncharacterized protein At1g66480...    173   7e-49   
ref|XP_009357803.1|  PREDICTED: uncharacterized protein At1g66480       173   7e-49   
ref|XP_009805058.1|  PREDICTED: uncharacterized protein At1g66480...    174   1e-48   
ref|XP_004490863.1|  PREDICTED: uncharacterized protein At1g66480...    172   1e-48   
ref|XP_006582842.1|  PREDICTED: uncharacterized protein LOC100306...    172   2e-48   
ref|XP_007141885.1|  hypothetical protein PHAVU_008G233900g             171   3e-48   
ref|XP_004161194.1|  PREDICTED: uncharacterized protein At1g66480...    171   4e-48   
ref|XP_004140437.1|  PREDICTED: uncharacterized protein At1g66480...    171   4e-48   
ref|XP_007157721.1|  hypothetical protein PHAVU_002G092800g             170   9e-48   
ref|NP_001238620.1|  uncharacterized protein LOC100306423               169   1e-47   
ref|XP_006448285.1|  hypothetical protein CICLE_v10016683mg             169   3e-47   
ref|XP_004503145.1|  PREDICTED: uncharacterized protein At1g66480...    169   3e-47   
gb|KDO63111.1|  hypothetical protein CISIN_1g0323941mg                  166   4e-47   
ref|XP_010916176.1|  PREDICTED: uncharacterized protein At1g66480...    167   7e-47   
ref|XP_004505259.1|  PREDICTED: uncharacterized protein At1g66480...    167   7e-47   
ref|XP_010105767.1|  hypothetical protein L484_009963                   168   8e-47   
gb|KEH34686.1|  plastid movement impaired protein                       167   1e-46   
gb|AFK45330.1|  unknown                                                 167   2e-46   
ref|XP_003616384.1|  hypothetical protein MTR_5g079610                  166   2e-46   
ref|XP_009129247.1|  PREDICTED: uncharacterized protein At1g66480...    168   2e-46   
ref|XP_008454771.1|  PREDICTED: uncharacterized protein At1g66480...    166   2e-46   
ref|XP_008454773.1|  PREDICTED: uncharacterized protein At1g66480...    166   3e-46   
ref|XP_009414071.1|  PREDICTED: uncharacterized protein At1g66480...    166   3e-46   
ref|XP_011070637.1|  PREDICTED: uncharacterized protein At1g66480...    166   4e-46   
ref|XP_007153300.1|  hypothetical protein PHAVU_003G023400g             164   1e-45   
emb|CDY37375.1|  BnaC02g33930D                                          164   1e-45   
ref|XP_008775226.1|  PREDICTED: uncharacterized protein At1g66480...    164   2e-45   
ref|XP_007163405.1|  hypothetical protein PHAVU_001G232100g             164   2e-45   
ref|XP_009114243.1|  PREDICTED: uncharacterized protein At1g66480...    164   3e-45   
ref|NP_178243.2|  uncharacterized protein                               164   3e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40384.1|  BnaA02g26980D                                          164   3e-45   
ref|XP_010502111.1|  PREDICTED: uncharacterized protein At1g66480...    162   6e-45   
ref|XP_010528526.1|  PREDICTED: uncharacterized protein At1g66480...    162   7e-45   
ref|XP_010528525.1|  PREDICTED: uncharacterized protein At1g66480...    163   7e-45   
ref|XP_010424880.1|  PREDICTED: uncharacterized protein At1g66480...    162   9e-45   
ref|XP_006602004.1|  PREDICTED: uncharacterized protein At1g66480...    162   1e-44   
ref|XP_009101353.1|  PREDICTED: uncharacterized protein At1g66480...    162   1e-44   
ref|XP_008800768.1|  PREDICTED: uncharacterized protein At1g66480...    161   1e-44   
ref|XP_006293056.1|  hypothetical protein CARUB_v10019343mg             161   1e-44   
emb|CDY25937.1|  BnaC09g20500D                                          162   2e-44   
ref|XP_002875068.1|  hypothetical protein ARALYDRAFT_322480             161   2e-44   
ref|XP_010513852.1|  PREDICTED: uncharacterized protein At1g66480...    161   2e-44   
ref|XP_010553923.1|  PREDICTED: uncharacterized protein At1g66480...    161   2e-44   
ref|XP_003537453.1|  PREDICTED: uncharacterized protein At1g66480...    161   2e-44   
ref|XP_010553916.1|  PREDICTED: uncharacterized protein At1g66480...    161   2e-44   
emb|CDX77816.1|  BnaC07g20700D                                          160   4e-44   
ref|XP_006398523.1|  hypothetical protein EUTSA_v10001016mg             160   5e-44   
ref|XP_009388031.1|  PREDICTED: uncharacterized protein At1g66480...    160   6e-44   
ref|XP_010932597.1|  PREDICTED: uncharacterized protein At1g66480...    159   9e-44   
ref|XP_006344226.1|  PREDICTED: uncharacterized protein At1g66480...    160   1e-43   
ref|XP_006391401.1|  hypothetical protein EUTSA_v10019620mg             158   2e-43   
gb|KDO64706.1|  hypothetical protein CISIN_1g029320mg                   157   5e-43   
ref|XP_008801161.1|  PREDICTED: uncharacterized protein At1g66480...    157   8e-43   
ref|XP_010553900.1|  PREDICTED: uncharacterized protein At1g66480...    158   1e-42   
ref|XP_010910469.1|  PREDICTED: uncharacterized protein At1g66480...    155   2e-42   
gb|AAD14534.1|  unknown protein                                         155   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511478.1|  PREDICTED: uncharacterized protein At1g66480...    155   4e-42   
ref|XP_010470524.1|  PREDICTED: uncharacterized protein At1g66480       155   5e-42   
ref|XP_004140307.1|  PREDICTED: uncharacterized protein At1g66480...    155   6e-42   
gb|KGN51042.1|  hypothetical protein Csa_5G418770                       155   8e-42   
ref|XP_010415191.1|  PREDICTED: uncharacterized protein At1g66480...    154   1e-41   
ref|XP_004140306.1|  PREDICTED: uncharacterized protein At1g66480...    155   1e-41   
ref|XP_006302789.1|  hypothetical protein CARUB_v10020914mg             154   1e-41   
ref|NP_001236465.1|  uncharacterized protein LOC547692                  154   2e-41   
ref|XP_010471107.1|  PREDICTED: uncharacterized protein At1g66480...    152   8e-41   
ref|XP_002870572.1|  hypothetical protein ARALYDRAFT_493762             150   3e-40   
ref|XP_009105210.1|  PREDICTED: uncharacterized protein At1g66480...    150   3e-40   
emb|CDX96144.1|  BnaA07g25870D                                          150   3e-40   
ref|XP_009105209.1|  PREDICTED: uncharacterized protein At1g66480...    150   4e-40   
dbj|BAE99768.1|  hypothetical protein                                   150   4e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDY36204.1|  BnaC06g27480D                                          150   5e-40   
gb|AAG51153.1|AC074025_3  hypothetical protein                          149   9e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176821.2|  plastid movement impaired 2 protein                   149   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399731.1|  PREDICTED: uncharacterized protein At1g66480...    148   2e-39   
ref|XP_009419115.1|  PREDICTED: uncharacterized protein At1g66480...    147   3e-39   
gb|EYU44582.1|  hypothetical protein MIMGU_mgv1a025559mg                147   3e-39   
ref|XP_009388226.1|  PREDICTED: uncharacterized protein At1g66480...    147   3e-39   
ref|XP_010554976.1|  PREDICTED: uncharacterized protein At1g66480...    147   4e-39   
ref|XP_006390815.1|  hypothetical protein EUTSA_v10019172mg             147   5e-39   
ref|XP_002438190.1|  hypothetical protein SORBIDRAFT_10g009380          149   5e-39   Sorghum bicolor [broomcorn]
emb|CDX72768.1|  BnaC06g32160D                                          146   7e-39   
ref|XP_009409256.1|  PREDICTED: uncharacterized protein At1g66480...    147   7e-39   
ref|NP_001175592.1|  Os08g0429250                                       147   8e-39   
ref|XP_002888502.1|  hypothetical protein ARALYDRAFT_475748             147   8e-39   
ref|NP_683488.1|  uncharacterized protein                               145   1e-38   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10363.1|  unnamed protein product                                145   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010046540.1|  PREDICTED: uncharacterized protein At1g66480...    144   4e-38   
gb|EAZ07066.1|  hypothetical protein OsI_29313                          145   4e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_198600.1|  uncharacterized protein                               145   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004965177.1|  PREDICTED: uncharacterized protein At1g66480...    146   4e-38   
ref|XP_009401428.1|  PREDICTED: uncharacterized protein At1g66480...    144   6e-38   
ref|XP_003563985.1|  PREDICTED: uncharacterized protein At1g66480...    146   9e-38   
ref|XP_009105768.1|  PREDICTED: uncharacterized protein At1g66480       143   9e-38   
ref|XP_006838369.1|  hypothetical protein AMTR_s00002p00035620          144   9e-38   
gb|KFK41526.1|  hypothetical protein AALP_AA2G141000                    143   1e-37   
ref|XP_002888813.1|  hypothetical protein ARALYDRAFT_894932             143   1e-37   
ref|XP_009417656.1|  PREDICTED: uncharacterized protein At1g66480...    142   2e-37   
ref|XP_009139753.1|  PREDICTED: uncharacterized protein At1g66480       142   3e-37   
emb|CDY01698.1|  BnaC04g30540D                                          142   3e-37   
ref|XP_010427914.1|  PREDICTED: uncharacterized protein At1g66480...    141   9e-37   
dbj|BAJ97523.1|  predicted protein                                      143   1e-36   
dbj|BAJ94681.1|  predicted protein                                      142   2e-36   
dbj|BAJ95074.1|  predicted protein                                      143   3e-36   
dbj|BAD46205.1|  hypothetical protein                                   141   4e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80354.1|  hypothetical protein OsI_22441                          141   5e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001144982.1|  uncharacterized protein LOC100278137               141   7e-36   Zea mays [maize]
ref|XP_006302856.1|  hypothetical protein CARUB_v10020986mg             138   7e-36   
ref|NP_001057325.2|  Os06g0260000                                       141   7e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006285147.1|  hypothetical protein CARUB_v10006491mg             139   8e-36   
dbj|BAK00399.1|  predicted protein                                      140   8e-36   
ref|NP_001140541.1|  hypothetical protein                               140   1e-35   Zea mays [maize]
ref|XP_003578092.1|  PREDICTED: uncharacterized protein At1g66480...    138   2e-35   
ref|XP_011099483.1|  PREDICTED: uncharacterized protein At1g66480...    134   5e-35   
ref|XP_002462356.1|  hypothetical protein SORBIDRAFT_02g024320          136   9e-35   Sorghum bicolor [broomcorn]
ref|XP_010415796.1|  PREDICTED: uncharacterized protein At1g66480...    135   1e-34   
ref|XP_003570504.1|  PREDICTED: uncharacterized protein At1g66480...    137   1e-34   
ref|XP_004956774.1|  PREDICTED: uncharacterized protein At1g66480...    136   2e-34   
gb|EEC73945.1|  hypothetical protein OsI_08817                          136   2e-34   Oryza sativa Indica Group [Indian rice]
emb|CDY09510.1|  BnaC02g20520D                                          134   4e-34   
emb|CDY03707.1|  BnaA02g15300D                                          133   1e-33   
ref|XP_009127841.1|  PREDICTED: uncharacterized protein At1g66480...    132   1e-33   
ref|XP_010450546.1|  PREDICTED: uncharacterized protein At1g66480...    133   1e-33   
ref|XP_010435695.1|  PREDICTED: uncharacterized protein At1g66480...    132   1e-33   
ref|XP_010435694.1|  PREDICTED: uncharacterized protein At1g66480...    133   1e-33   
ref|XP_010693823.1|  PREDICTED: uncharacterized protein At1g66480...    131   5e-33   
gb|ACN25188.1|  unknown                                                 131   7e-33   Zea mays [maize]
tpg|DAA61371.1|  TPA: hypothetical protein ZEAMMB73_422493              132   1e-32   
ref|XP_004953825.1|  PREDICTED: uncharacterized protein At1g66480...    130   3e-32   
gb|KGN57888.1|  hypothetical protein Csa_3G368690                       129   4e-32   
gb|ABK23762.1|  unknown                                                 127   5e-31   Picea sitchensis
ref|XP_010440894.1|  PREDICTED: uncharacterized protein At1g66480...    125   1e-30   
gb|EEC84556.1|  hypothetical protein OsI_31309                          125   1e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001182953.1|  uncharacterized protein LOC100501255               125   3e-30   
dbj|BAD36318.1|  unknown protein                                        124   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009390356.1|  PREDICTED: uncharacterized protein At1g66480...    123   5e-30   
ref|XP_008457131.1|  PREDICTED: uncharacterized protein At1g66480...    122   5e-30   
ref|XP_008646204.1|  PREDICTED: uncharacterized protein At1g66480...    124   8e-30   
ref|XP_002454333.1|  hypothetical protein SORBIDRAFT_04g028880          124   9e-30   Sorghum bicolor [broomcorn]
emb|CDX75954.1|  BnaC03g40370D                                          117   9e-29   
ref|XP_002445525.1|  hypothetical protein SORBIDRAFT_07g020936          120   1e-28   Sorghum bicolor [broomcorn]
ref|XP_004151549.1|  PREDICTED: uncharacterized protein At1g66480...    118   2e-28   
ref|XP_004169622.1|  PREDICTED: uncharacterized protein At1g66480...    118   2e-28   
ref|NP_001183195.1|  hypothetical protein                               120   3e-28   
ref|XP_003572217.1|  PREDICTED: uncharacterized protein At1g66480...    119   5e-28   
ref|XP_010497880.1|  PREDICTED: uncharacterized protein At1g66480...    110   1e-26   
gb|AAL16667.1|AF419849_1  unknown                                       108   1e-25   Musa acuminata [banana]
gb|EAZ42812.1|  hypothetical protein OsJ_27397                          109   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008664670.1|  PREDICTED: uncharacterized protein At1g66480...    110   9e-25   
tpg|DAA49037.1|  TPA: hypothetical protein ZEAMMB73_148814              110   1e-24   
ref|XP_008664669.1|  PREDICTED: uncharacterized protein At1g66480...    110   1e-24   
gb|EAZ36542.1|  hypothetical protein OsJ_20883                          105   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656858.1|  PREDICTED: uncharacterized protein LOC102699696    103   2e-22   
ref|XP_006660146.1|  PREDICTED: uncharacterized protein LOC102701652  66.6    4e-10   
gb|EEE57751.1|  hypothetical protein OsJ_08272                        65.5    2e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00045.1|  predicted protein                                    65.1    4e-09   
gb|ABR16829.1|  unknown                                               58.9    3e-07   Picea sitchensis
emb|CDX74556.1|  BnaA04g08330D                                        54.3    6e-06   
gb|ACG46818.1|  hypothetical protein                                  52.8    1e-05   Zea mays [maize]
gb|EMS56085.1|  hypothetical protein TRIUR3_29230                     53.5    2e-05   
gb|EMT16940.1|  hypothetical protein F775_43108                       50.4    1e-04   
gb|KCW52110.1|  hypothetical protein EUGRSUZ_J01545                   50.1    3e-04   
ref|XP_004240422.1|  PREDICTED: uncharacterized protein LOC101247128  49.3    5e-04   
gb|AEX12177.1|  hypothetical protein 0_5630_02                        48.5    7e-04   



>emb|CDP02714.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = +1

Query  76   MGNAI---GGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPL  246
            MGN I   GGRKKAKVMKI GET KLKTPV AFDVVKDYPGHVLL+SE VKR G+RA PL
Sbjct  1    MGNNITGAGGRKKAKVMKISGETFKLKTPVLAFDVVKDYPGHVLLESEAVKRHGIRAKPL  60

Query  247  EAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAV  426
            E  +ELKPKKIYFLVELPK P   ER PRR RS VHM+A DRLE L+  RRS SDVS   
Sbjct  61   EPQEELKPKKIYFLVELPKLPE--ERAPRRARSAVHMNAKDRLECLVLSRRSGSDVSVQR  118

Query  427  RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
            +   GPVQ+K+RLP+ QVEK++ ESRDETE AE+I++LC+++
Sbjct  119  QNPAGPVQVKMRLPRTQVEKLVGESRDETELAERIVDLCMKN  160



>ref|XP_009629230.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=165

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN IGG +KK KVMKI+GE LKLKTPV+  DVVKDYPGHVLL+SE VK+FGVRA PLE 
Sbjct  1    MGNNIGGNKKKTKVMKINGEILKLKTPVTTLDVVKDYPGHVLLESEAVKKFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHG-ERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
             QELKP KIYFLVELP FP     RVPRR++S V MSA DRLE LM  RRS SD+S + +
Sbjct  61   EQELKPNKIYFLVELPLFPKEEISRVPRRVKSAVQMSAKDRLECLMLTRRSASDLSIS-K  119

Query  430  REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
               GPVQ+K++LP++ V+K++ ESRDETE AEKI++LC+ +   G
Sbjct  120  PNNGPVQLKMKLPRSLVQKLVEESRDETEVAEKIMDLCMPNSSYG  164



>ref|XP_007033077.1| Plastid movement impaired 2 [Theobroma cacao]
 gb|EOY04003.1| Plastid movement impaired 2 [Theobroma cacao]
Length=219

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 130/174 (75%), Gaps = 13/174 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GGRKKAKVMKIDGET KLKTPV A+DVVKDYPGHVLLDSE VK FG+RA PLE  
Sbjct  1    MGNSMGGRKKAKVMKIDGETFKLKTPVRAWDVVKDYPGHVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRS-GVHMSATDRLEALMKMRRSTSDV------  414
            Q+LKPKKIYFLVELPKFP   E+ PRR+RS G+HMSA DRLE LM  RRS SD+      
Sbjct  61   QDLKPKKIYFLVELPKFPE--EKAPRRVRSGGIHMSAKDRLECLMLSRRSVSDLSMVRPS  118

Query  415  ----SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                S  + R  G + +K+RLPK+Q+ K++ ESRD  E AEKI++L + +   G
Sbjct  119  SSLGSDGLGRSSGGMTVKMRLPKSQMAKLVEESRDGVEVAEKILDLYVENAGGG  172



>ref|XP_009794002.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=223

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = +1

Query  73   RMGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            RMGN IGG +KK KVMKI+GE LKLKTPV+  DVVKDYPGHVLL+SE  K+FGVRA PLE
Sbjct  58   RMGNNIGGNKKKTKVMKINGEILKLKTPVTTSDVVKDYPGHVLLESEAAKKFGVRAKPLE  117

Query  250  AAQELKPKKIYFLVELPKFP-HHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAV  426
              QELKP KIYFLVELP FP     RVPRR++S V MSA DRLE LM  RRS SD+S  +
Sbjct  118  PEQELKPNKIYFLVELPLFPKEENRRVPRRVKSAVQMSAKDRLECLMLTRRSASDLS-IL  176

Query  427  RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
            +   GP+Q+K++LP+  V+K++ ESRDETE AEKI++LC+ +   G
Sbjct  177  KPNNGPIQLKMKLPRTLVQKLVEESRDETEVAEKIMDLCMPNSSYG  222



>ref|XP_002284189.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera]
 emb|CBI26915.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 13/170 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVMKIDGE +KLKTPV A +VVKDYPGHVLL+SE VK FG+RA PLE+ 
Sbjct  1    MGNSLGGKKIAKVMKIDGEVIKLKTPVYAGEVVKDYPGHVLLESEAVKHFGIRAKPLESQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            QELKPK++YFLVELPK     E+VPRR+RSG++MSA DRLE+LM  RRS SD++      
Sbjct  61   QELKPKRLYFLVELPKGAE--EKVPRRVRSGINMSAKDRLESLMLSRRSVSDLTIMKPAS  118

Query  418  -----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                 P    E G V++K+RLPKA+VEK++ ES+DE EAAEKI++LCI +
Sbjct  119  IVHQEPKEASESGTVRMKMRLPKAEVEKLMRESKDEAEAAEKIMDLCIAN  168



>ref|XP_011023151.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
 ref|XP_011016335.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=228

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 9/170 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K AKVMKI+GET K KTPV A DVVKDYPGHVLL+SE VK +G RA PLEA 
Sbjct  1    MGNTLGGKKTAKVMKINGETFKFKTPVKAGDVVKDYPGHVLLESEAVKHYGTRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDV-----SP  420
            Q+L PK++YFLVELP+ P   ERVPRR+RSG++MSA DRLE+LM  RRSTSD+     S 
Sbjct  61   QDLVPKRLYFLVELPETPT--ERVPRRVRSGINMSAKDRLESLMLSRRSTSDLSIMKPSS  118

Query  421  AVRREW--GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
             V  E   G +++K+RLPK +VEK++ ES+DE EAA KI++LCI +   G
Sbjct  119  IVSEEAKRGAMRVKMRLPKEEVEKLMQESKDEAEAAAKILDLCIANTAGG  168



>ref|XP_002311497.1| hypothetical protein POPTR_0008s12770g [Populus trichocarpa]
 gb|EEE88864.1| hypothetical protein POPTR_0008s12770g [Populus trichocarpa]
Length=215

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 130/167 (78%), Gaps = 9/167 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K AKVMKI+GET K KTPV A DVVKDYPGHVLL+SE VK +G+RA PLEA 
Sbjct  1    MGNTLGGKKTAKVMKINGETFKFKTPVKAGDVVKDYPGHVLLESEAVKHYGIRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDV-----SP  420
            Q+L PK++YFLVELP+ P   ERVPRR+RSG++MSA DRLE+LM  RRSTSD+     S 
Sbjct  61   QDLVPKRLYFLVELPETPT--ERVPRRVRSGINMSAKDRLESLMLSRRSTSDLSIMKPSS  118

Query  421  AVRREW--GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDV  555
             V  E   G +++K+RLPK QVEK++ ES+DE EAA KI++LC+ + 
Sbjct  119  IVSEEAKRGAMRVKMRLPKEQVEKLMQESKDEAEAAAKILDLCMANT  165



>ref|XP_002315887.1| hypothetical protein POPTR_0010s12400g [Populus trichocarpa]
 gb|EEF02058.1| hypothetical protein POPTR_0010s12400g [Populus trichocarpa]
Length=215

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 131/167 (78%), Gaps = 9/167 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AKVMKI GET K KTPV A +VVKDYPGHVLL+SE VK +G+RA PLEA 
Sbjct  1    MGNSLGWKKTAKVMKISGETFKFKTPVKAGEVVKDYPGHVLLESEAVKHYGIRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L PK++YFLVELPK P   E+VPRR+RSG++MSA DRLE+LM  RRSTSD+S      
Sbjct  61   QDLVPKRLYFLVELPKTPT--EKVPRRVRSGINMSAKDRLESLMLSRRSTSDLSIMKPAS  118

Query  418  -PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDV  555
              A   + G +++K+RLPKA+VEK++ ES+DETEAA KI++LC+ + 
Sbjct  119  IEAEEAKSGAMRVKMRLPKAEVEKLMQESKDETEAAAKIVDLCMANT  165



>ref|XP_007216442.1| hypothetical protein PRUPE_ppa021996mg, partial [Prunus persica]
 gb|EMJ17641.1| hypothetical protein PRUPE_ppa021996mg, partial [Prunus persica]
Length=166

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR KAKVMKI GET K+KTP+ A DVVKDYPGHVLL+SE VK FGVRA PLE  
Sbjct  1    MGNTIGGRNKAKVMKISGETFKVKTPIRARDVVKDYPGHVLLNSEAVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSD---VSPAV  426
            Q+L+PKKIYFLV+LPKFP   ++VPRR+RSG+ +SA DRLE LM  RRS SD   V  A 
Sbjct  61   QDLRPKKIYFLVQLPKFPEEEKQVPRRVRSGIQVSAKDRLECLMLSRRSVSDLTSVRAAS  120

Query  427  RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                GPV++K+R+P+AQ+ K++ ES D+ E AE+II L + +
Sbjct  121  AGSEGPVRMKVRVPRAQMVKLVEESNDDAEIAERIIELYMAN  162



>ref|XP_011038667.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=229

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 9/170 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AKVMKI GET K KTPV A +VVKDYPGHVLL+SE VK +G+RA PLEA 
Sbjct  1    MGNSLGWKKTAKVMKISGETFKFKTPVKAGEVVKDYPGHVLLESEAVKHYGIRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L PK++YFLVELP  P   E+VPRR+RSG+ MSA DRLE+LM  RRSTSD+S      
Sbjct  61   QDLVPKRLYFLVELPNTPT--EKVPRRVRSGITMSAEDRLESLMHSRRSTSDLSIMKPAS  118

Query  418  -PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
              A   + G +++K+RLPKA+VE+++ ES+DETEAA KI++LC+ +   G
Sbjct  119  IAAEEAKSGAMRVKMRLPKAEVERLMQESKDETEAAAKIVDLCMANTAGG  168



>ref|XP_008381317.1| PREDICTED: uncharacterized protein At1g66480 [Malus domestica]
Length=219

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 129/167 (77%), Gaps = 11/167 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR+KAKVMKI GET K+KTP+ A+DVVKDYPGHVLL+SE VKRFGVRA PLE  
Sbjct  1    MGNTIGGRRKAKVMKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKRFGVRARPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGE--RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
            +ELKPKKIYFLV+LPKFP   E  +V RR+RSG+ +SA DRLE LM  RRS SD++ +VR
Sbjct  61   EELKPKKIYFLVQLPKFPAEEEEKQVTRRVRSGIQVSAKDRLECLMLSRRSVSDLT-SVR  119

Query  430  --------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                       GPV++K+RLPKAQ+ K++ ES+D+ E AE+II L +
Sbjct  120  ASSTTSSSSSEGPVRMKMRLPKAQMVKLVEESKDDVEIAERIIELYM  166



>ref|XP_010032667.1| PREDICTED: uncharacterized protein At1g66480-like [Eucalyptus 
grandis]
Length=227

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 128/168 (76%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+++AKVMKI+G+T KL TPV A DVVKDYPGHVL+DSE VK FG+RA PLE  
Sbjct  1    MGNSMGGKRRAKVMKINGDTFKLNTPVRAGDVVKDYPGHVLMDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRS-GVHMSATDRLEALMKMRRSTSDVSPAV--  426
            QELKPK++YFLVELPKFP   ++VPRR+RS G+ MSA DRLE LM  RR+ SD++ A   
Sbjct  61   QELKPKRVYFLVELPKFPEEDDKVPRRVRSTGIRMSAKDRLECLMLSRRAASDLALARSE  120

Query  427  ------RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                  RR  GP+ +K+RL +A++ K++ ESRDE E AE+I+ +C  D
Sbjct  121  GDGGLPRRGEGPLTVKMRLTRAEMAKLVEESRDEKEVAERIMGMCHGD  168



>ref|XP_006372587.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
 gb|ERP50384.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
Length=201

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 9/167 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G  KKAKVMKI+GET KLKTP  A DVVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNNLGRGKKAKVMKINGETFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGE-RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
            QELK KKIYFLVELPKFP   + R  RR++SG+HMSA DRLE LM  RRS SD+ P VR 
Sbjct  61   QELKAKKIYFLVELPKFPEEKDPRNTRRVQSGIHMSAKDRLECLMLSRRSVSDI-PMVRS  119

Query  433  EWG-------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
              G        V++K+RLPKAQV+K++ ES+DE E AEKII+L + +
Sbjct  120  SSGQTSDGPNTVRVKVRLPKAQVQKLVEESKDEAEVAEKIIDLYMDN  166



>emb|CDP00754.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 129/169 (76%), Gaps = 12/169 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG++ AKVMKI+GET+KLKTP+ A +VVKDYPG VLL+SE VK FG+RA PLE  
Sbjct  1    MGNSLGGKRVAKVMKINGETIKLKTPIYAGEVVKDYPGFVLLESEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELKPK +YFLVELPKFP    + PRR+RSG+ MSA DRLE+LM  RRS SD+S   PA 
Sbjct  61   QELKPKGLYFLVELPKFPEENTKGPRRVRSGIQMSAKDRLESLMLARRSVSDLSHLKPAS  120

Query  424  -VRREW-------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             V  E        G +++K+RLPKAQV+K+++ES+DE EAA KI+  C+
Sbjct  121  IVLDEQSQESSPNGAMRLKMRLPKAQVQKMMMESKDEAEAAAKIMEFCM  169



>ref|XP_006357781.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=162

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 123/163 (75%), Gaps = 6/163 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGG    KVMKI+GE LKLKTP++  +VVKDYPGHVLL+SE VK+FG+RA PLEA 
Sbjct  1    MGNNIGG--STKVMKINGEILKLKTPITTSEVVKDYPGHVLLESEAVKKFGIRAKPLEAE  58

Query  256  QELKPKKIYFLVELPKFPHH----GERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPA  423
            QELKP KIYFLVELP FP        +V RR++S VHM+A DRLE LM  RRS SD+S +
Sbjct  59   QELKPCKIYFLVELPLFPKQEITSNNKVTRRVKSDVHMNAQDRLECLMLSRRSASDLSIS  118

Query  424  VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                   VQ+K++LP++ V+K+I ESRDETE AEKI++LC+ +
Sbjct  119  KPSNGAVVQLKMKLPRSVVQKLIEESRDETEVAEKIMDLCMHN  161



>ref|XP_004231997.1| PREDICTED: uncharacterized protein At1g66480 [Solanum lycopersicum]
Length=166

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 124/165 (75%), Gaps = 6/165 (4%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN IGG  KK KVMKI+GE LKLKTP++  +VVKDYPGHVLL+SE VK+FG+RA PLE 
Sbjct  1    MGNNIGGTTKKTKVMKINGEILKLKTPITTLEVVKDYPGHVLLESEAVKKFGIRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHH-----GERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS  417
             QELKP KIYFLVELP FP         +V RR++S V+M+A DRLE LM  RRS SD+S
Sbjct  61   EQELKPTKIYFLVELPLFPKEEIITSNNKVTRRVKSDVYMNAQDRLECLMLSRRSASDLS  120

Query  418  PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
             +       VQ+K++LP++ V+K+I ESRDETE AEKI++LC+ +
Sbjct  121  ISKPSNGAVVQLKMKLPRSVVQKLIEESRDETEVAEKIMDLCMHN  165



>ref|XP_006372588.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
 gb|ERP50385.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
Length=216

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 9/167 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G  KKAKVMKI+GET KLKTP  A DVVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNNLGRGKKAKVMKINGETFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGE-RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
            QELK KKIYFLVELPKFP   + R  RR++SG+HMSA DRLE LM  RRS SD+ P VR 
Sbjct  61   QELKAKKIYFLVELPKFPEEKDPRNTRRVQSGIHMSAKDRLECLMLSRRSVSDI-PMVRS  119

Query  433  EWG-------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
              G        V++K+RLPKAQV+K++ ES+DE E AEKII+L + +
Sbjct  120  SSGQTSDGPNTVRVKVRLPKAQVQKLVEESKDEAEVAEKIIDLYMDN  166



>ref|XP_008229230.1| PREDICTED: uncharacterized protein At1g66480-like [Prunus mume]
Length=223

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 3/158 (2%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR KAKVMKI GET K+KTP+ A+DVVKDYPGHVLL+SE VK FGVRA PLE  
Sbjct  1    MGNTIGGRNKAKVMKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSD---VSPAV  426
            Q+L+PKKIYFLV+LPKFP   ++VPRR+RSG+ +SA DRLE LM  RRS SD   V  A 
Sbjct  61   QDLRPKKIYFLVQLPKFPEEEKQVPRRVRSGIQVSAKDRLECLMLSRRSVSDLTSVRAAS  120

Query  427  RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                 PV++K+R+P+AQ+ K++ ES D+ E AE+II L
Sbjct  121  ACSEDPVRMKVRVPRAQMVKLVEESNDDAEIAERIIEL  158



>ref|XP_011001505.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=216

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 9/167 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G  KKAKVMKI+G+T KLKTP  A DVVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNNLGRGKKAKVMKINGDTFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGE-RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
            QELK KKIYFLVELPKFP   + R  RR+RSG+HMSA DRLE LM  RRS SD+ P VR 
Sbjct  61   QELKAKKIYFLVELPKFPEEKDPRNTRRVRSGIHMSAKDRLECLMLSRRSVSDI-PMVRS  119

Query  433  EWG-------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
              G        V++K+RLPKAQV+K++ +S+DE E AEKII+L + +
Sbjct  120  SSGQTSDGPNTVRVKVRLPKAQVQKLVEQSKDEVEVAEKIIDLYMDN  166



>gb|KDP22653.1| hypothetical protein JCGZ_02495 [Jatropha curcas]
Length=216

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 125/172 (73%), Gaps = 14/172 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN+IG  KKAK+MK+DGET KLKTP  A DVVKDYPGHVLLDS+ VK FG+RA PLE  
Sbjct  1    MGNSIGRGKKAKIMKVDGETFKLKTPAKAMDVVKDYPGHVLLDSDAVKHFGIRAKPLEPE  60

Query  256  QELKPKKIYFLVELPKFPHHGE--RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
             EL PKKIYFLVELPK P   E   + RR+RSG+H+SA DRLE LM  RRS SD+S  VR
Sbjct  61   MELNPKKIYFLVELPKLPEEKEPISITRRVRSGIHLSAKDRLEFLMLSRRSVSDLS-IVR  119

Query  430  -----------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                          GPV++K+RLPKAQ+EK++ ES+DE E AEKI++L + +
Sbjct  120  PLPSQIPDDGHNGSGPVRVKMRLPKAQMEKLVEESKDEVEVAEKIVDLFMEN  171



>ref|XP_009371801.1| PREDICTED: uncharacterized protein At1g66480 [Pyrus x bretschneideri]
Length=219

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 128/167 (77%), Gaps = 11/167 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR+KAKVMKI GET K+KTP+ A+DVVKDYPGHVLL+SE VKRFG+RA PLE  
Sbjct  1    MGNTIGGRRKAKVMKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKRFGMRARPLEPK  60

Query  256  QELKPKKIYFLVELPKFPHHGE--RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
            QELKPKKIYFLV+LPKFP   E  +V RR+RSG+ +SA DRLE LM  RRS SD++ +VR
Sbjct  61   QELKPKKIYFLVQLPKFPAEEEEKQVKRRVRSGIQVSAKDRLECLMLSRRSVSDLT-SVR  119

Query  430  REW--------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                        PV++K+RLPKAQ+ K++ ES+D+ E AE+II L +
Sbjct  120  ESSTTSSSSSEDPVRMKMRLPKAQMLKLVEESKDDVEIAERIIELYM  166



>ref|XP_008243347.1| PREDICTED: uncharacterized protein At1g66480-like [Prunus mume]
Length=238

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 128/179 (72%), Gaps = 16/179 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVM+I GET KLKTPV A +VVK+YPGHVLL SE VK FGVRA PLE  
Sbjct  1    MGNSLGGKKSAKVMQISGETFKLKTPVQAGEVVKNYPGHVLLKSEEVKHFGVRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q L+P+ IYFLVELPK     ERVPRR+RSG++MSA DRLE+LM  RRS SD+S      
Sbjct  61   QNLEPRGIYFLVELPKVELPKERVPRRVRSGINMSAKDRLESLMLSRRSVSDLSVMKSSS  120

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                         R   G V++++RLPK QVEK++ +SRDE EAA++I++LC+ + + G
Sbjct  121  AASGNSIVPDEEAREIDGAVRVRMRLPKVQVEKLMKQSRDEAEAAQRIVDLCLVNNNSG  179



>ref|XP_007227565.1| hypothetical protein PRUPE_ppa010741mg [Prunus persica]
 gb|EMJ28764.1| hypothetical protein PRUPE_ppa010741mg [Prunus persica]
Length=238

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 128/179 (72%), Gaps = 16/179 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVM+I GET KLKTPV A +VVK+YPGHVLL SE VK FGVRA PLE  
Sbjct  1    MGNSLGGKKSAKVMQISGETFKLKTPVQAGEVVKNYPGHVLLKSEEVKHFGVRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q L+P+ IYFLVELPK     ERVPRR+RSG++MSA DRLE+LM  RRS SD+S      
Sbjct  61   QNLEPRGIYFLVELPKVELPKERVPRRVRSGINMSAKDRLESLMLSRRSVSDLSVMKSSS  120

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                         R   G V++++RLPK QVEK++ +SRDE EAA++I++LC+ + + G
Sbjct  121  AASANSIVPEEEAREIDGAVRVRMRLPKVQVEKLMKQSRDEAEAAQRIVDLCLVNNNSG  179



>ref|XP_011001592.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=216

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 9/167 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G  KKAKVMKI+G+T KLKTP  A DVVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNNLGRGKKAKVMKINGDTFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGE-RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
            QELK KKIYFLVELPKFP   + R  RR++SG+HMSA DRLE LM  RRS SD+ P VR 
Sbjct  61   QELKAKKIYFLVELPKFPEEKDPRNTRRVQSGIHMSAKDRLECLMLSRRSVSDI-PMVRS  119

Query  433  EWG-------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
              G        V++K+RLPKAQV+K++ +S+DE E AEKII+L + +
Sbjct  120  SSGQTSDGPNTVRVKVRLPKAQVQKLVEQSKDEVEVAEKIIDLYMDN  166



>ref|XP_006482147.1| PREDICTED: uncharacterized protein At1g66480-like [Citrus sinensis]
Length=225

 Score =   194 bits (492),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 126/168 (75%), Gaps = 12/168 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR+KAKVMKIDGET+KLKTP+ A +VVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNTIGGRRKAKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEPR  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q+LKPKK+YFLVELPK P   E++ RR+RSG+ MSA DRLE LM  RR+ SD++    R 
Sbjct  61   QQLKPKKVYFLVELPKLPDE-EKITRRVRSGIQMSAKDRLECLMLSRRAVSDLTAVNVRS  119

Query  436  -----------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                        G +++K+RLP+AQVEK++ ES ++ E AEKI++L +
Sbjct  120  SHGSEVARGPGTGQMRVKMRLPRAQVEKLMEESANDGEVAEKIVDLYV  167



>ref|XP_006430644.1| hypothetical protein CICLE_v10012690mg [Citrus clementina]
 gb|ESR43884.1| hypothetical protein CICLE_v10012690mg [Citrus clementina]
Length=223

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 126/168 (75%), Gaps = 12/168 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR+KAKVMKIDGET+KLKTP+ A +VVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNTIGGRRKAKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEPR  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q+LKPKK+YFLVELPK P   E++ RR+RSG+ MSA DRLE LM  RR+ SD++    R 
Sbjct  61   QQLKPKKVYFLVELPKLPDE-EKITRRVRSGIQMSAKDRLECLMLSRRAVSDLTAVNVRS  119

Query  436  -----------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                        G +++K+RLP+AQVEK++ ES ++ E AEKI++L +
Sbjct  120  SHGSEVAPGPGTGQMRVKMRLPRAQVEKLMEESANDEEVAEKIVDLYV  167



>ref|XP_010259616.1| PREDICTED: uncharacterized protein At1g66480-like [Nelumbo nucifera]
Length=222

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 124/169 (73%), Gaps = 14/169 (8%)
 Frame = +1

Query  76   MGNA-IGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+ +GGRK AKVMK+DGET KLKTPV    VVKDYPG VL++SE VK FGVRA PLE 
Sbjct  1    MGNSFVGGRKTAKVMKVDGETFKLKTPVRVGQVVKDYPGFVLMESEAVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----  417
              ELKPKK+YFL+ELPK P   +++PRR+RSG+ MSA DRLE+LM  RRS SD+S     
Sbjct  61   QMELKPKKLYFLIELPKLPD--QKLPRRVRSGIQMSAKDRLESLMLARRSVSDLSILKSS  118

Query  418  ------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  P +    G V+IKLRLPK+QV K++ +S D ++AA KI++LCI
Sbjct  119  SAVYDEPGLESTAGAVRIKLRLPKSQVAKLVQDSNDVSDAAAKIMDLCI  167



>ref|XP_004297360.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=209

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +KKAKVM+I GETLKLKTPV A  V+K+YPGHVLL S+ VK  G+RA PLE  
Sbjct  1    MGNSLGSKKKAKVMQISGETLKLKTPVQAGQVMKNYPGHVLLKSQEVKHLGIRARPLEPH  60

Query  256  QELKPKKIYFLVELPKFP---HHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---  417
            Q L+ K +YFLVELPK        ++VPRR+RSG++M+A DRLE+LM  RRS SD+S   
Sbjct  61   QHLEAKGVYFLVELPKAAAAHSFSDKVPRRVRSGINMTAKDRLESLMLSRRSVSDLSMMR  120

Query  418  --PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKGR*FS  576
              P    + GPV++++RLPKAQVE ++ +SR+E EAAEKI++LC+ + + G  F+
Sbjct  121  SIPEKSHQDGPVRVRMRLPKAQVEMLMQQSRNEEEAAEKIVDLCMVNANIGGEFN  175



>ref|XP_010274640.1| PREDICTED: uncharacterized protein At1g66480-like [Nelumbo nucifera]
Length=224

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 125/168 (74%), Gaps = 13/168 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GGRK AK+MKIDGET KLK PV   DVVKDYPG VL++SE VK FG+RA PLE  
Sbjct  1    MGNSLGGRKTAKIMKIDGETFKLKAPVRVGDVVKDYPGFVLMESEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDV-----SP  420
            QELKP+K+YFL+ELP  P   ++V RR+RSG+ MSA DRLE+LM  RRSTSD+     + 
Sbjct  61   QELKPRKLYFLIELPTLPQ--QKVARRVRSGIQMSAKDRLESLMLSRRSTSDLTILKSTS  118

Query  421  AVRREWGP------VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             +  E GP      +++KLRLPK+QV K++ ES D +EAA KI++LC+
Sbjct  119  VIPDESGPESPSGALRVKLRLPKSQVAKLMEESSDPSEAAAKIMDLCL  166



>ref|XP_009789651.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=232

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 124/187 (66%), Gaps = 30/187 (16%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K  KVMKIDG+T+K KTP+ A +V+K+YP  VLL+SE VK FGVRA PLE  
Sbjct  1    MGNTLGGKKTTKVMKIDGQTMKFKTPIYANEVLKNYPTMVLLESEAVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDV-------  414
            QELKPK++YFLVELPK+P   ++ PRR+RSG+ MSA DRLE LM  RRS SD+       
Sbjct  61   QELKPKRLYFLVELPKYPE--QKTPRRVRSGIQMSAKDRLETLMLARRSVSDLSILKPAS  118

Query  415  ---------------------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKI  531
                                 SP      GPV++KLRLPKA+VEK++ + +DE E AEKI
Sbjct  119  ITTEESSYHNNSASGSLVNNSSPCKTENGGPVRVKLRLPKAEVEKLMTQCKDENEVAEKI  178

Query  532  INLCIRD  552
            + LC+ +
Sbjct  179  MQLCMSN  185



>ref|XP_004297359.1| PREDICTED: uncharacterized protein At1g66480-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +KKAKVM+I GETLKLKTPV A  V+K+YPGHVLL S+ VK  G+RA PLE  
Sbjct  1    MGNSLGSKKKAKVMQISGETLKLKTPVQAGQVMKNYPGHVLLKSQEVKHLGIRARPLEPH  60

Query  256  QELKPKKIYFLVELPKFP---HHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---  417
            Q L+ K +YFLVELPK        ++VPRR+RSG++M+A DRLE+LM  RRS SD+S   
Sbjct  61   QHLEAKGVYFLVELPKAAAAHSFSDKVPRRVRSGINMTAKDRLESLMLSRRSVSDLSMMR  120

Query  418  --PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKGR*FS  576
              P    + GPV++++RLPKAQVE ++ +SR+E EAAEKI++LC+ + + G  F+
Sbjct  121  SIPEKSHQDGPVRVRMRLPKAQVEMLMQQSRNEEEAAEKIVDLCMVNANIGGEFN  175



>emb|CAN65027.1| hypothetical protein VITISV_028979 [Vitis vinifera]
Length=171

 Score =   187 bits (475),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 12/166 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGRKKAKVMKIDG   KL+TPV + +VV+DYPGHVLL+SE VK FG+RA PL+  
Sbjct  1    MGNNIGGRKKAKVMKIDGTIFKLRTPVRSMEVVQDYPGHVLLESEAVKHFGIRAKPLQPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            QELKPKKIYFL+ELP  P   E+  RR RS ++MSA DRLE LM  RRS SD+S      
Sbjct  61   QELKPKKIYFLIELPTLPPE-EKAHRRARSAINMSAKDRLECLMLSRRSVSDLSIVKSTN  119

Query  418  -----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                 P      G  ++K+RLPKAQV K+I ES+DE EAAEKII+ 
Sbjct  120  VASDGPGTSAGPGVTRVKVRLPKAQVTKLIEESKDEDEAAEKIIHF  165



>ref|XP_009356153.1| PREDICTED: uncharacterized protein At1g66480-like [Pyrus x bretschneideri]
Length=228

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 129/173 (75%), Gaps = 11/173 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K+AKVM+++GET KLKTPV A +VVKD+PGHVLL S  VK FGVRA PLEA 
Sbjct  1    MGNSLGGKKRAKVMQVNGETFKLKTPVQAGEVVKDFPGHVLLKSSDVKHFGVRAKPLEAY  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L+P ++YFLVELPK     E  PRR+RSG++MSA DRLE+LM  RRS SD+S      
Sbjct  61   QQLEPNRLYFLVELPKVDVKKESFPRRVRSGINMSAKDRLESLMLSRRSVSDLSVMKSSA  120

Query  418  ---PAVRREW--GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
                 V  E   G V++++RLP+A+VEK++ +S D+ EAA+KI++LC+ + + 
Sbjct  121  STASIVPEEEANGAVRVRMRLPRAEVEKLMRQSGDDAEAAQKIMDLCMVNTNN  173



>ref|XP_002305871.1| hypothetical protein POPTR_0004s08660g [Populus trichocarpa]
 gb|EEE86382.1| hypothetical protein POPTR_0004s08660g [Populus trichocarpa]
Length=216

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGG  KAKVM ++GET KLKTP  A +VVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNNIGGGNKAKVMLVNGETFKLKTPARAGEVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGE-RVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA  423
            QELK KKIYFL+ELP+ P   + R  RR+RS +HMSA +RLE LM  RRS SD+S   P+
Sbjct  61   QELKAKKIYFLIELPQIPEEKDPRSTRRVRSAIHMSAKERLENLMLTRRSVSDLSMVRPS  120

Query  424  VRREWG---PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              +      PVQ+K+RLPKAQV+K++ ES+DE E AEK+I+L +
Sbjct  121  SSQTSDGREPVQVKVRLPKAQVQKLVEESQDEVEVAEKLIDLYM  164



>ref|XP_009608883.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=240

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 131/189 (69%), Gaps = 28/189 (15%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K  KVMKIDG+T+K KTP+ A +V+++YP  VLL+SE+VK FGVRA PLE  
Sbjct  1    MGNTLGGKKTTKVMKIDGQTMKFKTPIYANEVLRNYPTMVLLESESVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS----PA  423
            QELKPK++YFLVELPK+P   E+ PRR+RSG+ MSA DRLE LM  RRS SD+S    P+
Sbjct  61   QELKPKRLYFLVELPKYPE--EKTPRRVRSGIQMSAKDRLETLMLARRSVSDLSILKPPS  118

Query  424  VRRE----------------------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIIN  537
            +  E                       GPV++KLRLP+A+VEK+++ES++E + AEKI+ 
Sbjct  119  IITEESSYHNNYASGSVLNNSKTENGGGPVRLKLRLPRAEVEKLMMESKEEGDVAEKIMR  178

Query  538  LCIRDVDKG  564
            LC+ +   G
Sbjct  179  LCLVNNGGG  187



>ref|XP_002271689.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera]
 emb|CBI33547.3| unnamed protein product [Vitis vinifera]
Length=171

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 117/166 (70%), Gaps = 12/166 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGRKKAKVMKIDG   KL+TPV + +VV+DYPGHVLL+SE VK FG+RA PL+  
Sbjct  1    MGNNIGGRKKAKVMKIDGTIFKLRTPVRSMEVVQDYPGHVLLESEAVKHFGIRAKPLQPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            QELKPKKIYFL+ELP  P   E+  RR RS ++MSA DRLE LM  RRS SD+S      
Sbjct  61   QELKPKKIYFLIELPTLPPE-EKAHRRARSAINMSAKDRLECLMLSRRSVSDLSIVKSTN  119

Query  418  -----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                 P      G  ++K+RLPKAQV  +I ES+DE EAAEKII+ 
Sbjct  120  VASDGPGTSAGPGVTRVKVRLPKAQVTNLIEESKDEDEAAEKIIHF  165



>ref|XP_002278115.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera]
 emb|CBI15547.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 126/163 (77%), Gaps = 8/163 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GGRK AKVMKID +T KLKTPV  ++ VKDYPGHVL++SE  K FG+RA PLE  
Sbjct  1    MGNRLGGRKTAKVMKIDSQTFKLKTPVRVWETVKDYPGHVLIESEAFKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----P  420
            +ELKPKK+YFL+E+PK  H G+R  RR++SG++M+A DRL++LM  RRS SD+S      
Sbjct  61   RELKPKKLYFLLEIPK--HSGDRTVRRVQSGINMNAVDRLQSLMLSRRSVSDLSTIKQTT  118

Query  421  AVR-REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            ++R    G ++++LRLPK+Q+ K+I ES+D  EAAEKI++LC+
Sbjct  119  SIRPLNCGAIRVQLRLPKSQLMKLIQESKDNEEAAEKIMDLCM  161



>gb|EPS72336.1| hypothetical protein M569_02423, partial [Genlisea aurea]
Length=172

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 125/166 (75%), Gaps = 11/166 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G +K AKVMKIDGET K K P+ A  +++  PGHVLL+SE VK FGVRA PLE  
Sbjct  1    MGNTMGWKKSAKVMKIDGETFKTKAPIRAGSILEKNPGHVLLESEAVKHFGVRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----P  420
            QELKP+++YFLVELPK P   ER PRR+RSG+ MSA DRLE+LM  RRS+SD+S     P
Sbjct  61   QELKPRRLYFLVELPKLPE--ERGPRRVRSGIQMSAKDRLESLMLARRSSSDLSILKPTP  118

Query  421  AV---RREWGP-VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            ++   R E G  V++K+RLPKA+V++++ ES+D  EAAEKI+ LC+
Sbjct  119  SMAEERSEGGTGVRVKMRLPKAEVDRLMAESKDGAEAAEKIVTLCM  164



>ref|XP_011006437.1| PREDICTED: uncharacterized protein At1g66480-like isoform X1 
[Populus euphratica]
Length=211

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 121/163 (74%), Gaps = 8/163 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG  KAKVM I+GET KLKTP  A +VVKDYPGHVLLDSE VK FG+RA PLE  
Sbjct  1    MGNNLGGGNKAKVMLINGETFKLKTPARAGEVVKDYPGHVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS----PA  423
            QELK  KIYFL+ELP+ P   E+ PRR+RS +H+ A +RLE LM  RRS SD+S     +
Sbjct  61   QELKANKIYFLIELPEIPE--EKDPRRVRSAIHIGAKERLENLMLSRRSVSDMSMVRPSS  118

Query  424  VRREWG--PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             +   G  PVQ+K+RLP+AQV+K++ ES+DE E AEK+I+L +
Sbjct  119  TQTSDGRQPVQVKVRLPRAQVQKLVEESQDEVEVAEKLIDLYM  161



>ref|XP_009592681.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=223

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 125/176 (71%), Gaps = 21/176 (12%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K  KVMKIDG+T+K KTP+ A +V+K+YP  VLL+SE VK FGVRA PLE  
Sbjct  1    MGNTLGGKKTTKVMKIDGQTMKFKTPLYANEVLKNYPTMVLLESEAVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS----PA  423
            QELKPK++YFLVELPK+P   E+ PRR+RSG+ MSA DRLE LM  RRS SD+S    P+
Sbjct  61   QELKPKRLYFLVELPKYPE--EKPPRRVRSGIQMSAKDRLETLMLARRSVSDLSILKPPS  118

Query  424  VRRE---------------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            +  E                G V++KLRLPKA+VEK++ + +DE + AEKI+ LC+
Sbjct  119  IITEESSYHNNSSPRKAEIGGSVRVKLRLPKAEVEKLMTQCKDEGDVAEKIMQLCM  174



>ref|XP_011006438.1| PREDICTED: uncharacterized protein At1g66480-like isoform X2 
[Populus euphratica]
Length=207

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 121/163 (74%), Gaps = 8/163 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG  KAKVM I+GET KLKTP  A +VVKDYPGHVLLDSE VK FG+RA PLE  
Sbjct  1    MGNNLGGGNKAKVMLINGETFKLKTPARAGEVVKDYPGHVLLDSEAVKHFGIRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS----PA  423
            QELK  KIYFL+ELP+ P   E+ PRR+RS +H+ A +RLE LM  RRS SD+S     +
Sbjct  61   QELKANKIYFLIELPEIPE--EKDPRRVRSAIHIGAKERLENLMLSRRSVSDMSMVRPSS  118

Query  424  VRREWG--PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             +   G  PVQ+K+RLP+AQV+K++ ES+DE E AEK+I+L +
Sbjct  119  TQTSDGRQPVQVKVRLPRAQVQKLVEESQDEVEVAEKLIDLYM  161



>ref|XP_010681969.1| PREDICTED: uncharacterized protein At1g66480 [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 129/174 (74%), Gaps = 17/174 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K AK+MKI+GET+K KTP+ A +VVKDYPGHV+L+S+ VK +G++A PL+  
Sbjct  1    MGNTLGGKKTAKIMKINGETMKFKTPIQAKEVVKDYPGHVVLESDAVKHYGIKAKPLDPF  60

Query  256  QELKPKKIYFLVELPKFPH-HGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA  423
              L+PKK+YFLVELPKFPH H  RVPR++RSG+ MSA DRLE+LM  RRS SD+S   PA
Sbjct  61   HNLEPKKLYFLVELPKFPHDHQHRVPRKVRSGIQMSAKDRLESLMLSRRSMSDISIMGPA  120

Query  424  VR----------REWGP---VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             R           E  P   ++++++LPKA+V++++ ES D+   AEKI++LC+
Sbjct  121  TRVMVDGGYHDASEGAPSSGLRVRMKLPKAEVDRLMSESTDQEGVAEKIMDLCL  174



>ref|XP_008389224.1| PREDICTED: uncharacterized protein At1g66480 [Malus domestica]
Length=228

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 128/173 (74%), Gaps = 11/173 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K+AKVM+++GET KLKTPV A +VVKD+PGHVLL S  VK FGVRA PLE  
Sbjct  1    MGNSLGGKKRAKVMQVNGETFKLKTPVQAGEVVKDFPGHVLLKSSDVKHFGVRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L+P ++YFLVELPK     E  PRR+RSG++MSA DRLE+LM  RRS SD+S      
Sbjct  61   QQLEPNRLYFLVELPKVDVKKESFPRRVRSGINMSAKDRLESLMLSRRSVSDLSVMKSSA  120

Query  418  ---PAVRREW--GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
                 V  E   G V++++RLP+A+VEK++ +S D+ EAA+KI++LC+ + + 
Sbjct  121  STASIVPEEEANGAVRVRMRLPRAEVEKLMRQSGDDAEAAQKIMDLCMVNTNN  173



>ref|XP_011075706.1| PREDICTED: uncharacterized protein At1g66480-like [Sesamum indicum]
Length=220

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 127/172 (74%), Gaps = 16/172 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVMKI+GET KLKTPV A  VV+ +PGHVLL+SE VK +GVRA PLE  
Sbjct  1    MGNSLGGKKSAKVMKINGETFKLKTPVRAGSVVESHPGHVLLESEAVKHYGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELKPK++YFLVELPKFP   E+  RR+RSG+ MSA DRLE+LM  RRS SD+S   PA 
Sbjct  61   QELKPKRLYFLVELPKFPE--EKGARRVRSGIQMSAKDRLESLMLARRSASDLSIMKPAS  118

Query  424  ----------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIR  549
                           G V++++RLPKA+VE+++ +S+D  E AEKI++LC++
Sbjct  119  MASEEEKKGGSEGGGGGVRVRMRLPKAEVERLMADSKDGAEVAEKIVSLCMK  170



>ref|XP_007045105.1| Encodes a protein whose expression is responsive to nematode 
infection, putative [Theobroma cacao]
 gb|EOY00937.1| Encodes a protein whose expression is responsive to nematode 
infection, putative [Theobroma cacao]
Length=227

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 128/172 (74%), Gaps = 14/172 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKI+GET KLKTPV A +VVKDYPGHVLL+SE+VK FG+RA PL++ 
Sbjct  1    MGNSLGGKKTTKVMKINGETFKLKTPVKAEEVVKDYPGHVLLESESVKHFGIRAKPLQSH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q L+PK++YFLVELP+ P   E V RR+RSG++MSA DRLE+LM  RRS SD++      
Sbjct  61   QSLEPKRLYFLVELPEAPK--EIVTRRVRSGINMSAKDRLESLMLSRRSVSDLTLMKPKC  118

Query  418  ------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDV  555
                       E G +++K+RLP+A+VE+++ ES +E EAAEKI+ LC+ + 
Sbjct  119  VIPEESEEEGSESGAMRVKMRLPRAEVERLMKESNNEAEAAEKIMQLCVANT  170



>ref|XP_009789650.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=242

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 125/182 (69%), Gaps = 27/182 (15%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K  KVMKIDG+T+K KTP+ A +V+++YP  VLL+SE VK FGVRA PLE  
Sbjct  1    MGNTLGGKKTTKVMKIDGQTMKFKTPIYANEVLRNYPTMVLLESEAVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELK K++YFLVELPK+P   ++ PRR+RSG+ MSA DRLE LM  RRS SD+S   PA 
Sbjct  61   QELKSKRLYFLVELPKYPE--QKTPRRVRSGIQMSAKDRLETLMLARRSVSDLSIMKPAS  118

Query  424  ---------------------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                                 +    GPV++KLRLP+A+VEK++ +S+DE + AEKI+ L
Sbjct  119  IMTEESSYHNNFASGTLLNNKMENGGGPVRVKLRLPRAEVEKLMTQSKDEGDVAEKIMRL  178

Query  541  CI  546
            C+
Sbjct  179  CL  180



>ref|XP_006344227.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=237

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 125/193 (65%), Gaps = 30/193 (16%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDG+T+K KTPV A +V+K+YP  VLL+SE VK +GVRA PLE  
Sbjct  1    MGNSLGGKKTTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHYGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELK K++YFLVELPKFP   ++  RR+RS + MSA DRLE LM  RRS SD+S   PA 
Sbjct  61   QELKSKRLYFLVELPKFPEENKKSTRRVRSAIQMSAKDRLETLMLARRSASDLSIMKPAS  120

Query  424  ---------------------VRREWGPVQ-----IKLRLPKAQVEKVIVESRDETEAAE  525
                                 V    GP Q     +KLRL KA+VEK+++ES+DE E AE
Sbjct  121  IVTEECSSYHNNNNNNSSASGVLNSGGPSQAHPTRLKLRLSKAEVEKLMMESKDENEVAE  180

Query  526  KIINLCIRDVDKG  564
            KI+ LC+   + G
Sbjct  181  KIMKLCMNSNNCG  193



>ref|XP_004238848.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum]
Length=236

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 127/199 (64%), Gaps = 36/199 (18%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDG+T+K KTP+ A +V+K+YP  VLL+SE VK +GVRA PLE  
Sbjct  1    MGNSLGGKKTTKVMKIDGQTMKFKTPIYANEVLKNYPSMVLLESEEVKHYGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELK K++YFLVELPKFP   ++  RR+RS + MSA DRLE LM  RRSTSD+S   PA 
Sbjct  61   QELKSKRLYFLVELPKFPEENKKSTRRVRSAIQMSAKDRLETLMLARRSTSDLSIMKPAS  120

Query  424  ---------------------------VRREWGPVQ-----IKLRLPKAQVEKVIVESRD  507
                                       V    GP Q     +KLRL K++VEK+++ES+D
Sbjct  121  IVTEECSSYHNNNNNNNNNNNNNSASDVLNSGGPSQAHPTRLKLRLSKSEVEKLMMESKD  180

Query  508  ETEAAEKIINLCIRDVDKG  564
            E E AEKI+ LC+ + + G
Sbjct  181  ENEVAEKIMKLCMNNNNCG  199



>ref|XP_004238847.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum]
Length=243

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 126/185 (68%), Gaps = 22/185 (12%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K  KVMKIDG+T+K KTPV A +V+K+YP  VLL+SE VK FGVRA PLE  
Sbjct  1    MGNSLGRKKTTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELK K++YFLVELPKFP      PRR+RSG+ MSA DRLE LM  RRS SD++   PA 
Sbjct  61   QELKSKRLYFLVELPKFPEEKNNNPRRVRSGIQMSAKDRLETLMLARRSASDLTIMKPAS  120

Query  424  --VRREWG----------------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIR  549
              +  E+                 PV++KLRLPK +VEK++++S+D ++ AEKI+ LC+ 
Sbjct  121  VMMSEEYSSSFGSGPLDGVGPQAQPVRLKLRLPKGEVEKLMMQSKDGSDVAEKIMKLCMS  180

Query  550  DVDKG  564
              + G
Sbjct  181  SNNDG  185



>ref|XP_006344228.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=243

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 126/185 (68%), Gaps = 22/185 (12%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K  KVMKIDG+T+K KTPV A +V+K+YP  VLL+SE VK FGVRA PLE  
Sbjct  1    MGNSLGRKKTTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELK K++YFLVELPK P    + PRR+RSG+ MSA DRLE LM  RRS SD++   PA 
Sbjct  61   QELKSKRLYFLVELPKIPEEKNKNPRRVRSGIQMSAKDRLETLMLARRSASDLTIMKPAS  120

Query  424  --VRREWG----------------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIR  549
              +  E+                 PV++KLRLPKA+VEK++++S+D ++  EKI+ LC+ 
Sbjct  121  VMMSEEYSSSFASGPLNGVGPQAQPVRLKLRLPKAEVEKLMMQSKDGSDVGEKIMKLCMN  180

Query  550  DVDKG  564
              + G
Sbjct  181  SNNDG  185



>ref|XP_002526007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36347.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 122/176 (69%), Gaps = 19/176 (11%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GGRK  KVMKI GET KLKTPV A +VV+DYPGHVLL+SE VK +G RA PLE  
Sbjct  1    MGNSLGGRKTVKVMKITGETFKLKTPVKAGEVVRDYPGHVLLESEAVKHYGTRAKPLEQH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSD--------  411
            Q+L  K++YFLVELPK P   E+VPRR+RSG+ MSA DRLE LM  RRS SD        
Sbjct  61   QDLVAKRLYFLVELPKPP--TEKVPRRVRSGIQMSAKDRLENLMLARRSVSDLTIMKNSA  118

Query  412  -----VSPAVRREWGP----VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                 ++P    E        ++K+RLPK++VEK++ ES+D+ E A K+++LCI +
Sbjct  119  CSSSGIAPDQENETDSNGSITRVKMRLPKSEVEKLMKESKDDAEVAAKLMDLCISN  174



>gb|KDP38041.1| hypothetical protein JCGZ_04684 [Jatropha curcas]
Length=202

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 125/178 (70%), Gaps = 18/178 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +GG+K  K+MKI GET KLKTPV A +VVKDYPG VLL+SE VK +G+RA PL+  
Sbjct  1    MGNTLGGKKTVKIMKITGETFKLKTPVKAGEVVKDYPGLVLLESEAVKHYGIRAKPLQPN  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS-----  417
            Q+L PK++YFLVELPK P   E+V RR+RSG ++MSA DRLE+LM  RRS SD+S     
Sbjct  61   QDLVPKRLYFLVELPKSPT--EKVARRVRSGPINMSAKDRLESLMLARRSASDLSIIKNT  118

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
                           E   V++K+RLPKA+VEK++ ES++E E AEKI+NL + + +K
Sbjct  119  SSSSFVSDETEKNGHEESAVRVKMRLPKAEVEKLMKESKNEAEVAEKIMNLYVGNKEK  176



>ref|XP_003555905.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
 gb|KHN32250.1| Hypothetical protein glysoja_039276 [Glycine soja]
Length=212

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 118/165 (72%), Gaps = 15/165 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKIDGET KLKTPV   +V+KD+PG VLLDSE VK +GVRA PLEA 
Sbjct  1    MGNTFGAKKTTKVMKIDGETFKLKTPVKVGEVLKDHPGLVLLDSEAVKHYGVRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            ++L+PK++YFLVELPK     E  PRR+RSG++MSA DRLE+L+  RRS SD+S      
Sbjct  61   KDLQPKRLYFLVELPK-----ETTPRRVRSGINMSAKDRLESLVLTRRSASDLSIMKQSS  115

Query  418  ----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                       G V++K+RLPKA+VEK+I   +DE EAAE+I+NL
Sbjct  116  NTDNKENSNNGGGVRLKMRLPKAEVEKLIQGCKDEAEAAERIMNL  160



>gb|KEH40549.1| plastid movement impaired protein [Medicago truncatula]
Length=211

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 126/169 (75%), Gaps = 14/169 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDGET KLKTPV A +V+KD+PG VLL+SE VK +GVRA PLEA 
Sbjct  1    MGNSLGGKKSTKVMKIDGETFKLKTPVKAGEVLKDHPGLVLLESEEVKHYGVRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSP-----  420
            +ELKPK++YFLVELPK      RV RR+RS ++MSA DRLE+L   RRS SD++      
Sbjct  61   KELKPKRLYFLVELPKES----RVTRRVRSVINMSAKDRLESLSLARRSASDLTIMKPMN  116

Query  421  --AVRRE---WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
               V +E    G V++K+RLPKA VEK++  S+DE EAAEKI++LC+ +
Sbjct  117  DFEVGKEDLTNGGVRLKMRLPKADVEKLMQSSKDEGEAAEKIMSLCMAN  165



>ref|XP_008339566.1| PREDICTED: uncharacterized protein At1g66480-like [Malus domestica]
Length=230

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 127/173 (73%), Gaps = 11/173 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K+AKVM+++GE  KLKTPV A +VV+D+PGHVLL S  VK FGVRA PLE  
Sbjct  1    MGNSLGGKKRAKVMQVNGEAFKLKTPVQAGEVVRDFPGHVLLKSSEVKHFGVRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            ++L+P ++YFLVELPK     E   RR+RSG++MSA DRLE+LM  RRS SD+S      
Sbjct  61   EQLEPNRLYFLVELPKVDVKKESFQRRVRSGINMSAKDRLESLMLSRRSVSDLSVMKSSA  120

Query  418  ---PAVRREW--GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
                 V  E   G V++++RLP+A+VEK++ +SRD+ EAA++I++LC+ + + 
Sbjct  121  STASIVPEEEANGAVRVRMRLPRAEVEKLMRQSRDDGEAAQQIMDLCMVNTNN  173



>ref|NP_001236455.1| uncharacterized protein LOC547691 [Glycine max]
 gb|AAG38147.1| unknown [Glycine max]
Length=207

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+GG+K  KVMKIDGET KLKTP+   DV+K++PG VLL+SE VK +G+RA PLEA 
Sbjct  1    MGNALGGKKTTKVMKIDGETFKLKTPIKVCDVLKNHPGLVLLESEAVKHYGIRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PAV  426
            +EL PK+ YFLVELPK        PRR+RSG++MSA DRLE+L+  RRS SD++   PA 
Sbjct  61   KELMPKRFYFLVELPK---EATVAPRRVRSGINMSAKDRLESLVLARRSASDLTIMKPAC  117

Query  427  R---REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
            R    E G +++K+RLPKA+VE+++     E EAAEKI+ LC+ +   G
Sbjct  118  RVSPAENGGLRLKMRLPKAEVERLMRGCETEAEAAEKIMGLCMVNGGNG  166



>ref|XP_010066633.1| PREDICTED: uncharacterized protein At1g66480 [Eucalyptus grandis]
 gb|KCW64604.1| hypothetical protein EUGRSUZ_G02193 [Eucalyptus grandis]
Length=237

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 128/183 (70%), Gaps = 22/183 (12%)
 Frame = +1

Query  76   MGNAIGGRKK--AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGNAIG +K   AKVMKI GET KL+TPV A DV+ DYPGHVLL+SE VK FGVRATPL+
Sbjct  1    MGNAIGAKKSRTAKVMKISGETTKLRTPVLAGDVLGDYPGHVLLESEAVKHFGVRATPLD  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSD---VSP  420
            A Q L+PK++YFLVELP+     +R+PRR+RSG+ MSA DRLE LM  RRS SD   V+P
Sbjct  61   ARQNLEPKRLYFLVELPESSR--DRMPRRVRSGITMSARDRLEGLMLARRSVSDLSIVNP  118

Query  421  A------------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD---V  555
            A               E G  ++ +RLPK +VE+++ ESRDE EAAEKI+NL I +   V
Sbjct  119  ASIGAAKDAKGGGGGGEGGSKRLTMRLPKGEVERLMKESRDEGEAAEKIMNLYITNGCKV  178

Query  556  DKG  564
            D G
Sbjct  179  DGG  181



>ref|XP_003544245.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
Length=214

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 10/166 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G  KK KVMK+DGET KLKTP  A DVVKDYPGHVLLDSE VK FG+RA PLE  
Sbjct  1    MGNTMGRSKKTKVMKVDGETFKLKTPARANDVVKDYPGHVLLDSEAVKHFGLRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGER--VPRRMR-SGVH-MSATDRLEALMKMRRSTSDVSPA  423
            QELKPKKIYFLVELPK     E+  +PRR+R SG+  M+A+DRLE LM  +RS SD+ P 
Sbjct  61   QELKPKKIYFLVELPKIQPEEEKTALPRRVRSSGIRGMNASDRLELLMLSKRSVSDL-PL  119

Query  424  VRR-----EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             R+       GP+++K+RLPKA ++K++ ES D +E AEKI++L +
Sbjct  120  ARQGPKMGSDGPMRVKMRLPKAHLDKLMEESTDGSEVAEKIMSLYV  165



>ref|XP_003519341.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
 gb|KHN41087.1| Hypothetical protein glysoja_013429 [Glycine soja]
Length=214

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 125/166 (75%), Gaps = 10/166 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G  KKAKVMK+DGETLKLKTP  A DVVKDYPGHVLLDSE VK FG+RA PLE  
Sbjct  1    MGNTMGRSKKAKVMKVDGETLKLKTPARANDVVKDYPGHVLLDSEAVKHFGLRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGER--VPRRMR-SGVH-MSATDRLEALMKMRRSTSDV---  414
            QELKP KIYFLVELPK     E+  +PRR+R SG+  M+A+DRL+ LM  +RS SD+   
Sbjct  61   QELKPTKIYFLVELPKIQPEEEKTALPRRVRSSGIRGMNASDRLQLLMLSKRSVSDLPLS  120

Query  415  --SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              SP +  + GP+++K+RLPKA ++K++ ES D ++ A+KII+L +
Sbjct  121  RQSPNLGSD-GPIRVKMRLPKAHLDKLMEESTDGSQVAQKIISLYM  165



>gb|KHG02457.1| hypothetical protein F383_25869 [Gossypium arboreum]
Length=218

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 126/186 (68%), Gaps = 23/186 (12%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYP-GHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR KAKVMKIDGET+KLKTPV  +DV+KDYP GHVLLDS+TVK +G+RA PLE 
Sbjct  1    MGNSIGGRNKAKVMKIDGETIKLKTPVRVWDVLKDYPTGHVLLDSQTVKHYGIRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHG-ERVPRRMRS-GVHMSATDRLEALMKMRRSTSD-----  411
             + LKPKKIYFLVELPK       + PRR+RS G+HMSA DRLE LM  RR+ SD     
Sbjct  61   QESLKPKKIYFLVELPKLADDEVHKAPRRVRSGGIHMSAKDRLECLMLSRRTVSDLSMVQ  120

Query  412  ------VSPAVR---------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  VS  VR            G + +K+RLPK+Q+ K++ ES+D  E AEKI++L I
Sbjct  121  PSSTSIVSDGVRLGGGGGGGTSGGGMMTVKMRLPKSQMAKLVEESKDGVEVAEKILDLYI  180

Query  547  RDVDKG  564
             +   G
Sbjct  181  GNGGSG  186



>ref|XP_008348593.1| PREDICTED: uncharacterized protein At1g66480-like [Malus domestica]
Length=187

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 117/154 (76%), Gaps = 11/154 (7%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKI GET K+KTP+ A+DVVKDYPGHVLL+SE VKRFGVRA PLE  +ELKPKKIYFLV+
Sbjct  1    MKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKRFGVRARPLEPQEELKPKKIYFLVQ  60

Query  295  LPKFPHHGE--RVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR--------REWGP  444
            LPKFP   E  +V RR+RSG+ +SA DRLE LM  RRS SD++ +VR           GP
Sbjct  61   LPKFPAEEEEKQVTRRVRSGIQVSAKDRLECLMLSRRSVSDLT-SVRASSTTSSSSSEGP  119

Query  445  VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            V++K+RLPKAQ+ K++ ES+D+ E AE+II L +
Sbjct  120  VRMKMRLPKAQMVKLVEESKDDVEIAERIIELYM  153



>gb|KCW69333.1| hypothetical protein EUGRSUZ_F02820 [Eucalyptus grandis]
Length=221

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +1

Query  76   MGNAIG-GR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN++G GR ++AKVMKI GETLKL+TPV A  VV  +PGHVLLDSE+VK FG+RA PLE
Sbjct  1    MGNSVGSGRNRRAKVMKITGETLKLRTPVRACQVVDGHPGHVLLDSESVKHFGIRARPLE  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
               ELKPKKIYFLVELPKFP   E+  RR+RSG+ M A DRLE LM  RR+ SD+     
Sbjct  61   PHHELKPKKIYFLVELPKFPDGHEKAFRRVRSGLQMGAKDRLECLMLSRRAASDMVRPTE  120

Query  430  REW-----GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDV  555
              +      PVQ+K+R+P+AQ++K++ ES D+ E A +I++L +  V
Sbjct  121  ASFQPESAAPVQMKMRIPRAQLDKLMEESSDDAEVARRIVDLYMGQV  167



>gb|KHN04248.1| Hypothetical protein glysoja_049449 [Glycine soja]
Length=200

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 122/171 (71%), Gaps = 14/171 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+GG+K  KVMKIDGET KLKTP+   DV+K++PG VLL+SE VK +G+RA PLEA 
Sbjct  1    MGNALGGKKTTKVMKIDGETFKLKTPIKVCDVLKNHPGLVLLESEAVKHYGIRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            +EL PK+ YFLVELPK        PRR+RSG++MSA DRLE+L+  RRS SD++      
Sbjct  61   KELMPKRFYFLVELPK---EATVAPRRVRSGINMSAKDRLESLVLARRSASDLTIMKPLS  117

Query  418  --PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
              PA   E G +++K+RLPKA+VE+++     E EAAEKI+ LC+ +   G
Sbjct  118  SEPA---ENGGLRLKMRLPKAEVERLMRGCETEAEAAEKIMGLCMVNGGNG  165



>ref|XP_010109016.1| hypothetical protein L484_027215 [Morus notabilis]
 gb|EXC20656.1| hypothetical protein L484_027215 [Morus notabilis]
Length=230

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 16/175 (9%)
 Frame = +1

Query  76   MGNAI--GGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN+I  GG+K+ K+MKI+GET K+K P+ A DV KD+ GHVLLDSE VK FG++A PLE
Sbjct  1    MGNSITGGGKKRVKIMKINGETFKVKIPIRALDVTKDHQGHVLLDSEAVKHFGIKANPLE  60

Query  250  AAQELKPKKIYFLVELPKFPHHGE------RVPRRMRSGVHMSATDRLEALMKMRRSTSD  411
              Q LKP K+YFLVE+P+FP          R  RR+RSG++MSA DRLE LM  RRS SD
Sbjct  61   PQQHLKPNKVYFLVEIPRFPTSENNQDEISRGARRVRSGINMSAKDRLECLMLSRRSVSD  120

Query  412  VS--------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
            +S               GPV++K+RLP AQVEK++ ESRD+ E AEKI+ L + D
Sbjct  121  MSLLRPSSSTGLSSGGPGPVRVKMRLPLAQVEKLVEESRDKVEVAEKILALYMGD  175



>ref|XP_010062234.1| PREDICTED: uncharacterized protein At1g66480-like [Eucalyptus 
grandis]
 gb|KCW69332.1| hypothetical protein EUGRSUZ_F02820 [Eucalyptus grandis]
Length=228

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +1

Query  76   MGNAIG-GR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN++G GR ++AKVMKI GETLKL+TPV A  VV  +PGHVLLDSE+VK FG+RA PLE
Sbjct  1    MGNSVGSGRNRRAKVMKITGETLKLRTPVRACQVVDGHPGHVLLDSESVKHFGIRARPLE  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
               ELKPKKIYFLVELPKFP   E+  RR+RSG+ M A DRLE LM  RR+ SD+     
Sbjct  61   PHHELKPKKIYFLVELPKFPDGHEKAFRRVRSGLQMGAKDRLECLMLSRRAASDMVRPTE  120

Query  430  REW-----GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDV  555
              +      PVQ+K+R+P+AQ++K++ ES D+ E A +I++L +  V
Sbjct  121  ASFQPESAAPVQMKMRIPRAQLDKLMEESSDDAEVARRIVDLYMGQV  167



>ref|XP_004253408.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum]
Length=236

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 121/193 (63%), Gaps = 29/193 (15%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I GRKK+ KVMKIDG+T+K KTPV A +V+K+YP  VLL+SE VK FGVRA PLE 
Sbjct  1    MGNIILGRKKSTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----  417
             QELKPK++YFLVELPK P   ++ P R RS + MSA +RLE LM  RRS SD+S     
Sbjct  61   QQELKPKRLYFLVELPKLPEENKKSPFRARSAIQMSAKERLETLMLARRSASDLSIMKPT  120

Query  418  ------------------PAVRREWGPVQ-----IKLRLPKAQVEKVIVESRDETEAAEK  528
                                +    GP Q     +KLRL K +VEK+++ES+DE E A K
Sbjct  121  SMMMSTHEYSSSHTNNPTLGILNSGGPAQGRPTRLKLRLSKVEVEKLMMESKDENEVAHK  180

Query  529  IINLCIRDVDKGR  567
            I+ LC+ + + G 
Sbjct  181  IMKLCMNNNNGGN  193



>ref|XP_009596673.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=241

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 124/190 (65%), Gaps = 29/190 (15%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGH-VLLDSETVKRFGVRATPLEA  252
            MGN++G +K AKVMKIDG+ +K KTPV A +++K YP   VLL+SE VK FG++A PLE 
Sbjct  1    MGNSLGRKKTAKVMKIDGQIMKFKTPVYANEILKSYPNSMVLLESEEVKHFGIKAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----  417
             QELKPK++YFLVELPK+P   E+ PRR+RSG+ MSA DRLE LM  RRS SD+S     
Sbjct  61   QQELKPKRLYFLVELPKYPE--EKPPRRVRSGIQMSAKDRLETLMLARRSVSDLSILKPV  118

Query  418  ---------------------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKII  534
                                        GPV++KLRLPKA+VEK++++S+ E + AEKI+
Sbjct  119  SIITEESSYNNNYASGSVLNNSKTENGGGPVRVKLRLPKAEVEKLMMQSKGEEDVAEKIM  178

Query  535  NLCIRDVDKG  564
             LC+ +   G
Sbjct  179  RLCMANNGGG  188



>gb|EYU30052.1| hypothetical protein MIMGU_mgv1a023844mg [Erythranthe guttata]
Length=214

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 127/174 (73%), Gaps = 19/174 (11%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+++AKVMKI+GET KLKTPV A  V++ +PGHVLL+SE+V+  G RA PLE  
Sbjct  1    MGNSLGGKRRAKVMKINGETFKLKTPVQARSVLESHPGHVLLESESVRHHGARAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPA--VR  429
             ELKPK++YFLV+LPKFP   ++  RR+RSG+HMSA DRL++LM  RRS SD+S    VR
Sbjct  61   HELKPKRLYFLVQLPKFPE--DKSVRRVRSGIHMSAKDRLDSLMLARRSASDLSTVKPVR  118

Query  430  REW-----GPVQIK----------LRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             E      G ++ +          +RLPK++VE+++ ES+D  EAAEKI++LC+
Sbjct  119  FEIEEERKGILETRGGGGRGVRVTMRLPKSEVERLMAESKDGAEAAEKIVSLCM  172



>ref|XP_004498324.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=210

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 122/168 (73%), Gaps = 13/168 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN+ GG+K  KVMKIDGET KLKTP+   +V+KD+PG VLL+SE VK +G+RA PLE+ 
Sbjct  1    MGNSFGGKKTTKVMKIDGETFKLKTPIKVGEVLKDHPGLVLLESEEVKHYGIRAKPLESH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR--  429
            ++LKPK++YFLVELPK      RV RR+RS +++SA DRLE L   RRS SD+S      
Sbjct  61   KDLKPKRLYFLVELPKES----RVTRRVRSVINVSAKDRLENLSLARRSASDLSIMKSMS  116

Query  430  -------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                    E G V++K+RLPKA+VEK++  S+DE EAAEKI++LC+ +
Sbjct  117  GLEGREVMENGAVRLKMRLPKAEVEKLMQSSKDEGEAAEKIMSLCMAN  164



>ref|XP_009357803.1| PREDICTED: uncharacterized protein At1g66480 [Pyrus x bretschneideri]
Length=230

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 124/173 (72%), Gaps = 11/173 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVM+++GE  KLKTPV A +VVKD+PGHVLL S  VK FGVRA PLE  
Sbjct  1    MGNSLGGKKGAKVMQVNGEAFKLKTPVQAGEVVKDFPGHVLLKSSEVKHFGVRAKPLEPY  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            ++L+P ++Y LVELPK     E + RR+RSG++MSA DRLE+LM  RRS S +S      
Sbjct  61   EQLEPNRLYLLVELPKVDLKKETLQRRVRSGINMSAKDRLESLMLSRRSVSGLSVMKSSA  120

Query  418  ---PAVRRE--WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
                 V  E   G V++++RLP+A VEK++ +SRD+ EAA++I++LC+ + + 
Sbjct  121  STASIVPEEEANGAVRVRMRLPRADVEKLMRQSRDDGEAAQQIMDLCMVNTNN  173



>ref|XP_009805058.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=247

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%), Gaps = 27/184 (15%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K  KVMKIDG+ +K KTPV A +V+K+YP  VLL+SE VK FGVRA PLE  
Sbjct  1    MGNSLGRKKTTKVMKIDGQIMKFKTPVYANEVLKNYPTMVLLESEEVKHFGVRAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            QELK K++YFLVELPK+P   E+  RR+RSG+ MSA DRLE LM  RRS SD+S   PA 
Sbjct  61   QELKSKRLYFLVELPKYPE--EKNTRRIRSGIQMSAKDRLETLMLARRSVSDLSTMKPAS  118

Query  424  ---------------------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                                      GPV++KLRLP+A+VEK++ +S+ E + AEKI+ L
Sbjct  119  IMTEESSHHNNFASGTLLNNKTETGGGPVRVKLRLPRAEVEKLMTQSKGEEDVAEKIMRL  178

Query  541  CIRD  552
            C+ +
Sbjct  179  CMAN  182



>ref|XP_004490863.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=210

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 124/171 (73%), Gaps = 8/171 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IG  K+AKVMKIDGET K+K P +A DVVKDYP HVLLDS+ VK FG+RA PLE  
Sbjct  1    MGNTIGKSKRAKVMKIDGETFKVKIPSTANDVVKDYPNHVLLDSQAVKHFGLRARPLEPN  60

Query  256  QELKPKKIYFLVELPKFPHHGER--VPRRMR-SGVH-MSATDRLEALMKMRRSTSDVS--  417
            QELKPKKIYFLV+LPK     E+  +PRR+R SG+  M+A +RLE LM  +RS SD++  
Sbjct  61   QELKPKKIYFLVDLPKVQPEEEKTALPRRVRSSGIRTMNAKERLELLMLSKRSVSDLTLV  120

Query  418  --PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
              P      GP+++KLRLPKAQ+EK++ ES D ++ AEKI++L +   + G
Sbjct  121  KQPPNLDLDGPMRVKLRLPKAQLEKLMEESNDGSQVAEKIMSLYMGTNNGG  171



>ref|XP_006582842.1| PREDICTED: uncharacterized protein LOC100306423 isoform X1 [Glycine 
max]
 gb|KHN43039.1| Hypothetical protein glysoja_007569 [Glycine soja]
Length=210

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 13/167 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKIDGET KLKTPV   +V+KD+PG VLLDSE VK +GVRA PLEA 
Sbjct  1    MGNTFGAKKTTKVMKIDGETFKLKTPVKVREVLKDHPGLVLLDSEAVKHYGVRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            +EL+PK++YFLVELPK     E  PRR+RSG++MSA DRLE+L+  RRS SD+S      
Sbjct  61   KELQPKRLYFLVELPK-----ETKPRRVRSGINMSAKDRLESLVLTRRSASDLSIMKQSN  115

Query  418  --PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                     G V++K+RLPKA+VEK+I   +DE EAAE+I+ L + +
Sbjct  116  NMDNNENNGGGVRLKMRLPKAEVEKLIQGCKDEAEAAERIMKLYMAN  162



>ref|XP_007141885.1| hypothetical protein PHAVU_008G233900g [Phaseolus vulgaris]
 gb|ESW13879.1| hypothetical protein PHAVU_008G233900g [Phaseolus vulgaris]
Length=216

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 122/166 (73%), Gaps = 10/166 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IG  +KAKVMK+DGETLKLKTP  A DVVKDYPGHVLL+SE VK FG+RA PLE  
Sbjct  1    MGNTIGRSRKAKVMKVDGETLKLKTPARANDVVKDYPGHVLLESEAVKHFGLRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVP--RRMR-SGVH-MSATDRLEALMKMRRSTSDV---  414
             ELKPKKIYFLVELPK     E+    RR+R SG+  M+A DRL+ LM  +RS SD+   
Sbjct  61   HELKPKKIYFLVELPKIQPEEEKTALHRRVRSSGIRGMNAKDRLDLLMLSKRSASDLTLV  120

Query  415  --SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              SP +  + GP+++K+RLPKA ++K++ ES D +E AEKII+L +
Sbjct  121  RPSPNLASD-GPMRVKMRLPKAHLDKLMEESTDGSEVAEKIISLYM  165



>ref|XP_004161194.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=203

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 18/171 (11%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKI GET+KLKTPV A DVVKDYPG VLL+SE VK +GVRA PLE  
Sbjct  1    MGNTFGVKKTVKVMKISGETMKLKTPVQAGDVVKDYPGFVLLESEAVKHYGVRAKPLELH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L  K++YFLV+LP+ P   E+ PRR+RS ++MSA DRLE+LM  RRS SD++      
Sbjct  61   QKLSTKRLYFLVDLPRLPK--EQAPRRVRSAINMSAKDRLESLMLARRSASDLTIMKPKS  118

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                              P ++K+RLPKA+VE+++ E +DE EAAE+I+ L
Sbjct  119  MLTEEGGGESEEGSVSGAPTRVKMRLPKAEVERLLKECKDEAEAAERIMGL  169



>ref|XP_004140437.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=215

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 18/171 (11%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKI GET+KLKTPV A DVVKDYPG VLL+SE VK +GVRA PLE  
Sbjct  1    MGNTFGVKKTVKVMKISGETMKLKTPVQAGDVVKDYPGFVLLESEAVKHYGVRAKPLELH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L  K++YFLV+LP+ P   E+ PRR+RS ++MSA DRLE+LM  RRS SD++      
Sbjct  61   QKLSTKRLYFLVDLPRLPK--EQAPRRVRSAINMSAKDRLESLMLARRSASDLTIMKPKS  118

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                              P ++K+RLPKA+VE+++ E +DE EAAE+I+ L
Sbjct  119  MLTEEGGGESEEGSVSGAPTRVKMRLPKAEVERLLKECKDEAEAAERIMGL  169



>ref|XP_007157721.1| hypothetical protein PHAVU_002G092800g [Phaseolus vulgaris]
 gb|ESW29715.1| hypothetical protein PHAVU_002G092800g [Phaseolus vulgaris]
Length=217

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (69%), Gaps = 18/172 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKIDGET KLKTPV   +V+KD+PG VLLDSE VK +GVRA PLEA 
Sbjct  1    MGNTFGAKKTTKVMKIDGETFKLKTPVKVEEVLKDHPGLVLLDSEAVKHYGVRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            +EL PK++YFLVELPK     E  PRR+RSG++MSA DRLE L+  RRS SD+S   +  
Sbjct  61   KELHPKRLYFLVELPK-----EIKPRRVRSGINMSAKDRLENLVLTRRSASDLSIMKQSN  115

Query  436  WGP-------------VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                            V++K+RLPKA+VEK+I  S+D+ EAAE+I+ L + +
Sbjct  116  MSDGEQGNNKENNNGGVRLKMRLPKAEVEKLIQGSKDQAEAAERIVKLYMAN  167



>ref|NP_001238620.1| uncharacterized protein LOC100306423 [Glycine max]
 gb|ACU14590.1| unknown [Glycine max]
Length=198

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 119/167 (71%), Gaps = 13/167 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKIDGET KLKTPV   +V+KD+PG VLLDSE VK +GV+A PLEA 
Sbjct  1    MGNTFGAKKTTKVMKIDGETFKLKTPVKVREVLKDHPGLVLLDSEAVKHYGVKAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            +EL+PK++YFLVELPK     E  PRR+RSG++MSA DRLE+L+  RRS SD+S      
Sbjct  61   KELQPKRLYFLVELPK-----ETKPRRVRSGINMSAKDRLESLVLTRRSASDLSIMKQSN  115

Query  418  --PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                     G V++K+RLPKA+VEK+I   +DE EAAE+I+ L + +
Sbjct  116  NMDNNENNGGGVRLKMRLPKAEVEKLIQGCKDEAEAAERIMKLYMAN  162



>ref|XP_006448285.1| hypothetical protein CICLE_v10016683mg [Citrus clementina]
 ref|XP_006495050.1| PREDICTED: uncharacterized protein At1g66480-like [Citrus sinensis]
 gb|ESR61525.1| hypothetical protein CICLE_v10016683mg [Citrus clementina]
Length=212

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 120/169 (71%), Gaps = 13/169 (8%)
 Frame = +1

Query  76   MGNAIG----GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATP  243
            MGN++G     RK  KVMKI GET K+KTPV A +VVKDYPGHVLL+SE+VK +GVRA P
Sbjct  1    MGNSMGLGGKNRKTTKVMKITGETFKIKTPVKAGEVVKDYPGHVLLESESVKHYGVRAKP  60

Query  244  LEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS--  417
            L A Q L+ K++YFLVELP      E VPRR+RSG++MSA DRLE+L   RRS SD+S  
Sbjct  61   LGAEQNLEAKRLYFLVELPDVARK-EIVPRRVRSGINMSAKDRLESLKLSRRSVSDLSIL  119

Query  418  -PAVRR-----EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             P         E G +++KL+LPKA+VEK++ ES ++ E AEKI  LC+
Sbjct  120  KPVSSSSSSLPEDGAMRLKLKLPKAEVEKLMRESNNDAEIAEKIRELCM  168



>ref|XP_004503145.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=217

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 123/176 (70%), Gaps = 17/176 (10%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN + GR KKAKVMK+DGET KLK P  A DVVKDYPGH LL+S+ VK FG+RA PLE 
Sbjct  1    MGNTMMGRSKKAKVMKLDGETFKLKIPARANDVVKDYPGHALLESQAVKHFGLRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMR-SGVH-MSATDRLEALMKMRRSTSDVSPAV  426
             Q LKPKKIYFLVELPK     E +PRR+R SG+  M+A +RL+ LM  +RS SD+S   
Sbjct  61   YQMLKPKKIYFLVELPKL--QPEPLPRRVRSSGIRGMNAMERLDFLMLSKRSVSDLSLVK  118

Query  427  RREWGPV------------QIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVD  558
            R   G V            +IK+RLPKAQ+++++ ESRDETE AEKI++L + + D
Sbjct  119  RNSSGVVHDGPSLVRDGSKRIKMRLPKAQLDRLMEESRDETEVAEKIVSLYMGNND  174



>gb|KDO63111.1| hypothetical protein CISIN_1g0323941mg [Citrus sinensis]
 gb|KDO63112.1| hypothetical protein CISIN_1g0323941mg [Citrus sinensis]
Length=141

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IGGR+KAKVMKIDGET+KLKTP+ A +VVKDYPG+VLLDSE VK FG+RA PLE  
Sbjct  1    MGNTIGGRRKAKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEPR  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS  417
            Q+LKPKK+YFLVELPK P   E++ RR+RSG+ MSA DRLE LM  RR+ SD++
Sbjct  61   QQLKPKKVYFLVELPKLPDE-EKITRRVRSGIQMSAKDRLECLMLSRRAVSDLT  113



>ref|XP_010916176.1| PREDICTED: uncharacterized protein At1g66480-like [Elaeis guineensis]
Length=197

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 118/166 (71%), Gaps = 9/166 (5%)
 Frame = +1

Query  76   MGNAIGGRKK--AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGNAIGG+K+  AKVMK+DG T++LK P  A DV++D+  H LL++E VKR GVRA PLE
Sbjct  1    MGNAIGGKKRRTAKVMKLDGTTIRLKLPAQAGDVLRDHLEHTLLEAEEVKRLGVRAQPLE  60

Query  250  AAQELKPKKIYFLVELPKFPH-HGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPA  423
              Q +KP K+YFLVE+P+ P     RVPRR  SG +HMSA DRLE+LM  RRS SD++ A
Sbjct  61   PDQAIKPGKLYFLVEIPRLPRLQDRRVPRRAWSGAIHMSAKDRLESLMLSRRSASDLTLA  120

Query  424  VRRE-----WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                      G V+I++RLPKAQV K++ ES D  EAAE+I+ LC+
Sbjct  121  KPSSVETVGEGGVRIRMRLPKAQVAKLVEESSDSCEAAERIMALCV  166



>ref|XP_004505259.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=209

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 120/174 (69%), Gaps = 24/174 (14%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKIDGETLKLKTP+   +V+KD+PG VLLDSE VK +GVRA PLEA 
Sbjct  1    MGNTFGSKKTTKVMKIDGETLKLKTPIRVGEVLKDHPGLVLLDSEAVKHYGVRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            +EL+PK++YFLVELPK     E  PRR+RSG++MSA DRL+ LM  RRSTSD+S   + +
Sbjct  61   KELQPKRLYFLVELPK-----EIKPRRVRSGINMSAKDRLDNLMLTRRSTSDLSIMKQSK  115

Query  436  -------------------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                                G V++K+RLP+++VEK+I + +DE EAA +I++ 
Sbjct  116  RDDNDNDNDDDEKHGEENINGGVRLKVRLPRSEVEKLIRDCKDEAEAAHRIMSF  169



>ref|XP_010105767.1| hypothetical protein L484_009963 [Morus notabilis]
 gb|EXC06052.1| hypothetical protein L484_009963 [Morus notabilis]
Length=226

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 114/156 (73%), Gaps = 14/156 (9%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKI GE  KL+TP+ A +VVKDYPGHVLL+SE VK +G RA PLE  QELKPK++YFLVE
Sbjct  1    MKITGEEFKLRTPIQAGEVVKDYPGHVLLESEAVKHYGTRARPLEPNQELKPKRLYFLVE  60

Query  295  LPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS----------PAVRREWG-  441
            LPK     E+ PRR+RSG++MSA DRLE+LM  RRS SD+S           +     G 
Sbjct  61   LPKVTK--EKNPRRVRSGINMSAKDRLESLMLARRSVSDLSIMKPMSVLPEESTSENGGG  118

Query  442  -PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              V++++RLP+A+VE+++ ESRDE EAAEKI++LC+
Sbjct  119  SGVRVRMRLPRAEVERLMKESRDEAEAAEKIVDLCL  154



>gb|KEH34686.1| plastid movement impaired protein [Medicago truncatula]
Length=217

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 20/174 (11%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN + GR KKAKVMKIDGET KLKTP  A DVVK YPGH LLDS+ VK FG+RA PLE 
Sbjct  1    MGNVMMGRTKKAKVMKIDGETFKLKTPAKANDVVKHYPGHALLDSQAVKHFGLRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMR-SGVH----MSATDRLEALMKMRRSTSDVS  417
             Q+LK KKIYFLVELPK     + +PRR+R SG+H    M+AT+RL+ LM  +RS SD+ 
Sbjct  61   HQQLKAKKIYFLVELPKV--QSQPLPRRVRSSGLHPSCGMNATERLDFLMLSKRSVSDL-  117

Query  418  PAVRREW-----------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            P+V+R             G  ++K+R+PKAQ++K++ ESRD  E AEKI++L +
Sbjct  118  PSVKRSNLGDDGPGLVRDGSTRVKMRIPKAQLDKLMEESRDGAEVAEKIVSLYM  171



>gb|AFK45330.1| unknown [Medicago truncatula]
 gb|AFP87383.1| unknown [Medicago sativa]
 gb|KEH30890.1| plastid movement impaired protein [Medicago truncatula]
Length=210

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 117/168 (70%), Gaps = 18/168 (11%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKIDGET+KLKTP+ A +V+KD+PG VLLDSE VK +GVRA  +EA 
Sbjct  1    MGNTFGSKKTTKVMKIDGETMKLKTPIKAGEVLKDHPGLVLLDSEAVKHYGVRAKVIEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSP-----  420
            +EL+PK++YFLVELPK     E  PRR+RSG+ MSA DRL+ L+  RRS SD+S      
Sbjct  61   KELQPKRLYFLVELPK-----ETKPRRIRSGIQMSAKDRLDNLVLTRRSASDLSILKQSK  115

Query  421  --------AVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                      +   G V++K+RLPKA+VEK++ + +DE EAAE I+ L
Sbjct  116  MNDNSGELEGKENGGGVRLKVRLPKAEVEKLMRDCKDEAEAAEMIMRL  163



>ref|XP_003616384.1| hypothetical protein MTR_5g079610 [Medicago truncatula]
 gb|AES99342.1| plastid movement impaired protein [Medicago truncatula]
Length=211

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 12/169 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN IG  KKAK+MKIDGET K+KTP ++ +VVK+YP HVLLDS+ VK FG+RA PLE  
Sbjct  1    MGNTIGKSKKAKIMKIDGETFKVKTPTTSNEVVKNYPNHVLLDSQAVKHFGLRAKPLEPN  60

Query  256  QELKPKKIYFLVELPKFPHHGER--VPRRMR-SGV-HMSATDRLEALMKMRRSTSDVS--  417
            QELKPKKIYFLV+LPK     E+  +PRR+R SG+ ++ A  RLE LM  +RS SD+S  
Sbjct  61   QELKPKKIYFLVDLPKIEPENEKTSLPRRVRSSGIRNVDAKGRLELLMLSKRSVSDISLV  120

Query  418  -PAVRREW-----GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             P     +     G +++K+RLPKAQ+EK++ ES D +E AEKI++L +
Sbjct  121  KPPSNLGFDRPFDGSMRVKMRLPKAQLEKLMEESNDGSEVAEKIMSLYM  169



>ref|XP_009129247.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
Length=267

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 123/173 (71%), Gaps = 16/173 (9%)
 Frame = +1

Query  55   FIC--RTERMGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFG  228
            F C  +  +MGN++GG+K  KVMKIDGET KLKTPV+A +V+KD+PGHVLL+SE+VK +G
Sbjct  39   FSCPRKQSKMGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLESESVKHYG  98

Query  229  VRATPLEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTS  408
             RA PLE  Q L+ K++YF+VE  K     E  PRR+RSG+HMSA +RLE LM  RRS+S
Sbjct  99   ARAKPLEMKQMLEAKRLYFVVEPVK-----ECPPRRVRSGIHMSAKERLENLMLARRSSS  153

Query  409  DVS---PA------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
            D+S   PA        +E G V++KLR+PKA++E+++ E   E EA +KI  L
Sbjct  154  DLSILKPAGEWSKTEEKEGGAVRVKLRIPKAELERLVKEGATEAEATQKIAAL  206



>ref|XP_008454771.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Cucumis 
melo]
Length=213

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 115/169 (68%), Gaps = 16/169 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKI GETLKL TPV   DVVKDYPG VLL+SE VK +GVRA PLE  
Sbjct  1    MGNTFGVKKTVKVMKISGETLKLNTPVQVGDVVKDYPGFVLLESEAVKHYGVRAKPLELH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L  K++YFLV+LPK P   E+ PRR+RS ++MSA DRLE+LM  RRS SD++      
Sbjct  61   QKLSTKRLYFLVDLPKLPK--EQAPRRVRSAINMSAKDRLESLMLARRSASDLTIMKPKS  118

Query  418  --------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                     +     G  ++K+RLPKA+VE+++ E +DE EAAE+I+ L
Sbjct  119  VLTEEGGGESEGSGSGATRVKVRLPKAEVERLLKECKDEAEAAERIMGL  167



>ref|XP_008454773.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Cucumis 
melo]
Length=212

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 115/169 (68%), Gaps = 16/169 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN  G +K  KVMKI GETLKL TPV   DVVKDYPG VLL+SE VK +GVRA PLE  
Sbjct  1    MGNTFGVKKTVKVMKISGETLKLNTPVQVGDVVKDYPGFVLLESEAVKHYGVRAKPLELH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS------  417
            Q+L  K++YFLV+LPK P   E+ PRR+RS ++MSA DRLE+LM  RRS SD++      
Sbjct  61   QKLSTKRLYFLVDLPKLPK--EQAPRRVRSAINMSAKDRLESLMLARRSASDLTIMKPKS  118

Query  418  --------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                     +     G  ++K+RLPKA+VE+++ E +DE EAAE+I+ L
Sbjct  119  VLTEEGGGESEGSGSGATRVKVRLPKAEVERLLKECKDEAEAAERIMGL  167



>ref|XP_009414071.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=203

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 120/166 (72%), Gaps = 12/166 (7%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG+KK AKVMK+DG T KLK PV A  V++D+PG+ LLD++ V R GVRA PLE 
Sbjct  1    MGNSLGGKKKIAKVMKVDGTTFKLKPPVQAVSVLRDHPGYNLLDADDVTRLGVRAMPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               LKP K+YFLVELP+ P+  +R PRR  SG + +SA +RLE+L   RRS SD+     
Sbjct  61   DTSLKPGKLYFLVELPRVPN--QRAPRRAWSGALQVSAKERLESLRLTRRSLSDLSLATQ  118

Query  415  SPAVRREW---GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
            SP+V  E    G V++K+RLPKAQVEK++ ES+D  EAA+KI+ LC
Sbjct  119  SPSVEAEEAKDGTVRLKMRLPKAQVEKLMQESKDAAEAAQKIMQLC  164



>ref|XP_011070637.1| PREDICTED: uncharacterized protein At1g66480-like [Sesamum indicum]
Length=206

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG++ AKVMKI+GET KLKTPV    VV ++PGHVLLDSE V+ +GVRA PLE  
Sbjct  1    MGNSLGGKRSAKVMKINGETFKLKTPVRVGSVVGNHPGHVLLDSEAVRHYGVRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAV---  426
            QELKP+++YFLV+LPK P   ++ PRR+RSG+HMSA DRL + M    + + +       
Sbjct  61   QELKPRRLYFLVQLPKSPE--QKRPRRVRSGIHMSAKDRLASPMAEVAAQALLQGVFGGG  118

Query  427  --RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  G V++++RLPKA+VE+++ ES+D  E AEKI++LC+
Sbjct  119  GGGGGGGGVRVRMRLPKAEVERLMAESKDGAEVAEKIVSLCM  160



>ref|XP_007153300.1| hypothetical protein PHAVU_003G023400g [Phaseolus vulgaris]
 gb|ESW25294.1| hypothetical protein PHAVU_003G023400g [Phaseolus vulgaris]
Length=189

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 116/162 (72%), Gaps = 8/162 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+GG+K  KVMKIDG+T K KTP+   DV+KD+PG VLL+SE VK +GVRA PLE  
Sbjct  1    MGNALGGKKTTKVMKIDGQTFKFKTPIRVADVLKDHPGLVLLESEAVKHYGVRAKPLEVH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR-  432
            +EL PK++YFLVELP+        PRR+RS ++MSA DRLE+L+  RRS SD++    + 
Sbjct  61   RELAPKRLYFLVELPR---EATVAPRRVRSVINMSAKDRLESLVLARRSASDLTIMKGQG  117

Query  433  ----EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                E G V++++R+ KA+VE+V+     E EAAEKI+ LC+
Sbjct  118  MEGAEKGGVRLRMRVAKAEVERVMRGCETEAEAAEKIVGLCM  159



>emb|CDY37375.1| BnaC02g33930D [Brassica napus]
Length=220

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 14/166 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDGET KLKTPV+A +V+KD+PGHVLL+SE+VK +G RA PLE  
Sbjct  1    MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLEMK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            Q L+ K++YF+VE  K     E  PRR+RSG+HMSA +RLE LM  RRS+SD+S   PA 
Sbjct  61   QMLEAKRLYFVVEPVK-----ECPPRRVRSGIHMSAKERLENLMLARRSSSDLSILKPAG  115

Query  424  -----VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                   +E G V++KLR+P+A++E+++ E   E EA +KI  L +
Sbjct  116  EWSKTEEKEGGAVRVKLRIPRAELERLVKEGATEAEATQKIAALYM  161



>ref|XP_008775226.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=193

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = +1

Query  76   MGNAIGGRKK--AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN IGG+K+  AKV+K+DG T++LK P  A DV++D+P H LL++E VKR GVRA PL+
Sbjct  1    MGNVIGGKKRRTAKVVKLDGTTIRLKLPTQAGDVLRDHPEHTLLEAEEVKRLGVRAQPLD  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS---  417
              Q +KP+K+Y LVELP+      R+PRR  SG +HMSA DRLE+LM  RRS SD++   
Sbjct  61   PDQAIKPRKLYVLVELPRLQER--RLPRRAWSGAIHMSAKDRLESLMLSRRSASDLTLAK  118

Query  418  PAVRR-EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
            P+V     G V+I++RLP+AQV K++ ES D +EAAEKI+ LC
Sbjct  119  PSVETVGEGGVRIRMRLPRAQVAKLVEESSDSSEAAEKIVALC  161



>ref|XP_007163405.1| hypothetical protein PHAVU_001G232100g [Phaseolus vulgaris]
 gb|ESW35399.1| hypothetical protein PHAVU_001G232100g [Phaseolus vulgaris]
Length=218

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 122/173 (71%), Gaps = 13/173 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+G  KKAKVMKIDGET KLKTP +A DVVKDYPGHVLLDS  VK FG RA PLE  
Sbjct  1    MGNAMGS-KKAKVMKIDGETFKLKTPATANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPH  59

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMR-SGVH-MSATDRLEALMKMRRSTSDVSPAVR  429
             EL+P+K+YFLVELPK     E + RR+R SG+  M+A DRL+ LM  +RS SD++    
Sbjct  60   HELRPRKLYFLVELPKV--RPEPLTRRVRSSGIRGMNAKDRLDFLMLSKRSVSDLAVVKN  117

Query  430  R----EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD----VDKG  564
            R      GP ++++R+PKAQ+E+++ ES D  E AEKI++L + +    VD G
Sbjct  118  RPGPDSSGPTRVRMRVPKAQLERLMEESHDGGEVAEKILSLYMGNNAAAVDGG  170



>ref|XP_009114243.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
 emb|CDY41078.1| BnaA09g18570D [Brassica napus]
Length=217

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 125/177 (71%), Gaps = 18/177 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDGETLKLKTPV+A +V+KD+PGHVLL+SE+VK +G RA PL+A 
Sbjct  1    MGNSLGGKKTTKVMKIDGETLKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLDAK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PAV  426
            Q L  K++YF+VE  K     E  PRR+RSG+ MSA +RLE LM  RRS+SD+S   PA 
Sbjct  61   QRLVAKRLYFVVEPVK-----ECPPRRVRSGIQMSAKERLENLMLARRSSSDLSLLKPAG  115

Query  427  R--------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI--RDVDKGR  567
            R        ++ G +++KLR+PKA++E+++ E   E EA +KI  L +  +  DK R
Sbjct  116  RWTTKEEEEKDGGAMRVKLRIPKAELERLVKEGATEAEATQKIAALFMAKQKNDKAR  172



>ref|NP_178243.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY17424.1| At2g01340 [Arabidopsis thaliana]
 gb|ABF19028.1| At2g01340 [Arabidopsis thaliana]
 dbj|BAE98639.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05438.1| uncharacterized protein AT2G01340 [Arabidopsis thaliana]
Length=215

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 120/165 (73%), Gaps = 13/165 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDGET KLKTPV+A +V+KD+PGHVLLDSE+VK +G RA PLEA 
Sbjct  1    MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLDSESVKHYGARAKPLEAK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS----PA  423
            Q L+ K++YF+VE  K     E  PRR+RSG+H+SA +RLE+LM  RRS+SD+S    P 
Sbjct  61   QRLEAKRLYFVVEPVK-----ECPPRRVRSGIHVSAKERLESLMLARRSSSDLSILKPPG  115

Query  424  ---VRREWGPV-QIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  E G V ++K+R+PKA++EK++ E   E EA +KI  L +
Sbjct  116  GWTTEEEEGAVRRVKVRIPKAELEKLVKEGATEAEATQKIAALFM  160



>emb|CDY40384.1| BnaA02g26980D [Brassica napus]
Length=220

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 119/166 (72%), Gaps = 14/166 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDGET KLKTPV+A +V+KD+PGHVLL+ E+VK +G RA PLE  
Sbjct  1    MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLECESVKHYGARAKPLEMK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            Q L+ K++YF+VE  K     E  PRR+RSG+HMSA +RLE LM  RRS+SD+S   PA 
Sbjct  61   QMLEAKRLYFVVEPVK-----ECPPRRVRSGIHMSAKERLENLMLARRSSSDLSILKPAG  115

Query  424  -----VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                   +E G V++KLR+PKA++E+++ E   E EA +KI  L +
Sbjct  116  EWSKTEEKEGGAVRVKLRIPKAELERLVKEGATEAEATQKIAALYM  161



>ref|XP_010502111.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=212

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 121/167 (72%), Gaps = 15/167 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  K+MKIDGE+ KL+TPV+A +V+KD+PGHV+LDSE+VK +G R+ PLEA 
Sbjct  1    MGNSLGGKKTTKIMKIDGESFKLRTPVTAEEVLKDFPGHVVLDSESVKHYGARSKPLEAK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            Q L+ K++YF+VE  K     E  PRR+RSG+H+SA +RLE+LM  RRS+SD+S   PA 
Sbjct  61   QRLQAKRLYFVVEPVK-----ECPPRRVRSGIHVSAKERLESLMLARRSSSDLSILRPAG  115

Query  424  ------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                     E G V++K+R+PKA++E+++ E   E EA +KI  L +
Sbjct  116  GWTTTTSEEEGGAVRVKVRVPKAELERLVKEGATEAEATQKIAALFM  162



>ref|XP_010528526.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Tarenaya 
hassleriana]
Length=214

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 13/172 (8%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNAI  R KKAKVMKIDGET +LKTP +A +  K+YPG VLLDS+ VK FGVRA PL+ 
Sbjct  1    MGNAIMYRRKKAKVMKIDGETFRLKTPATASEATKEYPGFVLLDSDAVKSFGVRAKPLDP  60

Query  253  AQELKPKKIYFLVELPKFP--------HHGERVP-RRMRSGVHMSATDRLEALMKMRRST  405
             Q LKPKK YFLVELPK P          G  +P RR+ SG+H+SA +RLE LM  RR+ 
Sbjct  61   NQILKPKKTYFLVELPKRPPETTAVAAEEGSGLPYRRVMSGIHISAKERLEMLMLSRRTV  120

Query  406  SDVS---PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
            SDV+          GPV+++LRLP++QV K++ ES D +E AE+II L  ++
Sbjct  121  SDVTIDRRGGGDGAGPVRVRLRLPRSQVTKLVEESHDASEIAERIIGLYAKN  172



>ref|XP_010528525.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Tarenaya 
hassleriana]
Length=225

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 13/172 (8%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNAI  R KKAKVMKIDGET +LKTP +A +  K+YPG VLLDS+ VK FGVRA PL+ 
Sbjct  1    MGNAIMYRRKKAKVMKIDGETFRLKTPATASEATKEYPGFVLLDSDAVKSFGVRAKPLDP  60

Query  253  AQELKPKKIYFLVELPKFP--------HHGERVP-RRMRSGVHMSATDRLEALMKMRRST  405
             Q LKPKK YFLVELPK P          G  +P RR+ SG+H+SA +RLE LM  RR+ 
Sbjct  61   NQILKPKKTYFLVELPKRPPETTAVAAEEGSGLPYRRVMSGIHISAKERLEMLMLSRRTV  120

Query  406  SDVS---PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
            SDV+          GPV+++LRLP++QV K++ ES D +E AE+II L  ++
Sbjct  121  SDVTIDRRGGGDGAGPVRVRLRLPRSQVTKLVEESHDASEIAERIIGLYAKN  172



>ref|XP_010424880.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 120/166 (72%), Gaps = 14/166 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  K+MKIDGE+ KLKTPV+A +V+KD+PGHV+LDSE+VK +G RA PLE  
Sbjct  1    MGNSLGGKKTTKIMKIDGESFKLKTPVTAEEVLKDFPGHVVLDSESVKHYGARAKPLEGK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            Q L+ K++YF+VE  K     +  PRR+RSG+H+SA +RLE+LM  RRS+SD+S   PA 
Sbjct  61   QRLQAKRLYFVVEPVK-----DCPPRRVRSGIHVSAKERLESLMLARRSSSDLSILKPAE  115

Query  424  -----VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                    E G V++K+R+PKA++E+++ E   E EA +KI  L +
Sbjct  116  GWTTTSEEEGGAVRVKVRVPKAELERLVREGATEAEATQKIAALFM  161



>ref|XP_006602004.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
Length=218

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 118/172 (69%), Gaps = 11/172 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+G  KKAKVMKIDGET KL TP  A DVVKDYPGHVLLDS  VK FG RA PLE  
Sbjct  1    MGNAMGS-KKAKVMKIDGETFKLNTPARANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPD  59

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMR-SGVH-MSATDRLEALMKMRRSTSDVSPAVR  429
             +LKPKKIYFLVELPK       V RR+R SG+  M+A DRL+ LM  +RS SD++    
Sbjct  60   YQLKPKKIYFLVELPKVKPE-PLVTRRVRSSGIRGMNAQDRLDFLMLSKRSVSDLTMVKH  118

Query  430  ----REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD---VDKG  564
                   GP ++K+RLPKA +E+++ ES D +E AEKII+L + +   VD G
Sbjct  119  GPKPENGGPTRVKMRLPKAHLERLMEESHDGSEVAEKIISLYMGNNAAVDGG  170



>ref|XP_009101353.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
 emb|CDY17681.1| BnaA06g35000D [Brassica napus]
Length=216

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 120/169 (71%), Gaps = 17/169 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AK+MKIDGE+ KLKTPV+A +V++D+PG+VLLDSE+VK +G RA PLEA 
Sbjct  1    MGNSLGGKKTAKIMKIDGESFKLKTPVTAEEVLQDFPGYVLLDSESVKHYGARAKPLEAK  60

Query  256  QELKPKKIYFLVE-LPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----  417
            Q L+ K++YF+VE + + P      PRR+RSG+HM+A +RLE LM  RRS+SD+S     
Sbjct  61   QRLEAKRLYFVVEPVKECP-----PPRRVRSGIHMNAKERLEHLMLTRRSSSDLSILKPS  115

Query  418  ------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                       E G V++KLR+PKA++EK++ E   E EA  KI +L +
Sbjct  116  GGWTTKTEEEDEGGAVRVKLRIPKAELEKLVKEGATEAEATHKIASLFM  164



>ref|XP_008800768.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=187

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 7/159 (4%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGG+K+ AKVMKIDG   +LK P  A  V++DYPG+ LL+SE VK+ G+RA PLE 
Sbjct  1    MGNSIGGKKRTAKVMKIDGTAFRLKPPAMAGGVLRDYPGYSLLESEEVKQLGLRARPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
               LKP K+YFLVELP+ P+      RR  SG +H+SA +RLE LM  RRS SD+S A  
Sbjct  61   EALLKPGKLYFLVELPRLPNQ-----RRTWSGALHVSAKERLENLMLSRRSVSDLSLANT  115

Query  430  REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
               G V++++RLPKAQV K + ES+D  EAAEK++ LC+
Sbjct  116  AADGAVRLRMRLPKAQVAKFMEESKDSAEAAEKLMGLCL  154



>ref|XP_006293056.1| hypothetical protein CARUB_v10019343mg [Capsella rubella]
 gb|EOA25954.1| hypothetical protein CARUB_v10019343mg [Capsella rubella]
Length=207

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 12/164 (7%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++G +KK  KVMKIDGET KLK PV+A +V+KD+PGHV+LDSE+VK +G RA PLEA
Sbjct  1    MGNSLGSKKKTTKVMKIDGETFKLKNPVTAEEVLKDFPGHVVLDSESVKHYGARAKPLEA  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA  423
             Q L+ K++YF+VE  K     E  PRR+RSG+H+SA +RLE+LM  RRS+SD+S   PA
Sbjct  61   KQRLEAKRLYFVVEPVK-----ECPPRRVRSGIHVSAKERLESLMLARRSSSDLSILKPA  115

Query  424  ---VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  E G V++K+R+PKA++E++I E   E EA +KI  L +
Sbjct  116  GGWTEEEGGAVRVKVRVPKAELERLIKEGATEAEATQKIAALFM  159



>emb|CDY25937.1| BnaC09g20500D [Brassica napus]
Length=217

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 119/168 (71%), Gaps = 20/168 (12%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  +VMKIDGETLKLKTPV+A +V+KD+PGHVLL+SE+VK +G RA PLEA 
Sbjct  1    MGNSLGGKKTTRVMKIDGETLKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLEAK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PAV  426
            Q L  K++YF+VE  K     E  PRR+RSG+ MSA DRLE LM  RRS+SD+S   PA 
Sbjct  61   QGLVAKRLYFVVEPVK-----ECPPRRVRSGIQMSAKDRLENLMLARRSSSDLSILKPAG  115

Query  427  RREW----------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
            R  W          G V++KLR+PKA++E++I E   E EA +KI  L
Sbjct  116  R--WTTKEEEEKEGGAVRVKLRIPKAELERLIKEGATEAEATQKIAAL  161



>ref|XP_002875068.1| hypothetical protein ARALYDRAFT_322480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51327.1| hypothetical protein ARALYDRAFT_322480 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 13/165 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  KVMKIDGET KLKTPV+A +V++D+PGHVLLDSE+VK +G RA PLEA 
Sbjct  1    MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLQDFPGHVLLDSESVKHYGARAKPLEAR  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSP-----  420
            Q L+ K++YF+VE  K     E  PRR+RSG+H+SA +RLE+LM  RRS+SD+S      
Sbjct  61   QRLEAKRLYFVVEPVK-----ECPPRRVRSGIHVSAKERLESLMLARRSSSDLSILKQAG  115

Query  421  --AVRREWGPV-QIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  E G V ++K+R+PKA++E+++ E   E EA +KI  L +
Sbjct  116  GWTTEEEEGAVRRVKVRIPKAELERLVKEGATEAEATQKIAALFM  160



>ref|XP_010513852.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 121/166 (73%), Gaps = 14/166 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  K+MKIDGE+ KL+TPV+A +V+KD+PGHV+LDSE+VK +G RA PLEA 
Sbjct  1    MGNSLGGKKTTKIMKIDGESFKLRTPVTAEEVLKDFPGHVVLDSESVKHYGARAKPLEAK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA-  423
            Q L+ K++YF+VE  K     E  PRR+RSG+H+SA +RLE+LM  RRS+SD+S   PA 
Sbjct  61   QRLEAKRLYFVVEPVK-----ECPPRRVRSGIHVSAKERLESLMLARRSSSDLSILKPAG  115

Query  424  -----VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  + E   V++K+R+PKA++E+++ E   E EA +KI  L +
Sbjct  116  GWTTTSKEEGDAVRVKVRVPKAELERLVKEGATEAEATQKIAALFM  161



>ref|XP_010553923.1| PREDICTED: uncharacterized protein At1g66480-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010553933.1| PREDICTED: uncharacterized protein At1g66480-like isoform X3 
[Tarenaya hassleriana]
Length=206

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 130/174 (75%), Gaps = 16/174 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVMKIDGETLK+KTP++A +V+K+YPG VLLDSE VK +GVRA PL+A 
Sbjct  1    MGNSLGGKKTAKVMKIDGETLKMKTPMTAEEVLKEYPGLVLLDSEAVKHYGVRAKPLQAG  60

Query  256  QELKPKKIYFLVELPKFPHHGERV-PRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA  423
            Q L+ K++YFLVE P+     E + PRR+RSG+HMSA +RLE+L+  RRS SD+S   P+
Sbjct  61   QRLEAKRLYFLVEPPR---QREGIPPRRVRSGIHMSAQERLESLVLARRSASDLSILNPS  117

Query  424  VRR------EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI---RDVD  558
             RR        G V++K+R+PKA++E+++ ES  E EAAEKI+ L +   RD D
Sbjct  118  GRRTEAETAAAGSVRVKVRVPKAEIERLVRESATEAEAAEKIVGLFVAKQRDQD  171



>ref|XP_003537453.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
 gb|KHN17929.1| Hypothetical protein glysoja_017980 [Glycine soja]
Length=214

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 110/162 (68%), Gaps = 6/162 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+G  KKAK+MKIDGET KLKTP  A DVVKDYPGHVLLDS  VK FG RA PLE  
Sbjct  1    MGNAMGS-KKAKIMKIDGETFKLKTPARANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPD  59

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVH-MSATDRLEALMKMRRSTSDVSPAVR-  429
             ELKPKKIYFLVELPK         R   SG+  M+A DRL+ LM  +RS SD++     
Sbjct  60   YELKPKKIYFLVELPKVKPEPLGTRRVRSSGIRGMNAQDRLDFLMLSKRSVSDLTMVKHG  119

Query  430  ---REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  GP ++K+RLPKA +E+++ ES D  E AEKII+L +
Sbjct  120  PGPENGGPTRLKMRLPKAHLERLMEESHDGGEVAEKIISLYM  161



>ref|XP_010553916.1| PREDICTED: uncharacterized protein At1g66480-like isoform X1 
[Tarenaya hassleriana]
Length=206

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 130/174 (75%), Gaps = 16/174 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K AKVMKIDGETLK+KTP++A +V+K+YPG VLLDSE VK +GVRA PL+A 
Sbjct  1    MGNSLGGKKTAKVMKIDGETLKIKTPMTAEEVLKEYPGLVLLDSEAVKHYGVRAKPLQAG  60

Query  256  QELKPKKIYFLVELPKFPHHGERV-PRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA  423
            Q L+ K++YFLVE P+     E + PRR+RSG+HMSA +RLE+L+  RRS SD+S   P+
Sbjct  61   QRLEAKRLYFLVEPPR---QREGIPPRRVRSGIHMSAQERLESLVLARRSASDLSILNPS  117

Query  424  VRR------EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI---RDVD  558
             RR        G V++K+R+PKA++E+++ ES  E EAAEKI+ L +   RD D
Sbjct  118  GRRTEAETAAAGSVRVKVRVPKAEIERLVRESATEAEAAEKIVGLFVAKQRDQD  171



>emb|CDX77816.1| BnaC07g20700D [Brassica napus]
Length=216

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 119/169 (70%), Gaps = 17/169 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++GG+K  K+MKIDGET KLKTPV+A +V++D+PGHVLLDSE+VK +G RA PLEA 
Sbjct  1    MGNSLGGKKTTKIMKIDGETFKLKTPVTAEEVLEDFPGHVLLDSESVKHYGARAKPLEAK  60

Query  256  QELKPKKIYFLVE-LPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-----  417
            Q L+ K++YF+VE + + P      PR++RSG+HM+A +RLE LM  RRS+SD+S     
Sbjct  61   QRLEAKRLYFVVEPVKECP-----PPRKVRSGIHMNAKERLEHLMLTRRSSSDLSILKPS  115

Query  418  ------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                       E G V++KLR+PKA++E+++ E   E EA  KI +L +
Sbjct  116  GGWTTTKEEEDEGGAVRVKLRIPKAELERLVKEGATELEATHKIASLFM  164



>ref|XP_006398523.1| hypothetical protein EUTSA_v10001016mg [Eutrema salsugineum]
 gb|ESQ39976.1| hypothetical protein EUTSA_v10001016mg [Eutrema salsugineum]
Length=222

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 13/166 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDY-PGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG+K  K+MKIDGET KLKTPV+A +V+KD+ PGHVLLDSE+VK +G RA PLEA
Sbjct  1    MGNSLGGKKTTKIMKIDGETFKLKTPVTAEEVLKDFPPGHVLLDSESVKHYGARAKPLEA  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PA  423
             Q L+  ++YF+V+ P      E  PRR+RSG+ MSA +RLE LM  RRS+SD+S   PA
Sbjct  61   KQRLEANRLYFVVDEP----VKECPPRRVRSGIQMSAKERLENLMLARRSSSDLSILKPA  116

Query  424  V-----RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                   +E G V++KLR+PKA+++++I E   E EA +KI  L +
Sbjct  117  GGWTTEEKEGGAVRVKLRIPKAELQRLIKEGATEAEATQKIAALFM  162



>ref|XP_009388031.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 11/166 (7%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG+K+  KVMKIDG TLK K P  A DV++DYPG+ LL+SE VKR G RA PL++
Sbjct  1    MGNSLGGKKRMIKVMKIDGTTLKPKPPARAADVLRDYPGYNLLESEEVKRLGHRARPLDS  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
              +L+  K+YFLVELP+ P H +R PRR+ SG + +SA +RLE+LM  RR+ SD+S   R
Sbjct  61   HAQLETGKLYFLVELPRAPDH-QRGPRRVWSGELQVSAKERLESLMLARRAMSDLSSVGR  119

Query  430  REW--------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                       G +++K+RLPKA+VEK++ +SR+  EAAEKI+NLC
Sbjct  120  SSNVEAEENMDGSIRLKMRLPKAEVEKLMQDSRNAIEAAEKIMNLC  165



>ref|XP_010932597.1| PREDICTED: uncharacterized protein At1g66480-like [Elaeis guineensis]
Length=191

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 113/159 (71%), Gaps = 7/159 (4%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN IGG+K+ AKVMKIDG T +LK P +A  V++D+PG  LLD+E VK+ G+R+ PL+ 
Sbjct  1    MGNTIGGKKRTAKVMKIDGTTFRLKPPATAGGVLRDHPGFSLLDAEEVKQLGLRSRPLQP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
               L+P K+YFLVELP+ P       RR  SG +H+SA +RLE+LM  RRS SD+S    
Sbjct  61   ETLLRPGKLYFLVELPRLPDQ-----RRTWSGALHVSAKERLESLMLSRRSVSDLSLTKS  115

Query  430  REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
               GPV++++RLPKAQV K + ES+D  EAAEKI+ LC+
Sbjct  116  EPDGPVRLRMRLPKAQVTKFMEESKDSAEAAEKIMELCL  154



>ref|XP_006344226.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=222

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 110/178 (62%), Gaps = 28/178 (16%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKIDG+T+K KTP+ A +V+K+YP  VLL+SE VK FGVRA PLE  QELKPK++YFLVE
Sbjct  1    MKIDGQTMKFKTPIYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQQELKPKRLYFLVE  60

Query  295  LPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS-------------------  417
            LPK P   ++ P R RS + MSA +RLE LM  RRS SD+S                   
Sbjct  61   LPKLPEENKKSPFRARSAIQMSAKERLETLMLARRSASDLSIMKPTSMMMSTHEYSSSHT  120

Query  418  ----PAVRREWGPVQ-----IKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                       GP Q     +KLRL KA+VEK++ ES+DE E AEKI+ LC+ + + G
Sbjct  121  NNSTSGTLNSGGPPQAHPTRLKLRLSKAEVEKLMKESKDEDEVAEKIMRLCMNNNNGG  178



>ref|XP_006391401.1| hypothetical protein EUTSA_v10019620mg, partial [Eutrema salsugineum]
 gb|ESQ28687.1| hypothetical protein EUTSA_v10019620mg, partial [Eutrema salsugineum]
Length=198

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 115/172 (67%), Gaps = 17/172 (10%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I  R KKAKVMKIDGE  ++KTP +A ++  DYPG+VLLDSE VK FGVRA PLE 
Sbjct  1    MGNSIAARRKKAKVMKIDGEIFRIKTPATAREITADYPGYVLLDSEAVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKF-----PHHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDV  414
            +Q LKPKK YFLVELPK      P    ++P RR+ SG+H+ A +RLE LM  RR+ SDV
Sbjct  61   SQILKPKKTYFLVELPKLPPENPPETNNKLPYRRVMSGIHVGAKERLEMLMLSRRTVSDV  120

Query  415  SPA----------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
            + A          +  E     ++LRLP++Q+ K + ES D +E AEKI++L
Sbjct  121  AIARSDGGGDGPGLGLEPSQTSVRLRLPRSQITKFMEESHDTSEIAEKILSL  172



>gb|KDO64706.1| hypothetical protein CISIN_1g029320mg [Citrus sinensis]
Length=195

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 110/152 (72%), Gaps = 9/152 (6%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKI GET K+KTPV A +VVKDYPGHVLL+SE+VK +GVRA PL A Q L+ K++YFLVE
Sbjct  1    MKITGETFKIKTPVKAGEVVKDYPGHVLLESESVKHYGVRAKPLGAEQNLEAKRLYFLVE  60

Query  295  LPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---PAVRR-----EWGPVQ  450
            LP      E VPRR+RSG++MSA DRLE+L   RRS SD+S   P         E G ++
Sbjct  61   LPDVARK-EIVPRRVRSGINMSAKDRLESLKLSRRSVSDLSILKPVSSSSSSLPEEGAMR  119

Query  451  IKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            +KL+LPKA+VEK++ ES ++ E AEKI  LC+
Sbjct  120  LKLKLPKAEVEKLMRESNNDAEIAEKIRELCM  151



>ref|XP_008801161.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=199

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 124/180 (69%), Gaps = 10/180 (6%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGG+K+ AKVMKIDG T + K P  A DV++D+PG+ LL+SE VKR G+RA PLE 
Sbjct  1    MGNSIGGKKRTAKVMKIDGTTFRPKPPTQAGDVLRDHPGYTLLESEEVKRLGLRARPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
               LKP ++YFLVELP  P    RVPRR  SG +HMSA +RLE+L+  RRS SD++P   
Sbjct  61   ETPLKPGRLYFLVELPCRPDL--RVPRRAWSGALHMSAKERLESLVLSRRSVSDLTPTKP  118

Query  430  REW-----GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI-RDVDKGR*FSCVLPT  591
                    G V++++RLPK+QV K++ ES+D  EAAEKI+  C+ +D +  +  + V P+
Sbjct  119  SSVEAVTDGMVRLRVRLPKSQVAKLMEESKDCAEAAEKIMEFCVSKDSNTAKAAAAVPPS  178



>ref|XP_010553900.1| PREDICTED: uncharacterized protein At1g66480-like [Tarenaya hassleriana]
Length=254

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 124/207 (60%), Gaps = 40/207 (19%)
 Frame = +1

Query  37   YIPCHTFIC----------------RTERMGNAIGGR-KKAKVMKIDGETLKLKTPVSAF  165
            Y   H +IC                R   MGN I  R KKAKVMKIDGET +LKTP +A 
Sbjct  2    YTYIHIYICIPQHSDTLHHRTGERTREREMGNIITRRSKKAKVMKIDGETFQLKTPATAS  61

Query  166  DVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVELPKFPHHGER-------  324
            DV K+YPG +LLDS+ VK FGVRA PL+  Q LKPKK YFLV+LPK P   ER       
Sbjct  62   DVTKEYPGFMLLDSDDVKNFGVRADPLDPNQILKPKKTYFLVDLPKLPP--ERAAAKAAE  119

Query  325  -----VPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRREWGP--------VQIKLRL  465
                 + RR+ SG+H+ A +RLE +M  RR+ SDV+ A R  +G          ++KLRL
Sbjct  120  ESSKFLYRRVMSGIHIGAKERLELMMLSRRTVSDVTIA-RSGFGDGPEPEPETTRVKLRL  178

Query  466  PKAQVEKVIVESRDETEAAEKIINLCI  546
            P+AQV K++ ESRD +E AE+I+ L +
Sbjct  179  PRAQVTKLVEESRDASEMAERIVGLYV  205



>ref|XP_010910469.1| PREDICTED: uncharacterized protein At1g66480-like [Elaeis guineensis]
Length=200

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 123/181 (68%), Gaps = 11/181 (6%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGG+K+ AKVMKIDG T +LK P  A DV++D+PG+ +L+SE VKR GVRA PLE 
Sbjct  1    MGNSIGGKKRTAKVMKIDGTTFRLKPPSQAGDVLRDHPGYTILESEEVKRLGVRARPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPA--  423
               LKP ++YFLVELP+      RVPRR  SG + +SA +RLE+L+  RRS SDV+    
Sbjct  61   ETPLKPGRLYFLVELPQ--RLDLRVPRRAWSGALQLSAKERLESLVLSRRSVSDVTATKP  118

Query  424  ----VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI-RDVDKGR*FSCVLP  588
                   + G V++++RLPKAQV K++ ES+D  EAA KI+ LCI +D    +  + V P
Sbjct  119  SSVEAVTDGGTVRLRVRLPKAQVAKLMEESKDSAEAAGKIMELCIAKDSKTAKAPAVVSP  178

Query  589  T  591
            T
Sbjct  179  T  179



>gb|AAD14534.1| unknown protein [Arabidopsis thaliana]
Length=225

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 23/175 (13%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE--  249
            MGN++GG+K  KVMKIDGET KLKTPV+A +V+KD+PGHVLLDSE+VK +G RA PLE  
Sbjct  1    MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLDSESVKHYGARAKPLETK  60

Query  250  --------AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRST  405
                    A Q L+ K++YF+VE  K     E  PRR+RSG+H+SA +RLE+LM  RRS+
Sbjct  61   RLMLFGVQAKQRLEAKRLYFVVEPVK-----ECPPRRVRSGIHVSAKERLESLMLARRSS  115

Query  406  SDVSP-------AVRREWGPV-QIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
            SD+S            E G V ++K+R+PKA++EK++ E   E EA +KI  L +
Sbjct  116  SDLSILKPPGGWTTEEEEGAVRRVKVRIPKAELEKLVKEGATEAEATQKIAALFM  170



>ref|XP_010511478.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 116/168 (69%), Gaps = 11/168 (7%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RKKAKVMKIDGET ++KTPV+A +V  +YPG+VLLDS+ VK FGVRA PLE 
Sbjct  1    MGNSITVKRKKAKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP--HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDVS--  417
             Q LKPKK YFLVELPK P      ++P RR+ SG+H+ A +RLE LM  RR+ SDV+  
Sbjct  61   NQLLKPKKTYFLVELPKLPPETDNNKLPYRRVMSGIHVGAKERLEMLMLSRRTVSDVTIG  120

Query  418  -----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                        G   ++LRLP++Q+ K++ ES D++E A+KI+ + +
Sbjct  121  RSDGGDGFGVGPGHTSVRLRLPRSQITKLMEESNDDSEIADKILGIYM  168



>ref|XP_010470524.1| PREDICTED: uncharacterized protein At1g66480 [Camelina sativa]
Length=217

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 116/167 (69%), Gaps = 10/167 (6%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RKKAKVMKIDGET ++KTPV+A +V  +YPG+VLLDS+ VK FGVRA PLE 
Sbjct  1    MGNSITVKRKKAKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP--HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDVS--  417
             Q LKPKK YFLVELPK P      ++P RR+ SG+H+ A +RLE LM  RR+ SDV+  
Sbjct  61   NQVLKPKKTYFLVELPKLPPETDNNKLPYRRVMSGIHVGAKERLEMLMLSRRTVSDVTIG  120

Query  418  ----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                       G   ++LRLP++Q+ K++ ES D++E A+KI+ + +
Sbjct  121  RSDGGGDGFGPGHTSVRLRLPRSQITKLMEESNDDSEIADKILGIYM  167



>ref|XP_004140307.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162640.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Cucumis 
sativus]
Length=237

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 113/177 (64%), Gaps = 18/177 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN+IGGRK+ KVMK+DGE LKLK P+   +V+KDYP HVL++SE VK +GV+A PLE  
Sbjct  1    MGNSIGGRKRVKVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHG-----ERVPRRMRSGVHMSATDRLEALMKMRR-------  399
            Q+L  KKIYFL++LPK              R   SGVHMSA DRL+ LM  RR       
Sbjct  61   QDLNRKKIYFLLQLPKIAADNRPPPDRIPRRVRSSGVHMSAKDRLDLLMLSRRTMSEIAI  120

Query  400  ------STSDVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                  S +D S   R   GP+Q+K+++P++QV K++ ES  E E AEKII + +++
Sbjct  121  TRPSTTSATDSSAQPRFHSGPMQVKMKIPRSQVAKLMEESASEGEIAEKIIKMYLKN  177



>gb|KGN51042.1| hypothetical protein Csa_5G418770 [Cucumis sativus]
Length=243

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 113/177 (64%), Gaps = 18/177 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN+IGGRK+ KVMK+DGE LKLK P+   +V+KDYP HVL++SE VK +GV+A PLE  
Sbjct  1    MGNSIGGRKRVKVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHG-----ERVPRRMRSGVHMSATDRLEALMKMRR-------  399
            Q+L  KKIYFL++LPK              R   SGVHMSA DRL+ LM  RR       
Sbjct  61   QDLNRKKIYFLLQLPKIAADNRPPPDRIPRRVRSSGVHMSAKDRLDLLMLSRRTMSEIAI  120

Query  400  ------STSDVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                  S +D S   R   GP+Q+K+++P++QV K++ ES  E E AEKII + +++
Sbjct  121  TRPSTTSATDSSAQPRFHSGPMQVKMKIPRSQVAKLMEESASEGEIAEKIIKMYLKN  177



>ref|XP_010415191.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=217

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 116/167 (69%), Gaps = 10/167 (6%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RKKAKVMKIDGET ++KTPV+A +V  +YPG+VLLDS+ VK FGVRA PLE 
Sbjct  1    MGNSITVKRKKAKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP--HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDVS--  417
             Q LKPKK YFLVELPK P      ++P RR+ SG+H+ A +RLE LM  RR+ SDV+  
Sbjct  61   NQVLKPKKTYFLVELPKLPPETDNNKLPCRRVMSGIHVGAKERLEMLMLSRRTVSDVTIG  120

Query  418  ----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                       G   ++LRLP++Q+ K++ ES D+++ A+KI+ + +
Sbjct  121  RSDGGGDGFGPGHTSVRLRLPRSQITKLMEESNDDSQIADKILGIFM  167



>ref|XP_004140306.1| PREDICTED: uncharacterized protein At1g66480-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162639.1| PREDICTED: uncharacterized protein At1g66480-like isoform 1 [Cucumis 
sativus]
Length=263

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 113/177 (64%), Gaps = 18/177 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN+IGGRK+ KVMK+DGE LKLK P+   +V+KDYP HVL++SE VK +GV+A PLE  
Sbjct  1    MGNSIGGRKRVKVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQ  60

Query  256  QELKPKKIYFLVELPKFPHHG-----ERVPRRMRSGVHMSATDRLEALMKMRR-------  399
            Q+L  KKIYFL++LPK              R   SGVHMSA DRL+ LM  RR       
Sbjct  61   QDLNRKKIYFLLQLPKIAADNRPPPDRIPRRVRSSGVHMSAKDRLDLLMLSRRTMSEIAI  120

Query  400  ------STSDVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                  S +D S   R   GP+Q+K+++P++QV K++ ES  E E AEKII + +++
Sbjct  121  TRPSTTSATDSSAQPRFHSGPMQVKMKIPRSQVAKLMEESASEGEIAEKIIKMYLKN  177



>ref|XP_006302789.1| hypothetical protein CARUB_v10020914mg [Capsella rubella]
 gb|EOA35687.1| hypothetical protein CARUB_v10020914mg [Capsella rubella]
Length=223

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 18/174 (10%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RKKAKVMKIDGET ++KTP +A +V  +YPG+VLLDS+ VK FGVRA PLE 
Sbjct  1    MGNSITVKRKKAKVMKIDGETFRIKTPATAREVTAEYPGYVLLDSQAVKNFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP---------HHGERVP-RRMRSGVHMSATDRLEALMKMRRS  402
             Q LKPKK YFLVELPK P             ++P RR+ SG+H+ A +RLE LM  RR+
Sbjct  61   NQILKPKKTYFLVELPKLPPETTAAERDDSNNKLPYRRVMSGIHVGAKERLEMLMLSRRT  120

Query  403  TSDVSPAVRREWG----PVQ--IKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
             SDV+   R + G    P Q  ++LRLP++Q+ K++ ES+D +E A+KI+ + +
Sbjct  121  VSDVTIG-RSDGGDGFRPGQTSVRLRLPRSQITKLMEESKDASEIADKILGIYM  173



>ref|NP_001236465.1| uncharacterized protein LOC547692 [Glycine max]
 gb|AAG38148.1| unknown [Glycine max]
Length=211

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 117/173 (68%), Gaps = 13/173 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+GG+K  KVMKIDGET KLKTP+   DV+KD+PG VLL+SE VK +G+RA PLEA 
Sbjct  1    MGNALGGKKTTKVMKIDGETFKLKTPIKVCDVLKDHPGLVLLESEAVKHYGIRAKPLEAH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDR-LEALMKMRRSTSDVSP----  420
            +EL PK++YFLVELPK        PRR+RSG++MSA +R  E    +    SD++     
Sbjct  61   KELMPKRLYFLVELPK---EVTVAPRRVRSGINMSAKERPREPRFGVAGRASDLTDHGNP  117

Query  421  --AVRR---EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
              A +R     G V++K+RLPKA+VE+++     E EAAEKI+ LC+ +   G
Sbjct  118  RRAKKRLLESGGGVRLKMRLPKAEVERLMRGCETEAEAAEKIMGLCMANNGGG  170



>ref|XP_010471107.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 114/170 (67%), Gaps = 9/170 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AKVM I+GE+ KLKTP+ A  VVKD+PG+VLL+SE VK+FG+RA PLE  
Sbjct  1    MGNSLGSKKTAKVMNINGESFKLKTPLKAGTVVKDFPGYVLLESEAVKQFGIRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q L+ K++YF+VELP+     ER PRR+RSG+ +SA +RLE L   RRS SD+S   + E
Sbjct  61   QNLESKRLYFMVELPR--TWKERTPRRVRSGIQISAKERLENLKLSRRSLSDLSVMKKNE  118

Query  436  WGP-------VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                        + L+LPK +VEK+  ES   ++ + KI  LC+ +V  G
Sbjct  119  EFDHDTERQVSSVTLKLPKWKVEKLRKESESGSDFSNKIAALCLLNVPSG  168



>ref|XP_002870572.1| hypothetical protein ARALYDRAFT_493762 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46831.1| hypothetical protein ARALYDRAFT_493762 [Arabidopsis lyrata subsp. 
lyrata]
Length=211

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 7/160 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN I  R KAKVMKIDG+  +LKTPV+A D  K+YPG VLLDSETVKR GV A PLE  
Sbjct  1    MGNTIR-RNKAKVMKIDGDIFRLKTPVTASDATKEYPGFVLLDSETVKRLGVHAKPLEPN  59

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVRR  432
            Q LKP K YFLV+LP      +   RR+ SG +H+ A +RLE LM  RR+ SDV  A   
Sbjct  60   QNLKPNKTYFLVDLPPVDKKNKLPYRRVMSGNIHIGAKERLEMLMLSRRTVSDVGAARST  119

Query  433  -----EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIIN  537
                 E G  +++LRLP++Q+ K++ ES D +E A +IIN
Sbjct  120  EADGPELGQRRVRLRLPRSQITKLMGESHDASEVAARIIN  159



>ref|XP_009105210.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Brassica 
rapa]
Length=220

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 114/171 (67%), Gaps = 18/171 (11%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGE  ++KTP +A +V  DYPG+VLLDSE VK FGVR+ PLE 
Sbjct  1    MGNSITIKRKRAKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP-----HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDV  414
            +Q LKPKK YFLVELPK P         ++P RR+ SG+H+ A +RLE LM  RR+ SDV
Sbjct  61   SQLLKPKKTYFLVELPKLPPETTSGTDNKLPLRRVMSGIHVGAKERLEMLMLSRRTVSDV  120

Query  415  SPAVRRE---------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
              AV R           G   ++ RLP++Q+ K + ES D++E A+KI++ 
Sbjct  121  --AVGRSDGGDGLGLGPGQTSVRFRLPRSQITKFMEESNDDSEIADKILSF  169



>emb|CDX96144.1| BnaA07g25870D [Brassica napus]
Length=223

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 114/171 (67%), Gaps = 18/171 (11%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGE  ++KTP +A +V  DYPG+VLLDSE VK FGVR+ PLE 
Sbjct  1    MGNSITIKRKRAKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP-----HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDV  414
            +Q LKPKK YFLVELPK P         ++P RR+ SG+H+ A +RLE LM  RR+ SDV
Sbjct  61   SQLLKPKKTYFLVELPKLPPETTSGTDNKLPLRRVMSGIHVGAKERLEMLMLSRRTVSDV  120

Query  415  SPAVRRE---------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
              AV R           G   ++ RLP++Q+ K + ES D++E A+KI++ 
Sbjct  121  --AVGRSDGGDGLGLGPGQTSVRFRLPRSQITKFMEESNDDSEIADKILSF  169



>ref|XP_009105209.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Brassica 
rapa]
Length=223

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 114/171 (67%), Gaps = 18/171 (11%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGE  ++KTP +A +V  DYPG+VLLDSE VK FGVR+ PLE 
Sbjct  1    MGNSITIKRKRAKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP-----HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDV  414
            +Q LKPKK YFLVELPK P         ++P RR+ SG+H+ A +RLE LM  RR+ SDV
Sbjct  61   SQLLKPKKTYFLVELPKLPPETTSGTDNKLPLRRVMSGIHVGAKERLEMLMLSRRTVSDV  120

Query  415  SPAVRRE---------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
              AV R           G   ++ RLP++Q+ K + ES D++E A+KI++ 
Sbjct  121  --AVGRSDGGDGLGLGPGQTSVRFRLPRSQITKFMEESNDDSEIADKILSF  169



>dbj|BAE99768.1| hypothetical protein [Arabidopsis thaliana]
Length=210

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 115/175 (66%), Gaps = 18/175 (10%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGET ++KTPV+A +V  DYPG+VLLDS+ VK FGVR+ PLE 
Sbjct  1    MGNSITVKRKRAKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVP-------RRMRSGVHMSATDRLEALMKMRRSTSD  411
             Q LKPKK YFLVELPK P     V        RR+ SG+H+ A +RL+ LM  RR+ SD
Sbjct  61   NQTLKPKKTYFLVELPKLPPETTAVDTENKLPYRRVLSGIHVGAKERLDMLMLSRRTVSD  120

Query  412  VS-------PAVRREWGP--VQIKLRLPKAQVEKVIVESRDETEA-AEKIINLCI  546
            V+            E GP    ++LRLP++Q+ K++ E+ ++  A AEKI+ + +
Sbjct  121  VTIGRSDGGDGFGPELGPGHTSVRLRLPRSQITKLMEENNNDASAIAEKILGIYM  175



>emb|CDY36204.1| BnaC06g27480D [Brassica napus]
Length=223

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 114/171 (67%), Gaps = 18/171 (11%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGE  ++KTP +A +V  DYPG+VLLDSE VK FGVR+ PLE 
Sbjct  1    MGNSITIKRKRAKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP-----HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSDV  414
            +Q LKPKK YFLVELPK P         ++P RR+ SG+H+ A +RLE LM  RR+ SDV
Sbjct  61   SQLLKPKKTYFLVELPKLPPETPSGTDNKLPLRRVMSGIHVGAKERLEMLMLSRRTVSDV  120

Query  415  SPAVRRE---------WGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
              AV R           G   ++ RLP++Q+ K + ES D++E A+KI++ 
Sbjct  121  --AVGRSDGGDGLGLGPGQTSVRFRLPRSQITKFMEESNDDSEIADKILSF  169



>gb|AAG51153.1|AC074025_3 hypothetical protein [Arabidopsis thaliana]
Length=223

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 115/175 (66%), Gaps = 18/175 (10%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGET ++KTPV+A +V  DYPG+VLLDS+ VK FGVR+ PLE 
Sbjct  1    MGNSITVKRKRAKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVP-------RRMRSGVHMSATDRLEALMKMRRSTSD  411
             Q LKPKK YFLVELPK P     V        RR+ SG+H+ A +RL+ LM  RR+ SD
Sbjct  61   NQTLKPKKTYFLVELPKLPPETTAVDTENKLPYRRVMSGIHVGAKERLDMLMLSRRTVSD  120

Query  412  VS-------PAVRREWGP--VQIKLRLPKAQVEKVIVESRDETEA-AEKIINLCI  546
            V+            E GP    ++LRLP++Q+ K++ E+ ++  A AEKI+ + +
Sbjct  121  VTIGRSDGGDGFGPELGPGHTSVRLRLPRSQITKLMEENNNDASAIAEKILGIYM  175



>ref|NP_176821.2| plastid movement impaired 2 protein [Arabidopsis thaliana]
 sp|Q6NLC8.1|Y1648_ARATH RecName: Full=Uncharacterized protein At1g66480 [Arabidopsis 
thaliana]
 gb|AAS65946.1| At1g66480 [Arabidopsis thaliana]
 gb|AAS92322.1| At1g66480 [Arabidopsis thaliana]
 gb|AEE34514.1| plastid movement impaired 2 protein [Arabidopsis thaliana]
Length=225

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 115/175 (66%), Gaps = 18/175 (10%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGET ++KTPV+A +V  DYPG+VLLDS+ VK FGVR+ PLE 
Sbjct  1    MGNSITVKRKRAKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVP-------RRMRSGVHMSATDRLEALMKMRRSTSD  411
             Q LKPKK YFLVELPK P     V        RR+ SG+H+ A +RL+ LM  RR+ SD
Sbjct  61   NQTLKPKKTYFLVELPKLPPETTAVDTENKLPYRRVMSGIHVGAKERLDMLMLSRRTVSD  120

Query  412  VS-------PAVRREWGP--VQIKLRLPKAQVEKVIVESRDETEA-AEKIINLCI  546
            V+            E GP    ++LRLP++Q+ K++ E+ ++  A AEKI+ + +
Sbjct  121  VTIGRSDGGDGFGPELGPGHTSVRLRLPRSQITKLMEENNNDASAIAEKILGIYM  175



>ref|XP_009399731.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 114/167 (68%), Gaps = 13/167 (8%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GGRKK AKVMK+DG T K+K P  A +V++D+PGH LLD+E V+R G+RA PL+ 
Sbjct  1    MGNSLGGRKKRAKVMKVDGTTFKVKPPAQAMNVLRDHPGHALLDAEKVQRLGLRARPLDP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
               LKP K+YFLV+  + P   +R  RR  SG + + A +RLE+L    RS SD+S A  
Sbjct  61   DVPLKPGKLYFLVDHRQLPD--QRGARRAWSGSLQVGAKERLESLRLSHRSMSDLSRATW  118

Query  430  R---------EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
            R         + G V++K+RLPKAQVEK++ ES+D  EAAEKI+ LC
Sbjct  119  RPSALEAEETKDGTVRLKMRLPKAQVEKLMQESKDAAEAAEKIMQLC  165



>ref|XP_009419115.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=197

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 112/166 (67%), Gaps = 11/166 (7%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+GGRKKA K+MKIDG T K+K P  A  V++D+PGH LL+S+ VKR  +RA PL+ 
Sbjct  1    MGNALGGRKKAAKIMKIDGTTFKVKPPAQAITVLRDHPGHALLESDEVKRLALRARPLDP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
              +L+  K+YFLVEL +    G   PRR  SG + + A +RLE+L   RRS SD+S A R
Sbjct  61   DAQLQRGKLYFLVELTQL--RGRGAPRRAWSGQLQVGAKERLESLRLTRRSVSDLSLAGR  118

Query  430  -------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                    + G V++++RLPK QVEK++ +SRD  EAA KI+ LC+
Sbjct  119  CSVDVEEAKDGAVRLRVRLPKVQVEKLMQDSRDAAEAANKIMQLCV  164



>gb|EYU44582.1| hypothetical protein MIMGU_mgv1a025559mg [Erythranthe guttata]
Length=181

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 117/169 (69%), Gaps = 14/169 (8%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYP-GHVLLDSETVKRFGVRATPLE  249
            MGN IGG +KKAK+MK++GET KLK P +A DV+KDYP G+VLL+S+TVKR+GVRA  LE
Sbjct  1    MGNGIGGSKKKAKIMKVNGETFKLKVPATATDVLKDYPAGYVLLESKTVKRYGVRAPELE  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMS-ATDRLEALMKMRRSTSDVS---  417
              +E++P K YFL+E+PKFP   E   RR RS V+ S A +RL+ LM  R+ +S +    
Sbjct  61   PGEEIRPGKTYFLLEMPKFP---EPRTRRSRSVVYRSGAEERLDGLMLRRQKSSALEMVS  117

Query  418  -----PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIR  549
                          V+++LR+PKAQ+ K++ ES+DE E  E+I++LC++
Sbjct  118  GSGLGLGSGTGSDSVRVRLRIPKAQMVKMMRESKDEGEVTERIVDLCLQ  166



>ref|XP_009388226.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 14/169 (8%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN + G+K+  KVMK+DG TLKLK PV+A  V++D+PG+ LL+SE VKR GV+A PL  
Sbjct  1    MGNYLSGKKRIIKVMKVDGTTLKLKPPVNAESVLRDFPGYDLLESEEVKRVGVQARPLAR  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               L+  K+YFLVELP+ P   +R PRR  SG +H+SA +RLE+LM  RR+ SD+     
Sbjct  61   DAPLRSGKLYFLVELPRVPD--QRAPRRAWSGPMHLSAKERLESLMLTRRTMSDILVTGN  118

Query  415  --SPAVRREW---GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              S AV  E    G +++K+RLPKA++EK++ ES+  TEAA KI  LC+
Sbjct  119  TTSAAVEAEEGKDGTIRLKMRLPKAEMEKLMRESKTATEAAAKIAELCM  167



>ref|XP_010554976.1| PREDICTED: uncharacterized protein At1g66480-like [Tarenaya hassleriana]
Length=209

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 125/175 (71%), Gaps = 17/175 (10%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K  KVMKI+GET+KLKTP+ A +V+K YPG VLLDSE+VK +GVR+ PL+A 
Sbjct  1    MGNSLGRKKTTKVMKINGETMKLKTPIMAEEVLKGYPGFVLLDSESVKHYGVRSKPLQAG  60

Query  256  QELKPKKIYFLVELPKFPHHGERV-PRRMRSGVHMSATDRLEALMKMRRSTSDVS-----  417
            Q L+ K++YFLVE P+     E V PRR+RSG+ MSA +RL++LM  RRS SD+S     
Sbjct  61   QRLEAKRLYFLVEPPR-----ESVPPRRVRSGIQMSAKERLDSLMLARRSASDLSILNPS  115

Query  418  ---PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI---RDVDKG  564
                A   + G +++K+R+PKA++++++ ES  E EAAEKI+ L +   RD D G
Sbjct  116  GGWTAEDADGGALRVKVRVPKAEMQRLVRESATEAEAAEKIVGLFVAKQRDQDTG  170



>ref|XP_006390815.1| hypothetical protein EUTSA_v10019172mg [Eutrema salsugineum]
 gb|ESQ28101.1| hypothetical protein EUTSA_v10019172mg [Eutrema salsugineum]
Length=196

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 115/170 (68%), Gaps = 10/170 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AK+MKIDGE+ KLKTPV A  VVKDYPGHVL +SE+VK FG+RA PL+  
Sbjct  1    MGNSLGSKKTAKIMKIDGESFKLKTPVKAGTVVKDYPGHVLFESESVKHFGIRAKPLDPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q L+ K++YFLVELP+     ER PRR+RSG+ MSA +RLE L K+ R +S     +++E
Sbjct  61   QNLESKRLYFLVELPRT--WKERGPRRVRSGIQMSAKERLENL-KLSRRSSSDLSVMKKE  117

Query  436  WGPV-------QIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                        +KL+LPK +VEK+  ES   ++ + KI  LC+ ++  G
Sbjct  118  EVDDEEREVLSSVKLKLPKWKVEKLRKESESGSDFSNKITALCLLNIPSG  167



>ref|XP_002438190.1| hypothetical protein SORBIDRAFT_10g009380 [Sorghum bicolor]
 gb|EER89557.1| hypothetical protein SORBIDRAFT_10g009380 [Sorghum bicolor]
Length=276

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 115/175 (66%), Gaps = 16/175 (9%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS-PA-  423
              +L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD+S PA 
Sbjct  61   DAQLRPGRLYFLVALPR----PAVPPRRAWSGALHVGARERLESLMLTRRSTSDLSLPAG  116

Query  424  --------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                       E GPV++++RLPKAQVEK++ ESRD  EAA +I+ LC  +   G
Sbjct  117  TAPASPLSTASEGGPVRLRMRLPKAQVEKLMAESRDGAEAAARIMQLCAANAGSG  171



>emb|CDX72768.1| BnaC06g32160D [Brassica napus]
Length=195

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 118/170 (69%), Gaps = 8/170 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AK+MKI GE+ K++TPV A  VVKD+PGHVLL+SE+VK FG+RA PL+  
Sbjct  1    MGNSLGSKKTAKIMKITGESFKMQTPVRAGTVVKDFPGHVLLESESVKHFGIRAKPLDPN  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q L+ K++YF+VELP+     ER PRR+RSG+ MSA +RLE L   RRS+SD+S    +E
Sbjct  61   QNLESKRLYFMVELPR--TWKERAPRRVRSGIQMSAKERLENLKLSRRSSSDLSVMKNKE  118

Query  436  WGP------VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKGR  567
                       +KLRLPK +VEK+  ES   ++ ++KI  LC+ ++ + R
Sbjct  119  VDEEEREVMTSVKLRLPKWKVEKLRKESESGSDFSDKITALCLLNIQRQR  168



>ref|XP_009409256.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 112/167 (67%), Gaps = 15/167 (9%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+G +KK AKVMKIDG T K+K P  A +V++D+ GH LL+S  V R G+RA PL+ 
Sbjct  1    MGNALGAKKKTAKVMKIDGTTFKVKPPARAINVLRDHRGHDLLESGEVSRLGLRARPLDP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
               LKP K+YFLVELP       R PRR  SG + +SA +RLE+L   RRS SD+S A R
Sbjct  61   DAPLKPGKLYFLVELPT-----RRAPRRAWSGKLQVSAKERLESLRLTRRSMSDLSLAGR  115

Query  430  R--------EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                     + G V++++RLPK QVEK++ ESRD  EAA+KI+ LC+
Sbjct  116  SFAADVEEAKDGAVRLRMRLPKVQVEKLMQESRDAAEAAQKIMRLCV  162



>ref|NP_001175592.1| Os08g0429250 [Oryza sativa Japonica Group]
 dbj|BAC24939.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH94320.1| Os08g0429250 [Oryza sativa Japonica Group]
Length=216

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 112/167 (67%), Gaps = 14/167 (8%)
 Frame = +1

Query  76   MGNAIGG--RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGNAI G  R+ A+VM +DG T K + P SA   ++D+PG+ +L+SE V+R G+RA PL+
Sbjct  1    MGNAIAGGRRRTARVMTVDGTTYKYRPPASAAAALRDHPGYQVLESEEVRRLGMRARPLD  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSG--VHM-SATDRLEALMKMRRSTSD---  411
            A   LKP K+YFLVELP+      R PRR  SG  VH+  A +RLE++M  RRS SD   
Sbjct  61   ADAPLKPGKLYFLVELPRL----ARAPRRTWSGALVHVGGAGERLESMMLSRRSASDVAA  116

Query  412  --VSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              VS     E G V++++RLPKA+V +++ ESRD  EAAEKI+ LC+
Sbjct  117  SPVSSVEAGEGGAVRLRMRLPKAEVARLVKESRDAAEAAEKIMQLCV  163



>ref|XP_002888502.1| hypothetical protein ARALYDRAFT_475748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64761.1| hypothetical protein ARALYDRAFT_475748 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 116/175 (66%), Gaps = 18/175 (10%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RK+AKVMKIDGET ++KTPV+A +V  DYPG+VLLDS+ VK FGVR+ PLE 
Sbjct  1    MGNSITVKRKRAKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP------HHGERVP-RRMRSGVHMSATDRLEALMKMRRSTSD  411
            +Q LKPKK YFLVELPK P          ++P RR+ SG+H+ A +RLE LM  RR+ SD
Sbjct  61   SQILKPKKTYFLVELPKLPPETTATDSDNKLPYRRVMSGIHVGAKERLEMLMLSRRTVSD  120

Query  412  VS---------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEA-AEKIINLCI  546
            V+                G   ++LRLP++Q+ K++ E+ ++  A AEKI+ + +
Sbjct  121  VTIGRSDGGDGFGPGLGPGHTSVRLRLPRSQITKLMEENNNDASAIAEKILGIYM  175



>ref|NP_683488.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD55501.1|AC008148_11 Hypothetical protein [Arabidopsis thaliana]
 gb|AAS76267.1| At1g71015 [Arabidopsis thaliana]
 dbj|BAD94951.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD93955.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35151.1| uncharacterized protein AT1G71015 [Arabidopsis thaliana]
Length=195

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 109/175 (62%), Gaps = 20/175 (11%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K A +M I+GE+ KLKTPV A  VVKD+PGHVLL+SE VKR G+RA PLE  
Sbjct  1    MGNSLGTKKTATIMNINGESFKLKTPVEAGTVVKDFPGHVLLESEAVKRLGIRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEAL------------MKMRR  399
            Q L+ K+IYF+VELP+     ER PRR+RSG+ MSA +RLE L            MK + 
Sbjct  61   QNLESKRIYFMVELPRT--WKERTPRRVRSGIQMSAKERLENLKLSRRSSSDLSVMKKKT  118

Query  400  STSDVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
              +D    V        +KL+LPK ++EK+  ES   ++ + KI  LC+  +  G
Sbjct  119  EVNDEEREVS------SVKLKLPKWKIEKLRKESESGSDFSNKITQLCLLHIPSG  167



>dbj|BAB10363.1| unnamed protein product [Arabidopsis thaliana]
Length=219

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 106/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKIDG+  +LKTPV+A D  K+YPG VLLDSETVKR GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKIDGDIFRLKTPVTASDATKEYPGFVLLDSETVKRLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
             Q LKP   YFLV+LP      +   RR+ SG +H+ A +RLE LM  RR+ SDV  A  
Sbjct  61   NQILKPNHTYFLVDLPPVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDVGAARS  120

Query  430  R------EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIIN  537
                   E G  +++LRLP++Q+ K++ ES D +E A KII+
Sbjct  121  DVVGDGPELGHTRVRLRLPRSQITKLMEESHDASEVAAKIIS  162



>ref|XP_010046540.1| PREDICTED: uncharacterized protein At1g66480-like [Eucalyptus 
grandis]
 gb|KCW86208.1| hypothetical protein EUGRSUZ_B02897 [Eucalyptus grandis]
Length=192

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 108/165 (65%), Gaps = 8/165 (5%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGNA+GG    K+MK  GETLKL  PV A DVVKDYPG+VLL+S++VK  G+++ PLE  
Sbjct  1    MGNALGGATTVKIMKETGETLKLSMPVRAGDVVKDYPGYVLLESQSVKSLGIKSRPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR--  429
            QEL+ +++YFLVELPK   + +   R  + G   SA DRL+ ++  RR  SD S   R  
Sbjct  61   QELEHERLYFLVELPKEAVNDDEAGRGFQLGNKPSAKDRLDGVVLARRLVSDPSTMSRAT  120

Query  430  ------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                     G +++KLRLPKA+VEK+I ES+D+ E  +KI+ L +
Sbjct  121  ILSKEGNGHGGLRLKLRLPKAEVEKLIKESKDDAEVTDKIMELYV  165



>gb|EAZ07066.1| hypothetical protein OsI_29313 [Oryza sativa Indica Group]
Length=214

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 112/167 (67%), Gaps = 14/167 (8%)
 Frame = +1

Query  76   MGNAIGG--RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGNAI G  R+ A+VM +DG T K + P SA   ++D+PG+ +L+SE V+R G+RA PL+
Sbjct  1    MGNAIAGGRRRTARVMTVDGTTYKYRPPASAAAALRDHPGYQVLESEEVRRLGMRARPLD  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSG--VHM-SATDRLEALMKMRRSTSD---  411
            A   LKP K+YFLV+LP+      R PRR  SG  VH+  A +RLE++M  RRS SD   
Sbjct  61   ADAPLKPGKLYFLVKLPRL----ARAPRRTWSGALVHVGGAGERLESMMLSRRSASDVAA  116

Query  412  --VSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              VS     E G V++++RLPKA+V +++ ESRD  EAAEKI+ LC+
Sbjct  117  SPVSSVEAGEGGAVRLRMRLPKAEVARLVKESRDAAEAAEKIMQLCV  163



>ref|NP_198600.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAS99674.1| At5g37840 [Arabidopsis thaliana]
 gb|AAT41812.1| At5g37840 [Arabidopsis thaliana]
 gb|AED94238.1| uncharacterized protein AT5G37840 [Arabidopsis thaliana]
Length=214

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 106/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKIDG+  +LKTPV+A D  K+YPG VLLDSETVKR GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKIDGDIFRLKTPVTASDATKEYPGFVLLDSETVKRLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
             Q LKP   YFLV+LP      +   RR+ SG +H+ A +RLE LM  RR+ SDV  A  
Sbjct  61   NQILKPNHTYFLVDLPPVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDVGAARS  120

Query  430  R------EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIIN  537
                   E G  +++LRLP++Q+ K++ ES D +E A KII+
Sbjct  121  DVVGDGPELGHTRVRLRLPRSQITKLMEESHDASEVAAKIIS  162



>ref|XP_004965177.1| PREDICTED: uncharacterized protein At1g66480-like [Setaria italica]
Length=274

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 114/177 (64%), Gaps = 18/177 (10%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
              +L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD+S    
Sbjct  61   DAQLRPGRLYFLVALPR----PAVPPRRAWSGALHVGARERLESLMLTRRSTSDLSLPAS  116

Query  418  --------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                     +   E GPV++++RLPKAQVEK++ ESRD  EAA +I+ LC  +   G
Sbjct  117  AATAPASPLSTASEGGPVRLRMRLPKAQVEKLMAESRDGAEAAARIMQLCAANAGSG  173



>ref|XP_009401428.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=197

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 114/167 (68%), Gaps = 12/167 (7%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN + G+K+   VMKIDG TLKLK PV A D+++DY G+ LL+SE VK+ GV A PL  
Sbjct  1    MGNGLSGKKRTITVMKIDGTTLKLKAPVQAEDLLRDYRGYDLLESEAVKQLGVGARPLAP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRS-GVHMSATDRLEALMKMRRSTSDVSPAVR  429
               L P K+YFLV+LP+ P   +R PRR  S G+ +SA +RLE L   RR+ SDVS A R
Sbjct  61   DAPLHPGKLYFLVQLPRAPE--QRAPRRAWSGGLPVSARERLENLAFTRRTMSDVSVAGR  118

Query  430  --------REWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                       G V+++LR+PKA++EK++ ES+++TEAAEKI+ LC+
Sbjct  119  PSRVEAEEGSDGTVRLRLRIPKAEMEKLLQESKNDTEAAEKIMVLCV  165



>ref|XP_003563985.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=292

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 112/170 (66%), Gaps = 15/170 (9%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+GGR+K AKVM++DG   ++K P  A  V+ ++PG  LL+SE VK  GVRA PLE 
Sbjct  1    MGNALGGRRKGAKVMQLDGTAFRVKPPAFAGTVLNEHPGFQLLESEQVKLLGVRARPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
               L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD++    
Sbjct  61   DAPLRPGRLYFLVALPR----PTAPPRRAWSGALHVGARERLESLMLTRRSTSDLTFPTT  116

Query  418  -PA----VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
             PA       E GPVQ+++RLPKAQV K++ ESRD  EAA KI+ LC  +
Sbjct  117  APASPLSTASEGGPVQLRMRLPKAQVAKLMGESRDAAEAAAKIMQLCAAN  166



>ref|XP_009105768.1| PREDICTED: uncharacterized protein At1g66480 [Brassica rapa]
 emb|CDX96294.1| BnaA07g29050D [Brassica napus]
Length=195

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 116/171 (68%), Gaps = 10/171 (6%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AK+MKI GE+ K++TPV A  VVKD+PGHVLL+SE+VK FG+RA PL+  
Sbjct  1    MGNSLGSKKTAKIMKITGESFKMQTPVRAGTVVKDFPGHVLLESESVKHFGIRAKPLDPN  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q L  K++YF+VELP+     ER PRR+RSG+ MSA +RLE L K+ R +S     +++E
Sbjct  61   QNLVSKRLYFMVELPR--TWKERAPRRVRSGIQMSAKERLENL-KLSRRSSSDLSVMKKE  117

Query  436  WGP-------VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKGR  567
                        +KLRLPK +VEK+  ES   ++ ++KI  LC+ ++ + R
Sbjct  118  EVDEEEREVMTSVKLRLPKWKVEKLRKESESGSDFSDKITALCLLNIQRQR  168



>ref|XP_006838369.1| hypothetical protein AMTR_s00002p00035620 [Amborella trichopoda]
 gb|ERN00938.1| hypothetical protein AMTR_s00002p00035620 [Amborella trichopoda]
Length=219

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 111/160 (69%), Gaps = 6/160 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN+IG R  AK+M++DGETLKLK PV   DV+ D+PGHVL+D   V+  G+RA PL   
Sbjct  1    MGNSIGRRSTAKIMRVDGETLKLKAPVRVEDVLADHPGHVLIDYALVRELGIRAQPLGPD  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHM---SATDRLEALMKMRRSTSDVSPAV  426
              L P+++YFLV+  + P    R  RR+RS V +   SA +RL+ L+  RR+ SD+SP V
Sbjct  61   SLLMPRRVYFLVQKSELPPT--RPTRRVRSAVPVAAGSAKERLDGLLLARRTVSDLSPMV  118

Query  427  RREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
              E G +++++RLPKAQV +++ ES D +EAAE+I+ LC+
Sbjct  119  -GEGGGMRVRMRLPKAQVVRLMEESADGSEAAERILELCM  157



>gb|KFK41526.1| hypothetical protein AALP_AA2G141000 [Arabis alpina]
Length=199

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 116/167 (69%), Gaps = 6/167 (4%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K  K+MKI+GE+ KLKTPV A  VVKD+PGHV+ +SE+VK FG+RA PL+  
Sbjct  1    MGNSLGSKKSVKIMKINGESFKLKTPVKASTVVKDFPGHVVFESESVKHFGIRAKPLDPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRRE  435
            Q L+ K++YF+VELP+     ER PRR+RSG+ MSA +RLE L   RRS+SD+S   + E
Sbjct  61   QNLESKRLYFMVELPRTCK--ERGPRRVRSGIEMSAKERLENLKLSRRSSSDLSVMKKDE  118

Query  436  WGPV----QIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
               V     +KL+LPK +VEK+  ES   ++ + KI  LC+ ++  G
Sbjct  119  EREVMMMSSVKLKLPKWKVEKLRKESESVSDFSNKITKLCLLNIPSG  165



>ref|XP_002888813.1| hypothetical protein ARALYDRAFT_894932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65072.1| hypothetical protein ARALYDRAFT_894932 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 15/173 (9%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++  +K AK+M I+GE+ KLKTPV A  VVKD+PGH+LL+SE VKRFG+RA PLE  
Sbjct  1    MGNSLVSKKTAKIMNINGESFKLKTPVKAGTVVKDFPGHILLESEAVKRFGIRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMK----------MRRST  405
            Q L+ K++YF+VELP+     ER PRR+RSG+ MSA +RLE L            M++ T
Sbjct  61   QNLESKRLYFMVELPR--TWKERTPRRVRSGIQMSAKERLENLKLSRRSSSDLSVMKKKT  118

Query  406  SDVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
             +V    R       +KL+LPK ++EK+  ES   ++ + KI  LC+  +  G
Sbjct  119  EEVDDEEREV---SSVKLKLPKWKIEKLRKESESGSDFSNKITQLCLLHIPSG  168



>ref|XP_009417656.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=199

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 13/167 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKI-DGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG+KK   +   DG T+KLK P      ++D+PGH LLD+E VKR G+RA PL+ 
Sbjct  1    MGNSLGGKKKMVKVMKVDGTTVKLKPPAQTTQALRDHPGHTLLDAEEVKRLGLRARPLDP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
               LKP K+YF+VELP+ P    R PRR  SG + +SA +RLE+L   RRS SD++    
Sbjct  61   DAALKPGKLYFMVELPRLPDR--RAPRRASSGALRVSAKERLESLRLARRSMSDLAIATP  118

Query  418  --PAVRREW---GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
              P+V  E    G V++K+RLPKAQV++++ ES+D T+AA+KI++LC
Sbjct  119  APPSVEAEEAMDGTVRLKMRLPKAQVQRLMRESKDATDAAQKIMHLC  165



>ref|XP_009139753.1| PREDICTED: uncharacterized protein At1g66480 [Brassica rapa]
Length=213

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 105/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I   RKKA VMKIDG+T +L+TP    D  K+YPG VL DSE+VKR+GVR  PLE 
Sbjct  1    MGNIIMVRRKKATVMKIDGDTFRLQTPARVSDATKEYPGFVLFDSESVKRYGVRVKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
               L P K YFLVELP   +  +   RR+ SG+H+SA +RLE LM  RR+ SDV+ A R 
Sbjct  61   NHILAPNKTYFLVELPNLANRNKLPFRRVMSGIHVSAKERLEMLMLSRRAVSDVALA-RS  119

Query  433  EW------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
            +       G  ++ L+LP++Q+ K++ ES D +E  E+II L
Sbjct  120  DGGNGIGSGQTRVSLKLPRSQIMKLMGESHDASEVTERIIAL  161



>emb|CDY01698.1| BnaC04g30540D [Brassica napus]
Length=212

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 106/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I   RKKA VMKIDG+T +L+TP    D  K+YPG VL DSE+VKR+GVR  PLE 
Sbjct  1    MGNIIMVRRKKATVMKIDGDTFRLQTPARVSDATKEYPGFVLFDSESVKRYGVRVKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
               L P K YFLVELP   +  +   RR+ SG+H+SA +RLE LM  RR+ SDV+ A R 
Sbjct  61   NHILAPNKTYFLVELPNLANRNKLPFRRVMSGIHVSAKERLEMLMLSRRAVSDVALA-RS  119

Query  433  EW------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
            +       G  ++ L+LP++Q+ +++ ES D +E  E+II+L
Sbjct  120  DGGNGIGSGQTRVSLKLPRSQIMRLMGESHDASEVTERIISL  161



>ref|XP_010427914.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 113/172 (66%), Gaps = 13/172 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AKVM I+GE+ KLKTPV A  VVKD+PG+VLL+SE V++FG+RA PLE  
Sbjct  1    MGNSLGSKKTAKVMNINGESFKLKTPVKAGTVVKDFPGYVLLESEAVRQFGIRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEAL---------MKMRRSTS  408
            Q L+ K++YF+VELP+     ER PRR+RSG+ +SA +RLE L         + + +   
Sbjct  61   QNLESKRLYFMVELPR--TWKERTPRRVRSGIQISAKERLENLKLSRRSSSDLSVMKKNE  118

Query  409  DVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
            +V     R+   V +K  LPK +VEK+  ES + ++ + KI  LC+ ++  G
Sbjct  119  EVDHDEERQVSSVTLK--LPKWKVEKLRKESENGSDFSNKIAALCLLNIPSG  168



>dbj|BAJ97523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 111/175 (63%), Gaps = 20/175 (11%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V+ D+PG  LL+SE VK  GVRA PL+ 
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAYAGAVLGDHPGFQLLESEQVKLLGVRARPLDH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
               L+P ++YFLV LP    H    PRR  SG +H+ A +RLE+LM  RRSTSD++    
Sbjct  61   DALLRPGRLYFLVALP----HPTVPPRRAWSGALHVGARERLESLMLTRRSTSDLTFPTS  116

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                       +   E GPVQ+++RLPKAQV K++ ESRD  EAA KI+ LC  +
Sbjct  117  AGAGTAPSSPMSSASEGGPVQLRMRLPKAQVAKLMGESRDAAEAAAKIMQLCAAN  171



>dbj|BAJ94681.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 112/174 (64%), Gaps = 24/174 (14%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL+ 
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAQAGAVLRDHPGFQLLESEQVKLLGVRARPLDH  60

Query  253  AQELKPKKIYFLVELPK--FPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS--  417
               L+P ++YFLV LP+   P      PRR  SG +H+ A +RLE+LM  RRSTSD++  
Sbjct  61   DAPLRPGRLYFLVALPRPTVP------PRRAWSGALHVGARERLESLMLTRRSTSDLTFP  114

Query  418  ------------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                         +   E GPVQ+++RLPKAQV K++ ESRD  EAA KI+ LC
Sbjct  115  TSAGAGTAPSSPMSSASEGGPVQLRMRLPKAQVAKLMGESRDAAEAAAKIMQLC  168



>dbj|BAJ95074.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 112/175 (64%), Gaps = 20/175 (11%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL+ 
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAQAGAVLRDHPGFQLLESEQVKLLGVRARPLDH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
               L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD++    
Sbjct  61   DAPLRPGRLYFLVALPR----PTVPPRRAWSGALHVGARERLESLMLTRRSTSDLTFPTS  116

Query  418  ----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                       +   E GPVQ+++RLPKAQV K++ ESRD  EAA KI+ LC  +
Sbjct  117  AGAGTAPSSPMSSASEGGPVQLRMRLPKAQVAKLMGESRDAAEAAAKIMQLCAAN  171



>dbj|BAD46205.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD54158.1| hypothetical protein [Oryza sativa Japonica Group]
Length=279

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 22/174 (13%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD+     
Sbjct  61   DAPLRPGRLYFLVALPR----PTAPPRRAWSGALHVGARERLESLMLTRRSTSDLSLPAS  116

Query  415  -----------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                       S A     GPV++++RLPKAQVEK++ ESRD  EAA KI+ LC
Sbjct  117  AAVGTAPPSPMSTASEPGGGPVRLRMRLPKAQVEKLMGESRDSAEAAAKIMQLC  170



>gb|EEC80354.1| hypothetical protein OsI_22441 [Oryza sativa Indica Group]
Length=281

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 22/174 (13%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD+     
Sbjct  61   DAPLRPGRLYFLVALPR----PTAPPRRAWSGALHVGARERLESLMLTRRSTSDLSLPAS  116

Query  415  -----------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                       S A     GPV++++RLPKAQVEK++ ESRD  EAA KI+ LC
Sbjct  117  AAVGTAPPSPMSTASEPGGGPVRLRMRLPKAQVEKLMGESRDSAEAAAKIMQLC  170



>ref|NP_001144982.1| uncharacterized protein LOC100278137 [Zea mays]
 gb|ACG44200.1| hypothetical protein [Zea mays]
 gb|ACG47990.1| hypothetical protein [Zea mays]
Length=281

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 112/173 (65%), Gaps = 21/173 (12%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P SA  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPASAGAVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
              +L+P ++YFLV LP+        PRR  SG + + A +RLE+LM  RRSTSD+S    
Sbjct  61   DAQLRPGRLYFLVVLPR----PSVPPRRAWSGALQVGARERLESLMLTRRSTSDLSLPAS  116

Query  418  -----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                       P    E GPV++++RLPKAQVE+++ ESRD  EAA +I+ LC
Sbjct  117  AVTATATAPASPLSESEGGPVRLRMRLPKAQVERLMAESRDGAEAAARIVQLC  169



>ref|XP_006302856.1| hypothetical protein CARUB_v10020986mg [Capsella rubella]
 gb|EOA35754.1| hypothetical protein CARUB_v10020986mg [Capsella rubella]
Length=193

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 111/171 (65%), Gaps = 13/171 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K  K+M I+GE+ KLKTPV A  V+KD+PGHVLL+SE V++FGVRA PLE  
Sbjct  1    MGNSLGSKKTTKIMNINGESFKLKTPVKAGTVIKDFPGHVLLESEAVRQFGVRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRS--------TSD  411
            Q L+ K++YF+VELP+     ER PRR+RSG+ +SA +RLE L   RRS        T +
Sbjct  61   QNLESKRLYFMVELPR--TWKERTPRRVRSGIQISAKERLENLKLSRRSSSDLSVMKTEE  118

Query  412  VSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
            V    R       + L+LPK +VEK+  ES   ++ + K+  LC+ ++  G
Sbjct  119  VDDKERE---VSSVTLKLPKWKVEKLRKESESGSDFSNKMAALCLLNIPTG  166



>ref|NP_001057325.2| Os06g0260000 [Oryza sativa Japonica Group]
 dbj|BAF19239.2| Os06g0260000 [Oryza sativa Japonica Group]
Length=294

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 22/174 (13%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               L+P ++YFLV LP+        PRR  SG +H+ A +RLE+LM  RRSTSD+     
Sbjct  61   DAPLRPGRLYFLVALPR----PTAPPRRAWSGALHVGARERLESLMLTRRSTSDLSLPAS  116

Query  415  -----------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                       S A     GPV++++RLPKAQVEK++ ESRD  EAA KI+ LC
Sbjct  117  AAVGTAPPSPMSTASEPGGGPVRLRMRLPKAQVEKLMGESRDSAEAAAKIMQLC  170



>ref|XP_006285147.1| hypothetical protein CARUB_v10006491mg [Capsella rubella]
 gb|EOA18045.1| hypothetical protein CARUB_v10006491mg [Capsella rubella]
Length=206

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKIDG+  +LKTPV+A D  K+YPG  LLD+ETVKR GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKIDGDIFRLKTPVTASDATKEYPGFALLDAETVKRLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
               L+P K YFLV+LP      +   RR+ SG +H+ A +RLE LM  RR+ SD+  A  
Sbjct  61   NHILRPNKTYFLVDLPMVDKKNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDIGIASS  120

Query  430  REW---GPVQ--IKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                  GP Q  + L+LP++Q++K++ ES+D +E A K+I++ +
Sbjct  121  NNGDGPGPGQTRVTLKLPRSQIKKLMGESQDVSEVAAKLISVYL  164



>dbj|BAK00399.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 117/185 (63%), Gaps = 16/185 (9%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAF-DVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN+IG  RK AKVM++DG + ++KTP +A  DV++D+PG  LL++E VK  G RA PL 
Sbjct  1    MGNSIGAKRKGAKVMQLDGTSFRVKTPAAAASDVLRDHPGFQLLEAEEVKLLGARARPLA  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS---  417
                L+  ++YFLV LP+ P  G   PRR  SG + + A +RLE+LM  RRSTSD+S   
Sbjct  61   PDAPLRRGRLYFLVALPRRPAAGP--PRRAWSGNLRVGARERLESLMLARRSTSDLSSFQ  118

Query  418  -------PAVRREWG-PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKGR*F  573
                   PA     G PV++++RLPKAQVEK++ ESRD  EAA KI+ LC    D G   
Sbjct  119  GVASASAPASPLPGGTPVRLRMRLPKAQVEKLMGESRDAAEAAAKIMELCAAVGDGGACS  178

Query  574  SCVLP  588
            + V P
Sbjct  179  AKVTP  183



>ref|NP_001140541.1| hypothetical protein [Zea mays]
 gb|ACF84045.1| unknown [Zea mays]
 gb|AFW86286.1| hypothetical protein ZEAMMB73_407213 [Zea mays]
Length=286

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 112/173 (65%), Gaps = 21/173 (12%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P SA  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPASAGAVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
              +L+P ++YFLV LP+        PRR  SG + + A +RLE+LM  RRSTSD+S    
Sbjct  61   DAQLRPGRLYFLVVLPR----PSVPPRRAWSGALQVGARERLESLMLTRRSTSDLSLPAS  116

Query  418  -----------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                       P    E GPV++++RLPKAQVE+++ ESRD  EAA +I+ LC
Sbjct  117  AATATATAPPSPLSESEGGPVRLRMRLPKAQVERLMAESRDGAEAAARIMQLC  169



>ref|XP_003578092.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=229

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 122/203 (60%), Gaps = 32/203 (16%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+ GR++A KVM +DG T + KTP +A   ++ +PGH LL+S+ V+R GVRA PL+ 
Sbjct  1    MGNALAGRRRAAKVMTVDGATFRYKTPATAGAALRGHPGHQLLESDEVRRLGVRARPLDR  60

Query  253  AQELKPKKIYFLVELPKFPHH---------GERVPRRMRSG-VHMSATDRLEALMKMRRS  402
               LKP K+YFLV+LP+ P             R PR+  SG +H+ A +RLE+LM  RR+
Sbjct  61   DAALKPGKLYFLVQLPRGPARFDADAGAEDDARAPRKTWSGALHVGARERLESLMLSRRT  120

Query  403  TSDVSPAVRR--------------------EWGPVQIKLRLPKAQVEKVIVESRDETEAA  522
             SDV+  + R                    +  PV++++RLPKA+V +++ ES+D  EAA
Sbjct  121  VSDVASMMPRGAVPGSGGGRASSVEAGGGDDGAPVRLRMRLPKAEVARLMKESKDPAEAA  180

Query  523  EKIINLCIRDVDKGR*FSCVLPT  591
            E+I+ LC+   D+G   +  +P+
Sbjct  181  ERIMQLCV-ARDQGAHHAAPMPS  202



>ref|XP_011099483.1| PREDICTED: uncharacterized protein At1g66480-like [Sesamum indicum]
Length=147

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 31/165 (19%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYP-GHVLLDSETVKRFGVRATPLE  249
            MGN IGG KK AK+MKIDG+T KLK P  A DV+KDYP  +VLL+ E+VKRFG+RA  L+
Sbjct  1    MGNNIGGGKKTAKIMKIDGQTFKLKAPAIAMDVLKDYPPTYVLLEHESVKRFGIRAPELQ  60

Query  250  AAQELKPKKIYFLVELPKFPH----HGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS  417
              +ELKP KIYFLVE+P+FP        R   RMRSG+   A                  
Sbjct  61   PGEELKPGKIYFLVEMPEFPEAARSRRARSVARMRSGMGSGA------------------  102

Query  418  PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
                   G V++K+++P+AQ+EKV+ ESRD+ E  E+I+ LC+++
Sbjct  103  -------GRVRVKIKVPRAQIEKVMEESRDDAEVGERIVELCLKN  140



>ref|XP_002462356.1| hypothetical protein SORBIDRAFT_02g024320 [Sorghum bicolor]
 gb|EER98877.1| hypothetical protein SORBIDRAFT_02g024320 [Sorghum bicolor]
Length=212

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 114/180 (63%), Gaps = 23/180 (13%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+ GR++A KVM +DG T + KTP +A   ++ +PGH LL+SE V+R GVRA P++ 
Sbjct  1    MGNALAGRRRAAKVMTVDGGTFRYKTPAAAGAALRGHPGHQLLESEEVRRLGVRARPMDR  60

Query  253  AQELKPKKIYFLVELPKFPHHGE--RVPRRMRSG-VHMSATDRLEALMKMRRSTSDV---  414
               LKP K+YFLV++P+     +  R PR+  SG +H+ A +RLE+LM  RR+ SDV   
Sbjct  61   DAPLKPGKLYFLVQIPRGGGDDDDPRAPRKTWSGALHVGARERLESLMLSRRTVSDVAAS  120

Query  415  ---SPAVRREW-------------GPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
               S A R                G V++++RLPKA+V +++ ES+D  EAAE+I+ LC+
Sbjct  121  IVPSSAARLAAMSKPPSSVEVGVDGAVRLRMRLPKAEVARLMKESKDPAEAAERIMQLCV  180



>ref|XP_010415796.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=209

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 112/172 (65%), Gaps = 14/172 (8%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN++G +K AKVM I+GE+ KLKTPV A  VVKD+PG+VLL+SE VK+FG+RA PLE  
Sbjct  1    MGNSLGSKKTAKVMNINGESFKLKTPVKAGTVVKDFPGYVLLESEAVKQFGIRAKPLEPH  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEAL---------MKMRRSTS  408
            Q L+ K++YF+VELP+     ER PRR+RSG+ +SA +RLE L         + + +   
Sbjct  61   QNLESKRLYFMVELPR--TWKERTPRRVRSGIQISAKERLENLKLSRRSSSDLSVMKKNE  118

Query  409  DVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
            +V     R+   V   L+LPK +VEK + ++   ++ + KI  LC+ ++  G
Sbjct  119  EVDHDEERQVSSVT--LKLPKWKVEK-LRKASGGSDFSNKIAALCLLNIPSG  167



>ref|XP_003570504.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=260

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 111/194 (57%), Gaps = 31/194 (16%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IG  RK AKVM++DG + ++K P +A DV++D+PG  LL+SE VK  G RA PL  
Sbjct  1    MGNSIGAKRKGAKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERV--PRRMRSG-VHMSATDRLEALMKMRRSTSDVSP-  420
               L+  K+YFLV LP+ P  G R   PRR  SG + + A +RLE+LM  RRSTSD+S  
Sbjct  61   DAPLRRGKLYFLVALPRRPSGGGRAGPPRRAWSGNLRVGARERLESLMLTRRSTSDLSSF  120

Query  421  --------------------------AVRREWGPVQIKLRLPKAQVEKVIVESRDETEAA  522
                                             PV++K+RLPKAQVEK++ ESRD  EAA
Sbjct  121  QGGASASAPTSPLPGGIGIGIGIGGGGGGGGGTPVRLKMRLPKAQVEKLMGESRDAAEAA  180

Query  523  EKIINLCIRDVDKG  564
             KI+ LC    D G
Sbjct  181  AKIMELCAAVGDGG  194



>ref|XP_004956774.1| PREDICTED: uncharacterized protein At1g66480-like [Setaria italica]
Length=236

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 32/189 (17%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+ GR++A KVM +DG T + KTP +A   ++ +PGH LL+SE V+R GVRA PL+ 
Sbjct  1    MGNALAGRRRAAKVMTVDGATFRYKTPAAAGAALRGHPGHQLLESEEVRRLGVRARPLDR  60

Query  253  AQELKPKKIYFLVELPKFPHHG------ERVPRRMRSG-VHMSATDRLEALMKMRRSTSD  411
               LKP K+YFLV++P+    G       R PR+  SG +H+ A +RLE+LM  RR+ SD
Sbjct  61   DAPLKPGKLYFLVQIPRGAAVGCAGDDDPRAPRKTWSGALHVGARERLESLMLSRRTVSD  120

Query  412  V-----SPAVRREW-------------------GPVQIKLRLPKAQVEKVIVESRDETEA  519
            V     S A R                      G V++++RLPKA+V +++ ESRD  EA
Sbjct  121  VASIMPSSAARLAAVGAGGSPNKPPSSVEVGADGAVRLRMRLPKAEVARLMKESRDPAEA  180

Query  520  AEKIINLCI  546
            AE+I+ LC+
Sbjct  181  AERIMQLCV  189



>gb|EEC73945.1| hypothetical protein OsI_08817 [Oryza sativa Indica Group]
Length=246

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 22/176 (13%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGG RK AKVM++DG + ++K P  A DV++D+PG  LL+SE VK  G RA PL  
Sbjct  1    MGNSIGGKRKGAKVMQLDGTSFRVKPPAVAADVLRDHPGFQLLESEEVKLLGARARPLAP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               L+  ++YFLV LP+ P  G   PRR  SG + + A +RLE+LM  RRSTSD+     
Sbjct  61   DAPLRRGRLYFLVALPRRPAAGP--PRRAWSGNLRVGARERLESLMLARRSTSDLSSFPA  118

Query  415  -------------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                           A      PV++K+RLP+AQVEK++ ES+D +EAA KI+ LC
Sbjct  119  AQASASAPTSPLPGSACSGAATPVRLKMRLPRAQVEKLMGESKDASEAAAKIMELC  174



>emb|CDY09510.1| BnaC02g20520D [Brassica napus]
Length=202

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 12/175 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G +K  K+MKI+G++ KLKTPV A  VVKD+PGHVL +SE+VKRFG+RA PL+  
Sbjct  1    MGNILGSKKTVKIMKINGKSFKLKTPVKAGTVVKDFPGHVLFESESVKRFGIRAKPLDPK  60

Query  256  QELKPKKIYFLVELPKFPHH--------GERVPRRMRSGVHMSATDRLEALMKMRRSTSD  411
            Q L+ K+IYF+VELP              ER PRR+R G+ M A +RLE L   RRS+SD
Sbjct  61   QYLQSKRIYFMVELPSTGSDRNPRGRRWKERTPRRVRLGIKMGAKERLENLKLSRRSSSD  120

Query  412  ----VSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                   A   +     +KL+LPK +VEK+  ES   ++   KI  LC+ +V  G
Sbjct  121  LSVIKEVAEEEKEVVTSVKLKLPKWKVEKLWKESESVSDFYNKITALCLLNVPSG  175



>emb|CDY03707.1| BnaA02g15300D [Brassica napus]
Length=202

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 108/175 (62%), Gaps = 12/175 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G +K  K+MKI+G++ KLKTPV A  V+KD+PGHVL +SE+VKRFG+RA PL+  
Sbjct  1    MGNILGSKKTVKIMKINGKSFKLKTPVKAGTVIKDFPGHVLFESESVKRFGIRAKPLDPK  60

Query  256  QELKPKKIYFLVELPKFPHH--------GERVPRRMRSGVHMSATDRLEALMKMRRSTSD  411
            Q L+ K+IYF+VELP              ER PRR+R G  M A +RLE L   RRS+SD
Sbjct  61   QYLQSKRIYFMVELPSTGSDRNPRGRRWKERTPRRVRLGTRMGAKERLENLKLSRRSSSD  120

Query  412  ----VSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                   A   +     +KL+LPK +VEK+  ES   ++   KI  LC+ +V  G
Sbjct  121  LSVIKEVAEEEKEVVTSVKLKLPKWKVEKLWKESESVSDFYNKITALCLLNVPSG  175



>ref|XP_009127841.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
Length=202

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 110/175 (63%), Gaps = 12/175 (7%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G +K  K+MKI+G++ KLKTPV A  VVKD+PGHVL +SE+VKRFG+RA PL+  
Sbjct  1    MGNILGRKKTVKIMKINGKSFKLKTPVKAGTVVKDFPGHVLFESESVKRFGIRAKPLDPK  60

Query  256  QELKPKKIYFLVEL--------PKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSD  411
            Q L+ K+IYF+VEL        P+     +R PRR+R G+ M A +RLE L   RRS+SD
Sbjct  61   QYLQSKRIYFMVELPSTGSDRNPRGRRWKKRTPRRVRLGIRMGAKERLENLKLSRRSSSD  120

Query  412  ----VSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDKG  564
                   A   +     +KL+LPK +VEK+  ES   ++   KI  LC+ +V  G
Sbjct  121  LSVIKEVAEEEKEVVTSVKLKLPKWKVEKLWKESESVSDFYNKITALCLLNVSSG  175



>ref|XP_010450546.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=213

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 101/160 (63%), Gaps = 8/160 (5%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKIDG+  +LK+PV+A D  K+YPGHVLLD ETV+R GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKIDGDIFRLKSPVTASDATKEYPGHVLLDPETVRRLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
             Q L+P K YFLV+LP      +   RR+ SG +H+ A +RLE LM  RR+ SD+     
Sbjct  61   DQILRPNKTYFLVDLPLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDIGVGSL  120

Query  430  REW------GPVQIKLRLPKAQVEKVIVESRDETEAAEKI  531
                     G  ++ LRLP++ + K++ E +D +E A +I
Sbjct  121  DSGDGPGPAGQTRVTLRLPRSHITKLMGECQDASEVAARI  160



>ref|XP_010435695.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Camelina 
sativa]
Length=200

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 7/159 (4%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKI+G+  +LKTPV+A D  K+YPGHVLLD ETVKR GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKINGDIFQLKTPVTASDATKEYPGHVLLDPETVKRLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
             + L+P K YFLVEL       +   RR+ SG +H+ A +RLE LM  RR+ SD+     
Sbjct  61   NKILRPNKTYFLVELSLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDIGVGSL  120

Query  430  REW-----GPVQIKLRLPKAQVEKVIVESRDETEAAEKI  531
                    GP ++ LRLP++ + K++ E +D +E A +I
Sbjct  121  ECGDGPGPGPTRVTLRLPRSHITKLMGECQDASEVAARI  159



>ref|XP_010435694.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Camelina 
sativa]
Length=212

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 7/159 (4%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKI+G+  +LKTPV+A D  K+YPGHVLLD ETVKR GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKINGDIFQLKTPVTASDATKEYPGHVLLDPETVKRLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSPAVR  429
             + L+P K YFLVEL       +   RR+ SG +H+ A +RLE LM  RR+ SD+     
Sbjct  61   NKILRPNKTYFLVELSLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDIGVGSL  120

Query  430  REW-----GPVQIKLRLPKAQVEKVIVESRDETEAAEKI  531
                    GP ++ LRLP++ + K++ E +D +E A +I
Sbjct  121  ECGDGPGPGPTRVTLRLPRSHITKLMGECQDASEVAARI  159



>ref|XP_010693823.1| PREDICTED: uncharacterized protein At1g66480-like [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 103/185 (56%), Gaps = 28/185 (15%)
 Frame = +1

Query  76   MGNAIGG--RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN +G    K AKVMKI+GE  K  TP    D+ KDYP H+LLDSE   RF +RA PL 
Sbjct  1    MGNNMGSGSNKAAKVMKINGEFFKFNTPAKVIDITKDYPDHILLDSEEFLRFNLRAKPLN  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRL------EALMKMRRSTSD  411
               +LKP+KIY LV+LPKFP++  R  R   S +  + T R+      + L    RST D
Sbjct  61   PEYQLKPRKIYLLVDLPKFPNNNLR--RVQSSVLANTVTTRVSRRSVSDDLTIKTRSTVD  118

Query  412  V--------------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIR  549
            +              SP V    GP ++K+RL K QVEK++ ES D+ E A+KI+ LC+ 
Sbjct  119  MRSFDDDDDENGGSHSPVV----GPTRVKMRLRKTQVEKIMEESSDDVEVAKKIVRLCLE  174

Query  550  DVDKG  564
                G
Sbjct  175  QSTAG  179



>gb|ACN25188.1| unknown [Zea mays]
 tpg|DAA61372.1| TPA: hypothetical protein ZEAMMB73_422493 [Zea mays]
Length=232

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 111/184 (60%), Gaps = 27/184 (15%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+ GR++A KVM +DG T + KTP +A   ++ +PGH LL+SE V+R GVRA PL+ 
Sbjct  1    MGNALAGRRRAAKVMTVDGATFRYKTPAAACAALRGHPGHQLLESEEVRRLGVRARPLDR  60

Query  253  AQELKPKKIYFLVELPK-FPHHGE--RVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSP  420
               LKP K+YFLV++P+     G+  R PR+  SG + + A +RLE LM  RR+ SDVS 
Sbjct  61   DAPLKPGKLYFLVQIPRGGAGDGDDPRAPRKTWSGALRVGARERLEGLMLSRRTVSDVSS  120

Query  421  AVRREW----------------------GPVQIKLRLPKAQVEKVIVESRDETEAAEKII  534
             +                          G V++++RLPKA V +++ ESRD  EAAE+I+
Sbjct  121  ILPPPAAARLAAASPSPSPPSSVEVGADGAVRLRMRLPKADVARLMQESRDPAEAAERIM  180

Query  535  NLCI  546
             LC+
Sbjct  181  QLCV  184



>tpg|DAA61371.1| TPA: hypothetical protein ZEAMMB73_422493 [Zea mays]
Length=256

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 111/184 (60%), Gaps = 27/184 (15%)
 Frame = +1

Query  76   MGNAIGGRKKA-KVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNA+ GR++A KVM +DG T + KTP +A   ++ +PGH LL+SE V+R GVRA PL+ 
Sbjct  1    MGNALAGRRRAAKVMTVDGATFRYKTPAAACAALRGHPGHQLLESEEVRRLGVRARPLDR  60

Query  253  AQELKPKKIYFLVELPK-FPHHGE--RVPRRMRSG-VHMSATDRLEALMKMRRSTSDVSP  420
               LKP K+YFLV++P+     G+  R PR+  SG + + A +RLE LM  RR+ SDVS 
Sbjct  61   DAPLKPGKLYFLVQIPRGGAGDGDDPRAPRKTWSGALRVGARERLEGLMLSRRTVSDVSS  120

Query  421  AVRREW----------------------GPVQIKLRLPKAQVEKVIVESRDETEAAEKII  534
             +                          G V++++RLPKA V +++ ESRD  EAAE+I+
Sbjct  121  ILPPPAAARLAAASPSPSPPSSVEVGADGAVRLRMRLPKADVARLMQESRDPAEAAERIM  180

Query  535  NLCI  546
             LC+
Sbjct  181  QLCV  184



>ref|XP_004953825.1| PREDICTED: uncharacterized protein At1g66480-like [Setaria italica]
Length=258

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 109/184 (59%), Gaps = 28/184 (15%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG RK AKVM++DG + ++K P +A DV++D+PG  LL+SE VK  G RA PL  
Sbjct  1    MGNSLGGKRKSAKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAP  60

Query  253  AQELKPKKIYFLVELPKFPHHGE--RVPRRMRSGVHMSATDRLEALMKMRRSTSDVS---  417
               L+  ++YFLV LP+    G   R+ R     + + A +RLE+LM  RRSTSD+S   
Sbjct  61   DAPLRRGRLYFLVALPRRAPAGAAGRMRRAWSGNLRVGARERLESLMLARRSTSDLSSLP  120

Query  418  --------------------PAVRREWG--PVQIKLRLPKAQVEKVIVESRDETEAAEKI  531
                                PA     G  PV++K+RLP+AQVEK++ ES+D  EAA KI
Sbjct  121  AHASASAPTSPLPSGATSPLPAAGAGGGTTPVRLKMRLPRAQVEKLMGESKDPAEAAAKI  180

Query  532  INLC  543
            + LC
Sbjct  181  MELC  184



>gb|KGN57888.1| hypothetical protein Csa_3G368690 [Cucumis sativus]
Length=198

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 109/177 (62%), Gaps = 16/177 (9%)
 Frame = +1

Query  76   MGNAIG-----GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRAT  240
            MGNAIG      ++  KVMKI+GET+K+  P +A++V   YP H+L +S+++K FG+RA 
Sbjct  1    MGNAIGRGSRRKKRTTKVMKINGETIKITLPTTAYEVTSHYPSHLLYESKSLKLFGLRAK  60

Query  241  PLEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVH-MSATDRLEALMKMRRSTSDV-  414
            PL+    L+PK +YFL++LP  P     + RR  S +H +SA+DRLE L+  RRS SD+ 
Sbjct  61   PLDPHCHLEPKTLYFLLQLPTLPRDHCSL-RRTCSDLHNLSASDRLECLLLSRRSLSDLQ  119

Query  415  --------SPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
                    S        PVQ+K +LP+A+ E+++ E +++ E  ++I++ C R  D 
Sbjct  120  TLRFDPQRSSTDDGAAKPVQVKFQLPRAEFERLMKECKNKVEVTKRIVDYCARSRDN  176



>gb|ABK23762.1| unknown [Picea sitchensis]
Length=247

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 112/190 (59%), Gaps = 30/190 (16%)
 Frame = +1

Query  76   MGNAI--GGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGNAI   G K+ K+MK+DG+ +K K P++  +++K YP H +LDSE V+  G+RA PL 
Sbjct  1    MGNAIPSRGHKRIKIMKLDGQEIKFKAPMTVDEIMKKYPNHSVLDSEAVRHLGIRAKPLH  60

Query  250  AAQELKPKKIYFLVELPK--FPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVS--  417
             + +L+PK++YFLVE PK    ++  R P R+RS +  SA  RLE+++  RRS SD+S  
Sbjct  61   ESTQLEPKRLYFLVEWPKTKIINNIYRAPTRVRSEISTSAKSRLESMLLARRSVSDISAI  120

Query  418  -------------PAVRR-----------EWGPVQIKLRLPKAQVEKVIVESRDETEAAE  525
                         P++             E G V++K+RL KAQ+ K + ES+  +E AE
Sbjct  121  GASNGNRAGSLQYPSLTNSPSAQLDQTGGEDGAVRLKIRLTKAQLSKFMSESQTGSETAE  180

Query  526  KIINLCIRDV  555
            KI++  + + 
Sbjct  181  KILDAYLTNA  190



>ref|XP_010440894.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=212

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = +1

Query  76   MGNAIGGRK-KAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN I  R+ K KVMKIDG+  +LKTPV+A D  K+YPGHVLLD ETVK  GVRA PLE 
Sbjct  1    MGNTIMVRRNKVKVMKIDGDIFRLKTPVTASDATKEYPGHVLLDPETVKWLGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS-PAV  426
             + L+P K YFLV+L       +   RR+ SG +H+ A +RLE LM  RR+ SD+   ++
Sbjct  61   NKILRPNKTYFLVDLLLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSRRTVSDIGVGSL  120

Query  427  RREWGP----VQIKLRLPKAQVEKVIVESRDETEAAEKI  531
                GP     ++ LRLP++ + K++ + +D +E A +I
Sbjct  121  ECGDGPGPGRTRVTLRLPRSHITKLMGDCQDASEVAARI  159



>gb|EEC84556.1| hypothetical protein OsI_31309 [Oryza sativa Indica Group]
Length=235

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 116/186 (62%), Gaps = 29/186 (16%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYP-GHVLLDSETVKRFGVRATPLE  249
            MGNA+ G+++ AKVM +DG T + + P +A   ++ +P GH LL+SE V+R GVRA PL+
Sbjct  1    MGNALAGKRRVAKVMTVDGATFRYRAPATAGAALRGHPAGHQLLESEEVRRLGVRARPLD  60

Query  250  AAQELKPKKIYFLVELPKFP--HHGE---RVPRRMRSG-VHMSATDRLEALMKMRRSTSD  411
                LKP K+YFLV+LP+    + G+   R PR+  SG +H+ A +RLE+LM  RR+ SD
Sbjct  61   RDAPLKPGKLYFLVQLPRGAAGYGGDDDPRAPRKTWSGALHVGARERLESLMLSRRTVSD  120

Query  412  VSPAV--------------RREW-------GPVQIKLRLPKAQVEKVIVESRDETEAAEK  528
            ++  V              RR         G V++++RLPK++V +++ +S+D  EAAE+
Sbjct  121  MASVVPAARAVAGGGGEPARRPSSVEVGVDGAVRLRMRLPKSEVARLMKDSKDAAEAAER  180

Query  529  IINLCI  546
            I+ LC+
Sbjct  181  IMQLCV  186



>ref|NP_001182953.1| uncharacterized protein LOC100501255 [Zea mays]
 gb|ACR35257.1| unknown [Zea mays]
 gb|AFW63817.1| hypothetical protein ZEAMMB73_946324 [Zea mays]
Length=252

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 18/174 (10%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAF-DVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGN+IGG RK AKVM++DG + ++K P +A  DV++D+PG  LL+SE VK  G RA PL 
Sbjct  1    MGNSIGGKRKSAKVMQLDGTSFRVKPPAAAAADVLRDHPGFQLLESEEVKLLGARARPLA  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVR  429
                L+  ++YFLV LP+    G  + R     +++ A +RLE+L   RRSTSD+S    
Sbjct  61   PDAPLRRGRLYFLVALPRRAPAGGPMRRAWSGNLNVGARERLESLKLARRSTSDLSSLPA  120

Query  430  REWG----------------PVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                                PV++K+RLP+AQVEK++ ES+D  EAA KI+ LC
Sbjct  121  PAHASASAPASPLPGGGGATPVRLKMRLPRAQVEKLMGESKDPAEAAAKIMELC  174



>dbj|BAD36318.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG98963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 116/186 (62%), Gaps = 29/186 (16%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYP-GHVLLDSETVKRFGVRATPLE  249
            MGNA+ G+++ AKVM +DG T + + P +A   ++ +P GH LL+SE V+R GVRA PL+
Sbjct  1    MGNALTGKRRVAKVMTVDGATFRYRAPATAGAALRGHPAGHQLLESEEVRRLGVRARPLD  60

Query  250  AAQELKPKKIYFLVELPKFP--HHGE---RVPRRMRSG-VHMSATDRLEALMKMRRSTSD  411
                LKP K+YFLV+LP+    + G+   R PR+  SG +H+ A +RLE+LM  RR+ SD
Sbjct  61   RDAPLKPGKLYFLVQLPRGAAGYGGDDDPRAPRKTWSGALHVGARERLESLMLSRRTVSD  120

Query  412  VSPAV--------------RREW-------GPVQIKLRLPKAQVEKVIVESRDETEAAEK  528
            ++  V              RR         G V++++RLPK++V +++ +S+D  EAAE+
Sbjct  121  MASVVPAARAVAGGGGEPARRPSSVEVGVDGAVRLRMRLPKSEVARLMKDSKDAAEAAER  180

Query  529  IINLCI  546
            I+ LC+
Sbjct  181  IMQLCV  186



>ref|XP_009390356.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=195

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 106/163 (65%), Gaps = 6/163 (4%)
 Frame = +1

Query  76   MGNAI----GGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATP  243
            MGNA+      +K AKVM +DG  ++LK P +A DV++D+PGH +L+++ VKR GVRATP
Sbjct  1    MGNAVCAKEKKKKTAKVMTLDGAVIRLKPPAAAGDVLRDHPGHSVLEADEVKRLGVRATP  60

Query  244  LEAAQELKPKKIYFLVELPK-FPHHGERVPRRMRSGVHMSATDRLEALMKMR-RSTSDVS  417
            L++ Q L+P K+YFL ELP+     G R    + +    SATDRLE L   R R ++ ++
Sbjct  61   LDSTQPLEPGKLYFLAELPRPLDRRGLRRASSVVAAARGSATDRLENLRLSRPRRSASLA  120

Query  418  PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCI  546
                   G V++++RLP A+V K++ ES D TEAAE+I+ L +
Sbjct  121  VETAEGGGAVRVRVRLPAARVAKLLQESADGTEAAERIVELYL  163



>ref|XP_008457131.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis melo]
Length=164

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 99/161 (61%), Gaps = 16/161 (10%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKI+GET K+  P +A++V   YP H+L +S+++ +FG+RA PL+   +L+PK +YFL++
Sbjct  1    MKINGETFKITLPTTAYEVTSHYPNHLLYESKSLNQFGLRAKPLDPHCQLRPKTLYFLLQ  60

Query  295  LPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRREWGP----------  444
            LP   +  +R  RR  S +H+SA+DRLE L+  RRS SD+       + P          
Sbjct  61   LPTL-YGVDRSLRRTCSDLHLSASDRLECLLLSRRSVSDLQTL---RFDPQRSLIHDGAA  116

Query  445  --VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
              VQ+K +LP+A+ E+++ E ++  E  +KI++ C R  D 
Sbjct  117  KSVQVKFQLPRAEFERLMKECKNNVEVTKKIVDFCARSRDN  157



>ref|XP_008646204.1| PREDICTED: uncharacterized protein At1g66480-like [Zea mays]
 gb|AFW73273.1| hypothetical protein ZEAMMB73_726247 [Zea mays]
Length=253

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 108/181 (60%), Gaps = 27/181 (15%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG RK AKVM++DG + ++K P +A DV++D+PG  LL+SE VK  G RA PL +
Sbjct  1    MGNSLGGKRKGAKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAS  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDVS----  417
               L+  ++YFLV LP+    G    RR  SG +++ A +RLE+L   RRSTSD+S    
Sbjct  61   DAPLRRGRLYFLVALPRRAPAGPM--RRAWSGNLNVGARERLESLKLARRSTSDLSSLSA  118

Query  418  -------------------PAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINL  540
                               P       PV++K+RLP+AQVEK++ ES+D  E A KI+ L
Sbjct  119  HASASAPTSPLPGGAASPLPPTGSGATPVRVKMRLPRAQVEKLMGESKDPAEVAAKIMEL  178

Query  541  C  543
            C
Sbjct  179  C  179



>ref|XP_002454333.1| hypothetical protein SORBIDRAFT_04g028880 [Sorghum bicolor]
 gb|EES07309.1| hypothetical protein SORBIDRAFT_04g028880 [Sorghum bicolor]
Length=248

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 28/182 (15%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGG RK AKVM++DG + ++K P +A DV++D+PG  LL+SE VK  G RA PL  
Sbjct  1    MGNSIGGKRKSAKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG-VHMSATDRLEALMKMRRSTSDV-----  414
               L+  ++YFLV LP+    G    RR  SG +++ A +RLE+L   RRSTSD+     
Sbjct  61   DAPLRRGRLYFLVALPRRAPAGPM--RRAWSGNLNVGARERLESLKLARRSTSDLSSLPA  118

Query  415  ------------------SPAVRREWG-PVQIKLRLPKAQVEKVIVESRDETEAAEKIIN  537
                              SP        PV++K+RLP+AQVEK++ ES+D  EAA KI+ 
Sbjct  119  HAASASAPTSPLPGRGAASPLPGAGGATPVRLKMRLPRAQVEKLMGESKDPAEAAAKIME  178

Query  538  LC  543
            LC
Sbjct  179  LC  180



>emb|CDX75954.1| BnaC03g40370D [Brassica napus]
Length=124

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  76   MGNAIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAA  255
            MGN +G +K  K+MKI+G++ KLKTPV A  V+KD+PGHVL +SE+VKRFG+RA PL+  
Sbjct  1    MGNILGSKKTVKIMKINGKSFKLKTPVKAGTVIKDFPGHVLFESESVKRFGIRAKPLDPK  60

Query  256  QELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDR  372
            Q L+ K+IYF+VELP+     ER PRR+R G+ M A ++
Sbjct  61   QYLQSKRIYFMVELPR--RWKERTPRRVRLGIKMGAKEK  97



>ref|XP_002445525.1| hypothetical protein SORBIDRAFT_07g020936 [Sorghum bicolor]
 gb|EES15020.1| hypothetical protein SORBIDRAFT_07g020936 [Sorghum bicolor]
Length=227

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 110/186 (59%), Gaps = 15/186 (8%)
 Frame = +1

Query  31   VKYIPCHTFICRTERMGNAIGG--RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHV-LL  201
            V  I C     R   MGN+IGG  R+ A+VM +DG T K + P +A D ++D+PGH  LL
Sbjct  40   VLAISCLASSHRHIIMGNSIGGKRRRSARVMTVDGATYKYRPPAAAGDALRDHPGHHHLL  99

Query  202  DSETVKRFGVRATPLEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHM--SATDRL  375
            +SE V+R GVRA PL+    LKP K+YFLV+LP+         R     +H    A +RL
Sbjct  100  ESEEVRRLGVRARPLDPDAPLKPGKLYFLVDLPRLQ-RRRPPQRTWSGALHYGAGAGERL  158

Query  376  EALMKMRRSTSDVSPAVRREW---------GPVQIKLRLPKAQVEKVIVESRDETEAAEK  528
            E+LM  RRS SDV+ +              G V++++RLPK  V++++ ESRD  +AAE+
Sbjct  159  ESLMLARRSASDVAMSSSVLAASSVEAVGDGAVRLRVRLPKTDVQRLVKESRDAADAAER  218

Query  529  IINLCI  546
            I+ LC+
Sbjct  219  IMQLCV  224



>ref|XP_004151549.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=180

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKI+GET+K+  P +A++V   YP H+L +S+++K FG+RA PL+    L+PK +YFL++
Sbjct  1    MKINGETIKITLPTTAYEVTSHYPSHLLYESKSLKLFGLRAKPLDPHCHLEPKTLYFLLQ  60

Query  295  LPKFPHHGERVPRRMRSGVH-MSATDRLEALMKMRRSTSDV---------SPAVRREWGP  444
            LP  P     + RR  S +H +SA+DRLE L+  RRS SD+         S        P
Sbjct  61   LPTLPRDHCSL-RRTCSDLHNLSASDRLECLLLSRRSLSDLQTLRFDPQRSSTDDGAAKP  119

Query  445  VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
            VQ+K +LP+A+ E+++ E +++ E  ++I++ C R  D 
Sbjct  120  VQVKFQLPRAEFERLMKECKNKVEVTKRIVDYCARSRDN  158



>ref|XP_004169622.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=180

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  115  MKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVE  294
            MKI+GET+K+  P +A++V   YP H+L +S+++K FG+RA PL+    L+PK +YFL++
Sbjct  1    MKINGETIKITLPTTAYEVTSHYPSHLLYESKSLKLFGLRAKPLDPHCHLEPKTLYFLLQ  60

Query  295  LPKFPHHGERVPRRMRSGVH-MSATDRLEALMKMRRSTSDV---------SPAVRREWGP  444
            LP  P     + RR  S +H +SA+DRLE L+  RRS SD+         S        P
Sbjct  61   LPALPRDHCSL-RRTCSDLHNLSASDRLECLLLSRRSLSDLQTLRFDPQRSSTDDGAAKP  119

Query  445  VQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRDVDK  561
            VQ+K +LP+A+ E+++ E +++ E  ++I++ C R  D 
Sbjct  120  VQVKFQLPRAEFERLMKECKNKVEVTKRIVDYCARSRDN  158



>ref|NP_001183195.1| hypothetical protein [Zea mays]
 gb|ACR36022.1| unknown [Zea mays]
 gb|AFW76937.1| hypothetical protein ZEAMMB73_270962 [Zea mays]
Length=263

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 108/170 (64%), Gaps = 17/170 (10%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P SA  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPASAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPA---  423
              +L+P ++YFLV LP+      R        +H+ A +RLE+LM  RRSTSD+S A   
Sbjct  61   DAQLRPGRLYFLVALPRPAAPPRRA---WSGALHVGARERLESLMLTRRSTSDLSLAASA  117

Query  424  ----------VRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
                           GPV++++RLPKA+V++++ ESRD  +AA +I+ LC
Sbjct  118  GTAPPSPLSTASEGGGPVRLRMRLPKAEVDRLMAESRDAADAAARIMQLC  167



>ref|XP_003572217.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=260

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 37/193 (19%)
 Frame = +1

Query  76   MGNAIGG---RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPL  246
            MGNA+GG   RK A+VM +DG T K + P +A   ++++PGH LL+SE V+R GVRA PL
Sbjct  1    MGNAVGGMKRRKTARVMTVDGTTYKYRPPAAACAALREHPGHQLLESEDVRRLGVRARPL  60

Query  247  EAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMS-----ATDRLEALM--------  387
            +A   LKP K+YFLV LP+      R P+R  SG  +      A +RLE LM        
Sbjct  61   DADAPLKPGKLYFLVALPRLAARA-RAPQRTWSGALLGGSGSCAGERLERLMLSSSSRRS  119

Query  388  KMRRSTSDVSPAVRREW--------------------GPVQIKLRLPKAQVEKVIVESRD  507
                + +  SP  RR                      G V++++RLPKA+V +++ ES+D
Sbjct  120  ASDVAAAVASPMWRRSASDVAAAVASPLSASVEAAADGAVRLRMRLPKAEVARLLEESKD  179

Query  508  ETEAAEKIINLCI  546
              EAAE+I+ LC+
Sbjct  180  ADEAAERIMRLCV  192



>ref|XP_010497880.1| PREDICTED: uncharacterized protein At1g66480-like, partial [Camelina 
sativa]
Length=87

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +1

Query  76   MGNAIG-GRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+I   RKKAKVMKIDGET ++KTPV+A +V  +YPG+VLLDS+ VK FGVRA PLE 
Sbjct  1    MGNSITVKRKKAKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEP  60

Query  253  AQELKPKKIYFLVELPKFP  309
             Q LKPKK YFLVELPK P
Sbjct  61   NQVLKPKKTYFLVELPKLP  79



>gb|AAL16667.1|AF419849_1 unknown [Musa acuminata AAA Group]
Length=96

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN++GG+KK AKVMK+DG T KLK PV A  V++D+PG+ LLD++ V R GVRA PLE 
Sbjct  1    MGNSLGGKKKIAKVMKVDGTTFKLKPPVQAVSVLRDHPGYNLLDADEVTRLGVRAMPLEP  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSG  348
               LKP K+YFLVELP+ P+  +R PRR  SG
Sbjct  61   DTSLKPGKLYFLVELPRVPN--QRAPRRAWSG  90



>gb|EAZ42812.1| hypothetical protein OsJ_27397 [Oryza sativa Japonica Group]
Length=145

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +1

Query  76   MGNAIGG--RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLE  249
            MGNAI G  R+ A+VM +DG T K + P SA   ++D+PG+ +L+SE V+R G+RA PL+
Sbjct  1    MGNAIAGGRRRTARVMTVDGTTYKYRPPASAAAALRDHPGYQVLESEEVRRLGMRARPLD  60

Query  250  AAQELKPKKIYFLVELPKFPHHGERVPRRMRSG--VHM-SATDRLEALMKMRRSTSDVS  417
            A   LKP K+YFLVELP+      R PRR  SG  VH+  A +RLE++M  RRS SDV+
Sbjct  61   ADAPLKPGKLYFLVELPRL----ARAPRRTWSGALVHVGGAGERLESMMLSRRSASDVA  115



>ref|XP_008664670.1| PREDICTED: uncharacterized protein At1g66480-like isoform X2 
[Zea mays]
Length=271

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 117/184 (64%), Gaps = 14/184 (8%)
 Frame = +1

Query  37   YIPCHTFICRTERMGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPG--HVLLDS  207
            Y+ C         MGN++GG R++A+VM +DG T K + P +A D ++++PG  + LL+S
Sbjct  32   YVQCSAGTDNNHHMGNSMGGKRRRARVMTVDGTTYKYRAPAAAGDALREHPGKGNHLLES  91

Query  208  ETVKRFGVRATPLEAAQELKPKKIYFLVELP-----KFPHHGERVPRRMRSG-VHMSAT-  366
            E V+R G+RA PL+    LKP K+YFLVELP        H   R P+R  SG +H  A  
Sbjct  92   EEVRRLGLRARPLDPDAPLKPGKLYFLVELPPPSSAAHHHRRARAPQRTWSGALHYGAVA  151

Query  367  ---DRLEALMKMRRSTSDVSPAVRR-EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKII  534
               +RLE+LM  RRS SDV+ +    + G +++++RLPKA V++++ +SRD  +AAE+I+
Sbjct  152  GAGERLESLMLARRSASDVAASSSVGDGGALRLRVRLPKADVQRLVDDSRDAADAAERIM  211

Query  535  NLCI  546
             LC+
Sbjct  212  QLCV  215



>tpg|DAA49037.1| TPA: hypothetical protein ZEAMMB73_148814 [Zea mays]
Length=286

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 117/184 (64%), Gaps = 14/184 (8%)
 Frame = +1

Query  37   YIPCHTFICRTERMGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPG--HVLLDS  207
            Y+ C         MGN++GG R++A+VM +DG T K + P +A D ++++PG  + LL+S
Sbjct  32   YVQCSAGTDNNHHMGNSMGGKRRRARVMTVDGTTYKYRAPAAAGDALREHPGKGNHLLES  91

Query  208  ETVKRFGVRATPLEAAQELKPKKIYFLVELP-----KFPHHGERVPRRMRSG-VHMSAT-  366
            E V+R G+RA PL+    LKP K+YFLVELP        H   R P+R  SG +H  A  
Sbjct  92   EEVRRLGLRARPLDPDAPLKPGKLYFLVELPPPSSAAHHHRRARAPQRTWSGALHYGAVA  151

Query  367  ---DRLEALMKMRRSTSDVSPAVRR-EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKII  534
               +RLE+LM  RRS SDV+ +    + G +++++RLPKA V++++ +SRD  +AAE+I+
Sbjct  152  GAGERLESLMLARRSASDVAASSSVGDGGALRLRVRLPKADVQRLVDDSRDAADAAERIM  211

Query  535  NLCI  546
             LC+
Sbjct  212  QLCV  215



>ref|XP_008664669.1| PREDICTED: uncharacterized protein At1g66480-like isoform X1 
[Zea mays]
Length=284

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 117/184 (64%), Gaps = 14/184 (8%)
 Frame = +1

Query  37   YIPCHTFICRTERMGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPG--HVLLDS  207
            Y+ C         MGN++GG R++A+VM +DG T K + P +A D ++++PG  + LL+S
Sbjct  32   YVQCSAGTDNNHHMGNSMGGKRRRARVMTVDGTTYKYRAPAAAGDALREHPGKGNHLLES  91

Query  208  ETVKRFGVRATPLEAAQELKPKKIYFLVELP-----KFPHHGERVPRRMRSG-VHMSAT-  366
            E V+R G+RA PL+    LKP K+YFLVELP        H   R P+R  SG +H  A  
Sbjct  92   EEVRRLGLRARPLDPDAPLKPGKLYFLVELPPPSSAAHHHRRARAPQRTWSGALHYGAVA  151

Query  367  ---DRLEALMKMRRSTSDVSPAVRR-EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKII  534
               +RLE+LM  RRS SDV+ +    + G +++++RLPKA V++++ +SRD  +AAE+I+
Sbjct  152  GAGERLESLMLARRSASDVAASSSVGDGGALRLRVRLPKADVQRLVDDSRDAADAAERIM  211

Query  535  NLCI  546
             LC+
Sbjct  212  QLCV  215



>gb|EAZ36542.1| hypothetical protein OsJ_20883 [Oryza sativa Japonica Group]
Length=277

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 92/171 (54%), Gaps = 15/171 (9%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFL--------------VELPKFPHHGERVPRRMRSGVHMSATDRLEALMK  390
               L+P ++YFL              V        G          VH+          +
Sbjct  61   DAPLRPGRLYFLVALPRPRAPPRAALVRGATRRRAGAARVADAHPPVHLRPLPPGLGGGR  120

Query  391  MRRSTSDVSPAVRREWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
             R +  DV     R  GPV++++RLPKAQVEK++ ESRD  EAA KI+ LC
Sbjct  121  DRAAVPDVHRLRARAGGPVRLRMRLPKAQVEKLMGESRDSAEAAAKIMQLC  171



>ref|XP_006656858.1| PREDICTED: uncharacterized protein LOC102699696 [Oryza brachyantha]
Length=218

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 82/157 (52%), Gaps = 47/157 (30%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGGR+K AKVM++DG   ++K P  A  V++D+PG  LL+SE VK  GVRA PL  
Sbjct  1    MGNSIGGRRKGAKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAH  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
               L+P ++YFL                                                
Sbjct  61   DAPLRPGRLYFLAS----------------------------------------------  74

Query  433  EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
            E GPV++++RLPKAQVE+++ ESRD  EAA KI+ LC
Sbjct  75   EGGPVRLRMRLPKAQVERLMGESRDSAEAAAKIMQLC  111



>ref|XP_006660146.1| PREDICTED: uncharacterized protein LOC102701652 [Oryza brachyantha]
Length=152

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +1

Query  76   MGNAIGGRKK-AKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGNAI GRK+ A+VM +DG T K + P  A   ++D+PG+ LL+SE V+R G+RA PL+A
Sbjct  1    MGNAIAGRKRTARVMTVDGATYKYRPPAVAGAALRDHPGYQLLESEEVRRLGMRARPLDA  60



>gb|EEE57751.1| hypothetical protein OsJ_08272 [Oryza sativa Japonica Group]
Length=214

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 76/157 (48%), Gaps = 16/157 (10%)
 Frame = +1

Query  76   MGNAIGG-RKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRATPLEA  252
            MGN+IGG RK AKVM++DG + ++K P  A DV++D+PG         +          A
Sbjct  1    MGNSIGGKRKGAKVMQLDGTSFRVKPPAVAADVLRDHPGVPAAGVGGGEAPRRAGPAAWA  60

Query  253  AQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEALMKMRRSTSDVSPAVRR  432
             +    +K       P  P  G      +R G       R        R  S  +     
Sbjct  61   RRAAPKRKALLPRWAPATPGRGAAATPFIRFGPEFP---RFPG-----RVGSGAA-----  107

Query  433  EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLC  543
               PV++K+RLP+AQVEK++ ES+D +EAA KI+ LC
Sbjct  108  --NPVRLKMRLPRAQVEKLMGESKDASEAAAKIMELC  142



>dbj|BAK00045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 14/85 (16%)
 Frame = +1

Query  340  RSGVHMSATDRLEALMKMRRSTSDVS--------------PAVRREWGPVQIKLRLPKAQ  477
            R G   +   RLE+LM  RRSTSD++               +   E GPVQ+++RLPKAQ
Sbjct  19   RGGEEAAKDKRLESLMLTRRSTSDLTFPTSAGAGTAPSSPMSSASEGGPVQLRMRLPKAQ  78

Query  478  VEKVIVESRDETEAAEKIINLCIRD  552
            V K++ ESRD  EAA KI+ LC  +
Sbjct  79   VAKLMGESRDAAEAAAKIMQLCAAN  103



>gb|ABR16829.1| unknown [Picea sitchensis]
Length=168

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (55%), Gaps = 19/108 (18%)
 Frame = +1

Query  76   MGNAIGGR----KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRAT-  240
            MGN +  R    +  K+MK++G+  +L+ P+   ++ ++YP H + D+ETV+R G+  T 
Sbjct  1    MGNYVSLRLCLRRPIKLMKVNGDITELQAPLFVHEISQEYPDHWIFDAETVRRLGLLHTL  60

Query  241  PLEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRLEAL  384
            PL  +  L+  KIY LV +P                +++SAT RL+ L
Sbjct  61   PLHQSARLQAGKIYCLVPIPP--------------SINVSATSRLDEL  94



>emb|CDX74556.1| BnaA04g08330D [Brassica napus]
Length=123

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 7/72 (10%)
 Frame = +1

Query  343  SGVHMSATDRLEALMKMRRSTSDVSPAVRREW------GPVQIKLRLPKAQVEKVIVESR  504
            SG+H+SA +RLE LM  RR+ SDV+ A R +       G  ++ L+LP++Q+ +++ ES 
Sbjct  2    SGIHVSAKERLEMLMLSRRAVSDVALA-RSDGGNGIGSGQTRVSLKLPRSQIMRLMGESH  60

Query  505  DETEAAEKIINL  540
            D +E  E+II+L
Sbjct  61   DASEVTERIISL  72



>gb|ACG46818.1| hypothetical protein [Zea mays]
Length=63

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  76   MGNAIGGR-KKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVK  219
            MGN IGGR K AKVM++DG   ++K P SA  V+ D+PG  LL+SE VK
Sbjct  1    MGNNIGGRCKGAKVMQLDGTAFRVKPPGSAGTVLCDHPGFQLLESEEVK  49



>gb|EMS56085.1| hypothetical protein TRIUR3_29230 [Triticum urartu]
Length=150

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  433  EWGPVQIKLRLPKAQVEKVIVESRDETEAAEKIINLCIRD  552
            E GPVQ+++RLPKAQV K++ ESRD  EAA KI+ LC  +
Sbjct  6    EGGPVQLRMRLPKAQVAKLMGESRDAAEAAAKIMQLCAAN  45



>gb|EMT16940.1| hypothetical protein F775_43108 [Aegilops tauschii]
Length=106

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 13/108 (12%)
 Frame = +1

Query  169  VVKDYPGHVLLDSETVKRFGVRATPLEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSG  348
            +++++PG  LL+SE VK+ GVRA PLE    L+P + YFLV LP+        PR   SG
Sbjct  1    MLRNHPGFQLLESEQVKQLGVRAHPLEHDVLLRPGRHYFLVALPR----PTVPPRGAWSG  56

Query  349  VHMSATDRLEALMK--------MRRSTSDVSP-AVRREWGPVQIKLRL  465
                  +R  + ++        +   T+  SP +   E GPVQ  +RL
Sbjct  57   ALHVDGERSRSCLRAAPPPATDLSCQTAPASPLSAASEGGPVQPWMRL  104



>gb|KCW52110.1| hypothetical protein EUGRSUZ_J01545 [Eucalyptus grandis]
Length=157

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query  422  AGDTSEVDLRIFMSASSRSVALM*TP-DLIRLGTLSP**GNLGNSTRK*IFFGFSSCAAS  246
            A   S+  LR  +  SSRS+AL+  P D  RLGTLS   GNLG+STRK    G SSC  S
Sbjct  77   ASARSDAALRDSIRHSSRSLALIRMPVDRTRLGTLSSSSGNLGSSTRKYTLLGLSSCWGS  136

Query  245  NGVALTPNLFTVSESNKTCPG  183
            +G A  P   T SES +TCPG
Sbjct  137  SGFARMPKCLTASESIRTCPG  157



>ref|XP_004240422.1| PREDICTED: uncharacterized protein LOC101247128 [Solanum lycopersicum]
Length=159

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 16/110 (15%)
 Frame = +1

Query  76   MGNAI----------GGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRF  225
            MGN++          G     +++ ++G   ++ +P++A++V+K+YP HVL    +    
Sbjct  1    MGNSLRCCLACVLPCGALDLIRIVHLNGHVEEITSPITAYEVLKNYPNHVLSKPCSQGTM  60

Query  226  GVRATPLEAAQELKPKKIYFLVELPKFPHHGERVPRRMRSGVHMSATDRL  375
              R   L    ELK   IYFL+     P       ++ +SG+  S+ +RL
Sbjct  61   ARRILILSPESELKRGSIYFLIPASSVPE------KKKKSGITSSSINRL  104



>gb|AEX12177.1| hypothetical protein 0_5630_02 [Pinus taeda]
Length=144

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 7/82 (9%)
 Frame = +1

Query  76   MGN-----AIGGRKKAKVMKIDGETLKLKTPVSAFDVVKDYPGHVLLDSETVKRFGVRAT  240
            MGN      + GR + K+MK DG  +K++ P+   +++ DYP H +L++      G+ + 
Sbjct  1    MGNVLLRRGVDGRHRIKIMKADGTVMKVRGPLCVKEILIDYPNHEMLEAPAGPPLGMGSL  60

Query  241  --PLEAAQELKPKKIYFLVELP  300
              PL    EL    +Y+L+ LP
Sbjct  61   SRPLPDRAELVAAHLYYLIPLP  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1814529760516