BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31427_g1_i1 len=2091 path=[2069:0-2090]

Length=2091
                                                                      Score     E

gb|ABR45721.1|  P5CDH1                                                  976   0.0      Actinidia chinensis
ref|XP_006354791.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    975   0.0      
ref|XP_004241569.1|  PREDICTED: probable aldehyde dehydrogenase         968   0.0      
ref|XP_011071616.1|  PREDICTED: probable aldehyde dehydrogenase         966   0.0      
ref|XP_009770629.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    966   0.0      
ref|XP_009598232.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    962   0.0      
ref|XP_008359118.1|  PREDICTED: probable aldehyde dehydrogenase         943   0.0      
ref|XP_002273569.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    943   0.0      Vitis vinifera
gb|ACL13550.1|  delta-1-pyrroline-5-carboxylate dehydrogenase 1 p...    942   0.0      Malus domestica [apple tree]
gb|ACL13549.1|  delta-1-pyrroline-5-carboxylate dehydrogenase pro...    941   0.0      Malus domestica [apple tree]
ref|XP_008356611.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    941   0.0      
emb|CBI15259.3|  unnamed protein product                                938   0.0      
ref|XP_009369345.1|  PREDICTED: probable aldehyde dehydrogenase         938   0.0      
ref|XP_010663395.1|  PREDICTED: probable aldehyde dehydrogenase i...    937   0.0      
ref|XP_011047156.1|  PREDICTED: probable aldehyde dehydrogenase         936   0.0      
ref|XP_010029083.1|  PREDICTED: probable aldehyde dehydrogenase i...    933   0.0      
ref|XP_006476644.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    933   0.0      
gb|KDP31218.1|  hypothetical protein JCGZ_11594                         933   0.0      
ref|XP_006476645.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    932   0.0      
ref|XP_006439643.1|  hypothetical protein CICLE_v10019562mg             932   0.0      
ref|XP_010029092.1|  PREDICTED: probable aldehyde dehydrogenase i...    932   0.0      
ref|XP_008239830.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    929   0.0      
sp|Q40255.1|ALDH_LINUS  RecName: Full=Probable aldehyde dehydroge...    928   0.0      Linum usitatissimum
ref|XP_007209859.1|  hypothetical protein PRUPE_ppa003713mg             928   0.0      
ref|XP_010678575.1|  PREDICTED: probable aldehyde dehydrogenase         927   0.0      
ref|XP_004508769.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    927   0.0      
ref|XP_010550612.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    926   0.0      
ref|XP_006374487.1|  fis1 family protein                                926   0.0      
ref|XP_002511535.1|  1-pyrroline-5-carboxylate dehydrogenase, put...    926   0.0      Ricinus communis
ref|XP_007037247.1|  Aldehyde dehydrogenase 12A1 isoform 1              926   0.0      
ref|XP_006394383.1|  hypothetical protein EUTSA_v10003935mg             925   0.0      
ref|XP_007155331.1|  hypothetical protein PHAVU_003G192100g             924   0.0      
ref|XP_006579542.1|  PREDICTED: probable aldehyde dehydrogenase-l...    924   0.0      
ref|XP_004299391.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    923   0.0      
ref|XP_010242381.1|  PREDICTED: probable aldehyde dehydrogenase         922   0.0      
dbj|BAJ34440.1|  unnamed protein product                                922   0.0      
gb|KHG20910.1|  Delta-1-pyrroline-5-carboxylate dehydrogenase 12A...    922   0.0      
ref|XP_003524922.1|  PREDICTED: probable aldehyde dehydrogenase-l...    922   0.0      
ref|XP_009151373.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    919   0.0      
gb|KHN48668.1|  Putative aldehyde dehydrogenase                         918   0.0      
gb|EYU42874.1|  hypothetical protein MIMGU_mgv1a003968mg                916   0.0      
ref|XP_003549664.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    916   0.0      
emb|CDP14844.1|  unnamed protein product                                915   0.0      
gb|KFK27982.1|  hypothetical protein AALP_AA8G456400                    911   0.0      
gb|KHN18532.1|  Delta-1-pyrroline-5-carboxylate dehydrogenase 12A...    910   0.0      
ref|XP_003525474.1|  PREDICTED: probable aldehyde dehydrogenase-like    909   0.0      
ref|XP_003609016.1|  Delta-1-pyrroline-5-carboxylate dehydrogenas...    908   0.0      
gb|AAK73756.1|  delta-1-pyrroline-5-carboxylate dehydrogenase pre...    907   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_568955.1|  delta-1-pyrroline-5-carboxylate dehydrogenase 12A1    905   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11503.1|  dehydrogenase                                          905   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866497.1|  ALDH12A1                                           904   0.0      
ref|XP_006279602.1|  hypothetical protein CARUB_v10026134mg             904   0.0      
ref|XP_010444101.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    903   0.0      
ref|XP_008437552.1|  PREDICTED: probable aldehyde dehydrogenase i...    903   0.0      
ref|XP_010458998.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    900   0.0      
ref|XP_010483965.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    898   0.0      
emb|CDY61347.1|  BnaC03g74750D                                          898   0.0      
ref|XP_006842140.1|  hypothetical protein AMTR_s00078p00121310          898   0.0      
emb|CDY00303.1|  BnaA06g22040D                                          897   0.0      
ref|XP_004961379.1|  PREDICTED: probable aldehyde dehydrogenase-like    897   0.0      
gb|AAL70109.1|AF467542_1  putative aldehyde dehydrogenase WIS1          894   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_010934233.1|  PREDICTED: probable aldehyde dehydrogenase i...    893   0.0      
ref|XP_006655530.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    893   0.0      
gb|AAL70106.1|AF467539_1  putative aldehyde dehydrogenase BIS1          892   0.0      Hordeum vulgare [barley]
ref|XP_004152440.1|  PREDICTED: probable aldehyde dehydrogenase-like    892   0.0      
ref|XP_002441445.1|  hypothetical protein SORBIDRAFT_09g026810          892   0.0      Sorghum bicolor [broomcorn]
gb|EEC79594.1|  hypothetical protein OsI_20777                          892   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010029100.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    891   0.0      
gb|AAZ91463.1|  delta-1-pyrroline-5-carboxylate dehydrogenase           890   0.0      Triticum turgidum [cone wheat]
ref|XP_008649931.1|  PREDICTED: probable aldehyde dehydrogenase i...    890   0.0      
gb|EEE64501.1|  hypothetical protein OsJ_19352                          887   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADC45380.1|  putative aldehyde dehydrogenase MIS1                    885   0.0      
ref|XP_007037249.1|  Aldehyde dehydrogenase 12A1 isoform 3              882   0.0      
ref|XP_010231104.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    880   0.0      
ref|XP_008775703.1|  PREDICTED: probable aldehyde dehydrogenase i...    879   0.0      
ref|XP_008649930.1|  PREDICTED: probable aldehyde dehydrogenase i...    878   0.0      
ref|XP_008775704.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    876   0.0      
ref|XP_010934312.1|  PREDICTED: probable aldehyde dehydrogenase i...    875   0.0      
ref|XP_009386617.1|  PREDICTED: probable aldehyde dehydrogenase i...    873   0.0      
ref|XP_009386618.1|  PREDICTED: probable aldehyde dehydrogenase i...    872   0.0      
ref|XP_006439642.1|  hypothetical protein CICLE_v10019562mg             858   0.0      
gb|KCW83537.1|  hypothetical protein EUGRSUZ_B00436                     856   0.0      
ref|XP_010086568.1|  Delta-1-pyrroline-5-carboxylate dehydrogenas...    829   0.0      
gb|KHN48669.1|  Putative aldehyde dehydrogenase                         820   0.0      
gb|AAT39215.1|  putative aldehyde dehydrogenase                         817   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT22667.1|  Putative aldehyde dehydrogenase                         812   0.0      
ref|XP_010934383.1|  PREDICTED: probable aldehyde dehydrogenase i...    810   0.0      
ref|XP_008437559.1|  PREDICTED: probable aldehyde dehydrogenase i...    807   0.0      
gb|EMS51321.1|  putative aldehyde dehydrogenase                         806   0.0      
ref|XP_010934450.1|  PREDICTED: probable aldehyde dehydrogenase i...    805   0.0      
ref|XP_006439641.1|  hypothetical protein CICLE_v10019562mg             803   0.0      
ref|XP_007037250.1|  Aldehyde dehydrogenase 12A1 isoform 4              801   0.0      
ref|XP_006439644.1|  hypothetical protein CICLE_v10019562mg             802   0.0      
ref|XP_002989905.1|  hypothetical protein SELMODRAFT_184908             792   0.0      
ref|XP_002968656.1|  hypothetical protein SELMODRAFT_90262              791   0.0      
ref|XP_001760169.1|  mitochondrial P5CDH                                790   0.0      
ref|XP_008649934.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    773   0.0      
gb|KEH31911.1|  delta-1-pyrroline-5-carboxylate dehydrogenase           771   0.0      
gb|KDO34277.1|  aldehyde dehydrogenase                                  774   0.0      
ref|XP_008912633.1|  hypothetical protein PPTG_16640                    773   0.0      
ref|XP_008611922.1|  aldehyde dehydrogenase                             771   0.0      
ref|XP_009519821.1|  hypothetical protein PHYSODRAFT_481340             771   0.0      
ref|XP_008865914.1|  hypothetical protein H310_03722                    771   0.0      
ref|XP_008649932.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    761   0.0      
emb|CCA15825.1|  predicted protein putative                             763   0.0      
gb|AFK43067.1|  unknown                                                 759   0.0      
ref|XP_009825076.1|  hypothetical protein H257_02935                    758   0.0      
ref|XP_006600682.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    746   0.0      
ref|XP_006600683.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    745   0.0      
emb|CCI44680.1|  unnamed protein product                                746   0.0      
ref|XP_001696928.1|  aldehyde dehydrogenase                             729   0.0      Chlamydomonas reinhardtii
ref|XP_005844734.1|  hypothetical protein CHLNCDRAFT_32475              728   0.0      
ref|XP_005643005.1|  aldehyde dehydrogenase                             726   0.0      
ref|XP_002958122.1|  aldehyde dehydrogenase                             697   0.0      
gb|KFM25939.1|  putative aldehyde dehydrogenase                         689   0.0      
ref|XP_001417108.1|  predicted protein                                  682   0.0      Ostreococcus lucimarinus CCE9901
emb|CEF97382.1|  Aldehyde dehydrogenase, C-terminal                     683   0.0      
ref|XP_003078494.1|  delta-1-pyrroline-5-carboxylate dehydrogenas...    680   0.0      
ref|XP_005834032.1|  hypothetical protein GUITHDRAFT_94019              668   0.0      
emb|CBJ33088.1|  Aldehyde Dehydrogenase                                 666   0.0      
gb|EJK62218.1|  hypothetical protein THAOC_17178                        663   0.0      
ref|XP_002295441.1|  aldehyde dehydrogenase                             658   0.0      Thalassiosira pseudonana CCMP1335
ref|XP_001031541.1|  aldehyde dehydrogenase (NAD) family protein        649   0.0      Tetrahymena thermophila
ref|XP_002177243.1|  aldehyde dehydrogenase                             645   0.0      Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007508262.1|  aldehyde dehydrogenase                             642   0.0      
emb|CAN63138.1|  hypothetical protein VITISV_034571                     633   0.0      Vitis vinifera
ref|XP_002769289.1|  1-pyrroline-5-carboxylate dehydrogenase, put...    627   0.0      Perkinsus marinus ATCC 50983
ref|XP_002781067.1|  1-pyrroline-5-carboxylate dehydrogenase, put...    622   0.0      Perkinsus marinus ATCC 50983
gb|ABZ06724.1|  putative aldehyde dehydrogenase family protein          615   0.0      uncultured marine microorganism HF4000_141E02
gb|ABZ06182.1|  putative aldehyde dehydrogenase family protein          612   0.0      uncultured marine microorganism HF4000_006O13
ref|XP_010934527.1|  PREDICTED: probable aldehyde dehydrogenase i...    602   0.0      
gb|EJY76707.1|  Delta-1-pyrroline-5-carboxylate dehydrogenase           603   0.0      
ref|XP_002908669.1|  aldehyde dehydrogenase, putative                   599   0.0      
emb|CDW82503.1|  probable aldehyde dehydrogenase-like                   595   0.0      
ref|XP_009033417.1|  hypothetical protein AURANDRAFT_52250              595   0.0      
ref|XP_008889035.1|  aldehyde dehydrogenase (NAD) family protein        591   0.0      
gb|EPT27849.1|  aldehyde dehydrogenase (NAD) family protein             585   0.0      
gb|KFG62570.1|  putative mitochondrial P5CDH                            585   0.0      
gb|KFH08793.1|  putative mitochondrial P5CDH                            585   0.0      
gb|EPR59889.1|  aldehyde dehydrogenase (NAD) family protein             583   0.0      
ref|XP_001441466.1|  hypothetical protein                               575   0.0      Paramecium tetraurelia strain d4-2
gb|KHN18531.1|  Putative aldehyde dehydrogenase                         567   0.0      
ref|XP_003881052.1|  putative aldehyde dehydrogenase                    572   0.0      
ref|XP_002368285.1|  aldehyde dehydrogenase, putative                   568   0.0      Toxoplasma gondii ME49
ref|XP_001439437.1|  hypothetical protein                               567   0.0      Paramecium tetraurelia strain d4-2
ref|XP_001444818.1|  hypothetical protein                               527   4e-177   Paramecium tetraurelia strain d4-2
gb|AGT17067.1|  aldehyde dehydrogenase                                  452   5e-151   
emb|CDY30725.1|  BnaA02g33470D                                          446   5e-147   
gb|KDD74557.1|  aldehyde dehydrogenase                                  439   2e-144   
gb|EPS58308.1|  hypothetical protein M569_16507                         390   4e-128   
emb|CDJ43534.1|  aldehyde dehydrogenase, putative                       357   1e-112   
ref|XP_010485285.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    340   4e-109   
gb|EPS72192.1|  delta-1-pyrroline-5-carboxylate dehydrogenase 1 p...    332   1e-105   
gb|KDO76060.1|  hypothetical protein CISIN_1g030638mg                   308   5e-97    
ref|XP_004035148.1|  hypothetical protein IMG5_104840                   288   2e-88    
gb|EWM24081.1|  delta-1-pyrroline-5-carboxylate dehydrogenase 1 p...    288   4e-87    
ref|XP_008378843.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    263   1e-78    
emb|CDY30724.1|  BnaA02g33460D                                          241   5e-72    
ref|XP_004035149.1|  hypothetical protein IMG5_104850                   242   5e-71    
gb|KDD71694.1|  hypothetical protein H632_c4546p0                       235   1e-69    
gb|KDO76061.1|  hypothetical protein CISIN_1g030638mg                   234   2e-69    
gb|AFK43124.1|  unknown                                                 219   1e-62    
emb|CDY66231.1|  BnaAnng21870D                                          209   9e-60    
gb|AAT45086.1|  pyrroline-5-carboxylate dehydrogenase                   199   1e-56    Medicago sativa [alfalfa]
emb|CCI41062.1|  unnamed protein product                                198   2e-53    
ref|XP_002299716.2|  hypothetical protein POPTR_0001s18510g             186   9e-51    Populus trichocarpa [western balsam poplar]
gb|KDO76064.1|  hypothetical protein CISIN_1g030638mg                   180   1e-49    
gb|KDO76062.1|  hypothetical protein CISIN_1g030638mg                   179   1e-49    
gb|KDO76063.1|  hypothetical protein CISIN_1g030638mg                   179   2e-49    
ref|XP_005856054.1|  1-pyrroline-5-carboxylate dehydrogenase            168   1e-45    
ref|XP_008385272.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    163   3e-44    
ref|NP_001174503.1|  Os05g0536400                                       158   2e-42    
ref|XP_010483964.1|  PREDICTED: delta-1-pyrroline-5-carboxylate d...    154   2e-40    
emb|CDJ67549.1|  aldehyde dehydrogenase, putative                       140   5e-33    
gb|KHN24897.1|  Delta-1-pyrroline-5-carboxylate dehydrogenase 12A...    128   5e-31    
gb|EPS63147.1|  hypothetical protein M569_11639                         123   3e-29    
ref|WP_008639741.1|  MULTISPECIES: aldehyde dehydrogenase               117   2e-24    
ref|WP_026576908.1|  aldehyde dehydrogenase                             115   8e-24    
ref|WP_013144236.1|  aldehyde dehydrogenase                             115   9e-24    
ref|WP_014194855.1|  MULTISPECIES: aldehyde dehydrogenase               115   1e-23    
ref|WP_025783419.1|  aldehyde dehydrogenase                             114   2e-23    
ref|WP_033844634.1|  aldehyde dehydrogenase                             114   2e-23    
ref|WP_016837670.1|  aldehyde dehydrogenase                             114   2e-23    
ref|WP_033009542.1|  aldehyde dehydrogenase                             114   2e-23    
ref|WP_033018492.1|  aldehyde dehydrogenase                             114   2e-23    
ref|WP_013986248.1|  aldehyde dehydrogenase                             114   3e-23    
ref|WP_023633780.1|  aldehyde dehydrogenase                             114   3e-23    
ref|WP_033024653.1|  aldehyde dehydrogenase                             114   3e-23    
ref|WP_015373898.1|  putative aldehyde dehydrogenase                    113   3e-23    
ref|WP_021321355.1|  aldehyde dehydrogenase                             113   4e-23    
ref|WP_011229878.1|  aldehyde dehydrogenase                             113   4e-23    
ref|WP_026800912.1|  aldehyde dehydrogenase                             113   4e-23    
ref|WP_025949046.1|  aldehyde dehydrogenase                             113   5e-23    
ref|WP_031405803.1|  aldehyde dehydrogenase                             112   5e-23    
ref|WP_003395837.1|  NAD-dependent aldehyde dehydrogenase               112   6e-23    
ref|WP_018661901.1|  aldehyde dehydrogenase                             112   6e-23    
gb|EZP78455.1|  aldehyde dehydrogenase                                  112   6e-23    
ref|WP_039044162.1|  aldehyde dehydrogenase                             112   1e-22    
ref|WP_013522926.1|  MULTISPECIES: aldehyde dehydrogenase               111   2e-22    
ref|WP_013877527.1|  aldehyde dehydrogenase                             111   2e-22    
ref|WP_003253054.1|  MULTISPECIES: aldehyde dehydrogenase               111   2e-22    
ref|WP_035067573.1|  aldehyde dehydrogenase                             111   2e-22    
ref|WP_033829055.1|  aldehyde dehydrogenase                             110   3e-22    
gb|AAZ91465.1|  delta-1-pyrroline-5-carboxylate dehydrogenase           101   3e-22    Triticum aestivum [Canadian hard winter wheat]
ref|WP_039230283.1|  aldehyde dehydrogenase                             110   3e-22    
gb|KDE57201.1|  aldehyde dehydrogenase                                  110   3e-22    
ref|WP_021095278.1|  NAD-dependent aldehyde dehydrogenase               110   4e-22    
ref|WP_019381264.1|  aldehyde dehydrogenase                             110   4e-22    
ref|WP_027417390.1|  aldehyde dehydrogenase                             110   5e-22    
ref|WP_012574867.1|  aldehyde dehydrogenase                             109   6e-22    
ref|WP_019417797.1|  aldehyde dehydrogenase                             109   6e-22    
ref|WP_027445523.1|  aldehyde dehydrogenase                             109   7e-22    
ref|WP_033072266.1|  transcriptional regulator                          111   8e-22    
ref|WP_035199972.1|  transcriptional regulator                          111   8e-22    
ref|WP_032488791.1|  proline dehydrogenase                              111   8e-22    
ref|WP_004432057.1|  bifunctional proline dehydrogenase/pyrroline...    111   8e-22    
gb|EGP55704.1|  proline dehydrogenase                                   111   9e-22    
ref|WP_006313920.1|  bifunctional proline dehydrogenase/pyrroline...    111   9e-22    
ref|WP_035509759.1|  MULTISPECIES: aldehyde dehydrogenase               109   9e-22    
ref|WP_019122292.1|  aldehyde dehydrogenase                             109   9e-22    
ref|WP_019566503.1|  bifunctional proline dehydrogenase/pyrroline...    111   1e-21    
gb|KAJ33291.1|  transcriptional regulator                               111   1e-21    
ref|WP_035210701.1|  transcriptional regulator                          111   1e-21    
ref|WP_035243018.1|  transcriptional regulator                          111   1e-21    
ref|WP_013762129.1|  bifunctional proline dehydrogenase/pyrroline...    111   1e-21    
emb|CDQ29555.1|  Aldehyde dehydrogenase, thermostable                   108   1e-21    
ref|WP_025919666.1|  transcriptional regulator                          110   2e-21    
ref|WP_014642171.1|  aldehyde dehydrogenase                             108   2e-21    
ref|WP_009361408.1|  NAD-dependent aldehyde dehydrogenase               108   2e-21    
ref|WP_012749119.1|  aldehyde dehydrogenase                             108   2e-21    
ref|WP_035223541.1|  transcriptional regulator                          110   2e-21    
ref|WP_025595193.1|  transcriptional regulator                          110   2e-21    
ref|WP_015731412.1|  bifunctional proline dehydrogenase/pyrroline...    110   2e-21    
ref|WP_020811556.1|  bifunctional proline dehydrogenase/pyrroline...    110   2e-21    
ref|WP_007084034.1|  aldehyde dehydrogenase                             107   2e-21    
ref|WP_038259110.1|  transcriptional regulator                          110   2e-21    
ref|WP_038196656.1|  transcriptional regulator                          109   3e-21    
ref|WP_017436130.1|  aldehyde dehydrogenase                             107   3e-21    
ref|WP_003522525.1|  bifunctional proline dehydrogenase/pyrroline...    109   3e-21    
ref|XP_005980166.1|  PREDICTED: uncharacterized protein LOC102320353    109   3e-21    
ref|WP_036834056.1|  aldehyde dehydrogenase                             107   4e-21    
ref|WP_006698043.1|  bifunctional proline dehydrogenase/pyrroline...    109   4e-21    
ref|WP_003508739.1|  bifunctional proline dehydrogenase/pyrroline...    109   4e-21    
ref|WP_022563491.1|  MULTISPECIES: Bifunctional putA protein: pro...    108   4e-21    
ref|WP_020009951.1|  MULTISPECIES: bifunctional proline dehydroge...    108   5e-21    
ref|WP_018709087.1|  aldehyde dehydrogenase                             107   5e-21    
ref|WP_034464442.1|  integrase                                          108   5e-21    
ref|WP_011065267.1|  aldehyde dehydrogenase                             107   6e-21    
gb|AIQ91187.1|  Bifunctional proline dehydrogenase/pyrroline-5-ca...    108   7e-21    
ref|WP_037090662.1|  transcriptional regulator                          108   7e-21    
ref|WP_014701809.1|  Proline dehydrogenase/delta-1-pyrroline-5-ca...    108   1e-20    
ref|WP_024904918.1|  transcriptional regulator                          108   1e-20    
ref|WP_024518330.1|  integrase                                          107   1e-20    
ref|WP_036178692.1|  aldehyde dehydrogenase                             105   1e-20    
ref|WP_010973605.1|  MULTISPECIES: bifunctional proline dehydroge...    107   1e-20    
emb|CEI83142.1|  Aldehyde dehydrogenase, thermostable                   105   1e-20    
ref|WP_012988469.1|  bifunctional proline dehydrogenase/pyrroline...    107   2e-20    
ref|WP_027539574.1|  integrase                                          107   2e-20    
ref|WP_005901069.1|  trifunctional transcriptional regulator/prol...    107   2e-20    
ref|WP_038248749.1|  transcriptional regulator                          107   2e-20    
ref|WP_017512699.1|  MULTISPECIES: hypothetical protein                 104   2e-20    
ref|WP_006319745.1|  NAD-dependent aldehyde dehydrogenase               104   2e-20    
gb|AIF42658.1|  aldehyde dehydrogenase                                  104   3e-20    
ref|WP_007908161.1|  aldehyde dehydrogenase                             104   3e-20    
ref|WP_010529654.1|  aldehyde dehydrogenase                             104   4e-20    
ref|WP_030102415.1|  transcriptional regulator                          106   4e-20    
ref|WP_008917909.1|  bifunctional proline dehydrogenase/pyrroline...    105   4e-20    
ref|WP_028198446.1|  transcriptional regulator                          105   4e-20    
ref|WP_036184335.1|  aldehyde dehydrogenase                             103   5e-20    
ref|WP_028227557.1|  transcriptional regulator                          105   5e-20    
ref|WP_028465426.1|  aldehyde dehydrogenase                             103   5e-20    
ref|WP_013090943.1|  bifunctional proline dehydrogenase/pyrroline...    105   6e-20    
ref|WP_021234761.1|  bifunctional proline dehydrogenase/pyrroline...    105   6e-20    
ref|WP_007596522.1|  pyrroline-5-carboxylate dehydrogenase              105   6e-20    
ref|WP_018643718.1|  pyrroline-5-carboxylate dehydrogenase              105   7e-20    
ref|WP_028134543.1|  integrase                                          105   7e-20    
pdb|4Q71|A  Chain A, Crystal Structure Of Bradyrhizobium Japonicu...    105   7e-20    
ref|WP_027199254.1|  transcriptional regulator                          105   7e-20    
ref|WP_008406266.1|  aldehyde dehydrogenase                             103   8e-20    
ref|WP_023044794.1|  bifunctional proline dehydrogenase/pyrroline...    105   8e-20    
ref|WP_036779081.1|  aldehyde dehydrogenase                             103   8e-20    
ref|WP_014824871.1|  aldehyde dehydrogenase                             103   8e-20    
ref|WP_039530089.1|  transcriptional regulator                          105   8e-20    
ref|WP_012809749.1|  aldehyde dehydrogenase                             103   9e-20    
dbj|BAQ09338.1|  aldehyde dehydrogenase                                 102   9e-20    
ref|WP_018418843.1|  bifunctional proline dehydrogenase/pyrroline...    104   9e-20    
ref|WP_019461877.1|  MULTISPECIES: hypothetical protein                 104   1e-19    
ref|WP_018432463.1|  bifunctional proline dehydrogenase/pyrroline...    104   1e-19    
ref|WP_010848062.1|  bifunctional proline dehydrogenase/pyrroline...    104   1e-19    
ref|WP_039286261.1|  transcriptional regulator                          104   1e-19    
ref|WP_018453672.1|  pyrroline-5-carboxylate dehydrogenase              104   1e-19    
ref|WP_010097260.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_038221489.1|  transcriptional regulator                          104   1e-19    
ref|WP_034771922.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_013250464.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_008006250.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_039168127.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_035046349.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_010302779.1|  aldehyde dehydrogenase                             102   1e-19    
ref|WP_008881242.1|  MULTISPECIES: aldehyde dehydrogenase               102   1e-19    
pdb|4Q73|A  Chain A, Crystal Structure Of Bradyrhizobium Japonicu...    104   1e-19    
ref|WP_027816010.1|  transcriptional regulator                          104   1e-19    
ref|WP_039512695.1|  transcriptional regulator                          104   2e-19    
ref|WP_038183603.1|  transcriptional regulator                          104   2e-19    
ref|WP_036839691.1|  transcriptional regulator                          104   2e-19    
ref|WP_037396737.1|  MULTISPECIES: transcriptional regulator            103   2e-19    
ref|WP_035523122.1|  transcriptional regulator                          103   2e-19    
ref|WP_012385732.1|  pyrroline-5-carboxylate dehydrogenase              103   2e-19    
ref|WP_007503050.1|  aldehyde dehydrogenase                             102   2e-19    
gb|AHG04849.1|  aldehyde dehydrogenase                                  102   2e-19    
ref|WP_027799210.1|  transcriptional regulator                          103   2e-19    
ref|WP_008388688.1|  Aldehyde Dehydrogenase                             102   2e-19    
ref|WP_011146219.1|  bifunctional proline dehydrogenase/pyrroline...    103   2e-19    
ref|WP_035532881.1|  transcriptional regulator                          103   2e-19    
ref|WP_022682928.1|  bifunctional proline dehydrogenase/pyrroline...    103   2e-19    
dbj|BAB39706.1|  probable aldehyde dehydrogenase                        101   2e-19    
ref|WP_029992434.1|  aldehyde dehydrogenase                             101   2e-19    
ref|WP_038213307.1|  transcriptional regulator                          103   3e-19    
ref|WP_020958587.1|  aldehyde dehydrogenase                             101   3e-19    
ref|WP_024764733.1|  transcriptional regulator                          103   3e-19    
ref|WP_028172934.1|  MULTISPECIES: integrase                            103   3e-19    
ref|WP_039305279.1|  transcriptional regulator                          103   3e-19    
ref|WP_038209522.1|  transcriptional regulator                          103   3e-19    
ref|WP_003332237.1|  aldehyde dehydrogenase                             101   3e-19    
ref|WP_036577421.1|  aldehyde dehydrogenase                             101   3e-19    
ref|WP_039692775.1|  transcriptional regulator                          103   3e-19    
gb|AJE51069.1|  aldehyde dehydrogenase                                  101   3e-19    
ref|WP_036807552.1|  transcriptional regulator                          103   3e-19    
ref|WP_026186571.1|  transcriptional regulator                          103   3e-19    
ref|WP_036775500.1|  transcriptional regulator                          103   3e-19    
ref|WP_038664626.1|  transcriptional regulator                          103   3e-19    
ref|WP_023181923.1|  trifunctional transcriptional regulator/prol...    103   3e-19    
ref|WP_027210621.1|  transcriptional regulator                          103   3e-19    
emb|CEG30667.1|  aldehyde dehydrogenase                                 101   3e-19    
ref|WP_027804525.1|  transcriptional regulator                          103   3e-19    
ref|WP_039325768.1|  transcriptional regulator                          103   3e-19    
ref|WP_016746921.1|  aldehyde dehydrogenase                             101   3e-19    
ref|WP_013340929.1|  bifunctional proline dehydrogenase/pyrroline...    103   3e-19    
ref|WP_039466130.1|  transcriptional regulator                          102   4e-19    
ref|WP_036280422.1|  integrase                                          102   4e-19    
ref|WP_027954542.1|  aldehyde dehydrogenase                             101   4e-19    
ref|WP_018706440.1|  aldehyde dehydrogenase                             101   4e-19    
pdb|3HAZ|A  Chain A, Crystal Structure Of Bifunctional Proline Ut...    102   4e-19    
pdb|4Q72|A  Chain A, Crystal Structure Of Bradyrhizobium Japonicu...    102   4e-19    
ref|WP_012434794.1|  bifunctional proline dehydrogenase/pyrroline...    102   5e-19    
ref|WP_031241150.1|  transcriptional regulator                          102   5e-19    
ref|WP_035445111.1|  aldehyde dehydrogenase                             100   5e-19    
ref|WP_039510576.1|  transcriptional regulator                          102   5e-19    
ref|WP_035444405.1|  transcriptional regulator                          102   5e-19    
ref|WP_037164450.1|  MULTISPECIES: transcriptional regulator            102   5e-19    
ref|WP_028223626.1|  transcriptional regulator                          102   5e-19    
ref|WP_012874513.1|  aldehyde dehydrogenase                             100   5e-19    
ref|WP_006050856.1|  bifunctional proline dehydrogenase/pyrroline...    102   5e-19    
gb|KCZ70478.1|  NAD-dependent aldehyde dehydrogenase                    100   5e-19    
ref|WP_028159498.1|  integrase                                          102   5e-19    
ref|WP_029971221.1|  transcriptional regulator                          102   5e-19    
ref|WP_027282367.1|  transcriptional regulator                          102   5e-19    
ref|WP_012402366.1|  bifunctional proline dehydrogenase/pyrroline...    102   5e-19    
ref|WP_025209887.1|  aldehyde dehydrogenase                             100   5e-19    
ref|WP_011089996.1|  MULTISPECIES: pyrroline-5-carboxylate dehydr...    102   5e-19    
ref|WP_025678028.1|  aldehyde dehydrogenase                             100   5e-19    
ref|WP_017425725.1|  MULTISPECIES: aldehyde dehydrogenase               100   5e-19    
ref|WP_028397584.1|  aldehyde dehydrogenase                             100   5e-19    
ref|WP_027447250.1|  aldehyde dehydrogenase                             100   6e-19    
ref|WP_004439971.1|  aldehyde dehydrogenase                             100   6e-19    
ref|WP_025115520.1|  aldehyde dehydrogenase                             100   6e-19    
ref|WP_036849088.1|  transcriptional regulator                          102   6e-19    
ref|WP_025598171.1|  transcriptional regulator                          102   6e-19    
ref|WP_035554372.1|  transcriptional regulator                          102   6e-19    
gb|KFK24134.1|  hypothetical protein AALP_AAs67913U000100             92.0    6e-19    
ref|WP_012049216.1|  aldehyde dehydrogenase                             100   6e-19    
ref|WP_023481486.1|  bifunctional protein putA                          102   6e-19    
ref|WP_013590048.1|  bifunctional proline dehydrogenase/pyrroline...    102   7e-19    
ref|WP_039516425.1|  transcriptional regulator                          102   7e-19    
emb|CCJ73053.1|  Transcriptional repressor of PutA and PutP / Pro...    102   8e-19    
ref|WP_039522147.1|  transcriptional regulator                          102   8e-19    
ref|WP_034183843.1|  transcriptional regulator                          102   8e-19    
ref|WP_039504669.1|  transcriptional regulator                          102   8e-19    
ref|WP_039557416.1|  transcriptional regulator                          101   8e-19    
ref|WP_020228210.1|  bifunctional proline dehydrogenase/pyrroline...    101   9e-19    
ref|WP_031418381.1|  aldehyde dehydrogenase                             100   9e-19    
ref|WP_028685686.1|  transcriptional regulator                          101   9e-19    
ref|WP_016819377.1|  aldehyde dehydrogenase                           99.8    9e-19    
ref|WP_038932264.1|  integrase                                          101   9e-19    
ref|WP_034306537.1|  betaine-aldehyde dehydrogenase                     100   9e-19    
ref|WP_008176190.1|  aldehyde dehydrogenase                             100   9e-19    
ref|WP_013986777.1|  aldehyde dehydrogenase                             100   9e-19    
ref|WP_012292622.1|  aldehyde dehydrogenase                             100   1e-18    
ref|WP_015740787.1|  bifunctional proline dehydrogenase/pyrroline...    101   1e-18    
ref|WP_004041055.1|  aldehyde dehydrogenase                           99.8    1e-18    
ref|WP_014916957.1|  bifunctional proline dehydrogenase/pyrroline...    101   1e-18    
ref|WP_004229708.1|  aldehyde dehydrogenase                           99.8    1e-18    
dbj|GAK40450.1|  NAD-dependent aldehyde dehydrogenase                 99.8    1e-18    
ref|WP_028364009.1|  transcriptional regulator                          101   1e-18    
ref|WP_039153794.1|  integrase                                          101   1e-18    
ref|WP_027776925.1|  transcriptional regulator                          101   1e-18    
ref|WP_010107201.1|  bifunctional proline dehydrogenase/pyrroline...    101   1e-18    
ref|WP_023986946.1|  aldehyde dehydrogenase                           99.4    1e-18    
ref|WP_025885202.1|  transcriptional regulator                          101   1e-18    
ref|WP_015600251.1|  delta-1-pyrroline-5-carboxylate dehydrogenase      101   1e-18    
ref|WP_006023925.1|  bifunctional proline dehydrogenase/pyrroline...    101   1e-18    
ref|WP_007866666.1|  Transcriptional repressor of PutA and PutP /...    100   1e-18    
ref|WP_039550119.1|  transcriptional regulator                          101   1e-18    
ref|WP_018317239.1|  pyrroline-5-carboxylate dehydrogenase              100   1e-18    
ref|WP_031397074.1|  transcriptional regulator                          101   1e-18    
ref|WP_017518389.1|  bifunctional proline dehydrogenase/pyrroline...    101   1e-18    
ref|WP_033569482.1|  transcriptional regulator                          101   1e-18    
ref|WP_027349448.1|  transcriptional regulator                          101   1e-18    
ref|WP_007614535.1|  pyrroline-5-carboxylate dehydrogenase              100   1e-18    
ref|WP_010117521.1|  bifunctional proline dehydrogenase/pyrroline...    101   1e-18    
ref|WP_028784502.1|  aldehyde dehydrogenase                           99.8    1e-18    
ref|WP_024555344.1|  transcriptional regulator                          100   1e-18    
ref|WP_036153398.1|  aldehyde dehydrogenase                           99.4    1e-18    
ref|WP_021025880.1|  aldehyde dehydrogenase                           99.4    1e-18    
ref|WP_024354626.1|  aldehyde dehydrogenase                           99.4    1e-18    
ref|WP_034197070.1|  transcriptional regulator                          100   1e-18    
ref|WP_026392402.1|  methylmalonate-semialdehyde dehydrogenase        99.4    2e-18    
ref|WP_009945717.1|  trifunctional transcriptional regulator/prol...  99.8    2e-18    
ref|WP_032993823.1|  transcriptional regulator                          100   2e-18    
ref|WP_038722153.1|  transcriptional regulator                        99.8    2e-18    
ref|WP_009914013.1|  trifunctional transcriptional regulator/prol...    100   2e-18    
ref|WP_013369349.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_029268674.1|  aldehyde dehydrogenase                           99.4    2e-18    
ref|WP_036199903.1|  aldehyde dehydrogenase                           99.4    2e-18    
ref|WP_039498158.1|  transcriptional regulator                          100   2e-18    
ref|WP_004535573.1|  bifunctional proline dehydrogenase/pyrroline...    100   2e-18    
ref|WP_034209640.1|  transcriptional regulator                          100   2e-18    
ref|WP_031462848.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_036222739.1|  aldehyde dehydrogenase                           99.0    2e-18    
gb|KIE61391.1|  betaine-aldehyde dehydrogenase                        99.4    2e-18    
ref|WP_011655625.1|  bifunctional proline dehydrogenase/pyrroline...    100   2e-18    
ref|WP_012945274.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_035962155.1|  transcriptional regulator                          100   2e-18    
ref|WP_017755098.1|  betaine-aldehyde dehydrogenase                   99.0    2e-18    
ref|WP_013057072.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_035284980.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_012734189.1|  bifunctional proline dehydrogenase/pyrroline...    100   2e-18    
ref|WP_037691403.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_037507559.1|  transcriptional regulator                          100   2e-18    
ref|WP_038863691.1|  transcriptional regulator                          100   2e-18    
ref|WP_039735107.1|  betaine-aldehyde dehydrogenase                   99.0    2e-18    
ref|WP_032101461.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_028203319.1|  transcriptional regulator                          100   2e-18    
ref|WP_039277729.1|  transcriptional regulator                          100   2e-18    
ref|WP_034201160.1|  transcriptional regulator                          100   2e-18    
ref|WP_006482203.1|  bifunctional proline dehydrogenase/pyrroline...    100   2e-18    
ref|WP_027520229.1|  integrase                                          100   2e-18    
ref|WP_012609111.1|  aldehyde dehydrogenase                           99.0    2e-18    
ref|WP_006496307.1|  bifunctional proline dehydrogenase/pyrroline...    100   2e-18    
gb|EKY24656.1|  putative aldehyde dehydrogenase, thermostable         98.6    2e-18    
ref|WP_026113477.1|  betaine-aldehyde dehydrogenase                   98.6    2e-18    
ref|WP_020979345.1|  delta-1-pyrroline-5-carboxylate dehydrogenase      100   2e-18    
ref|WP_013714300.1|  bifunctional proline dehydrogenase/pyrroline...    100   2e-18    
ref|WP_036122724.1|  MULTISPECIES: aldehyde dehydrogenase             98.6    3e-18    
ref|WP_038154550.1|  transcriptional regulator                          100   3e-18    
ref|WP_035971443.1|  transcriptional regulator                          100   3e-18    
ref|WP_008096947.1|  aldehyde dehydrogenase                           98.6    3e-18    
ref|WP_025977903.1|  aldehyde dehydrogenase                           98.6    3e-18    
ref|WP_010515308.1|  betaine-aldehyde dehydrogenase                   99.0    3e-18    
ref|WP_024342229.1|  integrase                                          100   3e-18    
ref|WP_027788704.1|  transcriptional regulator                          100   3e-18    
ref|WP_029617590.1|  transcriptional regulator                          100   3e-18    
ref|WP_011955597.1|  aldehyde dehydrogenase                           98.6    3e-18    
ref|WP_036771489.1|  transcriptional regulator                          100   3e-18    
ref|WP_023211199.1|  trifunctional transcriptional regulator/prol...    100   3e-18    
gb|EAY67455.1|  Delta 1-pyrroline-5-carboxylate dehydrogenase           100   3e-18    
ref|WP_017772235.1|  bifunctional proline dehydrogenase/pyrroline...    100   3e-18    
gb|KIF98744.1|  Betaine aldehyde dehydrogenase                        98.6    3e-18    
gb|KIA70314.1|  Betaine aldehyde dehydrogenase                        98.6    3e-18    
ref|WP_039535095.1|  transcriptional regulator                          100   3e-18    
ref|WP_036170793.1|  integrase                                        99.8    3e-18    
gb|EFZ97223.1|  trifunctional transcriptional regulator/proline d...  99.0    3e-18    
ref|WP_038880998.1|  transcriptional regulator                          100   3e-18    
gb|KGW26728.1|  delta-1-pyrroline-5-carboxylate dehydrogenase           100   3e-18    
ref|WP_024562067.1|  transcriptional regulator                          100   3e-18    
ref|WP_039345261.1|  transcriptional regulator                          100   3e-18    
ref|WP_012362770.1|  bifunctional proline dehydrogenase/pyrroline...    100   3e-18    
ref|WP_039492882.1|  transcriptional regulator                          100   3e-18    
ref|WP_023221561.1|  trifunctional transcriptional regulator/prol...    100   3e-18    
ref|WP_007561616.1|  bifunctional proline dehydrogenase/pyrroline...  99.8    3e-18    
gb|AIO32700.1|  delta-1-pyrroline-5-carboxylate dehydrogenase         99.8    3e-18    
ref|WP_017639441.1|  bifunctional proline dehydrogenase/pyrroline...  99.8    3e-18    
emb|CDG21688.1|  Bifunctional protein putA [Includes: Proline deh...  99.8    3e-18    
ref|WP_012125160.1|  bifunctional proline dehydrogenase/pyrroline...  99.8    3e-18    
ref|WP_027793059.1|  transcriptional regulator                        99.8    3e-18    
ref|WP_038750190.1|  transcriptional regulator                        99.8    4e-18    
ref|WP_027783173.1|  transcriptional regulator                        99.8    4e-18    
ref|WP_012441170.1|  bifunctional proline dehydrogenase/pyrroline...  99.8    4e-18    
ref|WP_014729166.1|  bifunctional proline dehydrogenase/pyrroline...  99.8    4e-18    
ref|WP_035543547.1|  aldehyde dehydrogenase                           97.1    4e-18    
gb|KIG05029.1|  Betaine aldehyde dehydrogenase                        98.2    4e-18    
ref|WP_027598206.1|  transcriptional regulator                        99.8    4e-18    
ref|WP_026021547.1|  aldehyde dehydrogenase                           98.2    4e-18    
ref|WP_028213219.1|  transcriptional regulator                        99.8    4e-18    
ref|WP_014766885.1|  aldehyde dehydrogenase                           98.2    4e-18    
ref|WP_007898014.1|  Transcriptional repressor of PutA and PutP /...  99.8    4e-18    
ref|WP_039351417.1|  transcriptional regulator                        99.8    4e-18    
ref|WP_004387580.1|  bifunctional proline dehydrogenase/pyrroline...  99.8    4e-18    
ref|WP_032973585.1|  transcriptional regulator                        99.8    4e-18    
ref|WP_032989962.1|  transcriptional regulator                        99.8    4e-18    



>gb|ABR45721.1| P5CDH1 [Actinidia chinensis]
Length=554

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/569 (81%), Positives = 510/569 (90%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+LQ   ++R RA+++A  ++ S   +R                 HSLPFAT+ VE+I+
Sbjct  1     MYRLQVCREMRARASQSAFNWVTSFNPSR---------------FIHSLPFATVKVEEIA  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEVHNLVQG WI SS WNTILDPLNGESFIKVAE+ + E+QPF+ES+ K PKHGLH
Sbjct  46    GSQPAEVHNLVQGKWIGSSKWNTILDPLNGESFIKVAEIDETEIQPFVESLSKVPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGD+S KAAHMLS PEVSDFFTRLIQRVSPKSYQQAL EV+VT+KFLEN
Sbjct  106   NPFKAPERYLMLGDVSVKAAHMLSQPEVSDFFTRLIQRVSPKSYQQALGEVYVTRKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF +PGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FCGDQVRFLARSFAIPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKVCIVMEQMLRLLHDCGLP+EDVDF+NSDGKTMNKLLLEG PRMTLFTGSSRV
Sbjct  226   PVLKVDSKVCIVMEQMLRLLHDCGLPVEDVDFINSDGKTMNKLLLEGNPRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLA DLKGRIKLEDAGFDWKILGPDV++VDY+AWVCDQDAYACSGQKCSAQS+LFMHE
Sbjct  286   ADKLAVDLKGRIKLEDAGFDWKILGPDVEQVDYVAWVCDQDAYACSGQKCSAQSMLFMHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSKS L+  M+ LAARRKL+DLTVGPVLTFTT+AML+HMNKLLQI GSKLLFGGE L+N
Sbjct  346   NWSKSSLLRQMNDLAARRKLEDLTVGPVLTFTTEAMLEHMNKLLQISGSKLLFGGEALKN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIPSIYGAI+PTA+FVPLEE+LKD NY+LVT E+FGPFQI+TEYKD+QLP+VL+ALERM
Sbjct  406   HSIPSIYGAIKPTAIFVPLEELLKDNNYELVTREIFGPFQIITEYKDHQLPMVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAA+VSND LFLQEVIG SVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAIVSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD GPV   W+ P +T
Sbjct  526   AIKLVWSCHREIIYDFGPVPQNWETPAST  554



>ref|XP_006354791.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Solanum tuberosum]
Length=555

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/569 (80%), Positives = 508/569 (89%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+L A+ QL+NRA+ + + ++    +TR NH+               L FAT+  E++S
Sbjct  2     MYRLSAYRQLKNRASSSHLNWITLFNSTRSNHT---------------LSFATVKAEEVS  46

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEVHNLVQG W +SSSWNTILDPLNG+ FIKVAEV ++ELQPF+ES+ KCPKHGLH
Sbjct  47    GSQPAEVHNLVQGKWTKSSSWNTILDPLNGQPFIKVAEVNESELQPFVESLSKCPKHGLH  106

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGD+STKAAH L LPEVSDFF +LIQRVSPKSYQQAL EV VTQKFLEN
Sbjct  107   NPFKAPERYLMLGDVSTKAAHALGLPEVSDFFAKLIQRVSPKSYQQALIEVLVTQKFLEN  166

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVA++ PFNFPLEIP+LQLMGALYMGNK
Sbjct  167   FCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAVIAPFNFPLEIPLLQLMGALYMGNK  226

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKVCIVMEQMLRLLH+CGLP++DVDF+NSDGKTMNKLL+E KPRMTLFTGSSRV
Sbjct  227   PVLKVDSKVCIVMEQMLRLLHECGLPVDDVDFINSDGKTMNKLLVEAKPRMTLFTGSSRV  286

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DL GR+KLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSA+SILFMHE
Sbjct  287   AEKLADDLSGRVKLEDAGFDWKILGPDVNEVDYVAWVCDQDAYACSGQKCSAESILFMHE  346

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSKS LI+ M+ LAARRKLDDLT+GPVLT TT+ MLDH  KLLQIPGS+LLFGGE L+N
Sbjct  347   NWSKSSLIDKMTELAARRKLDDLTIGPVLTVTTETMLDHAKKLLQIPGSRLLFGGEALQN  406

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP IYGAI+PTA+FVPLEEILKDE+Y LVT E+FGPFQ+VTEYKDNQLPLVL+ALE+M
Sbjct  407   HSIPKIYGAIKPTAIFVPLEEILKDEHYPLVTKEIFGPFQVVTEYKDNQLPLVLDALEKM  466

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQ+VIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  467   HAHLTAAVVSNDILFLQKVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  526

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   WK+P +T
Sbjct  527   AIKLVWSCHREIIYDVGPMPLGWKVPAST  555



>ref|XP_004241569.1| PREDICTED: probable aldehyde dehydrogenase [Solanum lycopersicum]
Length=555

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/569 (79%), Positives = 506/569 (89%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+L A+ QL+ RA+ + + ++    + R NH+               L FAT+  E++S
Sbjct  2     MYRLSAYRQLQKRASSSHLNWITLFDSRRSNHT---------------LSFATVKAEEVS  46

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEVHNLVQG W +SSSWNTILDPLNG+ FIKVAEV ++ELQPF+ES+ KCPKHGLH
Sbjct  47    GSQPAEVHNLVQGKWTKSSSWNTILDPLNGQPFIKVAEVNESELQPFVESLSKCPKHGLH  106

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGD+STKAAH L LPEVSDFF +LIQRVSPKSYQQAL EV VTQKFLEN
Sbjct  107   NPFKAPERYLMLGDVSTKAAHALGLPEVSDFFAKLIQRVSPKSYQQALVEVLVTQKFLEN  166

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVA++ PFNFPLEIP+LQLMGALYMGNK
Sbjct  167   FCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAVIAPFNFPLEIPLLQLMGALYMGNK  226

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKVCIVMEQMLRLLH+CGLP++DVDF+NSDGKTMNKLL+E KPRMTLFTGSSRV
Sbjct  227   PVLKVDSKVCIVMEQMLRLLHECGLPVDDVDFINSDGKTMNKLLVEAKPRMTLFTGSSRV  286

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DL GR+KLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSA+SILFMHE
Sbjct  287   AEKLADDLSGRVKLEDAGFDWKILGPDVNEVDYVAWVCDQDAYACSGQKCSAESILFMHE  346

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSKS L++ M+ LAARRKLDDLT+GPVLT TT+ MLDH  KLLQIPGS+LLFGGE L+N
Sbjct  347   NWSKSSLLDKMTELAARRKLDDLTIGPVLTVTTETMLDHAKKLLQIPGSRLLFGGEALQN  406

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP IYGAI+PTA+FVPLEEILKDE+Y LVT E+FGPFQ+VTEYKDNQLPLVL+ALE+M
Sbjct  407   HSIPKIYGAIKPTAIFVPLEEILKDEHYPLVTKEIFGPFQVVTEYKDNQLPLVLDALEKM  466

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQ+VIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  467   HAHLTAAVVSNDILFLQKVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  526

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   WK+P +T
Sbjct  527   AIKLVWSCHREIIYDVGPMPLGWKVPAST  555



>ref|XP_011071616.1| PREDICTED: probable aldehyde dehydrogenase [Sesamum indicum]
Length=555

 Score =   966 bits (2496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/570 (81%), Positives = 507/570 (89%), Gaps = 16/570 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRAT-RTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDI  346
             M  L AF  L+N+ + R ++++  S   +R                 HSLPFAT+N E++
Sbjct  1     MSGLLAFRHLKNKGSQRLSLSWFSSSDFSR---------------FLHSLPFATVNAEEV  45

Query  347   SGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGL  526
             SGS+PAEV NLVQG W RSSSWNTI DPLNGESFIKV+EV +  +QPF+ES+ KCPKHGL
Sbjct  46    SGSKPAEVLNLVQGKWTRSSSWNTIPDPLNGESFIKVSEVDEKGIQPFVESLSKCPKHGL  105

Query  527   HNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLE  706
             HNPFKAPERYLMLGD++TKAAH LSLPEVSDFF +LIQRVSPKSY+QAL EV+VTQKFLE
Sbjct  106   HNPFKAPERYLMLGDVTTKAAHKLSLPEVSDFFAKLIQRVSPKSYEQALGEVYVTQKFLE  165

Query  707   NFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGN  886
             NF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGN
Sbjct  166   NFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGN  225

Query  887   KPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSR  1066
             KP+LKVDSKVCIVMEQMLRLLHDCGLPLEDVDF+NSDGKTMNK+LLEGKPRMTLFTGSSR
Sbjct  226   KPLLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFINSDGKTMNKILLEGKPRMTLFTGSSR  285

Query  1067  VAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
             VAEKLA DLKGRIKLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LFMH
Sbjct  286   VAEKLAVDLKGRIKLEDAGFDWKILGPDVQEEDYVAWVCDQDAYACSGQKCSAQSLLFMH  345

Query  1247  ENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLE  1426
             ENW KS L+N ++SLAARRKLDDLTVGPVLTFTT AMLDHMNKLLQI GSKL+FGGEPL+
Sbjct  346   ENWGKSSLLNKLTSLAARRKLDDLTVGPVLTFTTNAMLDHMNKLLQIKGSKLIFGGEPLQ  405

Query  1427  NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALER  1606
             NHSIP++YGAI+PTAVF+PLEEILK+ NY+LVT E+FGPFQIVTEYK NQ+PLVL+ALER
Sbjct  406   NHSIPAVYGAIKPTAVFIPLEEILKETNYELVTKEIFGPFQIVTEYKHNQIPLVLDALER  465

Query  1607  MDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTP  1786
             M A+LTAAVVSND LF QE+IGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTP
Sbjct  466   MHAHLTAAVVSNDLLFQQEIIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTP  525

Query  1787  EAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             EAIKLVWSCHREIIYD+GPV  +W  P+ T
Sbjct  526   EAIKLVWSCHREIIYDVGPVPKSWTTPKPT  555



>ref|XP_009770629.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Nicotiana sylvestris]
Length=549

 Score =   966 bits (2496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/569 (80%), Positives = 504/569 (89%), Gaps = 20/569 (4%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY++ A+ QL+ R     ++++ S  +TR NH+               LPFAT+  E+IS
Sbjct  1     MYRVAAYRQLKIR-----VSWISSFNSTRSNHT---------------LPFATVKAEEIS  40

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEVHNLVQG W  SSSWNTILDPLNG+ FIKVAEV ++ELQPF+ES+ KCPKHGLH
Sbjct  41    GSQPAEVHNLVQGKWTGSSSWNTILDPLNGQPFIKVAEVDESELQPFVESLSKCPKHGLH  100

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGD+STKAAHML LPEVSDFF +LIQRVSPKSYQQA  EVFVTQKFLEN
Sbjct  101   NPFKAPERYLMLGDVSTKAAHMLGLPEVSDFFAKLIQRVSPKSYQQAHGEVFVTQKFLEN  160

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVA++ PFNFPLEIPVLQ+MGALYMGNK
Sbjct  161   FCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAVIAPFNFPLEIPVLQMMGALYMGNK  220

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKVC+VMEQ LRLLHDCGLP ++VDF+NSDGKTMNKLL+EGKPRMTLFTGSSRV
Sbjct  221   PVLKVDSKVCVVMEQFLRLLHDCGLPADNVDFINSDGKTMNKLLIEGKPRMTLFTGSSRV  280

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DL GR+KLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  281   AEKLADDLSGRVKLEDAGFDWKILGPDVHEVDYVAWVCDQDAYACSGQKCSAQSILFMHE  340

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NW +S L++ M+ LAARRKLDDLT+GPVLT TT+AMLDH  KLLQIPGS+LLFGGE L+N
Sbjct  341   NWGRSSLLDKMTELAARRKLDDLTIGPVLTVTTEAMLDHAKKLLQIPGSRLLFGGEALQN  400

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP+IYGAI+PTA+F+PLEEILK ++Y LVT E+FGPFQ+VTEYKDNQLPLVLNALE+M
Sbjct  401   HSIPAIYGAIKPTAIFIPLEEILKKQHYHLVTKEIFGPFQVVTEYKDNQLPLVLNALEKM  460

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  461   HAHLTAAVVSNDILFLQEVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  520

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHRE+IYD+GPV   WK P +T
Sbjct  521   AIKLVWSCHREVIYDVGPVPLGWKTPAST  549



>ref|XP_009598232.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Nicotiana tomentosiformis]
Length=549

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/569 (79%), Positives = 504/569 (89%), Gaps = 20/569 (4%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY++ A+ QL+NR     ++++ S   TR NH+               LPFAT+  E+IS
Sbjct  1     MYRVAAYRQLKNR-----VSWISSFNFTRSNHT---------------LPFATVKAEEIS  40

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEVHNLVQG W  SSSWNTILDPLNG+ FIKVAEV ++ELQPF+ES+ +CPKHGLH
Sbjct  41    GSQPAEVHNLVQGKWTGSSSWNTILDPLNGQPFIKVAEVDESELQPFVESLSRCPKHGLH  100

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGD+STKAAHML LPEVSDFF +LIQRVSPKSYQQA  EVFVTQKFLEN
Sbjct  101   NPFKAPERYLMLGDVSTKAAHMLGLPEVSDFFAKLIQRVSPKSYQQAHGEVFVTQKFLEN  160

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVA++ PFNFPLEIPVLQ+MGALYMGNK
Sbjct  161   FCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAVIAPFNFPLEIPVLQMMGALYMGNK  220

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKVC+VMEQ LRLLHDCGLP ++VDF+NSDGKTMNKLL+EGKPRMTLFTGSSRV
Sbjct  221   PVLKVDSKVCVVMEQFLRLLHDCGLPADNVDFINSDGKTMNKLLIEGKPRMTLFTGSSRV  280

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DL GR+KLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  281   AEKLADDLSGRVKLEDAGFDWKILGPDVHEVDYVAWVCDQDAYACSGQKCSAQSILFMHE  340

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NW +S L++ M+ L+ARRKLDDLT+GPVLT TT+AMLDH  KLLQIPGS+LLFGGE L+N
Sbjct  341   NWGRSSLLDKMTELSARRKLDDLTIGPVLTVTTEAMLDHAKKLLQIPGSRLLFGGEALQN  400

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP+IYGAI+PTA+F+PLEEILK+++Y LVT E+FGPFQ+VTEYKDNQL LVLNALE+M
Sbjct  401   HSIPAIYGAIKPTAIFIPLEEILKEQHYHLVTKEIFGPFQVVTEYKDNQLLLVLNALEKM  460

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  461   HAHLTAAVVSNDILFLQEVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  520

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHRE+IYD+GPV   WK P +T
Sbjct  521   AIKLVWSCHREVIYDVGPVPLGWKTPAST  549



>ref|XP_008359118.1| PREDICTED: probable aldehyde dehydrogenase [Malus domestica]
Length=554

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/569 (78%), Positives = 500/569 (88%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++    +LR RA +TA+++  SL  +R               + H +PFAT+ VE+IS
Sbjct  1     MNRILVSRELRARAPQTALSWFSSLNLSR---------------SIHGVPFATVEVEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  +  WNTILDPLNGE FI+V EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKNTDRWNTILDPLNGEPFIRVCEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGDIS KA HMLSLP+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLEN
Sbjct  106   NPFKAPERYLMLGDISAKAGHMLSLPKVSDFFTRLIQRVAPKSYQQASGEVYVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FS DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FSADQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKVCIVMEQM+RLLH CGLP EDVDF+NSDGKTMNKLL EG PRMTLFTGSSRV
Sbjct  226   PVLKVDSKVCIVMEQMMRLLHYCGLPTEDVDFINSDGKTMNKLLXEGNPRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLAGDLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LFMHE
Sbjct  286   ADKLAGDLKGRVKLEDAGFDWKILGPDVQEEDYVAWVCDQDAYACSGQKCSAQSMLFMHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ +++ M  LA RR L+DLT+GPVLTFTT+AML+H NKLLQIPGSKLLFGGEPL +
Sbjct  346   NWSKTSILSKMKDLAERRNLEDLTIGPVLTFTTEAMLEHKNKLLQIPGSKLLFGGEPLTD  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP +YGAI+PTAV+VPLEEILK++NY+LVT E+FGPFQIVT+YK++QLPLVL+ALERM
Sbjct  406   HSIPPVYGAIKPTAVYVPLEEILKEKNYELVTREIFGPFQIVTDYKNDQLPLVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   W+ P +T
Sbjct  526   AIKLVWSCHREIIYDVGPLPKQWQTPPST  554



>ref|XP_002273569.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial isoform X1 [Vitis vinifera]
Length=555

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/570 (79%), Positives = 502/570 (88%), Gaps = 16/570 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATR-TAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDI  346
             MY+     ++R R  +  A+ +LGSL  +R               + H+LPFAT+ VE+I
Sbjct  1     MYRFGVCREMRGRVPQIAALNWLGSLSLSR---------------SIHNLPFATIEVEEI  45

Query  347   SGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGL  526
             SGSQPAEV NLVQG W  S+S  TI+DPLNGE FI+VAEV +  +QPF++S+ KCPKHGL
Sbjct  46    SGSQPAEVQNLVQGKWTGSTSGETIVDPLNGEPFIQVAEVDETGIQPFVDSLSKCPKHGL  105

Query  527   HNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLE  706
             HNPFKAPERYLMLGDIS KAAHMLSLP+VSDFFTRLIQRV+PKSYQQAL EV+VTQKFLE
Sbjct  106   HNPFKAPERYLMLGDISNKAAHMLSLPKVSDFFTRLIQRVAPKSYQQALGEVYVTQKFLE  165

Query  707   NFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGN  886
             NFSGDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGN
Sbjct  166   NFSGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGN  225

Query  887   KPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSR  1066
             KP+LKVDSKV IVMEQM+RLLH CGLP+ED+DF+NSDGKTMNKLLLE  PRMTLFTGSSR
Sbjct  226   KPILKVDSKVSIVMEQMIRLLHHCGLPMEDLDFINSDGKTMNKLLLEANPRMTLFTGSSR  285

Query  1067  VAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
             VA+KLA DLKGRIKLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQSI+FMH
Sbjct  286   VADKLAVDLKGRIKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSIVFMH  345

Query  1247  ENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLE  1426
             ENW KS LI+ M  LAARRKL+DLT+GPVL+FTT+AML+HMNKLLQIPGS+LLFGG+ LE
Sbjct  346   ENWFKSSLISRMKDLAARRKLEDLTIGPVLSFTTEAMLEHMNKLLQIPGSELLFGGKALE  405

Query  1427  NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALER  1606
             NHSIP IYGA++PTA+++PLEE+LKD NY+LVT E+FGPFQ+VT+YKDNQLP VL ALER
Sbjct  406   NHSIPPIYGALKPTAIYIPLEEMLKDGNYELVTREIFGPFQVVTDYKDNQLPRVLEALER  465

Query  1607  MDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTP  1786
             M A+LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTP
Sbjct  466   MHAHLTAAVVSNDSLFLQEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTP  525

Query  1787  EAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             EAIKLVWSCHREIIYDIGP+   W++P AT
Sbjct  526   EAIKLVWSCHREIIYDIGPLPSHWEIPPAT  555



>gb|ACL13550.1| delta-1-pyrroline-5-carboxylate dehydrogenase 1 protein [Malus 
domestica]
Length=554

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/569 (79%), Positives = 500/569 (88%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++    QLR RA +TA+++  SL  +R               + H +PFAT+ VE+IS
Sbjct  1     MNRILVSRQLRARAPQTALSWFTSLNISR---------------SIHGVPFATVEVEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  ++ WNTILDPLNGE FI+V EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKNTNRWNTILDPLNGEPFIRVCEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGDIS KA HMLSLP+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLEN
Sbjct  106   NPFKAPERYLMLGDISAKAGHMLSLPKVSDFFTRLIQRVAPKSYQQASGEVYVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FS DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FSSDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDG+TMNKLLLEG PRMTLFTGSSRV
Sbjct  226   PVLKVDSKVGIVMEQMMRLLHYCGLPTEDVDFINSDGQTMNKLLLEGNPRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLAGDLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LF+HE
Sbjct  286   ADKLAGDLKGRVKLEDAGFDWKILGPDVHEEDYVAWVCDQDAYACSGQKCSAQSMLFIHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ M  LA RR L+DLT+GPVLTFTT+AML+H NKLLQIPGSK+LFGGEPL N
Sbjct  346   NWSKTSLLSKMKDLAERRNLEDLTIGPVLTFTTEAMLEHKNKLLQIPGSKVLFGGEPLTN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP +YGAI PTA+FVPLEEILKD+NY+LVT E+FGPFQIVT+YK++QLPLVL+ALERM
Sbjct  406   HSIPPVYGAIEPTAIFVPLEEILKDKNYELVTREIFGPFQIVTDYKNDQLPLVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GPV   W+ P +T
Sbjct  526   AIKLVWSCHREIIYDVGPVPKQWQTPPST  554



>gb|ACL13549.1| delta-1-pyrroline-5-carboxylate dehydrogenase protein [Malus 
domestica]
Length=554

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/569 (78%), Positives = 499/569 (88%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++    QLR RA +TA+++  SL  +R               + H +PFAT+ VE+IS
Sbjct  1     MNRILVSRQLRARAPQTALSWFTSLNISR---------------SIHGVPFATVEVEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  ++ WNTILDPLNGE FI+V EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKNTNRWNTILDPLNGEPFIRVCEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGDIS KA HMLSLP+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLEN
Sbjct  106   NPFKAPERYLMLGDISAKAGHMLSLPKVSDFFTRLIQRVAPKSYQQASGEVYVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FS DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FSSDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDG+TMNKLLLEG PRMTLFTGSSRV
Sbjct  226   PVLKVDSKVSIVMEQMMRLLHYCGLPTEDVDFINSDGQTMNKLLLEGNPRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLAGDLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LF+HE
Sbjct  286   ADKLAGDLKGRVKLEDAGFDWKILGPDVHEEDYVAWVCDQDAYACSGQKCSAQSMLFIHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ M  LA RR L+DLT+GPVLTFTT+AML+H NKLLQIPGSK+LFGGEPL N
Sbjct  346   NWSKTSLLSKMKDLAERRNLEDLTIGPVLTFTTEAMLEHKNKLLQIPGSKVLFGGEPLTN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP +YGAI PTA+FVPLEEILKD+NY+LVT E+FGPFQIVT+YK++QLPLVL+ALERM
Sbjct  406   HSIPPVYGAIEPTAIFVPLEEILKDKNYELVTREIFGPFQIVTDYKNDQLPLVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGA IGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGASIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GPV   W+ P +T
Sbjct  526   AIKLVWSCHREIIYDVGPVPKQWQTPPST  554



>ref|XP_008356611.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Malus domestica]
Length=554

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/569 (78%), Positives = 499/569 (88%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++    QLR RA +TA+++  SL  +R               + H +PFAT+ VE+IS
Sbjct  1     MNRILVSRQLRARAPQTALSWFTSLNISR---------------SIHGVPFATVEVEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  ++ WNTILDPLNGE FI+V EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKNTNRWNTILDPLNGEPFIRVCEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGDIS KA HMLSLP+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLEN
Sbjct  106   NPFKAPERYLMLGDISAKAGHMLSLPKVSDFFTRLIQRVAPKSYQQASGEVYVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FS DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FSSDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDG+TMNKLLLEG P MTLFTGSSRV
Sbjct  226   PVLKVDSKVSIVMEQMMRLLHYCGLPTEDVDFINSDGQTMNKLLLEGNPXMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLAGDLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LF+HE
Sbjct  286   ADKLAGDLKGRVKLEDAGFDWKILGPDVHEEDYVAWVCDQDAYACSGQKCSAQSMLFIHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ M  LA RR L+DLT+GPVLTFTT+AML+H NKLLQIPGSK+LFGGEPL N
Sbjct  346   NWSKTSLLSKMKDLAERRNLEDLTIGPVLTFTTEAMLEHKNKLLQIPGSKVLFGGEPLTN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP +YGAI PTA+FVPLEEILKD+NY+LVT E+FGPFQIVT+YK++QLPLVL+ALERM
Sbjct  406   HSIPPVYGAIEPTAIFVPLEEILKDKNYELVTREIFGPFQIVTDYKNDQLPLVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GPV   W+ P +T
Sbjct  526   AIKLVWSCHREIIYDVGPVPKQWQTPPST  554



>emb|CBI15259.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/561 (80%), Positives = 498/561 (89%), Gaps = 16/561 (3%)
 Frame = +2

Query  197   LRNRATR-TAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVH  373
             +R R  +  A+ +LGSL  +R               + H+LPFAT+ VE+ISGSQPAEV 
Sbjct  1     MRGRVPQIAALNWLGSLSLSR---------------SIHNLPFATIEVEEISGSQPAEVQ  45

Query  374   NLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPER  553
             NLVQG W  S+S  TI+DPLNGE FI+VAEV +  +QPF++S+ KCPKHGLHNPFKAPER
Sbjct  46    NLVQGKWTGSTSGETIVDPLNGEPFIQVAEVDETGIQPFVDSLSKCPKHGLHNPFKAPER  105

Query  554   YLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRF  733
             YLMLGDIS KAAHMLSLP+VSDFFTRLIQRV+PKSYQQAL EV+VTQKFLENFSGDQVRF
Sbjct  106   YLMLGDISNKAAHMLSLPKVSDFFTRLIQRVAPKSYQQALGEVYVTQKFLENFSGDQVRF  165

Query  734   LARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSK  913
             LARSF VPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP+LKVDSK
Sbjct  166   LARSFAVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPILKVDSK  225

Query  914   VCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDL  1093
             V IVMEQM+RLLH CGLP+ED+DF+NSDGKTMNKLLLE  PRMTLFTGSSRVA+KLA DL
Sbjct  226   VSIVMEQMIRLLHHCGLPMEDLDFINSDGKTMNKLLLEANPRMTLFTGSSRVADKLAVDL  285

Query  1094  KGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLI  1273
             KGRIKLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQSI+FMHENW KS LI
Sbjct  286   KGRIKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSIVFMHENWFKSSLI  345

Query  1274  NLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYG  1453
             + M  LAARRKL+DLT+GPVL+FTT+AML+HMNKLLQIPGS+LLFGG+ LENHSIP IYG
Sbjct  346   SRMKDLAARRKLEDLTIGPVLSFTTEAMLEHMNKLLQIPGSELLFGGKALENHSIPPIYG  405

Query  1454  AIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAV  1633
             A++PTA+++PLEE+LKD NY+LVT E+FGPFQ+VT+YKDNQLP VL ALERM A+LTAAV
Sbjct  406   ALKPTAIYIPLEEMLKDGNYELVTREIFGPFQVVTDYKDNQLPRVLEALERMHAHLTAAV  465

Query  1634  VSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  1813
             VSND LFLQEVIG SVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC
Sbjct  466   VSNDSLFLQEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  525

Query  1814  HREIIYDIGPVSPAWKLPQAT  1876
             HREIIYDIGP+   W++P AT
Sbjct  526   HREIIYDIGPLPSHWEIPPAT  546



>ref|XP_009369345.1| PREDICTED: probable aldehyde dehydrogenase [Pyrus x bretschneideri]
Length=554

 Score =   938 bits (2424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/569 (78%), Positives = 498/569 (88%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++    QLR RA +TA+++  SL  +R               + H +PFAT+ VE+IS
Sbjct  1     MNRILVSRQLRARAPQTALSWFTSLNISR---------------SIHGVPFATVEVEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  ++ WNTILDPLNGE FI+V EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKNTNRWNTILDPLNGEPFIRVCEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLMLGDIS KA HMLSLP+VSDFFTRLIQRV+PKSY QA  EV+VTQKFLEN
Sbjct  106   NPFKAPERYLMLGDISAKAGHMLSLPKVSDFFTRLIQRVAPKSYHQASGEVYVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FS DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FSSDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDG+ MNKLLLEG PRMTLFTGSSRV
Sbjct  226   PVLKVDSKVSIVMEQMMRLLHYCGLPTEDVDFINSDGQAMNKLLLEGNPRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLAGDLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LF+HE
Sbjct  286   ADKLAGDLKGRVKLEDAGFDWKILGPDVHEEDYVAWVCDQDAYACSGQKCSAQSMLFIHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ M  LA RR L+DLT+GPVLTFTT+AML+H NKLLQIPGSK+LFGGEPL N
Sbjct  346   NWSKTSLLSKMKDLAERRNLEDLTIGPVLTFTTEAMLEHKNKLLQIPGSKVLFGGEPLTN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP +YGAI PTA+FVPLEEILKD+NY+LVT E+FGPFQ+VT+YK++QLPLVL+ALERM
Sbjct  406   HSIPPVYGAIEPTAIFVPLEEILKDKNYELVTREIFGPFQVVTDYKNDQLPLVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   W+ P +T
Sbjct  526   AIKLVWSCHREIIYDVGPLPKQWQTPPST  554



>ref|XP_010663395.1| PREDICTED: probable aldehyde dehydrogenase isoform X2 [Vitis 
vinifera]
Length=533

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/527 (83%), Positives = 486/527 (92%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
              R+ H+LPFAT+ VE+ISGSQPAEV NLVQG W  S+S  TI+DPLNGE FI+VAEV + 
Sbjct  7     VRSIHNLPFATIEVEEISGSQPAEVQNLVQGKWTGSTSGETIVDPLNGEPFIQVAEVDET  66

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF++S+ KCPKHGLHNPFKAPERYLMLGDIS KAAHMLSLP+VSDFFTRLIQRV+PK
Sbjct  67    GIQPFVDSLSKCPKHGLHNPFKAPERYLMLGDISNKAAHMLSLPKVSDFFTRLIQRVAPK  126

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL EV+VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAIVTPFNF
Sbjct  127   SYQQALGEVYVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIVTPFNF  186

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+ED+DF+NSDGKTMNK
Sbjct  187   PLEIPVLQLMGALYMGNKPILKVDSKVSIVMEQMIRLLHHCGLPMEDLDFINSDGKTMNK  246

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  PRMTLFTGSSRVA+KLA DLKGRIKLEDAGFDWKILGPDV EVDY+AWVCDQDA
Sbjct  247   LLLEANPRMTLFTGSSRVADKLAVDLKGRIKLEDAGFDWKILGPDVQEVDYVAWVCDQDA  306

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSI+FMHENW KS LI+ M  LAARRKL+DLT+GPVL+FTT+AML+HMNK
Sbjct  307   YACSGQKCSAQSIVFMHENWFKSSLISRMKDLAARRKLEDLTIGPVLSFTTEAMLEHMNK  366

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LLQIPGS+LLFGG+ LENHSIP IYGA++PTA+++PLEE+LKD NY+LVT E+FGPFQ+V
Sbjct  367   LLQIPGSELLFGGKALENHSIPPIYGALKPTAIYIPLEEMLKDGNYELVTREIFGPFQVV  426

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+YKDNQLP VL ALERM A+LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQN
Sbjct  427   TDYKDNQLPRVLEALERMHAHLTAAVVSNDSLFLQEVIGKSVNGTTYAGLRARTTGAPQN  486

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W++P AT
Sbjct  487   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPSHWEIPPAT  533



>ref|XP_011047156.1| PREDICTED: probable aldehyde dehydrogenase [Populus euphratica]
Length=551

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/527 (83%), Positives = 485/527 (92%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R+ HSLPFAT++ E ISGSQPA+VHNLVQG WI SS+WNTI+DPLNGE FIK+AEV + 
Sbjct  25    SRSVHSLPFATVDAEGISGSQPAKVHNLVQGKWIGSSTWNTIVDPLNGEPFIKIAEVDET  84

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF+ES+ KCPKHGLHNPFK+PERYL+ GDI+ KAA MLS+P+VSDFFTRLIQRV+PK
Sbjct  85    GTQPFVESLSKCPKHGLHNPFKSPERYLLYGDITAKAARMLSVPKVSDFFTRLIQRVAPK  144

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  145   SYQQALGEVQVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  204

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKP+LKVDSKVCIVMEQM+RLLH CG+P  DVDF+NSDGKTMNK
Sbjct  205   PLEIPVLQLMGALYMGNKPILKVDSKVCIVMEQMIRLLHHCGMPSSDVDFINSDGKTMNK  264

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  P+MTLFTGSS+VAEKLA DLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA
Sbjct  265   LLLEANPQMTLFTGSSKVAEKLAVDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  324

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSILFMHENWS + LI+ M  LA RRKL+DLT+GPVLT TT+AMLDHMNK
Sbjct  325   YACSGQKCSAQSILFMHENWSATSLISKMKDLAERRKLEDLTIGPVLTLTTEAMLDHMNK  384

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LLQIPGSKLLFGG+PLENHSIPSIYGA++PTAV+VPLEEIL+ +NY+LVT E+FGPFQ++
Sbjct  385   LLQIPGSKLLFGGKPLENHSIPSIYGALKPTAVYVPLEEILRAKNYELVTREIFGPFQVI  444

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYK +QLP+VL+AL RM A+LTAAVVSND LFLQEVIG +VNGTTYAG+RARTTGAPQN
Sbjct  445   TEYKKDQLPMVLDALVRMHAHLTAAVVSNDVLFLQEVIGKTVNGTTYAGLRARTTGAPQN  504

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GP+   W++P +T
Sbjct  505   HWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDFGPLPKLWEIPPST  551



>ref|XP_010029083.1| PREDICTED: probable aldehyde dehydrogenase isoform X1 [Eucalyptus 
grandis]
 gb|KCW83536.1| hypothetical protein EUGRSUZ_B00436 [Eucalyptus grandis]
Length=556

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/545 (81%), Positives = 490/545 (90%), Gaps = 0/545 (0%)
 Frame = +2

Query  242   LGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTI  421
             +G  R   S   +   + +R+ HSLPFAT+N E+ISGS+PAEV N VQGNW +S + N I
Sbjct  12    IGGPRNGRSWLSSFHHLSSRSLHSLPFATVNAEEISGSRPAEVENFVQGNWTKSKNSNEI  71

Query  422   LDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLS  601
             LDPLNGE FIKVAEV + E+QPF+ES+ KCPKHGLHNPFKAPERYL+ GDIS KAAHML+
Sbjct  72    LDPLNGEPFIKVAEVDETEIQPFVESLSKCPKHGLHNPFKAPERYLLYGDISAKAAHMLA  131

Query  602   LPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQS  781
              P+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLENFSGDQVRFLARSFGVPGNHLGQQS
Sbjct  132   QPKVSDFFTRLIQRVAPKSYQQAFGEVYVTQKFLENFSGDQVRFLARSFGVPGNHLGQQS  191

Query  782   HGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCG  961
             HGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPV+KVDSKV IVMEQM+RLLH CG
Sbjct  192   HGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVVKVDSKVSIVMEQMMRLLHHCG  251

Query  962   LPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKIL  1141
             LP+EDVDF+NSDGKTMN+LLLE  PRMTLFTGSSRVAEKLA DLKG+IKLEDAGFDWK+L
Sbjct  252   LPVEDVDFINSDGKTMNRLLLEANPRMTLFTGSSRVAEKLATDLKGQIKLEDAGFDWKVL  311

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLT  1321
             GPDV EVDY+AWVCDQDAYACSGQKCSAQSILFMHENWSKS LI+ M +LA RRKL+DLT
Sbjct  312   GPDVQEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWSKSSLISKMRNLAERRKLEDLT  371

Query  1322  VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILK  1501
             +GPVLTFTT  MLDHM+ LL IPGSKLLFGGEPLENHSIP IYGA++PTAV+VP++EILK
Sbjct  372   IGPVLTFTTGQMLDHMSSLLCIPGSKLLFGGEPLENHSIPHIYGALKPTAVYVPIDEILK  431

Query  1502  DENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSV  1681
             +EN++LVT E+FGPFQIVTEYKD+QLP +L+ALERM A+LTAAVVSND LFLQEVIG +V
Sbjct  432   EENFELVTREIFGPFQIVTEYKDDQLPKILDALERMHAHLTAAVVSNDPLFLQEVIGKTV  491

Query  1682  NGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWK  1861
             NGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GP+   W+
Sbjct  492   NGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDFGPLPKHWE  551

Query  1862  LPQAT  1876
             +P  T
Sbjct  552   VPPPT  556



>ref|XP_006476644.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like isoform X1 [Citrus sinensis]
Length=553

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/529 (82%), Positives = 490/529 (93%), Gaps = 0/529 (0%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
             + +R++H+LPFATL  ++ISGS+P EV+NLVQG W  SS+W+T+LDPLNGE FI++AEV 
Sbjct  25    LSSRSAHTLPFATLEADEISGSKPGEVYNLVQGKWTGSSNWSTLLDPLNGEQFIRIAEVG  84

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
             + E+QPF+ES+ KCPKHGLHNPFK+PERYL+ GDISTKAAHMLSLP+VS+FFTRLIQRVS
Sbjct  85    EKEIQPFVESLSKCPKHGLHNPFKSPERYLLYGDISTKAAHMLSLPKVSNFFTRLIQRVS  144

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSYQQAL EV VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPF
Sbjct  145   PKSYQQALGEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPF  204

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIPVLQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTM
Sbjct  205   NFPLEIPVLQLMGALYMGNKPILKVDSKVSIVMEQMMRLLHYCGLPVEDVDFINSDGKTM  264

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             NKLL+E  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY++WVCDQ
Sbjct  265   NKLLMEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVNEVDYVSWVCDQ  324

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQS+LFMHENWS + L++ M  LA RRKL+DLTVGPVLTFTT+AML+HM
Sbjct  325   DAYACSGQKCSAQSVLFMHENWSSTSLLSKMKDLADRRKLEDLTVGPVLTFTTEAMLEHM  384

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
             NKLL++PGSKLLFGGE L+NHSIPSIYGA++PTA+FVPLEEILKD NY+LVT E+FGPFQ
Sbjct  385   NKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAIFVPLEEILKDGNYELVTREIFGPFQ  444

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             IVTEYK +QLPLVLNALERM A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAP
Sbjct  445   IVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAP  504

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGP+GDPRGAGIGTPEAIKLVWS HREIIYD GP+   W++P +T
Sbjct  505   QNHWFGPSGDPRGAGIGTPEAIKLVWSSHREIIYDYGPIPGNWEIPPST  553



>gb|KDP31218.1| hypothetical protein JCGZ_11594 [Jatropha curcas]
Length=551

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/569 (78%), Positives = 499/569 (88%), Gaps = 18/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+L     LR   T+  I++L S   +R                 HSLPFAT+ VE+IS
Sbjct  1     MYRLVGCRGLR---TQKGISWLSSFNLSR---------------TVHSLPFATVEVEEIS  42

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEVHNLVQG WI SS WNTI+DPLNGE FIKVA+V + E++PF+ES+ KCPKHGLH
Sbjct  43    GSQPAEVHNLVQGKWIGSSRWNTIVDPLNGEPFIKVADVDETEIKPFVESLSKCPKHGLH  102

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFK+PERYL+ GDIS KA HMLSLP+VS+FFTRLIQRV+PKSYQQAL EV VTQKFL+N
Sbjct  103   NPFKSPERYLLYGDISAKAGHMLSLPKVSNFFTRLIQRVAPKSYQQALGEVQVTQKFLQN  162

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FSGDQVRFLARSF +PGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  163   FSGDQVRFLARSFAIPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  222

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVD KVCIVMEQM+RLLH CGLP EDVDF+NSDGKTMNKLL+E  PRMTLFTGSSRV
Sbjct  223   PVLKVDDKVCIVMEQMMRLLHYCGLPEEDVDFINSDGKTMNKLLVEANPRMTLFTGSSRV  282

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLA DLKG IKLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  283   ADKLAVDLKGCIKLEDAGFDWKILGPDVNEVDYVAWVCDQDAYACSGQKCSAQSILFMHE  342

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWS + LI+ M  LA RRKL+DLT+GPVLTFTT+AM++HM+KLL++PGSKLLFGG+PLEN
Sbjct  343   NWSGTSLISKMKDLAERRKLEDLTIGPVLTFTTEAMVEHMHKLLKLPGSKLLFGGKPLEN  402

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIPSIYGA++PTAV+VP+EEILK+ NY+LVT E+FGPFQIVT+YK +QLPLVL ALERM
Sbjct  403   HSIPSIYGALQPTAVYVPIEEILKETNYELVTREIFGPFQIVTDYKKDQLPLVLEALERM  462

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  463   HAHLTAAVVSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  522

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD GP+   W++P +T
Sbjct  523   AIKLVWSCHREIIYDFGPLPKHWEIPPST  551



>ref|XP_006476645.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like isoform X2 [Citrus sinensis]
Length=552

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/527 (82%), Positives = 489/527 (93%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R++H+LPFATL  ++ISGS+P EV+NLVQG W  SS+W+T+LDPLNGE FI++AEV + 
Sbjct  26    SRSAHTLPFATLEADEISGSKPGEVYNLVQGKWTGSSNWSTLLDPLNGEQFIRIAEVGEK  85

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E+QPF+ES+ KCPKHGLHNPFK+PERYL+ GDISTKAAHMLSLP+VS+FFTRLIQRVSPK
Sbjct  86    EIQPFVESLSKCPKHGLHNPFKSPERYLLYGDISTKAAHMLSLPKVSNFFTRLIQRVSPK  145

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL EV VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNF
Sbjct  146   SYQQALGEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNF  205

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK
Sbjct  206   PLEIPVLQLMGALYMGNKPILKVDSKVSIVMEQMMRLLHYCGLPVEDVDFINSDGKTMNK  265

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL+E  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY++WVCDQDA
Sbjct  266   LLMEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVNEVDYVSWVCDQDA  325

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWS + L++ M  LA RRKL+DLTVGPVLTFTT+AML+HMNK
Sbjct  326   YACSGQKCSAQSVLFMHENWSSTSLLSKMKDLADRRKLEDLTVGPVLTFTTEAMLEHMNK  385

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL++PGSKLLFGGE L+NHSIPSIYGA++PTA+FVPLEEILKD NY+LVT E+FGPFQIV
Sbjct  386   LLKVPGSKLLFGGEELKNHSIPSIYGALKPTAIFVPLEEILKDGNYELVTREIFGPFQIV  445

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYK +QLPLVLNALERM A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQN
Sbjct  446   TEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQN  505

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGP+GDPRGAGIGTPEAIKLVWS HREIIYD GP+   W++P +T
Sbjct  506   HWFGPSGDPRGAGIGTPEAIKLVWSSHREIIYDYGPIPGNWEIPPST  552



>ref|XP_006439643.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
 gb|ESR52883.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
Length=552

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/527 (82%), Positives = 490/527 (93%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R++H+LPFATL  ++ISGS+P EV+NLVQG W  SS+W+T+LDPLNGE FI++AEV + 
Sbjct  26    SRSAHTLPFATLEADEISGSKPGEVYNLVQGKWTGSSNWSTLLDPLNGEQFIRIAEVGEK  85

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E+QP++ES+ KCPKHGLHNPFK+PERYL+ GDISTKAAHMLSLP+VS+FFTRLIQRVSPK
Sbjct  86    EIQPYVESLSKCPKHGLHNPFKSPERYLLYGDISTKAAHMLSLPKVSNFFTRLIQRVSPK  145

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL+EV VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNF
Sbjct  146   SYQQALSEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNF  205

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK
Sbjct  206   PLEIPLLQLMGALYMGNKPILKVDSKVSIVMEQMIRLLHYCGLPVEDVDFINSDGKTMNK  265

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL+E  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY++WVCDQDA
Sbjct  266   LLMEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVNEVDYVSWVCDQDA  325

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWS + L++ M  LA RRKL+DLTVGPVLTFTT+AML+HMNK
Sbjct  326   YACSGQKCSAQSVLFMHENWSSTSLLSKMKDLADRRKLEDLTVGPVLTFTTEAMLEHMNK  385

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+FGPFQIV
Sbjct  386   LLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIV  445

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYK +QLPLVLNALERM A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQN
Sbjct  446   TEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQN  505

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGP+GDPRGAGIGTPEAIKLVWS HREIIYD GPV   W++P +T
Sbjct  506   HWFGPSGDPRGAGIGTPEAIKLVWSSHREIIYDYGPVPGNWEIPPST  552



>ref|XP_010029092.1| PREDICTED: probable aldehyde dehydrogenase isoform X2 [Eucalyptus 
grandis]
 gb|KCW83535.1| hypothetical protein EUGRSUZ_B00436 [Eucalyptus grandis]
Length=555

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/527 (83%), Positives = 484/527 (92%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R+ HSLPFAT+N E+ISGS+PAEV N VQGNW +S + N ILDPLNGE FIKVAEV + 
Sbjct  29    SRSLHSLPFATVNAEEISGSRPAEVENFVQGNWTKSKNSNEILDPLNGEPFIKVAEVDET  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E+QPF+ES+ KCPKHGLHNPFKAPERYL+ GDIS KAAHML+ P+VSDFFTRLIQRV+PK
Sbjct  89    EIQPFVESLSKCPKHGLHNPFKAPERYLLYGDISAKAAHMLAQPKVSDFFTRLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EV+VTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  149   SYQQAFGEVYVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPV+KVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMN+
Sbjct  209   PLEIPVLQLMGALYMGNKPVVKVDSKVSIVMEQMMRLLHHCGLPVEDVDFINSDGKTMNR  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  PRMTLFTGSSRVAEKLA DLKG+IKLEDAGFDWK+LGPDV EVDY+AWVCDQDA
Sbjct  269   LLLEANPRMTLFTGSSRVAEKLATDLKGQIKLEDAGFDWKVLGPDVQEVDYVAWVCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSILFMHENWSKS LI+ M +LA RRKL+DLT+GPVLTFTT  MLDHM+ 
Sbjct  329   YACSGQKCSAQSILFMHENWSKSSLISKMRNLAERRKLEDLTIGPVLTFTTGQMLDHMSS  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL IPGSKLLFGGEPLENHSIP IYGA++PTAV+VP++EILK+EN++LVT E+FGPFQIV
Sbjct  389   LLCIPGSKLLFGGEPLENHSIPHIYGALKPTAVYVPIDEILKEENFELVTREIFGPFQIV  448

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYKD+QLP +L+ALERM A+LTAAVVSND LFLQEVIG +VNGTTYAG+RARTTGAPQN
Sbjct  449   TEYKDDQLPKILDALERMHAHLTAAVVSNDPLFLQEVIGKTVNGTTYAGLRARTTGAPQN  508

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GP+   W++P  T
Sbjct  509   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDFGPLPKHWEVPPPT  555



>ref|XP_008239830.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Prunus mume]
Length=554

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/569 (77%), Positives = 496/569 (87%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++ A  +LR RA +TA+++  SL  +R               + H LPFAT+  E+IS
Sbjct  1     MNRILACRELRARAPQTALSWFSSLNISR---------------SVHGLPFATVEAEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W +++ WNTILDPLNGE FIKV EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKKTARWNTILDPLNGEPFIKVCEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLM GDIS KAAHMLSLP+VSDFFTRLIQRV+PKSYQQA  EV+VT+KFLEN
Sbjct  106   NPFKAPERYLMFGDISAKAAHMLSLPKVSDFFTRLIQRVAPKSYQQASGEVYVTRKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F+GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FAGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             P+LKVDSKV IVMEQM+RLLH CGLP+EDV+F+NSDGKTMNKLLLE   RMTLFTGSSRV
Sbjct  226   PILKVDSKVSIVMEQMMRLLHYCGLPIEDVEFINSDGKTMNKLLLEANTRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LF+HE
Sbjct  286   AEKLALDLKGRVKLEDAGFDWKILGPDVQEEDYVAWVCDQDAYACSGQKCSAQSMLFIHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ M  LA RR L+DLT+GPVLT TT+ ML+H NKLLQI GSKLLFGGEPL+N
Sbjct  346   NWSKTSLLSKMKDLAERRNLEDLTIGPVLTVTTETMLEHKNKLLQISGSKLLFGGEPLKN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP IYGAI PTA++VPLEEILK  N+DLVT E+FGPFQ+VT+Y+ +QLPLVL+A+ERM
Sbjct  406   HSIPPIYGAIEPTAIYVPLEEILKGNNFDLVTREIFGPFQVVTDYRSDQLPLVLDAVERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   W++P +T
Sbjct  526   AIKLVWSCHREIIYDVGPLPKQWEIPPST  554



>sp|Q40255.1|ALDH_LINUS RecName: Full=Probable aldehyde dehydrogenase; AltName: Full=Flax-inducible 
sequence 1 [Linum usitatissimum]
 emb|CAA60412.1| fis1 [Linum usitatissimum]
Length=551

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/526 (82%), Positives = 487/526 (93%), Gaps = 0/526 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R SHSLPFAT++ E++SG++PAEV NLVQGNW  SSSW+T++DPLNGE FIKVAEV + E
Sbjct  26    RFSHSLPFATVDAEELSGAKPAEVLNLVQGNWGGSSSWHTVVDPLNGEPFIKVAEVDETE  85

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             ++PF+ES+ KCPKHGLHNPFK+PERYL+ GDISTKA HMLS+P+VS+FF RLIQRV+PKS
Sbjct  86    IKPFVESLSKCPKHGLHNPFKSPERYLLYGDISTKAGHMLSIPKVSEFFARLIQRVAPKS  145

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             Y QAL EV VTQKF ENF+GDQVRFLARSFGVPGNHLGQQS+GFRWP+GPVAI+TPFNFP
Sbjct  146   YHQALGEVQVTQKFFENFTGDQVRFLARSFGVPGNHLGQQSNGFRWPFGPVAIITPFNFP  205

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+ D DF+NSDGK MNK+
Sbjct  206   LEIPVLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPVGDADFVNSDGKAMNKI  265

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             LLE  PRMTLFTGSSRVAEKLA DLKGRIKLEDAGFDWKILGPDV+E DY+AWVCDQDAY
Sbjct  266   LLEANPRMTLFTGSSRVAEKLALDLKGRIKLEDAGFDWKILGPDVNEADYVAWVCDQDAY  325

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILFMHENW+ +PLI+ +  LA RRKL+DLTVGPVLT TT+AMLDH+NKL
Sbjct  326   ACSGQKCSAQSILFMHENWAATPLISRLKELAERRKLEDLTVGPVLTVTTEAMLDHLNKL  385

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             LQIPG+KLLFGG+PLENH+IPSIYGA++PTAV+VPLEEILK  NY+LVT E+FGPFQ+VT
Sbjct  386   LQIPGAKLLFGGKPLENHTIPSIYGAVKPTAVYVPLEEILKVSNYELVTKEIFGPFQVVT  445

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             EYK++QLP+VL ALERM A+LTAAVVSNDQLFLQEVIGN+VNGTTYAG+RARTTGAPQNH
Sbjct  446   EYKNSQLPMVLEALERMHAHLTAAVVSNDQLFLQEVIGNTVNGTTYAGLRARTTGAPQNH  505

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVS  W++P +T
Sbjct  506   WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSHHWEIPPST  551



>ref|XP_007209859.1| hypothetical protein PRUPE_ppa003713mg [Prunus persica]
 gb|EMJ11058.1| hypothetical protein PRUPE_ppa003713mg [Prunus persica]
Length=554

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/569 (77%), Positives = 496/569 (87%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M ++ A  +LR RA +TA+++  SL  +R               + H LPFAT+  E+IS
Sbjct  1     MNRILACRELRARAPQTALSWFSSLNISR---------------SVHGLPFATVEAEEIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W +++ WNTILDPLNGE FIKV+EV +  +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVLNLVQGKWKKTARWNTILDPLNGEPFIKVSEVDETGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYLM GDIS KAAHMLSLP+V DFFTRLIQRV+PKSYQQA  EV+VT+KFLEN
Sbjct  106   NPFKAPERYLMFGDISAKAAHMLSLPKVFDFFTRLIQRVAPKSYQQASGEVYVTRKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F+GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FAGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             P+LKVDSKV IVMEQM+RLLH CGLP+EDV+F+NSDGKTMNKLLLE   RMTLFTGSSRV
Sbjct  226   PILKVDSKVSIVMEQMMRLLHYCGLPIEDVEFINSDGKTMNKLLLEANTRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DLKGR+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQS+LF+HE
Sbjct  286   AEKLALDLKGRVKLEDAGFDWKILGPDVQEEDYVAWVCDQDAYACSGQKCSAQSMLFIHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ M  LA RR L+DLT+GPVLT TT+ ML+H NKLLQI GSKLLFGGEPL+N
Sbjct  346   NWSKTSLLSKMKDLAERRNLEDLTIGPVLTVTTETMLEHKNKLLQISGSKLLFGGEPLKN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP IYGAI PTA++VPLEEILK  N+DLVT E+FGPFQ+VT+Y+ +QLPLVL+A+ERM
Sbjct  406   HSIPPIYGAIEPTAIYVPLEEILKGNNFDLVTREIFGPFQVVTDYRSDQLPLVLDAVERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPLFLQEVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   W++P +T
Sbjct  526   AIKLVWSCHREIIYDVGPLPKQWEIPPST  554



>ref|XP_010678575.1| PREDICTED: probable aldehyde dehydrogenase [Beta vulgaris subsp. 
vulgaris]
Length=554

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/569 (77%), Positives = 498/569 (88%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY++    ++R    + AI++ GS   +R      Y +         S+PFAT+  E I 
Sbjct  1     MYRIGLGREMRAIVPKKAISWFGSCNISR------YMS---------SIPFATVEAEKIC  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
              SQPAEVHNLVQG WI+SSSW+ ++DPLNGE FIKVAEV  +E++PF++S+ KCPKHGLH
Sbjct  46    CSQPAEVHNLVQGKWIQSSSWSRVVDPLNGEPFIKVAEVDKSEIKPFVDSLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFK+PERYL+ GDISTKAAHML  P+VSDFF RLIQRVSPKSYQQAL EV VTQKFLEN
Sbjct  106   NPFKSPERYLLYGDISTKAAHMLLQPQVSDFFARLIQRVSPKSYQQALGEVSVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FSGDQVRFLARSF +PGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIP+LQLMGALYMGNK
Sbjct  166   FSGDQVRFLARSFAIPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPLLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVM+QMLRLLH CGLP+EDVDF+NSDGKTMNKLL+E  PRMTLFTGSSRV
Sbjct  226   PVLKVDSKVSIVMDQMLRLLHACGLPVEDVDFINSDGKTMNKLLMEANPRMTLFTGSSRV  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DLKGR++LEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  286   AEKLAEDLKGRVRLEDAGFDWKILGPDVQEEDYVAWVCDQDAYACSGQKCSAQSILFMHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWS+SPLI+ +  LAARRKL+DLTVGPVLT TT+AML+H+ KLL+IPGSKLLFGGE LEN
Sbjct  346   NWSQSPLISKLKDLAARRKLEDLTVGPVLTVTTEAMLEHVKKLLKIPGSKLLFGGETLEN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIPS+YGA +PTAV+VPLEEI+KD+N++LVT E+FGPFQI+T+YK NQL +VL+ALERM
Sbjct  406   HSIPSVYGAFKPTAVYVPLEEIVKDKNFELVTKEIFGPFQIITDYKANQLQMVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIG+SVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDVLFLQEVIGSSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYDIGPV   W +P +T
Sbjct  526   AIKLVWSCHREIIYDIGPVPHKWTVPPST  554



>ref|XP_004508769.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Cicer arietinum]
Length=553

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/526 (83%), Positives = 480/526 (91%), Gaps = 0/526 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R  HS+P AT+  E+ISG++PAEV NLVQG W  SS+WNTI+DPLNGE FIKVAEV +A 
Sbjct  28    RDVHSIPLATVEAEEISGARPAEVLNLVQGKWSGSSNWNTIVDPLNGEPFIKVAEVDEAG  87

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             +QPF+ES+  CPKHGLHNPFKAPERYLM GDIS KAAHMLSLP+VSDFFTRLIQRVSPKS
Sbjct  88    VQPFVESLTSCPKHGLHNPFKAPERYLMYGDISAKAAHMLSLPKVSDFFTRLIQRVSPKS  147

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             YQQA AEV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAIVTPFNFP
Sbjct  148   YQQAYAEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  207

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLP+EDVDF+N DGKTMNKL
Sbjct  208   LEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHSCGLPVEDVDFINCDGKTMNKL  267

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             LLE  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DYIAWVCDQDAY
Sbjct  268   LLEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYIAWVCDQDAY  327

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQS+LFMHENWSK+ LI+ M  LA RRKL DLT+GPVLTFTT+++L+H NKL
Sbjct  328   ACSGQKCSAQSLLFMHENWSKTSLISKMKDLAERRKLADLTIGPVLTFTTESLLEHKNKL  387

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             L+IPGSKLLFGG+PLE+HSIP IYGAI+PTAV+VPLEEI+KD+NY+LVT E+FGPFQ+VT
Sbjct  388   LEIPGSKLLFGGQPLEDHSIPQIYGAIKPTAVYVPLEEIVKDKNYELVTKEIFGPFQVVT  447

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             +Y  NQLP+VL+ LE+M A+LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQNH
Sbjct  448   DYTSNQLPIVLDVLEKMHAHLTAAVVSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQNH  507

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GPVS  W++P ++
Sbjct  508   WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDYGPVSNDWEIPASS  553



>ref|XP_010550612.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Tarenaya hassleriana]
Length=551

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/529 (81%), Positives = 488/529 (92%), Gaps = 0/529 (0%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
             +G+R SHSLPFAT++ E+ISG++PAEV NLVQG WI SS+WNT++DPLNGE FIKVAEV 
Sbjct  23    IGSRFSHSLPFATVDAEEISGAKPAEVQNLVQGKWIGSSTWNTLVDPLNGEPFIKVAEVD  82

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
             +  +QPF+ES+ KC KHGLHNPFK+PERYL+ GDIS KAAHMLSLP+VSDFF+RLIQRVS
Sbjct  83    ETGIQPFVESLSKCSKHGLHNPFKSPERYLLYGDISAKAAHMLSLPKVSDFFSRLIQRVS  142

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSYQQA AEV+VT+KFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPV I+TPF
Sbjct  143   PKSYQQAYAEVYVTRKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVTIITPF  202

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIP+LQLMGALYMGNKP+LKVDSKV IVM+QM+RLLH CGLP+EDVDF+NSDGKTM
Sbjct  203   NFPLEIPLLQLMGALYMGNKPLLKVDSKVSIVMDQMMRLLHYCGLPVEDVDFINSDGKTM  262

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             NK+LL+  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV E+DY+AWVCDQ
Sbjct  263   NKILLKADPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVQEIDYVAWVCDQ  322

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL+DLT+GPVLT TT+AM++HM
Sbjct  323   DAYACSGQKCSAQSMLFMHENWSKTSLVSKLKDLAERRKLEDLTIGPVLTVTTEAMIEHM  382

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
              KLL IPGSKL+FGG+PL+NHSIPSIYGA++PTAV+VPLEEILKD+ Y+LVT E+FGPFQ
Sbjct  383   EKLLHIPGSKLIFGGKPLKNHSIPSIYGALQPTAVYVPLEEILKDKYYELVTKEIFGPFQ  442

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             I+TEYK +QLPLVL ALERM A+LTAAVVSN+ +FLQEVIGNSVNGTTYAG+RARTTGAP
Sbjct  443   IITEYKADQLPLVLEALERMHAHLTAAVVSNNPIFLQEVIGNSVNGTTYAGLRARTTGAP  502

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W++P +T
Sbjct  503   QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWEVPPST  551



>ref|XP_006374487.1| fis1 family protein [Populus trichocarpa]
 gb|ERP52284.1| fis1 family protein [Populus trichocarpa]
Length=567

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/543 (80%), Positives = 487/543 (90%), Gaps = 16/543 (3%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R+ HSLPFAT++ E ISGSQPA+VHNLVQG WI SS+WNTI+DPLNGE FIK+AEV + 
Sbjct  25    SRSVHSLPFATVDAEGISGSQPAKVHNLVQGKWIGSSTWNTIVDPLNGEPFIKIAEVDET  84

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF+ES+ KCPKHGLHNPFK+PERYL+ GDI+ KAAHML++P+VSDFFTRLIQRV+PK
Sbjct  85    GTQPFVESLSKCPKHGLHNPFKSPERYLLYGDITAKAAHMLAVPKVSDFFTRLIQRVAPK  144

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  145   SYQQALGEVQVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  204

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKVCIVMEQM+RLLH CG+PL DVDF+NSDGKTMNK
Sbjct  205   PLEIPLLQLMGALYMGNKPILKVDSKVCIVMEQMIRLLHHCGMPLSDVDFINSDGKTMNK  264

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL E  P+MTLFTGSS+VAEKLA DLKGRIKLEDAGFDWKILGPDV+EVDYIAWVCDQDA
Sbjct  265   LLQEANPQMTLFTGSSKVAEKLAVDLKGRIKLEDAGFDWKILGPDVNEVDYIAWVCDQDA  324

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSILFMHENWS + LI+ M  LA RRKL+DLT+GPVLT TT+AMLDHMNK
Sbjct  325   YACSGQKCSAQSILFMHENWSATSLISKMKDLAERRKLEDLTIGPVLTLTTEAMLDHMNK  384

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LLQIPGSKLLFGG+PLENHSIPSIYGA++PTA++VPLEEIL+ +NY+LVT E+FGPFQ++
Sbjct  385   LLQIPGSKLLFGGKPLENHSIPSIYGALKPTAIYVPLEEILRAKNYELVTREIFGPFQVI  444

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ----------------EVIGNSVNG  1687
             TEYK +QLP+VL+ALERM A+LTAAVVSND LFLQ                EVIG +VNG
Sbjct  445   TEYKKDQLPMVLDALERMHAHLTAAVVSNDVLFLQARLENIFASHPTPLPIEVIGKTVNG  504

Query  1688  TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             TTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GP+   W++P
Sbjct  505   TTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDFGPLPKLWEIP  564

Query  1868  QAT  1876
              +T
Sbjct  565   PST  567



>ref|XP_002511535.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Ricinus communis]
 gb|EEF52137.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Ricinus communis]
Length=584

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/530 (82%), Positives = 484/530 (91%), Gaps = 4/530 (1%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R+ HSLPFAT+ VE+ISGSQPAEV NLVQG W  SSSWNTILDPLNGE FIK+AEV +  
Sbjct  55    RSVHSLPFATVEVEEISGSQPAEVRNLVQGKWTGSSSWNTILDPLNGEPFIKIAEVDETG  114

Query  479   LQPFLESMRKCPKHGLHNPFKAPERY----LMLGDISTKAAHMLSLPEVSDFFTRLIQRV  646
             +QPF+ES+ KCPKHGLHNPFK PER+     + GDIS KAAHMLSLP+VS+FFTRLIQRV
Sbjct  115   IQPFVESLSKCPKHGLHNPFKLPERFELHVSLYGDISAKAAHMLSLPKVSNFFTRLIQRV  174

Query  647   SPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTP  826
             +PKSYQQAL EV VTQKFLENFSGDQVRFLARSF +PGNHLGQQSHGFRWPYGPVAI+TP
Sbjct  175   APKSYQQALGEVQVTQKFLENFSGDQVRFLARSFSIPGNHLGQQSHGFRWPYGPVAIITP  234

Query  827   FNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKT  1006
             FNFPLEIPVLQLMGALYMGNKP+LKVDSKVCIVMEQM+RLLH CGLP+EDVDF+NSDGKT
Sbjct  235   FNFPLEIPVLQLMGALYMGNKPILKVDSKVCIVMEQMMRLLHYCGLPVEDVDFINSDGKT  294

Query  1007  MNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCD  1186
             MNK+LLE  P MTLFTGSSRVA+KLA DLKGRIKLEDAGFDWK+LGPDV+EVDY+AWVCD
Sbjct  295   MNKILLEANPSMTLFTGSSRVADKLAVDLKGRIKLEDAGFDWKVLGPDVNEVDYVAWVCD  354

Query  1187  QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDH  1366
             QDAYACSGQKCSAQSILFMHENW+ + L++ M  LA RRKL+DLT+GPVLTFTT+AM+ H
Sbjct  355   QDAYACSGQKCSAQSILFMHENWAGTSLLSKMKDLAERRKLEDLTIGPVLTFTTEAMVGH  414

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
             MNKLLQIPGSKLLFGG+PLENHSIP IYGA++PTA++VP+EE+LK+ NY+LVT E+FGPF
Sbjct  415   MNKLLQIPGSKLLFGGKPLENHSIPPIYGALKPTAIYVPIEEMLKERNYELVTREIFGPF  474

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGA  1726
             Q++TEYK +QLPLVL+ALERM A+LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGA
Sbjct  475   QVITEYKRDQLPLVLDALERMHAHLTAAVVSNDPLFLQEVIGKSVNGTTYAGLRARTTGA  534

Query  1727  PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GP+   W++P +T
Sbjct  535   PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDFGPLPKHWEIPPST  584



>ref|XP_007037247.1| Aldehyde dehydrogenase 12A1 isoform 1 [Theobroma cacao]
 ref|XP_007037248.1| Aldehyde dehydrogenase 12A1 isoform 1 [Theobroma cacao]
 gb|EOY21748.1| Aldehyde dehydrogenase 12A1 isoform 1 [Theobroma cacao]
 gb|EOY21749.1| Aldehyde dehydrogenase 12A1 isoform 1 [Theobroma cacao]
Length=554

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/561 (78%), Positives = 491/561 (88%), Gaps = 15/561 (3%)
 Frame = +2

Query  194   QLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVH  373
             +LR+RA+  A+ ++ S   +R               + HSLPF T+  E ISGSQPAEV 
Sbjct  9     ELRSRASHKALAWVNSFNISR---------------SVHSLPFTTVEAEGISGSQPAEVQ  53

Query  374   NLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPER  553
             NLVQG W  S++WNT+LDPLNGE FIKVAEV +  +QPF+ES+ KCPKHGLHNPFK+PER
Sbjct  54    NLVQGKWTGSAAWNTLLDPLNGEPFIKVAEVDETGVQPFVESLSKCPKHGLHNPFKSPER  113

Query  554   YLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRF  733
             YL+ GDIS KAAHMLSLP+VSDFFTRLIQRVSPKSYQQAL EV+VT+KFLENFSGDQVRF
Sbjct  114   YLLYGDISAKAAHMLSLPKVSDFFTRLIQRVSPKSYQQALGEVYVTRKFLENFSGDQVRF  173

Query  734   LARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSK  913
             LAR F VPGNH+GQQSHG+RWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKP+LKVDSK
Sbjct  174   LARCFAVPGNHIGQQSHGYRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPILKVDSK  233

Query  914   VCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDL  1093
             V IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNKLL+E  PRMTLFTGSSRVAEKLA DL
Sbjct  234   VSIVMEQMMRLLHYCGLPVEDVDFINSDGKTMNKLLMEANPRMTLFTGSSRVAEKLAVDL  293

Query  1094  KGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLI  1273
             KG IKLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSAQSILFMHENWS S LI
Sbjct  294   KGCIKLEDAGFDWKILGPDVEEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWSASSLI  353

Query  1274  NLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYG  1453
               M  LA RRKL DLT+GPVLT TT+AML+H  KLLQI GSKLLFGGEPLENHSIP IYG
Sbjct  354   PKMKYLAERRKLADLTIGPVLTVTTEAMLEHKKKLLQISGSKLLFGGEPLENHSIPPIYG  413

Query  1454  AIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAV  1633
             A++PTA+++PLEEILKD+NY+LVT E+FGPFQI+T+YK +QLP+VL+ALERM A+LTAAV
Sbjct  414   ALKPTAIYIPLEEILKDDNYELVTKEIFGPFQIITDYKKDQLPMVLDALERMHAHLTAAV  473

Query  1634  VSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  1813
             VSND +FLQ VIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC
Sbjct  474   VSNDPIFLQGVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  533

Query  1814  HREIIYDIGPVSPAWKLPQAT  1876
             HREIIYD GP+   W++P +T
Sbjct  534   HREIIYDFGPLPRDWEIPPST  554



>ref|XP_006394383.1| hypothetical protein EUTSA_v10003935mg [Eutrema salsugineum]
 gb|ESQ31669.1| hypothetical protein EUTSA_v10003935mg [Eutrema salsugineum]
Length=557

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/572 (76%), Positives = 503/572 (88%), Gaps = 18/572 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRA--TRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVED  343
             MY++ A   LR ++     + ++LGSL  +R NHS               LPFAT++ E+
Sbjct  1     MYRVLASRGLRAKSLLCDKSASFLGSLTFSRLNHS---------------LPFATVDAEE  45

Query  344   ISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHG  523
             +SG+ PAEV + VQG WI SS++NT+LDPLNGE FIKVAEV++  +QPF+ES+ +CPKHG
Sbjct  46    LSGAHPAEVQSFVQGKWIGSSNYNTLLDPLNGEPFIKVAEVEETGIQPFVESLSQCPKHG  105

Query  524   LHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFL  703
             LHNPFK+PERYL+ GDISTKAAHML+LP+VSDFFTRLIQRV+PKSYQQA  EVFVT+KFL
Sbjct  106   LHNPFKSPERYLLYGDISTKAAHMLALPKVSDFFTRLIQRVAPKSYQQAAGEVFVTRKFL  165

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPV IVTPFNFPLEIP+LQLMGALYMG
Sbjct  166   ENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVTIVTPFNFPLEIPLLQLMGALYMG  225

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSS  1063
             NKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK+LLE  PRMTLFTGSS
Sbjct  226   NKPLLKVDSKVSIVMEQMMRLLHHCGLPVEDVDFINSDGKTMNKILLEANPRMTLFTGSS  285

Query  1064  RVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             RVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AWVCDQDAYACSGQKCSAQS+LFM
Sbjct  286   RVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWVCDQDAYACSGQKCSAQSMLFM  345

Query  1244  HENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL  1423
             HENWSK+PL++ +  LAARRKL+DLT+GPVLTFTT+AML+HM  LLQIPGSKLLFGG+PL
Sbjct  346   HENWSKTPLVSKLKELAARRKLEDLTIGPVLTFTTEAMLEHMENLLQIPGSKLLFGGKPL  405

Query  1424  ENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQIVTEYKDNQLPLVLNAL  1600
             +NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQIVTEYK +QLPLVL+AL
Sbjct  406   KNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQIVTEYKKDQLPLVLDAL  465

Query  1601  ERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  1780
             ERM A+LTAAVVSND +F+QEVIGNSVNGTTYAG+R RTTGAPQNHWFGPAGDPRGAGIG
Sbjct  466   ERMHAHLTAAVVSNDPIFIQEVIGNSVNGTTYAGLRGRTTGAPQNHWFGPAGDPRGAGIG  525

Query  1781  TPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TPEAIKLVWSCHREIIYD GP+   W++P +T
Sbjct  526   TPEAIKLVWSCHREIIYDYGPIPQGWEVPPST  557



>ref|XP_007155331.1| hypothetical protein PHAVU_003G192100g [Phaseolus vulgaris]
 gb|ESW27325.1| hypothetical protein PHAVU_003G192100g [Phaseolus vulgaris]
Length=553

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/543 (80%), Positives = 486/543 (90%), Gaps = 1/543 (0%)
 Frame = +2

Query  248   TTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILD  427
             +T  NHS  +A     +R  HSL FAT+  E++SGS+PAEV NLVQG W+ SS+WNTILD
Sbjct  12    STSRNHSG-FAAFSFSSRCVHSLQFATVEAEEVSGSKPAEVLNLVQGKWVGSSNWNTILD  70

Query  428   PLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLP  607
             PLNG+SFI VAEV +  +QPF+ES+  CPKHG+HNPFKAPERYLM GDISTKAAHMLSLP
Sbjct  71    PLNGDSFINVAEVDETGIQPFVESLSSCPKHGVHNPFKAPERYLMYGDISTKAAHMLSLP  130

Query  608   EVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHG  787
             +VSDFFTRLIQRVSPKSYQQA AEV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG
Sbjct  131   KVSDFFTRLIQRVSPKSYQQAFAEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHG  190

Query  788   FRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLP  967
             FRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLP
Sbjct  191   FRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHTCGLP  250

Query  968   LEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGP  1147
             +EDVDF+NSDGK MNKLLLE  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGP
Sbjct  251   VEDVDFINSDGKIMNKLLLEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGP  310

Query  1148  DVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVG  1327
             DV E DY AWVCDQDAYACSGQKCSAQS+LFMHENWSK+ L++ M  LA RRKL DLT+G
Sbjct  311   DVHEEDYTAWVCDQDAYACSGQKCSAQSLLFMHENWSKTSLLSKMKDLAERRKLTDLTIG  370

Query  1328  PVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDE  1507
             PVLT TT +ML+H+NKLL+IPGSKLLFGG PLE+HSIPSIYGAI+PTAV+VPLEEI+KD+
Sbjct  371   PVLTVTTDSMLEHVNKLLEIPGSKLLFGGRPLEDHSIPSIYGAIKPTAVYVPLEEIMKDK  430

Query  1508  NYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNG  1687
             N++LVT E+FGPFQIVT+YK+++L +VL+ALERM  +LTAAVVSND LFLQEVIG SVNG
Sbjct  431   NFELVTKEIFGPFQIVTDYKNSELSVVLDALERMHNHLTAAVVSNDPLFLQEVIGKSVNG  490

Query  1688  TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             TTYAG+RARTTGAPQNHWFGPAGD RGAGIGTPEAIKLVWSCHRE+IYD GPV   W++P
Sbjct  491   TTYAGLRARTTGAPQNHWFGPAGDARGAGIGTPEAIKLVWSCHREVIYDYGPVPKNWEIP  550

Query  1868  QAT  1876
              +T
Sbjct  551   PST  553



>ref|XP_006579542.1| PREDICTED: probable aldehyde dehydrogenase-like isoform X2 [Glycine 
max]
Length=554

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 493/563 (88%), Gaps = 10/563 (2%)
 Frame = +2

Query  188   FTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAE  367
             F  L +R T+ +I+           +   +A+    +R +HSL FAT+  E+ISGS+PAE
Sbjct  2     FMFLVSRVTKDSIS----------RNRNAFASFAFSSRCAHSLSFATVEAEEISGSRPAE  51

Query  368   VHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             V NLVQG W+ SS+WNTI DPLNG+SFIKVAEV +  +QPF++S+  CPKHG+HNPFKAP
Sbjct  52    VLNLVQGKWVGSSNWNTIADPLNGDSFIKVAEVDETGIQPFIKSLSSCPKHGVHNPFKAP  111

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ERYLM GDISTKAAHMLSLP+VSDFFT+LIQRVSPKSYQQA  EV+VTQKFLENF GDQV
Sbjct  112   ERYLMYGDISTKAAHMLSLPKVSDFFTKLIQRVSPKSYQQAFGEVYVTQKFLENFCGDQV  171

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             RFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPVLKVD
Sbjct  172   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVLKVD  231

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAG  1087
             SKV IVMEQMLRLLH CGLP EDVDF+NSDGKTMN+LLLE  PRMTLFTGSSRVA+KLA 
Sbjct  232   SKVSIVMEQMLRLLHTCGLPAEDVDFINSDGKTMNRLLLEANPRMTLFTGSSRVADKLAV  291

Query  1088  DLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSP  1267
             DLKGR+KLEDAGFDWKILGPDV + DYIAWVCDQDAYACSGQKCSAQS+LFMHENWSK+ 
Sbjct  292   DLKGRVKLEDAGFDWKILGPDVHQEDYIAWVCDQDAYACSGQKCSAQSLLFMHENWSKTS  351

Query  1268  LINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSI  1447
             L++ +  LA RRKL+DLT+GPVLT TT  ML+H NKLL+IPGSKLLFGG PLENHSIP I
Sbjct  352   LLSKLKDLAERRKLEDLTIGPVLTCTTGMMLEHKNKLLEIPGSKLLFGGSPLENHSIPPI  411

Query  1448  YGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTA  1627
             YGAI+PTAV+VPLEEI+KD+N+DLVT E+FGPFQ++T+YK++QL +VL+A+ERM  +LTA
Sbjct  412   YGAIKPTAVYVPLEEIMKDKNFDLVTKEIFGPFQVITDYKNSQLSVVLDAVERMHNHLTA  471

Query  1628  AVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVW  1807
             AVVSND LFLQEV+GNSVNGTTYAG+RARTTGAPQNHWFGPAGD RGAGIGTPEAIKLVW
Sbjct  472   AVVSNDPLFLQEVVGNSVNGTTYAGLRARTTGAPQNHWFGPAGDARGAGIGTPEAIKLVW  531

Query  1808  SCHREIIYDIGPVSPAWKLPQAT  1876
             SCHRE+IYD GPV   WK PQ+T
Sbjct  532   SCHREVIYDFGPVPKDWKTPQST  554



>ref|XP_004299391.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=551

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/559 (77%), Positives = 491/559 (88%), Gaps = 15/559 (3%)
 Frame = +2

Query  200   RNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNL  379
             R R  +TA+++  S   +R               ++HSLPFAT+  E+ISGS PAEVHN+
Sbjct  8     RTRVPKTALSWFTSFNLSR---------------SAHSLPFATVEAEEISGSLPAEVHNI  52

Query  380   VQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYL  559
             V+G W +SS+WNTI+DPLNGE FIKVAE+ +  +QPF+ES+  CPKHGLHNPFK+PERYL
Sbjct  53    VKGKWTKSSTWNTIVDPLNGEPFIKVAEIDETGIQPFVESLSNCPKHGLHNPFKSPERYL  112

Query  560   MLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLA  739
             M GDIS KAA MLSLP+V+DFFTRLIQRV+PKSYQQA  EV+VTQKFLENFSGDQVRFLA
Sbjct  113   MYGDISAKAATMLSLPKVADFFTRLIQRVAPKSYQQAYGEVYVTQKFLENFSGDQVRFLA  172

Query  740   RSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVC  919
             RSF VPGNHLGQQS+G+RWPYGPVA+VTPFNFPLEIPVLQLMGALYMGNKP+LKVDSKV 
Sbjct  173   RSFAVPGNHLGQQSNGYRWPYGPVAVVTPFNFPLEIPVLQLMGALYMGNKPILKVDSKVS  232

Query  920   IVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKG  1099
             +VM+QM+RLLH CGLP+EDVDF+NSDGKTMNKLLL+  PRMTLFTGSSRVAEKL  DLKG
Sbjct  233   LVMDQMMRLLHYCGLPVEDVDFINSDGKTMNKLLLKANPRMTLFTGSSRVAEKLVADLKG  292

Query  1100  RIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINL  1279
             R+KLEDAGFDWKILGPDV E DY+AWVCDQDAYACSGQKCSAQSILFMHENWSK+ L++ 
Sbjct  293   RVKLEDAGFDWKILGPDVHEEDYVAWVCDQDAYACSGQKCSAQSILFMHENWSKTSLLSK  352

Query  1280  MSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAI  1459
             M  LA RRKL+DLTVGPVLT TT+ MLDH NKLLQIPGSKLLFGG+PLENHSIP IYGAI
Sbjct  353   MKDLAERRKLEDLTVGPVLTLTTETMLDHANKLLQIPGSKLLFGGKPLENHSIPPIYGAI  412

Query  1460  RPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVS  1639
             +PTA++VPLEE+LK+ NY+LVT E+FGPFQ+VTEYK +QLPLVL+ALERM+A+LTAAVVS
Sbjct  413   QPTAIYVPLEEMLKENNYELVTREIFGPFQVVTEYKKDQLPLVLDALERMNAHLTAAVVS  472

Query  1640  NDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHR  1819
             ND  F QEV+GN+VNGTTYAG+RARTTGAPQNHWFGPAGDP GAGIGTPEAIKLVWSCHR
Sbjct  473   NDPYFQQEVLGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPLGAGIGTPEAIKLVWSCHR  532

Query  1820  EIIYDIGPVSPAWKLPQAT  1876
             EIIYD+GP+   W+LP +T
Sbjct  533   EIIYDVGPMPKQWELPPST  551



>ref|XP_010242381.1| PREDICTED: probable aldehyde dehydrogenase [Nelumbo nucifera]
Length=555

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/569 (76%), Positives = 496/569 (87%), Gaps = 14/569 (2%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+     +++ RA + A+ +  S                + +R+ +SLPFAT+ VE IS
Sbjct  1     MYRFGVCREMQARAHKLALNWFNS--------------SFIVSRSVYSLPFATVEVEKIS  46

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  SS+W+T++DPLNGE FIKVAEV + ELQPF+ES+ KCPKHGLH
Sbjct  47    GSQPAEVRNLVQGRWTESSNWSTVVDPLNGEPFIKVAEVNETELQPFVESLSKCPKHGLH  106

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFKAPERYL+ GD+S +A HMLS PEVS+FFTRLIQRVSPKSYQQALAEV+V+QKFLEN
Sbjct  107   NPFKAPERYLLFGDVSARAGHMLSQPEVSNFFTRLIQRVSPKSYQQALAEVYVSQKFLEN  166

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF VPGNHLGQQSHG RWPYGPVAIVTPFNFPLEIP+LQ+MGALYMGNK
Sbjct  167   FCGDQVRFLARSFAVPGNHLGQQSHGLRWPYGPVAIVTPFNFPLEIPILQMMGALYMGNK  226

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             P+LKVDSKV IVMEQMLRLLH+CGLP EDVDF+NSDGKTMNKLLLE KP+MTLFTGSSRV
Sbjct  227   PILKVDSKVSIVMEQMLRLLHNCGLPREDVDFINSDGKTMNKLLLEAKPQMTLFTGSSRV  286

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLA DLKGRIKLEDAGFDWKILGPDV +VDY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  287   ADKLAVDLKGRIKLEDAGFDWKILGPDVQQVDYVAWVCDQDAYACSGQKCSAQSILFMHE  346

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NW+ + LI+ +  LA RRKL+DLT+GPVLT TT+ ML+H+NK+L++PGSKLLFGGEPL+N
Sbjct  347   NWATTSLISKLKDLAERRKLEDLTIGPVLTCTTEKMLEHINKVLELPGSKLLFGGEPLKN  406

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP+IYGAI+PTAV+VPL+E+LKD NY+LV  E+FGPFQIVT+YK  QLP VL+ALERM
Sbjct  407   HSIPNIYGAIKPTAVYVPLDEMLKDNNYELVRKEIFGPFQIVTDYKQEQLPKVLDALERM  466

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND  FLQ+V+G SVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  467   HAHLTAAVVSNDPQFLQDVLGKSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  526

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP+   W++P +T
Sbjct  527   AIKLVWSCHREIIYDVGPLPQDWEIPPST  555



>dbj|BAJ34440.1| unnamed protein product [Thellungiella halophila]
Length=557

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/572 (76%), Positives = 502/572 (88%), Gaps = 18/572 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRA--TRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVED  343
             MY++ A   LR ++     + ++LGSL  +R NHS               LPFAT++ E+
Sbjct  1     MYRVLASRGLRAKSLLCDKSASFLGSLTFSRLNHS---------------LPFATVDAEE  45

Query  344   ISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHG  523
             +SG+ PAEV + VQG WI SS++NT+LDPLNGE FIKVAEV++  +QPF+ES+ +CPKHG
Sbjct  46    LSGAHPAEVQSFVQGKWIGSSNYNTLLDPLNGEPFIKVAEVEETGIQPFVESLSQCPKHG  105

Query  524   LHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFL  703
             LHNPFK+PERYL+ GDISTKAAHML+LP+VSDFFTRLIQRV+PKSYQQA  EVFVT+KFL
Sbjct  106   LHNPFKSPERYLLYGDISTKAAHMLALPKVSDFFTRLIQRVAPKSYQQAAGEVFVTRKFL  165

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPV IVTPFNFPLEIP+LQLMGALYMG
Sbjct  166   ENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVTIVTPFNFPLEIPLLQLMGALYMG  225

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSS  1063
             NKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK+LLE  PRMTLFTGSS
Sbjct  226   NKPLLKVDSKVSIVMEQMMRLLHHCGLPVEDVDFINSDGKTMNKILLEANPRMTLFTGSS  285

Query  1064  RVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             RVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AWVCDQDAYACSGQKC AQS+LFM
Sbjct  286   RVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWVCDQDAYACSGQKCFAQSMLFM  345

Query  1244  HENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL  1423
             HENWSK+PL++ +  LAARRKL+DLT+GPVLTFTT+AML+HM  LLQIPGSKLLFGG+PL
Sbjct  346   HENWSKTPLVSKLKELAARRKLEDLTIGPVLTFTTEAMLEHMENLLQIPGSKLLFGGKPL  405

Query  1424  ENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQIVTEYKDNQLPLVLNAL  1600
             +NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQIVTEYK +QLPLVL+AL
Sbjct  406   KNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQIVTEYKKDQLPLVLDAL  465

Query  1601  ERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  1780
             ERM A+LTAAVVSND +F+QEVIGNSVNGTTYAG+R RTTGAPQNHWFGPAGDPRGAGIG
Sbjct  466   ERMHAHLTAAVVSNDPIFIQEVIGNSVNGTTYAGLRGRTTGAPQNHWFGPAGDPRGAGIG  525

Query  1781  TPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TPEAIKLVWSCHREIIYD GP+   W++P +T
Sbjct  526   TPEAIKLVWSCHREIIYDYGPIPQGWEVPPST  557



>gb|KHG20910.1| Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial 
-like protein [Gossypium arboreum]
Length=554

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/569 (76%), Positives = 493/569 (87%), Gaps = 15/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             M+++    ++R+RA+  A+++  S    R               + HSLPFAT+  E IS
Sbjct  1     MHRIVLQREIRSRASHKALSWFSSSNLFR---------------SVHSLPFATVEAEGIS  45

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQG W  S++WNT++DPLNGE FIKVAEV    +QPF+ES+ KCPKHGLH
Sbjct  46    GSQPAEVQNLVQGKWTGSAAWNTLVDPLNGEPFIKVAEVDGNGIQPFVESLSKCPKHGLH  105

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFK+PERYL+ GDIS KAA+ML+LP+VSDFFTRLIQRVSPKSYQQA  EV+VTQKFLEN
Sbjct  106   NPFKSPERYLLYGDISAKAANMLALPKVSDFFTRLIQRVSPKSYQQAFGEVYVTQKFLEN  165

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FSGDQVRFLARSF VPGNH+GQQSHG+RWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  166   FSGDQVRFLARSFAVPGNHIGQQSHGYRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  225

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK+L+E  PRMTLFTGSSR+
Sbjct  226   PVLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNKVLMEANPRMTLFTGSSRI  285

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  286   AEKLAVDLKGRVKLEDAGFDWKILGPDVEEVDYVAWVCDQDAYACSGQKCSAQSILFMHE  345

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWS S LI+ +  LA RRKL DLTVGPVLT TT+AML+H  KLLQI GSKLLFGGEPLEN
Sbjct  346   NWSTSSLISKIKDLAERRKLADLTVGPVLTVTTEAMLEHKKKLLQISGSKLLFGGEPLEN  405

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP+IYGAI+PTA+++PLEEILK  NY+LVT E+FGPFQI+T+YK +QLP+VL+ALERM
Sbjct  406   HSIPAIYGAIKPTAIYIPLEEILKPTNYELVTKEIFGPFQIITDYKKDQLPMVLDALERM  465

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND  FLQ+VIG +VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  466   HAHLTAAVVSNDPFFLQDVIGKTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  525

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD GPV   W++P +T
Sbjct  526   AIKLVWSCHREIIYDFGPVPRGWEIPPST  554



>ref|XP_003524922.1| PREDICTED: probable aldehyde dehydrogenase-like isoform X1 [Glycine 
max]
Length=553

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/527 (81%), Positives = 480/527 (91%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HSL FAT+  E+ISGS+PAEV NLVQG W+ SS+WNTI DPLNG+SFIKVAEV + 
Sbjct  27    SRCAHSLSFATVEAEEISGSRPAEVLNLVQGKWVGSSNWNTIADPLNGDSFIKVAEVDET  86

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF++S+  CPKHG+HNPFKAPERYLM GDISTKAAHMLSLP+VSDFFT+LIQRVSPK
Sbjct  87    GIQPFIKSLSSCPKHGVHNPFKAPERYLMYGDISTKAAHMLSLPKVSDFFTKLIQRVSPK  146

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EV+VTQKFLENF GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  147   SYQQAFGEVYVTQKFLENFCGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNF  206

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLP EDVDF+NSDGKTMN+
Sbjct  207   PLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHTCGLPAEDVDFINSDGKTMNR  266

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  PRMTLFTGSSRVA+KLA DLKGR+KLEDAGFDWKILGPDV + DYIAWVCDQDA
Sbjct  267   LLLEANPRMTLFTGSSRVADKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYIAWVCDQDA  326

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL+DLT+GPVLT TT  ML+H NK
Sbjct  327   YACSGQKCSAQSLLFMHENWSKTSLLSKLKDLAERRKLEDLTIGPVLTCTTGMMLEHKNK  386

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPGSKLLFGG PLENHSIP IYGAI+PTAV+VPLEEI+KD+N+DLVT E+FGPFQ++
Sbjct  387   LLEIPGSKLLFGGSPLENHSIPPIYGAIKPTAVYVPLEEIMKDKNFDLVTKEIFGPFQVI  446

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+YK++QL +VL+A+ERM  +LTAAVVSND LFLQEV+GNSVNGTTYAG+RARTTGAPQN
Sbjct  447   TDYKNSQLSVVLDAVERMHNHLTAAVVSNDPLFLQEVVGNSVNGTTYAGLRARTTGAPQN  506

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGD RGAGIGTPEAIKLVWSCHRE+IYD GPV   WK PQ+T
Sbjct  507   HWFGPAGDARGAGIGTPEAIKLVWSCHREVIYDFGPVPKDWKTPQST  553



>ref|XP_009151373.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Brassica rapa]
Length=557

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/572 (76%), Positives = 503/572 (88%), Gaps = 18/572 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRA--TRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVED  343
             MY++ A   LR ++     A ++L S  ++R NHS               +PFAT++ E+
Sbjct  1     MYRVLASRGLRAKSLCDNKASSFLASFTSSRLNHS---------------IPFATVDAEE  45

Query  344   ISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHG  523
             ISG++PAEV + VQG WI SS++NT+LDPLNGE FIKVAEV+++ +QPF+ES+ +CPKHG
Sbjct  46    ISGARPAEVQSFVQGKWIGSSNYNTLLDPLNGEPFIKVAEVEESGVQPFIESLAQCPKHG  105

Query  524   LHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFL  703
             LHNPFK+PERYL+ GDISTKAAHML+LP+VSDFFTRLIQRV+PKSYQQA  EVFVT+KFL
Sbjct  106   LHNPFKSPERYLLYGDISTKAAHMLALPKVSDFFTRLIQRVAPKSYQQAAGEVFVTRKFL  165

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPV IVTPFNFPLEIP+LQLMGALYMG
Sbjct  166   ENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVTIVTPFNFPLEIPLLQLMGALYMG  225

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSS  1063
             NKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK+LLE  PRMTLFTGSS
Sbjct  226   NKPLLKVDSKVSIVMEQMMRLLHYCGLPVEDVDFINSDGKTMNKILLEANPRMTLFTGSS  285

Query  1064  RVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             RVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AWVCDQDAYACSGQKCSAQS+LF+
Sbjct  286   RVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWVCDQDAYACSGQKCSAQSMLFV  345

Query  1244  HENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL  1423
             HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AM++HM  LLQIPGSKLLFGG+PL
Sbjct  346   HENWSKTPLLSKLKDLAGRRKLEDLTIGPVLTFTTEAMVEHMENLLQIPGSKLLFGGKPL  405

Query  1424  ENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQIVTEYKDNQLPLVLNAL  1600
             +NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQIVTEYK +QLPLVL+AL
Sbjct  406   KNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQIVTEYKKDQLPLVLDAL  465

Query  1601  ERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  1780
             ERM A+LTAAVVSND +F+QEVIGNSVNGTTYAG+R RTTGAPQNHWFGPAGDPRGAGIG
Sbjct  466   ERMHAHLTAAVVSNDPIFIQEVIGNSVNGTTYAGLRGRTTGAPQNHWFGPAGDPRGAGIG  525

Query  1781  TPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TPEAIKLVWSCHRE+IYD GP+   W+LP +T
Sbjct  526   TPEAIKLVWSCHREVIYDYGPIPQGWELPPST  557



>gb|KHN48668.1| Putative aldehyde dehydrogenase [Glycine soja]
Length=560

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/569 (76%), Positives = 493/569 (87%), Gaps = 16/569 (3%)
 Frame = +2

Query  188   FTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAE  367
             F  L +R T+ +I+           +   +A+    +R +HSL FAT+  E+ISGS+PAE
Sbjct  2     FMFLVSRVTKDSIS----------RNRNAFASFAFSSRCAHSLSFATVEAEEISGSRPAE  51

Query  368   VHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             V NLVQG W+ SS+WNTI DPLNG+SFIKVAEV +  +QPF++S+  CPKHG+HNPFKAP
Sbjct  52    VLNLVQGKWVGSSNWNTIADPLNGDSFIKVAEVDETGIQPFIKSLSSCPKHGVHNPFKAP  111

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ERYLM GDISTKAAHMLSLP+VSDFFT+LIQRVSPKSYQQA  EV+VTQKFLENF GDQV
Sbjct  112   ERYLMYGDISTKAAHMLSLPKVSDFFTKLIQRVSPKSYQQAFGEVYVTQKFLENFCGDQV  171

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             RFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPVLKVD
Sbjct  172   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVLKVD  231

Query  908   SK------VCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             SK      V IVMEQMLRLLH CGLP EDVDF+NSDGKTMN+LLLE  PRMTLFTGSSRV
Sbjct  232   SKASSFGSVSIVMEQMLRLLHTCGLPAEDVDFINSDGKTMNRLLLEANPRMTLFTGSSRV  291

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             A+KLA DLKGR+KLEDAGFDWKILGPDV + DYIAWVCDQDAYACSGQKCSAQS+LFMHE
Sbjct  292   ADKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYIAWVCDQDAYACSGQKCSAQSLLFMHE  351

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSK+ L++ +  LA RRKL+DLT+GPVLT TT  ML+H NKLL+IPGSKLLFGG PLEN
Sbjct  352   NWSKTSLLSKLKDLAERRKLEDLTIGPVLTCTTGMMLEHKNKLLEIPGSKLLFGGSPLEN  411

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP IYGAI+PTAV+VPLEEI+KD+N+DLVT E+FGPFQ++T+YK++QL +VL+A+ERM
Sbjct  412   HSIPPIYGAIKPTAVYVPLEEIMKDKNFDLVTKEIFGPFQVITDYKNSQLSVVLDAVERM  471

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
               +LTAAVVSND LFLQEV+GNSVNGTTYAG+RARTTGAPQNHWFGPAGD RGAGIGTPE
Sbjct  472   HNHLTAAVVSNDPLFLQEVVGNSVNGTTYAGLRARTTGAPQNHWFGPAGDARGAGIGTPE  531

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHRE+IYD GPV   WK PQ+T
Sbjct  532   AIKLVWSCHREVIYDFGPVPKDWKTPQST  560



>gb|EYU42874.1| hypothetical protein MIMGU_mgv1a003968mg [Erythranthe guttata]
Length=552

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/569 (78%), Positives = 487/569 (86%), Gaps = 17/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY L AF  L+NR  + A         +  N SR            HS  FAT+  E++S
Sbjct  1     MYVLMAFRHLKNRVPQLA-------SPSSFNFSR----------LVHSFSFATVKAEELS  43

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GSQPAEV NLVQGNWI SS+ NTI DPLNGESFI+V+EV +  +QPF+ES+ KCPKHGLH
Sbjct  44    GSQPAEVLNLVQGNWIGSSNRNTIPDPLNGESFIRVSEVDEKGIQPFVESLSKCPKHGLH  103

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFK+PERYLMLGD+S KAA  LSLPEVSDFF +LIQRVSPKSY+QAL EVFVT KFLEN
Sbjct  104   NPFKSPERYLMLGDVSIKAAQKLSLPEVSDFFAKLIQRVSPKSYEQALGEVFVTGKFLEN  163

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             F GDQVRFLARSF VPGNHLGQQS+G+RWP+GPV I+TPFNFPLEIP+LQLMGALYMGNK
Sbjct  164   FCGDQVRFLARSFAVPGNHLGQQSNGYRWPFGPVTIITPFNFPLEIPLLQLMGALYMGNK  223

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             P+LKVDSKV +VMEQMLRLLH+CGLP EDVDF+NSDGKTMNKLLLE +PRMTLFTGSS+V
Sbjct  224   PLLKVDSKVSLVMEQMLRLLHECGLPAEDVDFINSDGKTMNKLLLEAEPRMTLFTGSSKV  283

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DLKGRIKLEDAGFDWKILGPDV   DY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  284   AEKLALDLKGRIKLEDAGFDWKILGPDVQNEDYVAWVCDQDAYACSGQKCSAQSILFMHE  343

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NWSKS  I  ++ LA+RRKLDDLTVGPVLT TTK MLDHM KLL+I GSKLLFGGE LEN
Sbjct  344   NWSKSSFIEKLTGLASRRKLDDLTVGPVLTVTTKEMLDHMKKLLEIKGSKLLFGGEALEN  403

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP+IYGAI+PTAVF+PLEEIL + NYDLVT E+FGPFQ+VTEYK N+L LVLN LE+M
Sbjct  404   HSIPAIYGAIKPTAVFIPLEEILNENNYDLVTKEIFGPFQVVTEYKQNELQLVLNVLEKM  463

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIGNSVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  464   HAHLTAAVVSNDPLFLQEVIGNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  523

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHRE+IYDIGPV   W+ P+ T
Sbjct  524   AIKLVWSCHREVIYDIGPVPQNWQTPKPT  552



>ref|XP_003549664.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like isoform X1 [Glycine max]
Length=553

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/527 (81%), Positives = 479/527 (91%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HSLPFAT+  E+ISGS+ AEV NLVQG W+ SS+WNT++DPLNG+SFIKVAEV + 
Sbjct  27    SRYAHSLPFATVEAEEISGSRAAEVLNLVQGKWVGSSNWNTVVDPLNGDSFIKVAEVDET  86

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF+ES+  CPKHG HNPFKAPERYLM G+IS KAAHMLSLP+V DFFTRLIQRVSPK
Sbjct  87    GIQPFVESLSSCPKHGAHNPFKAPERYLMFGEISAKAAHMLSLPKVLDFFTRLIQRVSPK  146

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  147   SYQQAFGEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  206

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLPLEDVDF+NSDGKTMNK
Sbjct  207   PLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHTCGLPLEDVDFINSDGKTMNK  266

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLEG PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DY+AWVCDQDA
Sbjct  267   LLLEGNPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYVAWVCDQDA  326

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL DLT+GPVLT TT +ML+H+NK
Sbjct  327   YACSGQKCSAQSLLFMHENWSKTSLLSKLKDLAERRKLADLTIGPVLTVTTDSMLEHVNK  386

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPGSKLLFGG PLENHSIP IYGAI+PTAV+VPLEEI+KD+N++LVT E+FGPFQ++
Sbjct  387   LLEIPGSKLLFGGSPLENHSIPPIYGAIKPTAVYVPLEEIMKDKNFELVTKEIFGPFQVI  446

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+Y+++QL +VL+ALERM  +LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQN
Sbjct  447   TDYQNSQLAVVLDALERMHNHLTAAVVSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQN  506

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGD RGAGIGTPEAIKLVWSCHREIIYD GPV   W++P +T
Sbjct  507   HWFGPAGDARGAGIGTPEAIKLVWSCHREIIYDFGPVPKNWEVPPST  553



>emb|CDP14844.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/569 (77%), Positives = 491/569 (86%), Gaps = 14/569 (2%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+L+   +LR RA++ A+ +  +   +R  HS  +                 +  EDIS
Sbjct  1     MYRLKGCRELRKRASQIALNWFSTFSFSRSTHSVSFD--------------PIITAEDIS  46

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GS+PA V NLVQGNW R S+W TI+DPLNGE FI V EV D  LQP++ES+ KCPKHGLH
Sbjct  47    GSKPAAVQNLVQGNWTRPSNWTTIVDPLNGEPFITVFEVDDRGLQPYIESLHKCPKHGLH  106

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NPFK+PERYLMLGDIS KAAH+LSLP++SDFFT+LIQRVSPKSYQQA  EV+VTQKFLEN
Sbjct  107   NPFKSPERYLMLGDISAKAAHLLSLPKISDFFTKLIQRVSPKSYQQAYGEVYVTQKFLEN  166

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FSGDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNK
Sbjct  167   FSGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNK  226

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             PVLKVDSKV IVME+MLRLLH+CGLP EDVDF+N DG TM KLLLE KPRMTLFTGSSRV
Sbjct  227   PVLKVDSKVSIVMEKMLRLLHECGLPREDVDFINCDGNTMTKLLLEAKPRMTLFTGSSRV  286

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLA DLKGRIKLEDAGFDWKILGPDV EVDY+AWVCD DAYACSGQKCSAQSILFMHE
Sbjct  287   AEKLAVDLKGRIKLEDAGFDWKILGPDVQEVDYVAWVCDHDAYACSGQKCSAQSILFMHE  346

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NW +SPL++ +   AARR+LDDLTVGPVLT  T+A+L H NKLL+IPGSKLLFGG+ L N
Sbjct  347   NWGRSPLLDTIKKHAARRELDDLTVGPVLTVNTEALLLHKNKLLKIPGSKLLFGGKALTN  406

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             HSIP+IYGAI PTAVFVPLEEILKD+NY+LVT E+FGPFQIVTEYKDNQLP+VLNALE+M
Sbjct  407   HSIPAIYGAIEPTAVFVPLEEILKDDNYELVTKEIFGPFQIVTEYKDNQLPMVLNALEKM  466

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND LFLQEVIG SVNGTTY G+RARTTGAPQNHWFGPAGDPRGAGIGTPE
Sbjct  467   HAHLTAAVVSNDVLFLQEVIGKSVNGTTYVGLRARTTGAPQNHWFGPAGDPRGAGIGTPE  526

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYD+GP++  W++P++T
Sbjct  527   AIKLVWSCHREIIYDVGPIAQNWQIPRST  555



>gb|KFK27982.1| hypothetical protein AALP_AA8G456400 [Arabis alpina]
Length=557

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/572 (75%), Positives = 500/572 (87%), Gaps = 18/572 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRA--TRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVED  343
             MY++ A   LR ++     + + LGSL ++R NHS               LPFAT++ E+
Sbjct  1     MYRVFASRALRAKSLCNNKSSSCLGSLTSSRLNHS---------------LPFATVDAEE  45

Query  344   ISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHG  523
             +SG+ PAEV + VQG WI SS+ NT+LDPLNGE+FIKV EV+++ +QPF+ES+ +CPKHG
Sbjct  46    LSGANPAEVQSFVQGKWIGSSNHNTLLDPLNGEAFIKVGEVEESGIQPFVESLSQCPKHG  105

Query  524   LHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFL  703
             LHNPFK+PERYL+ GDISTKAAHML+LP+V+DFFTRLIQRV+PKSYQQA  EVFVT+KFL
Sbjct  106   LHNPFKSPERYLLYGDISTKAAHMLALPKVADFFTRLIQRVAPKSYQQAAGEVFVTRKFL  165

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPV IVTPFNFPLEIP+LQLMGALYMG
Sbjct  166   ENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVTIVTPFNFPLEIPLLQLMGALYMG  225

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSS  1063
             NKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK+LLE  PRMTLFTGSS
Sbjct  226   NKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNKILLEANPRMTLFTGSS  285

Query  1064  RVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             RVAEKLA DLKGRI+LEDAGFDWK+LGPDV E+DY+AWVCDQDAYACSGQKCSAQS+LF+
Sbjct  286   RVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEIDYVAWVCDQDAYACSGQKCSAQSMLFI  345

Query  1244  HENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL  1423
             HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+H+  LLQIPGSKLLFGG+ L
Sbjct  346   HENWSKTPLVSKLKELAGRRKLEDLTIGPVLTFTTEAMLEHVENLLQIPGSKLLFGGKEL  405

Query  1424  ENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQIVTEYKDNQLPLVLNAL  1600
             +NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQIVTEYK +QLPLVL+AL
Sbjct  406   KNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQIVTEYKKDQLPLVLDAL  465

Query  1601  ERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  1780
             ERM A+LTAAVVSND +F+QEVIGN+VNGTTYAG+R RTTGAPQNHWFGPAGDPRGAGIG
Sbjct  466   ERMHAHLTAAVVSNDPIFIQEVIGNTVNGTTYAGLRGRTTGAPQNHWFGPAGDPRGAGIG  525

Query  1781  TPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TPEAIKLVWSCHREIIYD GPV   W++P +T
Sbjct  526   TPEAIKLVWSCHREIIYDYGPVPHGWEVPPST  557



>gb|KHN18532.1| Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial 
[Glycine soja]
Length=553

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/527 (81%), Positives = 477/527 (91%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HSLPFAT+  E+ISGS+ AEV NLVQG W+ SS+WNT++DPLNG+SFIKVAEV + 
Sbjct  27    SRYAHSLPFATVEAEEISGSRAAEVLNLVQGKWVGSSNWNTVVDPLNGDSFIKVAEVDET  86

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF+ES+  CPKHG HNPFKAPERYLM G+IS KAAHMLSL +V DFFTRLIQRVSPK
Sbjct  87    GIQPFVESLSSCPKHGAHNPFKAPERYLMFGEISAKAAHMLSLHKVLDFFTRLIQRVSPK  146

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  147   SYQQAFGEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  206

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLPLEDVDF+N DGKTMNK
Sbjct  207   PLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHTCGLPLEDVDFINYDGKTMNK  266

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLEG PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DY+AWVCDQDA
Sbjct  267   LLLEGNPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYVAWVCDQDA  326

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL DLT+GPVLT TT +ML+H+NK
Sbjct  327   YACSGQKCSAQSLLFMHENWSKTSLLSKLKDLAERRKLADLTIGPVLTVTTDSMLEHVNK  386

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPGSKLLFGG PLENHSIP IYGAI+PTAV+VPLEEI+KD+N++LVT E+FGPFQ++
Sbjct  387   LLEIPGSKLLFGGSPLENHSIPPIYGAIKPTAVYVPLEEIMKDKNFELVTKEIFGPFQVI  446

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+Y+++QL +VL+ALERM  +LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQN
Sbjct  447   TDYQNSQLAVVLDALERMHNHLTAAVVSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQN  506

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGD RGAGIGTPEAIKLVWSCHREIIYD GPV   W++P +T
Sbjct  507   HWFGPAGDARGAGIGTPEAIKLVWSCHREIIYDFGPVPKNWEVPPST  553



>ref|XP_003525474.1| PREDICTED: probable aldehyde dehydrogenase-like [Glycine max]
Length=542

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/526 (81%), Positives = 478/526 (91%), Gaps = 0/526 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R +HSLPFAT+  E+IS S+PAEV NLVQG W  SS+WNT++DPLNG+SFIKVAEV +  
Sbjct  17    RFAHSLPFATVQAEEISDSRPAEVLNLVQGKWAGSSNWNTVVDPLNGDSFIKVAEVDETG  76

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             +QPF+ES+  CPKHG+HNPFKAPERYLM G+IS KAAHMLSLP+VSDFFTRLIQRVSPKS
Sbjct  77    IQPFVESLSSCPKHGVHNPFKAPERYLMFGEISAKAAHMLSLPKVSDFFTRLIQRVSPKS  136

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             YQQA  EV+VTQKFLENF GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFP
Sbjct  137   YQQAFGEVYVTQKFLENFCGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFP  196

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKPVLKVDSKV IVM+QMLRLLH+CGLPLEDVDF+NSDGKTMNKL
Sbjct  197   LEIPVLQLMGALYMGNKPVLKVDSKVSIVMDQMLRLLHNCGLPLEDVDFINSDGKTMNKL  256

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             LLE  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DYIAWVCDQDAY
Sbjct  257   LLEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVLQEDYIAWVCDQDAY  316

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL DLTVGPVLT TT +ML+H+NKL
Sbjct  317   ACSGQKCSAQSLLFMHENWSKTSLLSKLKDLADRRKLADLTVGPVLTVTTDSMLEHINKL  376

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             L+IPGSKLLFGG+PLE+HSIP IYGA++PTAV+VPLEEI+K +N++LVT E+FGPFQIVT
Sbjct  377   LEIPGSKLLFGGQPLEDHSIPPIYGAMKPTAVYVPLEEIMKAKNFELVTREIFGPFQIVT  436

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             +YK +QL +VL+ALERM  +LTAAVVSND LFLQEVIG SVNGT YAG+RARTTGAPQNH
Sbjct  437   DYKSSQLSVVLDALERMHNHLTAAVVSNDPLFLQEVIGQSVNGTAYAGLRARTTGAPQNH  496

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGD RGAGIGTPEAIKLVWSCHREIIYD GPV   W++P +T
Sbjct  497   WFGPAGDARGAGIGTPEAIKLVWSCHREIIYDFGPVPKNWEVPPST  542



>ref|XP_003609016.1| Delta-1-pyrroline-5-carboxylate dehydrogenase 1 protein [Medicago 
truncatula]
 gb|AES91213.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Medicago truncatula]
Length=553

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/527 (80%), Positives = 475/527 (90%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R+  S+P AT+  E+ISG++PAEV NLV G W+ SS+WNTI+DPLNGE FIKVAEV + 
Sbjct  27    SRSVSSIPLATVEAEEISGARPAEVLNLVHGKWVGSSNWNTIVDPLNGEPFIKVAEVDET  86

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF+ES+  CPKHGLHNPFKAPERYLM GDIS KAA MLSLP+VS+FF +LIQRVSPK
Sbjct  87    GVQPFVESLSSCPKHGLHNPFKAPERYLMYGDISAKAAQMLSLPKVSEFFAKLIQRVSPK  146

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA AEV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  147   SYQQAFAEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  206

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLP+EDVDF+N DGKTMNK
Sbjct  207   PLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHSCGLPVEDVDFINCDGKTMNK  266

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DY AWVCDQDA
Sbjct  267   LLLEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYTAWVCDQDA  326

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWSK+ LI+ +  LA RRKL DLT+GPVLTFTT+++L+H   
Sbjct  327   YACSGQKCSAQSLLFMHENWSKTSLISKLKELAERRKLSDLTIGPVLTFTTESLLEHTKN  386

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPG+KLLFGG+PLE+HSIP +YGAI+PTAV+VP+EEI+KD+NY+LVT E+FGPFQ++
Sbjct  387   LLEIPGAKLLFGGQPLEDHSIPHVYGAIKPTAVYVPIEEIVKDKNYELVTKEIFGPFQVI  446

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+YK +QLP+VL  LE+M A+LTAAVVSND LFLQEVIG SVNGTTYAG+RARTTGAPQN
Sbjct  447   TDYKGSQLPIVLEVLEKMHAHLTAAVVSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQN  506

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GPVS  W++P +T
Sbjct  507   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDYGPVSKDWEIPPST  553



>gb|AAK73756.1| delta-1-pyrroline-5-carboxylate dehydrogenase precursor [Arabidopsis 
thaliana]
Length=556

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/528 (80%), Positives = 480/528 (91%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SGS PAEV + VQG WI SS+ NT+LDPLNGE FIKVAEV ++
Sbjct  29    SRLNHSIPFATVDAEELSGSHPAEVQSFVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDES  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQRV+PK
Sbjct  89    GTQPFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQI
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDNKTYELVTKEIFGPFQI  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL+ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLDALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWELPPST  556



>ref|NP_568955.1| delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Arabidopsis 
thaliana]
 sp|Q8VZC3.1|AL121_ARATH RecName: Full=Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial; Short=AtP5CDH; Short=P5C dehydrogenase; 
AltName: Full=Aldehyde dehydrogenase family 12 member A1; AltName: 
Full=L-glutamate gamma-semialdehyde dehydrogenase; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL38248.1| dehydrogenase [Arabidopsis thaliana]
 gb|AAN31887.1| putative dehydrogenase [Arabidopsis thaliana]
 gb|AAQ56834.1| At5g62530 [Arabidopsis thaliana]
 gb|AED97619.1| delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Arabidopsis 
thaliana]
Length=556

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/528 (80%), Positives = 479/528 (91%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SG+ PAEV + VQG WI SS+ NT+LDPLNGE FIKVAEV ++
Sbjct  29    SRLNHSIPFATVDAEELSGAHPAEVQSFVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDES  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQRV+PK
Sbjct  89    GTQPFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQI
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDNKTYELVTKEIFGPFQI  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWELPPST  556



>dbj|BAB11503.1| dehydrogenase [Arabidopsis thaliana]
Length=556

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/528 (80%), Positives = 480/528 (91%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SG+ PAEV ++VQG WI SS+ NT+LDPLNGE FIKVAEV ++
Sbjct  29    SRLNHSIPFATVDAEELSGAHPAEVMSIVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDES  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQRV+PK
Sbjct  89    GTQPFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQI
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDNKTYELVTKEIFGPFQI  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWELPPST  556



>ref|XP_002866497.1| ALDH12A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42756.1| ALDH12A1 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/528 (79%), Positives = 477/528 (90%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SG+ PAEV + VQG WI SS+ NT+LDPLNGE FIKVAEV + 
Sbjct  29    SRLNHSIPFATVDAEELSGAHPAEVQSFVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDET  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQR +PK
Sbjct  89    GTQPFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRAAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQ+
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQV  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWELPPST  556



>ref|XP_006279602.1| hypothetical protein CARUB_v10026134mg, partial [Capsella rubella]
 gb|EOA12500.1| hypothetical protein CARUB_v10026134mg, partial [Capsella rubella]
Length=588

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/527 (79%), Positives = 477/527 (91%), Gaps = 1/527 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R +HS+PFAT++ E++SG+ PAEV + VQG WI SS+ NT+LDPLNGE FIKVAEV +  
Sbjct  62    RLNHSIPFATVDAEELSGAHPAEVQSFVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDETG  121

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
              QPF++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQRV+PKS
Sbjct  122   TQPFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRVAPKS  181

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             YQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNFP
Sbjct  182   YQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNFP  241

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK+
Sbjct  242   LEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNKI  301

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDAY
Sbjct  302   LLEASPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDAY  361

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  L
Sbjct  362   ACSGQKCSAQSMLFVHENWSKTPLLSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMENL  421

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQIV  1555
             LQIPGSKLLFGG+ L+NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQIV
Sbjct  422   LQIPGSKLLFGGKELKNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQIV  481

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYK +QLPLVL ALERM A+LTAAVVSND +F+QEV+GNSVNGTTYAG+R RTTGAPQN
Sbjct  482   TEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFIQEVVGNSVNGTTYAGLRGRTTGAPQN  541

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  542   HWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPKGWELPSST  588



>ref|XP_010444101.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Camelina sativa]
Length=556

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/528 (79%), Positives = 478/528 (91%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SG+ PAEV + VQG WI SS+ NT+LDPLNGE FIKVAEV + 
Sbjct  29    SRLNHSIPFATVDAEELSGAHPAEVQSFVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDET  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF++S+ +CPKHGLHNPFK+PERYL+ GD+STKAAHML+LP+V+DFF RLIQRV+PK
Sbjct  89    GTQPFVDSLSQCPKHGLHNPFKSPERYLLYGDVSTKAAHMLALPKVADFFARLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPS+YGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQI
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSVYGALEPTAVYVPIEEILKDSQTYELVTKEIFGPFQI  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPHGWELPPST  556



>ref|XP_008437552.1| PREDICTED: probable aldehyde dehydrogenase isoform X1 [Cucumis 
melo]
Length=555

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/526 (80%), Positives = 474/526 (90%), Gaps = 0/526 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R  HS+ F+T+ V+ ISGS+P +V NLVQG WI SS WNTI+DPLNGE FI+VAE+ + E
Sbjct  30    RTVHSMVFSTVEVDQISGSKPGDVLNLVQGKWIGSSGWNTIVDPLNGEPFIRVAEIDETE  89

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             +QPF++S+ KCPKHGLHNPFK+PERYL+ GD+S+KAA +LS PEV+DFF RLIQRVSPKS
Sbjct  90    IQPFVKSLTKCPKHGLHNPFKSPERYLLFGDVSSKAADVLSKPEVTDFFARLIQRVSPKS  149

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             YQQA AEV VT KFL NFSGDQVRFLARSF VPG+HLGQQSHGFRWPYGPVAIVTPFNFP
Sbjct  150   YQQACAEVNVTVKFLRNFSGDQVRFLARSFAVPGDHLGQQSHGFRWPYGPVAIVTPFNFP  209

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH CGLPLED+DF+N DGKTMNKL
Sbjct  210   LEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHHCGLPLEDLDFINCDGKTMNKL  269

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             L+E  P MTLFTGSSRVA+KLA DLKGRIKLEDAGFDWK+LGPDV E DY+AWVCDQDAY
Sbjct  270   LMEANPSMTLFTGSSRVADKLAVDLKGRIKLEDAGFDWKVLGPDVREEDYVAWVCDQDAY  329

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILFMHENWS + LI+ +  LA RR L DLT+GPVLT TT+A+LDHMNKL
Sbjct  330   ACSGQKCSAQSILFMHENWSTTSLISKIKDLAERRNLTDLTIGPVLTLTTEAILDHMNKL  389

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             L+IPG+KLLFGGEPL+NHSIPSIYGAI+PTA+++PLEE++KDENY+LVT E+FGPFQIVT
Sbjct  390   LKIPGAKLLFGGEPLKNHSIPSIYGAIKPTALYIPLEEMMKDENYELVTKEIFGPFQIVT  449

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             EYK +QL +VL+ALERM A+LTAAVVSND LFLQEVIG +VNGTTY G+RARTTGAPQNH
Sbjct  450   EYKRDQLSVVLDALERMHAHLTAAVVSNDPLFLQEVIGKTVNGTTYVGLRARTTGAPQNH  509

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   WK+P AT
Sbjct  510   WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPSHWKIPSAT  555



>ref|XP_010458998.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Camelina sativa]
Length=556

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/528 (79%), Positives = 478/528 (91%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SG+ PAEV + VQG WI SS+ NT+LDPLNGE FIKVAEV ++
Sbjct  29    SRLNHSIPFATVDAEELSGAHPAEVQSFVQGKWIGSSNHNTLLDPLNGEPFIKVAEVDES  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
               QPF++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQRV+PK
Sbjct  89    GTQPFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW  DQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQSDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAERRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPS+YGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQI
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSVYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQI  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWELPPST  556



>ref|XP_010483965.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Camelina sativa]
Length=556

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/528 (79%), Positives = 478/528 (91%), Gaps = 1/528 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HS+PFAT++ E++SG+ PA+V + VQG WI S + NT+LDPLNGE FIKVAEV ++
Sbjct  29    SRLNHSIPFATVDAEELSGAHPAQVQSFVQGTWIGSYNHNTLLDPLNGEPFIKVAEVDES  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             + + F++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+V+DFF RLIQRV+PK
Sbjct  89    DTKLFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVADFFARLIQRVAPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+RWPYGPV IVTPFNF
Sbjct  149   SYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGYRWPYGPVTIVTPFNF  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP EDVDF+NSDGKTMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPAEDVDFINSDGKTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AW CDQDA
Sbjct  269   ILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWQCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AML+HM  
Sbjct  329   YACSGQKCSAQSMLFVHENWSKTPLVSKLKELAGRRKLEDLTIGPVLTFTTEAMLEHMEN  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             LLQIPGSKLLFGG+ L+NHSIPS+YGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQI
Sbjct  389   LLQIPGSKLLFGGKELKNHSIPSVYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQI  448

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEYK +QLPLVL ALERM A+LTAAVVSND +FLQEVIGNSVNGTTYAG+R RTTGAPQ
Sbjct  449   VTEYKKDQLPLVLEALERMHAHLTAAVVSNDPIFLQEVIGNSVNGTTYAGLRGRTTGAPQ  508

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GPV   W+LP +T
Sbjct  509   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPVPQGWELPPST  556



>emb|CDY61347.1| BnaC03g74750D [Brassica napus]
Length=548

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/540 (78%), Positives = 481/540 (89%), Gaps = 10/540 (2%)
 Frame = +2

Query  260   NHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNG  439
             N S  +      +R +HS+PFAT++ E+ISG+ PAEV + VQG WI SS++NT+LDPLNG
Sbjct  18    NKSSSFLASFTSSRLNHSIPFATVDAEEISGAHPAEVQSFVQGKWIGSSNYNTLLDPLNG  77

Query  440   ESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSD  619
             E FIKVAEV+++ +QPF+ES+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+VSD
Sbjct  78    EPFIKVAEVEESGVQPFIESLAQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVSD  137

Query  620   FFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWP  799
             FFTRLIQRV+PKSYQQA  EVFVT+KFLENF GDQVRFLARSF VPGNHLGQQSHG+RWP
Sbjct  138   FFTRLIQRVAPKSYQQAAGEVFVTRKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWP  197

Query  800   YGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDV  979
             YGPV IVTPFNFPLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDV
Sbjct  198   YGPVTIVTPFNFPLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPVEDV  257

Query  980   DFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDE  1159
             DF+NSDGKTMNK+LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPDV E
Sbjct  258   DFINSDGKTMNKILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPDVQE  317

Query  1160  VDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLT  1339
             VDY+AWVCDQDAYACSGQKCSAQS+LF+HENWSK+PL++ +  LA RRKL+DLT+GPVLT
Sbjct  318   VDYVAWVCDQDAYACSGQKCSAQSMLFVHENWSKTPLLSKLKDLAGRRKLEDLTIGPVLT  377

Query  1340  FTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYD  1516
             FTT+AM++HM  LLQIPGSKLLFGG+PL+ HSIPSIYGA+ PTAV+VP+EEILKD + Y+
Sbjct  378   FTTEAMVEHMENLLQIPGSKLLFGGKPLKKHSIPSIYGALEPTAVYVPIEEILKDSKTYE  437

Query  1517  LVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTY  1696
             LVT E+FGPFQIVTEYK +QLPLVL+ALERM A+LTAAV         EVIGNSVNGTTY
Sbjct  438   LVTKEIFGPFQIVTEYKKDQLPLVLDALERMHAHLTAAV---------EVIGNSVNGTTY  488

Query  1697  AGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AG+R RTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD GP+   W+LP +T
Sbjct  489   AGLRGRTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDYGPIPQGWELPPST  548



>ref|XP_006842140.1| hypothetical protein AMTR_s00078p00121310 [Amborella trichopoda]
 gb|ERN03815.1| hypothetical protein AMTR_s00078p00121310 [Amborella trichopoda]
Length=551

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/569 (75%), Positives = 488/569 (86%), Gaps = 18/569 (3%)
 Frame = +2

Query  170   MYQLQAFTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDIS  349
             MY+      LRN + +TA            NH R          ASHSL F+ + VE+IS
Sbjct  1     MYRYNICRSLRNVSRQTAYYSF--------NHGR----------ASHSLSFSDIAVEEIS  42

Query  350   GSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             GS+PAEV+NLVQG+W   S+W+TILDPLNGE FIKVA V   E+ P++ES+ KCPK+GLH
Sbjct  43    GSRPAEVYNLVQGSWKGVSNWSTILDPLNGEPFIKVANVLQTEINPYVESLSKCPKYGLH  102

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             NP ++ ERY++ GDI+ KAA  L+ PEVS FF RLIQRVSPKSY+QALAEV V+QKFLEN
Sbjct  103   NPLRSQERYVLFGDITAKAASFLAQPEVSHFFARLIQRVSPKSYKQALAEVQVSQKFLEN  162

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
             FSGDQVRFL  SFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIP+LQLMGALYMGNK
Sbjct  163   FSGDQVRFLGSSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPLLQLMGALYMGNK  222

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRV  1069
             P+LKVDSKV IVMEQMLRLLH CGL +EDVDF+NSDG TMN++LLE KPRMTLFTGSSRV
Sbjct  223   PILKVDSKVSIVMEQMLRLLHQCGLNMEDVDFINSDGNTMNRILLEAKPRMTLFTGSSRV  282

Query  1070  AEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
             AEKLAGDLKGRIKLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQSILFMHE
Sbjct  283   AEKLAGDLKGRIKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSILFMHE  342

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLEN  1429
             NW  S L++ ++ LA RRKL+DLT+GPVLT TT++ML HMNKLL+IPGSKLLFGGEPLEN
Sbjct  343   NWISSGLVSNLTLLAERRKLEDLTIGPVLTVTTESMLAHMNKLLEIPGSKLLFGGEPLEN  402

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERM  1609
             H+IP IYGAI+PTAVF+PLEEILKD+N++L TTE+FGPFQI+TEYK +QLP+VL+A ERM
Sbjct  403   HNIPKIYGAIKPTAVFIPLEEILKDKNFELATTEIFGPFQILTEYKHDQLPMVLDACERM  462

Query  1610  DANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPE  1789
              A+LTAAVVSND +FLQEV+G SVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTP+
Sbjct  463   HAHLTAAVVSNDPIFLQEVLGRSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPD  522

Query  1790  AIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             AIKLVWSCHREIIYDIGP+   W++P +T
Sbjct  523   AIKLVWSCHREIIYDIGPLPQQWQVPPST  551



>emb|CDY00303.1| BnaA06g22040D [Brassica napus]
Length=547

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/572 (74%), Positives = 493/572 (86%), Gaps = 28/572 (5%)
 Frame = +2

Query  170   MYQLQAFTQLRNRA--TRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVED  343
             MY++ A   LR ++     A ++L S  ++R NHS               +PFAT++ E+
Sbjct  1     MYRVLASRGLRAKSLCDNKASSFLASFTSSRLNHS---------------IPFATVDAEE  45

Query  344   ISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHG  523
             ISG+ PAEV + VQG WI SS++NT+LDPLNGE FIKVAEV+++ +QPF+ES+ +CPKHG
Sbjct  46    ISGAHPAEVQSFVQGKWIGSSNYNTLLDPLNGEPFIKVAEVEESGVQPFIESLAQCPKHG  105

Query  524   LHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFL  703
             LHNPFK+PERYL+ GDISTKAAHML+LP+VSDFFTRLIQRV+PKSYQQA  EVFVT+KFL
Sbjct  106   LHNPFKSPERYLLYGDISTKAAHMLALPKVSDFFTRLIQRVAPKSYQQAAGEVFVTRKFL  165

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPV IVTPFNFPLEIP+LQLMGALYMG
Sbjct  166   ENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVTIVTPFNFPLEIPLLQLMGALYMG  225

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSS  1063
             NKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK+LLE  PRMTLFTGSS
Sbjct  226   NKPLLKVDSKVSIVMEQMMRLLHYCGLPVEDVDFINSDGKTMNKILLEANPRMTLFTGSS  285

Query  1064  RVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             RVAEKLA DLKGRI+LEDAGFDWK+LGPDV EVDY+AWVCDQDAYACSGQKCSAQS+LF+
Sbjct  286   RVAEKLALDLKGRIRLEDAGFDWKVLGPDVQEVDYVAWVCDQDAYACSGQKCSAQSMLFV  345

Query  1244  HENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL  1423
             HENWSK+PL++ +  LA RRKL+DLT+GPVLTFTT+AM++HM  LLQIPGSKLLFGG+PL
Sbjct  346   HENWSKTPLLSKLKDLAGRRKLEDLTIGPVLTFTTEAMVEHMENLLQIPGSKLLFGGKPL  405

Query  1424  ENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQIVTEYKDNQLPLVLNAL  1600
             +NHSIPSIYGA+ PTAV+VP+EEILKD + Y+LVT E+FGPFQIVTEYK +QLPLVL+AL
Sbjct  406   KNHSIPSIYGALEPTAVYVPIEEILKDSKTYELVTKEIFGPFQIVTEYKKDQLPLVLDAL  465

Query  1601  ERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  1780
             ERM A+LTAA          EVIGNSVNGTTYAG+R RTTGAPQNHWFGPAGDPRGAGIG
Sbjct  466   ERMHAHLTAA----------EVIGNSVNGTTYAGLRGRTTGAPQNHWFGPAGDPRGAGIG  515

Query  1781  TPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TPEAIKLVWSCHRE+IYD GP+   W+LP +T
Sbjct  516   TPEAIKLVWSCHREVIYDYGPIPQGWELPPST  547



>ref|XP_004961379.1| PREDICTED: probable aldehyde dehydrogenase-like [Setaria italica]
Length=610

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/527 (80%), Positives = 470/527 (89%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R  H+  FAT++ ++ISGS PAEVHN VQG+W  S++WN I+DPLNGE FIK+AEV   
Sbjct  84    SRWLHTPSFATVSPQEISGSNPAEVHNFVQGSWTASANWNWIVDPLNGEKFIKIAEVNGT  143

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++PF+ES+ KCPKHGLHNP KAPERYLM GDIS KAAHML  P VSDFF +LIQRVSPK
Sbjct  144   EIKPFVESLSKCPKHGLHNPLKAPERYLMYGDISAKAAHMLGQPAVSDFFAKLIQRVSPK  203

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ+S+G+RWPYGPVAI+TPFNF
Sbjct  204   SYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQRSNGYRWPYGPVAIITPFNF  263

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQ+MGALYMGNKP+LKVDSKV +VMEQMLRLLHDCGLP ED+DF+NSDG TMNK
Sbjct  264   PLEIPLLQVMGALYMGNKPLLKVDSKVSVVMEQMLRLLHDCGLPAEDMDFINSDGVTMNK  323

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  P+MTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV EVDYIAWVCDQDA
Sbjct  324   LLLEANPKMTLFTGSSRVAEKLAADLKGRVKLEDAGFDWKILGPDVQEVDYIAWVCDQDA  383

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT TT+AM +HMN 
Sbjct  384   YACSGQKCSAQSVLFMHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVTTEAMTEHMNN  443

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPGSK+LFGGEPLENHSIP IYGA++PTAVFVPLEEILK  N++LVT E+FGPFQ+V
Sbjct  444   LLKIPGSKVLFGGEPLENHSIPKIYGALKPTAVFVPLEEILKSGNFELVTKEIFGPFQVV  503

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEY ++QL LVL A ERM+A+LTAAVVSND LFLQ+V+G SVNGTTYAGIRARTTGAPQN
Sbjct  504   TEYSEDQLDLVLEACERMNAHLTAAVVSNDPLFLQDVLGRSVNGTTYAGIRARTTGAPQN  563

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPV   W LP AT
Sbjct  564   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVPKNWSLPSAT  610



>gb|AAL70109.1|AF467542_1 putative aldehyde dehydrogenase WIS1 [Triticum aestivum]
Length=551

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/528 (79%), Positives = 470/528 (89%), Gaps = 0/528 (0%)
 Frame = +2

Query  293   GTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQD  472
              +R  H+  FAT++ E+ISGS PAEV N VQG WI+S++WN I+DPLNGE FIKVAEVQ 
Sbjct  24    ASRWLHTPAFATVSPEEISGSSPAEVQNFVQGKWIKSANWNWIVDPLNGEKFIKVAEVQG  83

Query  473   AELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSP  652
             +E++PF+ES+ KCPKHGLHNP +APERYLM GDISTKAAHML  PEV DFF +L+QRVSP
Sbjct  84    SEIKPFVESLSKCPKHGLHNPLRAPERYLMYGDISTKAAHMLGQPEVLDFFAKLVQRVSP  143

Query  653   KSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFN  832
             KSYQQAL EV V+QKFLENF GDQVRFLARSF VPGNH+GQ S+G+RWP+GPVAI+TPFN
Sbjct  144   KSYQQALLEVQVSQKFLENFCGDQVRFLARSFAVPGNHVGQMSNGYRWPFGPVAIITPFN  203

Query  833   FPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMN  1012
             FPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH+CGLP EDVDF+NSDG TMN
Sbjct  204   FPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHECGLPAEDVDFINSDGITMN  263

Query  1013  KLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQD  1192
             KLLLE  P+MTLFTGSSRVAEKLA DL+GRIKLEDAGFDWKILGPDV EVDYI+WVCDQD
Sbjct  264   KLLLEANPKMTLFTGSSRVAEKLAADLQGRIKLEDAGFDWKILGPDVQEVDYISWVCDQD  323

Query  1193  AYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMN  1372
             AYACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT TT  M++HMN
Sbjct  324   AYACSGQKCSAQSMLFMHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVTTATMIEHMN  383

Query  1373  KLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQI  1552
              LL+IPGSK+LFGGEPL NHSIP IYGAI+PTAVFVPL EILK +N++LVT E+FGPFQ+
Sbjct  384   NLLKIPGSKVLFGGEPLGNHSIPEIYGAIKPTAVFVPLVEILKSDNFELVTKEIFGPFQV  443

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEY ++QL LVL A ERM+A+LTAAVVSND+LFLQEV+G SVNGTTYAGIRARTTGAPQ
Sbjct  444   VTEYSEDQLELVLEACERMNAHLTAAVVSNDKLFLQEVLGRSVNGTTYAGIRARTTGAPQ  503

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP AT
Sbjct  504   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKKWALPAAT  551



>ref|XP_010934233.1| PREDICTED: probable aldehyde dehydrogenase isoform X1 [Elaeis 
guineensis]
Length=554

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/523 (81%), Positives = 469/523 (90%), Gaps = 0/523 (0%)
 Frame = +2

Query  308   HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
             HS PFAT+ VE+ISGS PAEV+NLVQG+W  S++WN + DPLNGE FIKVA VQ+AE++P
Sbjct  32    HSPPFATIAVEEISGSHPAEVYNLVQGDWKASANWNWVPDPLNGEPFIKVANVQEAEIKP  91

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F+ES+ KCPK+GLHNP +  ERYL+LGD+S KAAHML+ PEVSDFF+RLIQRVSPKSY+Q
Sbjct  92    FVESLSKCPKYGLHNPLRGQERYLLLGDVSAKAAHMLAQPEVSDFFSRLIQRVSPKSYKQ  151

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
             AL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNFPLEI
Sbjct  152   ALGEVHVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNFPLEI  211

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
             P+LQLMGALYMGNKP LKVDSKV IVMEQMLRLLH CGLP EDVDF+NSDG TMNK LLE
Sbjct  212   PLLQLMGALYMGNKPTLKVDSKVSIVMEQMLRLLHYCGLPEEDVDFINSDGVTMNKFLLE  271

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
              KPRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV EVDY+AWVCDQDA+ACS
Sbjct  272   AKPRMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQEVDYVAWVCDQDAHACS  331

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILFMHENW  S LI  M  LA RRKL+DLT+GPVLT TT++ML+H++KLL I
Sbjct  332   GQKCSAQSILFMHENWVSSELIPKMLCLAKRRKLEDLTIGPVLTVTTESMLEHIDKLLNI  391

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             PGSKLLFGGEPLENHSIP IYGA++PTAVF+PL EILK  N+DLVT E+FGPFQI+T+YK
Sbjct  392   PGSKLLFGGEPLENHSIPKIYGALKPTAVFIPLTEILKSNNFDLVTKEIFGPFQIITDYK  451

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
              +QL +VL A ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNHWFG
Sbjct  452   HDQLSMVLEACERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQNHWFG  511

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+    ++P AT
Sbjct  512   PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPQHGEIPSAT  554



>ref|XP_006655530.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Oryza brachyantha]
Length=550

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/529 (79%), Positives = 469/529 (89%), Gaps = 0/529 (0%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
             + +R  HS PFAT++ E+ISGS PAEV N VQG+W  S +WN ++DPLNGE FIKVAEVQ
Sbjct  22    LASRCLHSPPFATVSPEEISGSSPAEVQNFVQGSWTASGNWNWLVDPLNGEKFIKVAEVQ  81

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
             +AE++PF++S+  CPKHGLHNP +APERYLM GDIS KAA+ML+ P VSDFF +LIQRVS
Sbjct  82    EAEIKPFVKSLSNCPKHGLHNPLRAPERYLMYGDISAKAANMLAQPVVSDFFAKLIQRVS  141

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSYQQALAEV VTQKFLENF GDQVRFLARSF VPGNHLGQ S+G+RWPYGPVAI+TPF
Sbjct  142   PKSYQQALAEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQSSNGYRWPYGPVAIITPF  201

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CG+P EDVDF+NSDG TM
Sbjct  202   NFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHACGMPAEDVDFINSDGITM  261

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             NKLLLE  P+MTLFTGS RVAEKLA DLKG+IKLEDAGFDWKILGPDV EVDYIAWVCDQ
Sbjct  262   NKLLLEANPKMTLFTGSLRVAEKLAADLKGKIKLEDAGFDWKILGPDVQEVDYIAWVCDQ  321

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQSILFMH+NWS S L++ M +L+ RRKL+DLT+GPVLT TT +M++HM
Sbjct  322   DAYACSGQKCSAQSILFMHKNWSSSGLLDKMKNLSGRRKLEDLTIGPVLTVTTSSMIEHM  381

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
               LL+IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK  N++LVT E+FGPFQ
Sbjct  382   KNLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPLSEILKSGNFELVTREIFGPFQ  441

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             +VTEY D+QL LVL A ERM+A+LTAAVVSN+ LFLQEV+G SVNGTTYAGIRARTTGAP
Sbjct  442   VVTEYSDDQLELVLEACERMNAHLTAAVVSNNPLFLQEVLGRSVNGTTYAGIRARTTGAP  501

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP AT
Sbjct  502   QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKNWALPSAT  550



>gb|AAL70106.1|AF467539_1 putative aldehyde dehydrogenase BIS1 [Hordeum vulgare]
 gb|AAZ91461.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Hordeum vulgare]
Length=551

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/528 (79%), Positives = 468/528 (89%), Gaps = 0/528 (0%)
 Frame = +2

Query  293   GTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQD  472
              +R  H+  FAT++ E+ISGS PAEV N VQG WI+ ++WN I+DPLNGE FIKV EVQ 
Sbjct  24    ASRWLHTPAFATVSPEEISGSSPAEVQNFVQGKWIKPANWNWIVDPLNGEKFIKVGEVQG  83

Query  473   AELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSP  652
             +E++PF+ES+ KCPKHGLHNP +APERYLM GDISTKAAHML  PEV DFF +L+QRVSP
Sbjct  84    SEIKPFVESLSKCPKHGLHNPLRAPERYLMYGDISTKAAHMLGQPEVLDFFAKLVQRVSP  143

Query  653   KSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFN  832
             KSYQQAL EV V+QKFLENF GDQVRFLARSF VPGNH+GQ S+G+RWP+GPVAI+TPFN
Sbjct  144   KSYQQALLEVQVSQKFLENFCGDQVRFLARSFAVPGNHVGQMSNGYRWPFGPVAIITPFN  203

Query  833   FPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMN  1012
             FPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH+CGLP EDVDF+NSDG TMN
Sbjct  204   FPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHECGLPAEDVDFINSDGITMN  263

Query  1013  KLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQD  1192
             KLLLE  P+MTLFTGSSRVAEKLA DL+GRIKLEDAGFDWKILGPDV EVDYI+WVCDQD
Sbjct  264   KLLLEANPKMTLFTGSSRVAEKLAADLQGRIKLEDAGFDWKILGPDVQEVDYISWVCDQD  323

Query  1193  AYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMN  1372
             AYACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT TT  M++HMN
Sbjct  324   AYACSGQKCSAQSMLFMHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVTTSTMIEHMN  383

Query  1373  KLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQI  1552
              LL+IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK +N++LVT E+FGPFQ+
Sbjct  384   NLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPLVEILKSDNFELVTKEIFGPFQV  443

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEY ++QL LVL A ERM+A+LTAAVVSND+LFLQEV+G SVNGTTYAGIRARTTGAPQ
Sbjct  444   VTEYSEDQLELVLEACERMNAHLTAAVVSNDKLFLQEVLGKSVNGTTYAGIRARTTGAPQ  503

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP AT
Sbjct  504   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKNWALPSAT  551



>ref|XP_004152440.1| PREDICTED: probable aldehyde dehydrogenase-like [Cucumis sativus]
 ref|XP_004165453.1| PREDICTED: probable aldehyde dehydrogenase-like [Cucumis sativus]
 gb|KGN64251.1| hypothetical protein Csa_1G045490 [Cucumis sativus]
Length=555

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/526 (79%), Positives = 471/526 (90%), Gaps = 0/526 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R  HS  F+T+ V+ ISGS+P +V NLVQG WI SS WNTI+DPLNGE FI+VAEV + E
Sbjct  30    RTIHSTVFSTVEVDQISGSKPGDVLNLVQGKWIGSSGWNTIVDPLNGEPFIRVAEVNETE  89

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             +QPF++S+ KCPKHGLHNPFK+PERYL+ GD+S+K+A +LS PEV+DFF RLIQRVSPKS
Sbjct  90    IQPFVKSLTKCPKHGLHNPFKSPERYLLFGDVSSKSADVLSKPEVTDFFARLIQRVSPKS  149

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             YQQA AEV VT KFL NFSGDQVRFLARSF VPG+HLGQQSHGFRWPYGPVAI+TPFNFP
Sbjct  150   YQQACAEVNVTVKFLRNFSGDQVRFLARSFAVPGDHLGQQSHGFRWPYGPVAIITPFNFP  209

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH CGLPLED+DF+N DGKTMNK 
Sbjct  210   LEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHHCGLPLEDLDFINCDGKTMNKF  269

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             L+E  P MTLFTGSSRVA+KLA DLKGRIKLEDAGFDWK+LGPDV E DY+AWVCDQDAY
Sbjct  270   LMEANPSMTLFTGSSRVADKLAVDLKGRIKLEDAGFDWKVLGPDVREEDYVAWVCDQDAY  329

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILFMHENWS + LI+ +  LA RR L DLT+GPVLT TT+A+LDH+NKL
Sbjct  330   ACSGQKCSAQSILFMHENWSTTSLISKIKDLAERRNLTDLTIGPVLTLTTEAILDHLNKL  389

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             ++IPG+KLLFGGEPL+NHSIP +YGAI+PTA+++PLEE++KDENY+LVT E+FGPFQIVT
Sbjct  390   IKIPGAKLLFGGEPLKNHSIPPVYGAIKPTALYIPLEEMMKDENYELVTKEIFGPFQIVT  449

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             EYK +QL +VL+ALERM A+LTAAVVSND LFLQEVIGN+VNGTTY G+RARTTGAPQNH
Sbjct  450   EYKRDQLSVVLDALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYVGLRARTTGAPQNH  509

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W +P +T
Sbjct  510   WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPSHWTVPSST  555



>ref|XP_002441445.1| hypothetical protein SORBIDRAFT_09g026810 [Sorghum bicolor]
 gb|EES19875.1| hypothetical protein SORBIDRAFT_09g026810 [Sorghum bicolor]
Length=549

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/527 (79%), Positives = 469/527 (89%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R  H+  FAT++  ++SGS PAEV N VQG+W  S++WN I+DPLNG+ FIKVAEVQ  
Sbjct  23    SRWLHTPSFATVSPHEVSGSSPAEVQNFVQGSWTASANWNWIVDPLNGDQFIKVAEVQGT  82

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++PF+ES+ KCPKHGLHNP KAPERYLM GDIS KAAHML  P VSDFF +LIQRVSPK
Sbjct  83    EIKPFVESLSKCPKHGLHNPLKAPERYLMYGDISAKAAHMLGQPAVSDFFAKLIQRVSPK  142

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ+S+G+RWPYGPVAI+TPFNF
Sbjct  143   SYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQRSNGYRWPYGPVAIITPFNF  202

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQ+MGALYMGNKPVLKVDSKV IVMEQM+RLLHDCGLP ED+DF+NSDG TMNK
Sbjct  203   PLEIPLLQVMGALYMGNKPVLKVDSKVSIVMEQMIRLLHDCGLPAEDMDFINSDGVTMNK  262

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  P+MTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV EVDY+AWVCDQDA
Sbjct  263   LLLEANPKMTLFTGSSRVAEKLAADLKGRVKLEDAGFDWKILGPDVQEVDYVAWVCDQDA  322

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT TT+AM++HMN 
Sbjct  323   YACSGQKCSAQSVLFMHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVTTEAMIEHMNN  382

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+I GSK+LFGGEPL NHSIP IYGA++PTAVFVPLEEILK  N++LVT E+FGPFQ+V
Sbjct  383   LLKIQGSKVLFGGEPLANHSIPKIYGAMKPTAVFVPLEEILKSGNFELVTKEIFGPFQVV  442

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEY ++QL LVL A ERM+A+LTAAVVSND LFLQ+V+G SVNGTTYAGIRARTTGAPQN
Sbjct  443   TEYSEDQLELVLEACERMNAHLTAAVVSNDPLFLQDVLGRSVNGTTYAGIRARTTGAPQN  502

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD+GPV  +W LP AT
Sbjct  503   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDVGPVPKSWALPSAT  549



>gb|EEC79594.1| hypothetical protein OsI_20777 [Oryza sativa Indica Group]
Length=550

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/529 (79%), Positives = 469/529 (89%), Gaps = 0/529 (0%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
             + +R  H+ PFAT++ ++ISGS PAEV N VQG+W  S +WN ++DPLNGE FIKVAEVQ
Sbjct  22    LASRWLHTPPFATVSPQEISGSSPAEVQNFVQGSWTTSGNWNWLVDPLNGEKFIKVAEVQ  81

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
             +AE++PF+ES+  CPKHGLHNP KAPERYLM GDIS KAA+ML  P VSDFF +LIQRVS
Sbjct  82    EAEIKPFVESLSNCPKHGLHNPLKAPERYLMYGDISAKAANMLGQPVVSDFFAKLIQRVS  141

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ S+G+RWPYGPVAI+TPF
Sbjct  142   PKSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQSSNGYRWPYGPVAIITPF  201

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIP+LQLMGALYMGNKPVLKVDSKV IVM+QMLRLLH CG+P EDVDF+NSDG TM
Sbjct  202   NFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMDQMLRLLHACGMPAEDVDFINSDGITM  261

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             NKLLLE  P+MTLFTGSSR+AEKLA DLKG+IKLEDAGFDWKILGPDV EVDYIAWVCDQ
Sbjct  262   NKLLLEANPKMTLFTGSSRIAEKLAADLKGKIKLEDAGFDWKILGPDVQEVDYIAWVCDQ  321

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQSILFMH+NWS S L++ M SL+ RRKL+DLT+GPVLT TT +M++HM
Sbjct  322   DAYACSGQKCSAQSILFMHKNWSSSGLLDKMKSLSERRKLEDLTIGPVLTVTTSSMIEHM  381

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
               LL+IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK  N++LVT E+FGPFQ
Sbjct  382   KNLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPLSEILKSGNFELVTREIFGPFQ  441

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             +VTEY D++L LVL A ERM+A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAP
Sbjct  442   VVTEYSDDELELVLEACERMNAHLTAAVVSNDPLFLQEVLGRSVNGTTYAGIRARTTGAP  501

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP AT
Sbjct  502   QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKNWALPSAT  550



>ref|XP_010029100.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial isoform X3 [Eucalyptus grandis]
Length=499

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/499 (83%), Positives = 460/499 (92%), Gaps = 0/499 (0%)
 Frame = +2

Query  380   VQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYL  559
             +QGNW +S + N ILDPLNGE FIKVAEV + E+QPF+ES+ KCPKHGLHNPFKAPERYL
Sbjct  1     MQGNWTKSKNSNEILDPLNGEPFIKVAEVDETEIQPFVESLSKCPKHGLHNPFKAPERYL  60

Query  560   MLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLA  739
             + GDIS KAAHML+ P+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLENFSGDQVRFLA
Sbjct  61    LYGDISAKAAHMLAQPKVSDFFTRLIQRVAPKSYQQAFGEVYVTQKFLENFSGDQVRFLA  120

Query  740   RSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVC  919
             RSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPV+KVDSKV 
Sbjct  121   RSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVVKVDSKVS  180

Query  920   IVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKG  1099
             IVMEQM+RLLH CGLP+EDVDF+NSDGKTMN+LLLE  PRMTLFTGSSRVAEKLA DLKG
Sbjct  181   IVMEQMMRLLHHCGLPVEDVDFINSDGKTMNRLLLEANPRMTLFTGSSRVAEKLATDLKG  240

Query  1100  RIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINL  1279
             +IKLEDAGFDWK+LGPDV EVDY+AWVCDQDAYACSGQKCSAQSILFMHENWSKS LI+ 
Sbjct  241   QIKLEDAGFDWKVLGPDVQEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWSKSSLISK  300

Query  1280  MSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAI  1459
             M +LA RRKL+DLT+GPVLTFTT  MLDHM+ LL IPGSKLLFGGEPLENHSIP IYGA+
Sbjct  301   MRNLAERRKLEDLTIGPVLTFTTGQMLDHMSSLLCIPGSKLLFGGEPLENHSIPHIYGAL  360

Query  1460  RPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVS  1639
             +PTAV+VP++EILK+EN++LVT E+FGPFQIVTEYKD+QLP +L+ALERM A+LTAAVVS
Sbjct  361   KPTAVYVPIDEILKEENFELVTREIFGPFQIVTEYKDDQLPKILDALERMHAHLTAAVVS  420

Query  1640  NDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHR  1819
             ND LFLQEVIG +VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHR
Sbjct  421   NDPLFLQEVIGKTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHR  480

Query  1820  EIIYDIGPVSPAWKLPQAT  1876
             EIIYD GP+   W++P  T
Sbjct  481   EIIYDFGPLPKHWEVPPPT  499



>gb|AAZ91463.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum turgidum]
Length=551

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/528 (79%), Positives = 468/528 (89%), Gaps = 0/528 (0%)
 Frame = +2

Query  293   GTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQD  472
              +R  H+  FAT++ E+ISGS PAEV N VQG WI+S++WN I+DPLNGE FIKV EVQ 
Sbjct  24    ASRWLHTPAFATVSPEEISGSSPAEVQNFVQGKWIKSANWNWIVDPLNGEKFIKVGEVQG  83

Query  473   AELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSP  652
             +E++PF+ES+ KCPKHGLHNP +APERYLM GDISTKAAHML  PEV DFF +L+QRVSP
Sbjct  84    SEIKPFVESLSKCPKHGLHNPLRAPERYLMYGDISTKAAHMLGQPEVLDFFAKLVQRVSP  143

Query  653   KSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFN  832
             KSYQQAL EV V+QKFLENF GDQVRFLARSF VPGNH+GQ S+G+RWP+GPVAI+TPFN
Sbjct  144   KSYQQALLEVQVSQKFLENFCGDQVRFLARSFAVPGNHVGQMSNGYRWPFGPVAIITPFN  203

Query  833   FPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMN  1012
             FPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH+CGLP EDVDF+NSDG TMN
Sbjct  204   FPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHECGLPAEDVDFINSDGITMN  263

Query  1013  KLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQD  1192
             KLLLE  P+MTLFTGSSRVAEKLA DL+GRIKLEDAGFDWKILGPDV EVDYI+WVCDQD
Sbjct  264   KLLLEANPKMTLFTGSSRVAEKLAADLQGRIKLEDAGFDWKILGPDVQEVDYISWVCDQD  323

Query  1193  AYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMN  1372
             AYACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT TT  M++HMN
Sbjct  324   AYACSGQKCSAQSMLFMHKNWSSSGLLEKMKRLSERRKLEDLTIGPVLTVTTATMIEHMN  383

Query  1373  KLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQI  1552
              LL+IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK+ N++LVT E+FGPFQ+
Sbjct  384   NLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPLVEILKNGNFELVTKEIFGPFQV  443

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEY + QL LVL A ERM+A+LTAAVVSND+LFLQEV+G SVNGTTYAGIRARTTGAPQ
Sbjct  444   VTEYSEEQLDLVLEACERMNAHLTAAVVSNDKLFLQEVLGRSVNGTTYAGIRARTTGAPQ  503

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP AT
Sbjct  504   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKKWALPAAT  551



>ref|XP_008649931.1| PREDICTED: probable aldehyde dehydrogenase isoform X2 [Zea mays]
 gb|AAL70108.1|AF467541_1 putative aldehyde dehydrogenase MIS1 [Zea mays]
 gb|ACN32124.1| unknown [Zea mays]
 gb|AFW78899.1| hypothetical protein ZEAMMB73_854970 [Zea mays]
Length=549

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/527 (78%), Positives = 468/527 (89%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R  H+  FAT++ +++SGS PAEV N VQG+W  S++WN I+DPLNG+ FIKVAEVQ  
Sbjct  23    SRWLHTPSFATVSPQEVSGSSPAEVQNFVQGSWTASANWNWIVDPLNGDKFIKVAEVQGT  82

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++PF+ES+ KCPKHGLHNP KAPERYLM GDIS KAAHML  P V DFF +LIQRVSPK
Sbjct  83    EIKPFVESLSKCPKHGLHNPLKAPERYLMYGDISAKAAHMLGQPAVLDFFAKLIQRVSPK  142

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ+S+G+RWPYGPVAI+TPFNF
Sbjct  143   SYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQRSNGYRWPYGPVAIITPFNF  202

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLHDCGLP ED+DF+NSDG  MNK
Sbjct  203   PLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHDCGLPAEDMDFINSDGAVMNK  262

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  P+MTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV EVDY+AWVCDQDA
Sbjct  263   LLLEANPKMTLFTGSSRVAEKLAADLKGRVKLEDAGFDWKILGPDVQEVDYVAWVCDQDA  322

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT TT+AM++HMN 
Sbjct  323   YACSGQKCSAQSVLFMHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVTTEAMIEHMNN  382

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+I GSK+LFGGEPL NHSIP IYGA++PTAVFVPLEEILK  N++LVT E+FGPFQ+V
Sbjct  383   LLKIRGSKVLFGGEPLANHSIPKIYGAMKPTAVFVPLEEILKSGNFELVTKEIFGPFQVV  442

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEY ++QL LVL A ERM+A+LTAAVVSND LFLQ+V+G SVNGTTYAGIRARTTGAPQN
Sbjct  443   TEYSEDQLELVLEACERMNAHLTAAVVSNDPLFLQDVLGRSVNGTTYAGIRARTTGAPQN  502

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD+GPV  +W LP AT
Sbjct  503   HWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDVGPVPESWALPSAT  549



>gb|EEE64501.1| hypothetical protein OsJ_19352 [Oryza sativa Japonica Group]
Length=550

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/529 (79%), Positives = 468/529 (88%), Gaps = 0/529 (0%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
             + +R  H+ PFAT++ ++ISGS PAEV N VQG+W  S +WN ++DPLNGE FIKVAEVQ
Sbjct  22    LASRWMHTPPFATVSPQEISGSSPAEVQNFVQGSWTTSGNWNWLVDPLNGEKFIKVAEVQ  81

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
             +AE++PF+ES+  CPKHGLHNP KAPERYLM GDIS KAA+ML  P VSDFF +LIQRVS
Sbjct  82    EAEIKPFVESLSNCPKHGLHNPLKAPERYLMYGDISAKAANMLGQPVVSDFFAKLIQRVS  141

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ S+G+RWPYGPVAI+TPF
Sbjct  142   PKSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQSSNGYRWPYGPVAIITPF  201

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIP+LQLMGALYMGNKPVLKVDSKV IVM+QMLRLLH CG+P EDVDF+NSDG TM
Sbjct  202   NFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMDQMLRLLHACGMPAEDVDFINSDGITM  261

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             NKLLLE  P+MTLFTGSSR+AEKLA DLKG+IKLEDAGFDWKILGPDV EVDYIAWVCDQ
Sbjct  262   NKLLLEANPKMTLFTGSSRIAEKLAADLKGKIKLEDAGFDWKILGPDVQEVDYIAWVCDQ  321

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQSILFMH+NWS S L++ M SL+ RRKL+DLT+GPVLT TT +M++HM
Sbjct  322   DAYACSGQKCSAQSILFMHKNWSSSGLLDKMKSLSERRKLEDLTIGPVLTVTTSSMIEHM  381

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
               LL+IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK  N++LVT E+FGPFQ
Sbjct  382   KNLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPLSEILKSGNFELVTREIFGPFQ  441

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             +VTEY D++L LVL A ERM+A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAP
Sbjct  442   VVTEYSDDELELVLEACERMNAHLTAAVVSNDPLFLQEVLGRSVNGTTYAGIRARTTGAP  501

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+     LP AT
Sbjct  502   QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKNRALPSAT  550



>gb|ADC45380.1| putative aldehyde dehydrogenase MIS1 [Cleistogenes songorica]
Length=551

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/536 (77%), Positives = 468/536 (87%), Gaps = 0/536 (0%)
 Frame = +2

Query  269   RPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESF  448
             R YA    G+R  H+  FAT++ ++ISGS PAEV N VQG W  S++W+ I+DPLNGE F
Sbjct  16    RRYAPLAFGSRWLHTPSFATVSPQEISGSNPAEVQNFVQGKWTSSTNWSWIVDPLNGEKF  75

Query  449   IKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFT  628
             IK+AEVQ  E++PF++S+  CPKHGLHNP KAPERYLM GDIS KAAHML  P VSDF  
Sbjct  76    IKIAEVQGTEIKPFVDSLASCPKHGLHNPLKAPERYLMYGDISAKAAHMLGQPAVSDFLA  135

Query  629   RLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGP  808
             +LIQRVSPKSYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ S+G+RWPYGP
Sbjct  136   KLIQRVSPKSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQMSNGYRWPYGP  195

Query  809   VAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFL  988
             VAI+TPFNFPLEIP+LQ+MGALYMGNKPVLKVDSKV IVM+QMLRLLH CGLP ED+DF+
Sbjct  196   VAIITPFNFPLEIPLLQVMGALYMGNKPVLKVDSKVSIVMDQMLRLLHTCGLPAEDMDFI  255

Query  989   NSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDY  1168
             NSDG TMNKLLLE  P+MTLFTGSSRVAEKLA DLKGRIKLEDAGFDWKILGPDV EVDY
Sbjct  256   NSDGVTMNKLLLEANPKMTLFTGSSRVAEKLAADLKGRIKLEDAGFDWKILGPDVQEVDY  315

Query  1169  IAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTT  1348
             IAWVCDQDAYACSGQKCSAQS+LF+H+NWS S L+  M  L+ RRKL+DLT+GPVLT TT
Sbjct  316   IAWVCDQDAYACSGQKCSAQSVLFIHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVTT  375

Query  1349  KAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTT  1528
             +AM++HMN LL+IPGSK+LFGGEPL NHSIP +YGA++PTAVFVPLEEILK  N++LV  
Sbjct  376   EAMMEHMNNLLKIPGSKVLFGGEPLGNHSIPKVYGAMKPTAVFVPLEEILKSGNFELVMK  435

Query  1529  EVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIR  1708
             E+FGPF++VTEY ++QL LVL A ERM+A+LTAAVVSN+ LFLQEV+G SVNGTTYAGIR
Sbjct  436   EIFGPFRVVTEYSEDQLELVLEACERMNAHLTAAVVSNNPLFLQEVLGRSVNGTTYAGIR  495

Query  1709  ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPV   W LP AT
Sbjct  496   ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVPKNWALPSAT  551



>ref|XP_007037249.1| Aldehyde dehydrogenase 12A1 isoform 3 [Theobroma cacao]
 gb|EOY21750.1| Aldehyde dehydrogenase 12A1 isoform 3 [Theobroma cacao]
Length=504

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/500 (82%), Positives = 458/500 (92%), Gaps = 0/500 (0%)
 Frame = +2

Query  377   LVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERY  556
             LVQG W  S++WNT+LDPLNGE FIKVAEV +  +QPF+ES+ KCPKHGLHNPFK+PERY
Sbjct  5     LVQGKWTGSAAWNTLLDPLNGEPFIKVAEVDETGVQPFVESLSKCPKHGLHNPFKSPERY  64

Query  557   LMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFL  736
             L+ GDIS KAAHMLSLP+VSDFFTRLIQRVSPKSYQQAL EV+VT+KFLENFSGDQVRFL
Sbjct  65    LLYGDISAKAAHMLSLPKVSDFFTRLIQRVSPKSYQQALGEVYVTRKFLENFSGDQVRFL  124

Query  737   ARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKV  916
             AR F VPGNH+GQQSHG+RWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKP+LKVDSKV
Sbjct  125   ARCFAVPGNHIGQQSHGYRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPILKVDSKV  184

Query  917   CIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLK  1096
              IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNKLL+E  PRMTLFTGSSRVAEKLA DLK
Sbjct  185   SIVMEQMMRLLHYCGLPVEDVDFINSDGKTMNKLLMEANPRMTLFTGSSRVAEKLAVDLK  244

Query  1097  GRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLIN  1276
             G IKLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSAQSILFMHENWS S LI 
Sbjct  245   GCIKLEDAGFDWKILGPDVEEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWSASSLIP  304

Query  1277  LMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA  1456
              M  LA RRKL DLT+GPVLT TT+AML+H  KLLQI GSKLLFGGEPLENHSIP IYGA
Sbjct  305   KMKYLAERRKLADLTIGPVLTVTTEAMLEHKKKLLQISGSKLLFGGEPLENHSIPPIYGA  364

Query  1457  IRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVV  1636
             ++PTA+++PLEEILKD+NY+LVT E+FGPFQI+T+YK +QLP+VL+ALERM A+LTAAVV
Sbjct  365   LKPTAIYIPLEEILKDDNYELVTKEIFGPFQIITDYKKDQLPMVLDALERMHAHLTAAVV  424

Query  1637  SNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCH  1816
             SND +FLQ VIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCH
Sbjct  425   SNDPIFLQGVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCH  484

Query  1817  REIIYDIGPVSPAWKLPQAT  1876
             REIIYD GP+   W++P +T
Sbjct  485   REIIYDFGPLPRDWEIPPST  504



>ref|XP_010231104.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial [Brachypodium distachyon]
Length=551

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/528 (78%), Positives = 465/528 (88%), Gaps = 0/528 (0%)
 Frame = +2

Query  293   GTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQD  472
              +R  H+  FAT++ E+ISGS PAEV N VQG WI S++ + I+DPLNG+ FIKVAE+Q 
Sbjct  24    ASRWLHTPAFATVSPEEISGSSPAEVQNFVQGKWIASANSSWIVDPLNGDKFIKVAEIQG  83

Query  473   AELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSP  652
             +E++PF+ES+  CPKHGLHNP +APERYLM GDIS KAAH+L  PEV DFF +L+QRVSP
Sbjct  84    SEIKPFVESLSNCPKHGLHNPLRAPERYLMYGDISAKAAHVLGQPEVLDFFAKLVQRVSP  143

Query  653   KSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFN  832
             KSYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ S+G+RWPYGPVAI+TPFN
Sbjct  144   KSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQISNGYRWPYGPVAIITPFN  203

Query  833   FPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMN  1012
             FPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH+CGLP EDVDF+NSDG TMN
Sbjct  204   FPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHECGLPAEDVDFINSDGITMN  263

Query  1013  KLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQD  1192
             KLLLE  P+MTLFTGSSRVAEKLA DL+GRIKLEDAGFDWKILGPDV EVDYI+WVCDQD
Sbjct  264   KLLLEANPKMTLFTGSSRVAEKLAADLQGRIKLEDAGFDWKILGPDVQEVDYISWVCDQD  323

Query  1193  AYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMN  1372
             AYACSGQKCSAQS+LFMH+NWS S L+  M  L+ RR+L+DLT+GPVLT TT +M++HMN
Sbjct  324   AYACSGQKCSAQSMLFMHKNWSSSGLLEKMKGLSERRRLEDLTIGPVLTVTTASMIEHMN  383

Query  1373  KLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQI  1552
              LL IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK  N++LVT E+FGPFQ+
Sbjct  384   NLLNIPGSKVLFGGEPLENHSIPVIYGAFKPTAVFVPLTEILKSGNFELVTKEIFGPFQV  443

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             VTEY ++QL LVL A ERM+A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQ
Sbjct  444   VTEYSEDQLELVLEACERMNAHLTAAVVSNDPLFLQEVLGRSVNGTTYAGIRARTTGAPQ  503

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             NHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYDIGPV   W LP AT
Sbjct  504   NHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDIGPVPKNWALPSAT  551



>ref|XP_008775703.1| PREDICTED: probable aldehyde dehydrogenase isoform X1 [Phoenix 
dactylifera]
Length=555

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/527 (79%), Positives = 469/527 (89%), Gaps = 0/527 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             TR+ HS PFAT+ VE+ISGS PAEVHNLVQG+W  S++ N + DPLNGE FIKVA VQ+A
Sbjct  29    TRSLHSPPFATIAVEEISGSHPAEVHNLVQGDWKASANSNWVPDPLNGEPFIKVANVQEA  88

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++ F+ES+ KCPK+GLHNP +  ERYL+LGD+STKAAHML+ PEV+DFF RLIQRVSPK
Sbjct  89    EIKAFVESLSKCPKYGLHNPLRGQERYLLLGDVSTKAAHMLAQPEVADFFARLIQRVSPK  148

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SY+QAL EV +TQKFLENFSGDQVRFLARSF VPGNHLGQQS+G+RWPYGPVAI+ PFN+
Sbjct  149   SYKQALGEVHITQKFLENFSGDQVRFLARSFAVPGNHLGQQSYGYRWPYGPVAIIAPFNY  208

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP LKVDSKV IVMEQMLRLLH C LP EDVDF+NSDG TMNK
Sbjct  209   PLEIPLLQLMGALYMGNKPTLKVDSKVSIVMEQMLRLLHYCELPKEDVDFINSDGVTMNK  268

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
              +LE KP+MTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV +VDY+AWVCDQDA
Sbjct  269   FILEVKPKMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQKVDYVAWVCDQDA  328

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSILFMHENW  S LI  M SLA RRKL+DLT+GPVLT TT++ML+H++K
Sbjct  329   YACSGQKCSAQSILFMHENWVSSELIPKMQSLAERRKLEDLTIGPVLTVTTESMLEHIDK  388

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL IPGSKLLFGGE LENHSIP IYGA++PTA+F+PL E+LK  N+DLVT E+FGPFQIV
Sbjct  389   LLGIPGSKLLFGGEALENHSIPKIYGALKPTALFIPLTEMLKSNNFDLVTKEIFGPFQIV  448

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+YK +QL +VL+A ERM ++LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQN
Sbjct  449   TDYKQDQLMMVLDACERMHSHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQN  508

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPR AGIGTPEAIKLVWSCHREIIYDIGP+   W++P AT
Sbjct  509   HWFGPAGDPRCAGIGTPEAIKLVWSCHREIIYDIGPLPQHWEIPSAT  555



>ref|XP_008649930.1| PREDICTED: probable aldehyde dehydrogenase isoform X1 [Zea mays]
Length=565

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/543 (76%), Positives = 468/543 (86%), Gaps = 16/543 (3%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R  H+  FAT++ +++SGS PAEV N VQG+W  S++WN I+DPLNG+ FIKVAEVQ  
Sbjct  23    SRWLHTPSFATVSPQEVSGSSPAEVQNFVQGSWTASANWNWIVDPLNGDKFIKVAEVQGT  82

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++PF+ES+ KCPKHGLHNP KAPERYLM GDIS KAAHML  P V DFF +LIQRVSPK
Sbjct  83    EIKPFVESLSKCPKHGLHNPLKAPERYLMYGDISAKAAHMLGQPAVLDFFAKLIQRVSPK  142

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ+S+G+RWPYGPVAI+TPFNF
Sbjct  143   SYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQRSNGYRWPYGPVAIITPFNF  202

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLHDCGLP ED+DF+NSDG  MNK
Sbjct  203   PLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHDCGLPAEDMDFINSDGAVMNK  262

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  P+MTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV EVDY+AWVCDQDA
Sbjct  263   LLLEANPKMTLFTGSSRVAEKLAADLKGRVKLEDAGFDWKILGPDVQEVDYVAWVCDQDA  322

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLT------------  1339
             YACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+GPVLT            
Sbjct  323   YACSGQKCSAQSVLFMHKNWSSSGLLEKMKKLSERRKLEDLTIGPVLTVSQGRSQPFFGG  382

Query  1340  ----FTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDE  1507
                  TT+AM++HMN LL+I GSK+LFGGEPL NHSIP IYGA++PTAVFVPLEEILK  
Sbjct  383   QLTPVTTEAMIEHMNNLLKIRGSKVLFGGEPLANHSIPKIYGAMKPTAVFVPLEEILKSG  442

Query  1508  NYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNG  1687
             N++LVT E+FGPFQ+VTEY ++QL LVL A ERM+A+LTAAVVSND LFLQ+V+G SVNG
Sbjct  443   NFELVTKEIFGPFQVVTEYSEDQLELVLEACERMNAHLTAAVVSNDPLFLQDVLGRSVNG  502

Query  1688  TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHRE+IYD+GPV  +W LP
Sbjct  503   TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDVGPVPESWALP  562

Query  1868  QAT  1876
              AT
Sbjct  563   SAT  565



>ref|XP_008775704.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial isoform X2 [Phoenix dactylifera]
Length=554

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/523 (79%), Positives = 466/523 (89%), Gaps = 0/523 (0%)
 Frame = +2

Query  308   HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
             HS PFAT+ VE+ISGS PAEVHNLVQG+W  S++ N + DPLNGE FIKVA VQ+AE++ 
Sbjct  32    HSPPFATIAVEEISGSHPAEVHNLVQGDWKASANSNWVPDPLNGEPFIKVANVQEAEIKA  91

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F+ES+ KCPK+GLHNP +  ERYL+LGD+STKAAHML+ PEV+DFF RLIQRVSPKSY+Q
Sbjct  92    FVESLSKCPKYGLHNPLRGQERYLLLGDVSTKAAHMLAQPEVADFFARLIQRVSPKSYKQ  151

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
             AL EV +TQKFLENFSGDQVRFLARSF VPGNHLGQQS+G+RWPYGPVAI+ PFN+PLEI
Sbjct  152   ALGEVHITQKFLENFSGDQVRFLARSFAVPGNHLGQQSYGYRWPYGPVAIIAPFNYPLEI  211

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
             P+LQLMGALYMGNKP LKVDSKV IVMEQMLRLLH C LP EDVDF+NSDG TMNK +LE
Sbjct  212   PLLQLMGALYMGNKPTLKVDSKVSIVMEQMLRLLHYCELPKEDVDFINSDGVTMNKFILE  271

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
              KP+MTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV +VDY+AWVCDQDAYACS
Sbjct  272   VKPKMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQKVDYVAWVCDQDAYACS  331

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILFMHENW  S LI  M SLA RRKL+DLT+GPVLT TT++ML+H++KLL I
Sbjct  332   GQKCSAQSILFMHENWVSSELIPKMQSLAERRKLEDLTIGPVLTVTTESMLEHIDKLLGI  391

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             PGSKLLFGGE LENHSIP IYGA++PTA+F+PL E+LK  N+DLVT E+FGPFQIVT+YK
Sbjct  392   PGSKLLFGGEALENHSIPKIYGALKPTALFIPLTEMLKSNNFDLVTKEIFGPFQIVTDYK  451

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
              +QL +VL+A ERM ++LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNHWFG
Sbjct  452   QDQLMMVLDACERMHSHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQNHWFG  511

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PAGDPR AGIGTPEAIKLVWSCHREIIYDIGP+   W++P AT
Sbjct  512   PAGDPRCAGIGTPEAIKLVWSCHREIIYDIGPLPQHWEIPSAT  554



>ref|XP_010934312.1| PREDICTED: probable aldehyde dehydrogenase isoform X2 [Elaeis 
guineensis]
Length=547

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/523 (80%), Positives = 463/523 (89%), Gaps = 7/523 (1%)
 Frame = +2

Query  308   HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
             HS PFAT+ VE+ISGS PAEV+NLVQG+W  S++WN + DPLNGE FIKVA VQ+AE++P
Sbjct  32    HSPPFATIAVEEISGSHPAEVYNLVQGDWKASANWNWVPDPLNGEPFIKVANVQEAEIKP  91

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F+ES+ KCPK+GLHNP +  ERYL+LGD+S KAAHML+ PEVSDFF+RLIQRVSPKSY+Q
Sbjct  92    FVESLSKCPKYGLHNPLRGQERYLLLGDVSAKAAHMLAQPEVSDFFSRLIQRVSPKSYKQ  151

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
             AL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNFPLEI
Sbjct  152   ALGEVHVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNFPLEI  211

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
             P+LQLMGALYMGNKP LKVDSK       MLRLLH CGLP EDVDF+NSDG TMNK LLE
Sbjct  212   PLLQLMGALYMGNKPTLKVDSK-------MLRLLHYCGLPEEDVDFINSDGVTMNKFLLE  264

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
              KPRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV EVDY+AWVCDQDA+ACS
Sbjct  265   AKPRMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQEVDYVAWVCDQDAHACS  324

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILFMHENW  S LI  M  LA RRKL+DLT+GPVLT TT++ML+H++KLL I
Sbjct  325   GQKCSAQSILFMHENWVSSELIPKMLCLAKRRKLEDLTIGPVLTVTTESMLEHIDKLLNI  384

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             PGSKLLFGGEPLENHSIP IYGA++PTAVF+PL EILK  N+DLVT E+FGPFQI+T+YK
Sbjct  385   PGSKLLFGGEPLENHSIPKIYGALKPTAVFIPLTEILKSNNFDLVTKEIFGPFQIITDYK  444

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
              +QL +VL A ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNHWFG
Sbjct  445   HDQLSMVLEACERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQNHWFG  504

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+    ++P AT
Sbjct  505   PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPQHGEIPSAT  547



>ref|XP_009386617.1| PREDICTED: probable aldehyde dehydrogenase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=553

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/524 (78%), Positives = 463/524 (88%), Gaps = 0/524 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R  HS  FAT+ V+ IS S PAEV NLVQG W  SS WN +LDPLNG  FIKVA+VQ+A
Sbjct  27    SRTLHSTSFATVTVDAISSSHPAEVKNLVQGEWKVSSGWNWLLDPLNGSPFIKVADVQEA  86

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++PF+ S+ +CPK+GLHNPF+A +RYL+ GD+S KAA ML+ P+VS+FF RLIQRVSPK
Sbjct  87    EIEPFVHSLCRCPKYGLHNPFRAQDRYLLYGDVSAKAAQMLAQPQVSEFFARLIQRVSPK  146

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SY QAL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNF
Sbjct  147   SYNQALGEVNVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNF  206

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKP++KVDSKV IVMEQMLRLLHDCGLP EDVDF+NSDGKTMNK
Sbjct  207   PLEIPVLQLMGALYMGNKPIIKVDSKVSIVMEQMLRLLHDCGLPREDVDFINSDGKTMNK  266

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL E KP+MTLFTGSSRVAE LA DLKGRIKLEDAG+DWKILGPDV EVDY+AWVCDQDA
Sbjct  267   LLREAKPQMTLFTGSSRVAESLAVDLKGRIKLEDAGYDWKILGPDVQEVDYVAWVCDQDA  326

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSILF+HENW+ S L++ M  LA RRKL DLT+GPVLT TT++ML+H+ K
Sbjct  327   YACSGQKCSAQSILFIHENWASSELLSKMQLLAGRRKLQDLTIGPVLTVTTESMLEHIQK  386

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPGS+LLFGGE LENHSIP IYGA++PTAVFVPL EILK +N++LVT E+FGPFQI+
Sbjct  387   LLKIPGSELLFGGEELENHSIPKIYGALKPTAVFVPLAEILKPDNFELVTKEIFGPFQII  446

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T YK +QL  VLN  ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQN
Sbjct  447   TYYKHDQLTEVLNVCERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQN  506

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREII+DIGP+   W++P
Sbjct  507   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIHDIGPLPQNWEVP  550



>ref|XP_009386618.1| PREDICTED: probable aldehyde dehydrogenase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=552

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/523 (79%), Positives = 462/523 (88%), Gaps = 0/523 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R  HS  FAT+ V+ IS S PAEV NLVQG W  SS WN +LDPLNG  FIKVA+VQ+AE
Sbjct  27    RTLHSTSFATVTVDAISSSHPAEVKNLVQGEWKVSSGWNWLLDPLNGSPFIKVADVQEAE  86

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             ++PF+ S+ +CPK+GLHNPF+A +RYL+ GD+S KAA ML+ P+VS+FF RLIQRVSPKS
Sbjct  87    IEPFVHSLCRCPKYGLHNPFRAQDRYLLYGDVSAKAAQMLAQPQVSEFFARLIQRVSPKS  146

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             Y QAL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNFP
Sbjct  147   YNQALGEVNVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNFP  206

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKP++KVDSKV IVMEQMLRLLHDCGLP EDVDF+NSDGKTMNKL
Sbjct  207   LEIPVLQLMGALYMGNKPIIKVDSKVSIVMEQMLRLLHDCGLPREDVDFINSDGKTMNKL  266

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             L E KP+MTLFTGSSRVAE LA DLKGRIKLEDAG+DWKILGPDV EVDY+AWVCDQDAY
Sbjct  267   LREAKPQMTLFTGSSRVAESLAVDLKGRIKLEDAGYDWKILGPDVQEVDYVAWVCDQDAY  326

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILF+HENW+ S L++ M  LA RRKL DLT+GPVLT TT++ML+H+ KL
Sbjct  327   ACSGQKCSAQSILFIHENWASSELLSKMQLLAGRRKLQDLTIGPVLTVTTESMLEHIQKL  386

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             L+IPGS+LLFGGE LENHSIP IYGA++PTAVFVPL EILK +N++LVT E+FGPFQI+T
Sbjct  387   LKIPGSELLFGGEELENHSIPKIYGALKPTAVFVPLAEILKPDNFELVTKEIFGPFQIIT  446

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
              YK +QL  VLN  ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNH
Sbjct  447   YYKHDQLTEVLNVCERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQNH  506

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             WFGPAGDPRGAGIGTPEAIKLVWSCHREII+DIGP+   W++P
Sbjct  507   WFGPAGDPRGAGIGTPEAIKLVWSCHREIIHDIGPLPQNWEVP  549



>ref|XP_006439642.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
 gb|ESR52882.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
Length=510

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/483 (82%), Positives = 452/483 (94%), Gaps = 0/483 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R++H+LPFATL  ++ISGS+P EV+NLVQG W  SS+W+T+LDPLNGE FI++AEV + 
Sbjct  26    SRSAHTLPFATLEADEISGSKPGEVYNLVQGKWTGSSNWSTLLDPLNGEQFIRIAEVGEK  85

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E+QP++ES+ KCPKHGLHNPFK+PERYL+ GDISTKAAHMLSLP+VS+FFTRLIQRVSPK
Sbjct  86    EIQPYVESLSKCPKHGLHNPFKSPERYLLYGDISTKAAHMLSLPKVSNFFTRLIQRVSPK  145

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL+EV VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNF
Sbjct  146   SYQQALSEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNF  205

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK
Sbjct  206   PLEIPLLQLMGALYMGNKPILKVDSKVSIVMEQMIRLLHYCGLPVEDVDFINSDGKTMNK  265

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL+E  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY++WVCDQDA
Sbjct  266   LLMEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVNEVDYVSWVCDQDA  325

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWS + L++ M  LA RRKL+DLTVGPVLTFTT+AML+HMNK
Sbjct  326   YACSGQKCSAQSVLFMHENWSSTSLLSKMKDLADRRKLEDLTVGPVLTFTTEAMLEHMNK  385

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+FGPFQIV
Sbjct  386   LLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIV  445

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYK +QLPLVLNALERM A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RARTTGAPQN
Sbjct  446   TEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQN  505

Query  1736  HWF  1744
             HW+
Sbjct  506   HWW  508



>gb|KCW83537.1| hypothetical protein EUGRSUZ_B00436 [Eucalyptus grandis]
Length=511

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/500 (81%), Positives = 451/500 (90%), Gaps = 0/500 (0%)
 Frame = +2

Query  242   LGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTI  421
             +G  R   S   +   + +R+ HSLPFAT+N E+ISGS+PAEV N VQGNW +S + N I
Sbjct  12    IGGPRNGRSWLSSFHHLSSRSLHSLPFATVNAEEISGSRPAEVENFVQGNWTKSKNSNEI  71

Query  422   LDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLS  601
             LDPLNGE FIKVAEV + E+QPF+ES+ KCPKHGLHNPFKAPERYL+ GDIS KAAHML+
Sbjct  72    LDPLNGEPFIKVAEVDETEIQPFVESLSKCPKHGLHNPFKAPERYLLYGDISAKAAHMLA  131

Query  602   LPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQS  781
              P+VSDFFTRLIQRV+PKSYQQA  EV+VTQKFLENFSGDQVRFLARSFGVPGNHLGQQS
Sbjct  132   QPKVSDFFTRLIQRVAPKSYQQAFGEVYVTQKFLENFSGDQVRFLARSFGVPGNHLGQQS  191

Query  782   HGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCG  961
             HGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPV+KVDSKV IVMEQM+RLLH CG
Sbjct  192   HGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVVKVDSKVSIVMEQMMRLLHHCG  251

Query  962   LPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKIL  1141
             LP+EDVDF+NSDGKTMN+LLLE  PRMTLFTGSSRVAEKLA DLKG+IKLEDAGFDWK+L
Sbjct  252   LPVEDVDFINSDGKTMNRLLLEANPRMTLFTGSSRVAEKLATDLKGQIKLEDAGFDWKVL  311

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLT  1321
             GPDV EVDY+AWVCDQDAYACSGQKCSAQSILFMHENWSKS LI+ M +LA RRKL+DLT
Sbjct  312   GPDVQEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWSKSSLISKMRNLAERRKLEDLT  371

Query  1322  VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILK  1501
             +GPVLTFTT  MLDHM+ LL IPGSKLLFGGEPLENHSIP IYGA++PTAV+VP++EILK
Sbjct  372   IGPVLTFTTGQMLDHMSSLLCIPGSKLLFGGEPLENHSIPHIYGALKPTAVYVPIDEILK  431

Query  1502  DENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSV  1681
             +EN++LVT E+FGPFQIVTEYKD+QLP +L+ALERM A+LTAAVVSND LFLQEVIG +V
Sbjct  432   EENFELVTREIFGPFQIVTEYKDDQLPKILDALERMHAHLTAAVVSNDPLFLQEVIGKTV  491

Query  1682  NGTTYAGIRARTTGAPQNHW  1741
             NGTTYAG+RARTTGAPQNHW
Sbjct  492   NGTTYAGLRARTTGAPQNHW  511



>ref|XP_010086568.1| Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Morus notabilis]
 gb|EXB20723.1| Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1 [Morus notabilis]
Length=648

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/650 (65%), Positives = 474/650 (73%), Gaps = 114/650 (18%)
 Frame = +2

Query  239   SLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAEVHNLVQ-----------  385
             S+G   P+ +    +    +R+ HSLPFAT+ VE+ISGS+PAEVHNL Q           
Sbjct  9     SIGARAPHAALSLFSSFNLSRSVHSLPFATVEVEEISGSKPAEVHNLAQVQDLDIELCGP  68

Query  386   ----------------------------------GNWIRSSSWNTILDPLNGESFIKVAE  463
                                               G W  S  WNT++DPLNGE FIKVAE
Sbjct  69    AHGPKTHMAHGPKTHMAPIIMGGLDPAPAPLATVGKWTTSPCWNTLVDPLNGEPFIKVAE  128

Query  464   VQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQR  643
             + +   QPF+ES+ KCPKHGLHNPFK PERYL+ GDIS KAAH+LS P+VSDFFTRLIQR
Sbjct  129   IDEKGTQPFVESLSKCPKHGLHNPFKDPERYLLFGDISAKAAHLLSQPKVSDFFTRLIQR  188

Query  644   VSPKSYQQALA----------------EVFVTQKF-----LENFSGD-------------  721
             VSPKSYQQA A                E+  + KF     +  + GD             
Sbjct  189   VSPKSYQQAYAEVYVTRKFLENFSDGVEIGASWKFRYLGSIVQYEGDIEKDIQHRIKAGL  248

Query  722   -------------------------QVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTP  826
                                       VRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TP
Sbjct  249   VKWKNAMGVLCDGKMPIKLKGKFYRTVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITP  308

Query  827   FNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKT  1006
             FNFPLEIPVLQLMGALYMGNKP+LKVDSKV IVM+QM+RLLH  GLP EDVDF+NSDGKT
Sbjct  309   FNFPLEIPVLQLMGALYMGNKPLLKVDSKVSIVMDQMMRLLHYAGLPAEDVDFINSDGKT  368

Query  1007  MNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCD  1186
             MNKLLLE  PRMTLFTGSSRVA+KLA DLKGRIKLEDAGFDWKILGPDV E DY+AWVCD
Sbjct  369   MNKLLLEANPRMTLFTGSSRVADKLAVDLKGRIKLEDAGFDWKILGPDVQEEDYVAWVCD  428

Query  1187  QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDH  1366
             QDAYACSGQKCSAQSILFMHENW++S LI+ M  LAARRKL+DLT+GPVLTFTT AML+H
Sbjct  429   QDAYACSGQKCSAQSILFMHENWNQSKLISKMRELAARRKLEDLTIGPVLTFTTGAMLEH  488

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
             +NKLL IPGSKLLFGGEPLENHSIP IYGA++PTAV+VPLEE+LKDENY+LVTTE+FGPF
Sbjct  489   INKLLLIPGSKLLFGGEPLENHSIPPIYGALKPTAVYVPLEELLKDENYELVTTEIFGPF  548

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGA  1726
             QI+T+YK +QLPLVL+ALE+M A+LTAA          EVIG SVNGTTYAG+RARTTGA
Sbjct  549   QIITDYKKDQLPLVLDALEKMHAHLTAA----------EVIGKSVNGTTYAGLRARTTGA  598

Query  1727  PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GP+   W++P +T
Sbjct  599   PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDFGPLPKQWEIPPST  648



>gb|KHN48669.1| Putative aldehyde dehydrogenase [Glycine soja]
Length=504

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/526 (75%), Positives = 443/526 (84%), Gaps = 38/526 (7%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R +HSLPFAT+  E+IS S+PAEV NLVQG W  SS+WNT++DPLNG+SFIKVAEV +  
Sbjct  17    RFAHSLPFATVQAEEISDSRPAEVLNLVQGKWAGSSNWNTVVDPLNGDSFIKVAEVDETG  76

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             +QPF+ES+  CPKHG+HNPFKAPERYLM G+IS KAAHMLSLP                 
Sbjct  77    IQPFVESLSSCPKHGVHNPFKAPERYLMFGEISAKAAHMLSLP-----------------  119

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
                                  +VRFLARSFGVPGNHLGQQSHGFRWPYGPVAI+TPFNFP
Sbjct  120   ---------------------KVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFP  158

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKPVLKVDSKV IVM+QMLRLLH+CGLPLEDVDF+NSDGKTMNKL
Sbjct  159   LEIPVLQLMGALYMGNKPVLKVDSKVSIVMDQMLRLLHNCGLPLEDVDFINSDGKTMNKL  218

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             LLE  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DYIAWVCDQDAY
Sbjct  219   LLEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVLQEDYIAWVCDQDAY  278

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL DLTVGPVLT TT +ML+H+NKL
Sbjct  279   ACSGQKCSAQSLLFMHENWSKTSLLSKLKDLADRRKLADLTVGPVLTVTTDSMLEHINKL  338

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             L+IPGSKLLFGG+PLE+HSIP IYGA++PTAV+VPLEEI+K +N++LVT E+FGPFQIVT
Sbjct  339   LEIPGSKLLFGGQPLEDHSIPPIYGAMKPTAVYVPLEEIMKAKNFELVTREIFGPFQIVT  398

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             +YK +QL +VL+ALERM  +LTAAVVSND LFLQEVIG SVNGT YAG+RARTTGAPQNH
Sbjct  399   DYKSSQLSVVLDALERMHNHLTAAVVSNDPLFLQEVIGQSVNGTAYAGLRARTTGAPQNH  458

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGD RGAGIGTPEAIKLVWSCHREIIYD GPV   W++P +T
Sbjct  459   WFGPAGDARGAGIGTPEAIKLVWSCHREIIYDFGPVPKNWEVPPST  504



>gb|AAT39215.1| putative aldehyde dehydrogenase [Oryza sativa Japonica Group]
Length=513

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/529 (74%), Positives = 436/529 (82%), Gaps = 37/529 (7%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
             + +R  H+ PFAT++ ++ISGS PAEV N VQG+W  S +WN ++DPLNGE FIKVAEVQ
Sbjct  22    LASRWMHTPPFATVSPQEISGSSPAEVQNFVQGSWTTSGNWNWLVDPLNGEKFIKVAEVQ  81

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
             +AE++PF+ES+  CPKHGLHNP KAPERYLM GDIS KAA+ML  P VSDFF +LIQRVS
Sbjct  82    EAEIKPFVESLSNCPKHGLHNPLKAPERYLMYGDISAKAANMLGQPVVSDFFAKLIQRVS  141

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ S+G+RWPYGPVAI+TPF
Sbjct  142   PKSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQSSNGYRWPYGPVAIITPF  201

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIP+LQLMGALYMGNKPVLKVDSKV IVM+QMLRLLH CG+P EDVDF+NSDG TM
Sbjct  202   NFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMDQMLRLLHACGMPAEDVDFINSDGITM  261

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             NKLLLE  P+MTLFTGSSR+AEKLA DLKG+IKLEDAGFDWKILGPDV EVDYIAWVCDQ
Sbjct  262   NKLLLEANPKMTLFTGSSRIAEKLAADLKGKIKLEDAGFDWKILGPDVQEVDYIAWVCDQ  321

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQSILFMH+NWS S L++ M SL+ RRKL+DLT+GPVLT TT +M++HM
Sbjct  322   DAYACSGQKCSAQSILFMHKNWSSSGLLDKMKSLSERRKLEDLTIGPVLTVTTSSMIEHM  381

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
               LL+IPGSK+LFGGEPLENHSIP IYGA +PTAVFVPL EILK  N++LVT E+FGPF 
Sbjct  382   KNLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAVFVPLSEILKSGNFELVTREIFGPF-  440

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
                                                 QEV+G SVNGTTYAGIRARTTGAP
Sbjct  441   ------------------------------------QEVLGRSVNGTTYAGIRARTTGAP  464

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+     LP AT
Sbjct  465   QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKNRALPSAT  513



>gb|EMT22667.1| Putative aldehyde dehydrogenase [Aegilops tauschii]
Length=529

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/543 (72%), Positives = 437/543 (80%), Gaps = 52/543 (10%)
 Frame = +2

Query  293   GTRASHSLPFATLNVEDISGSQPAEVHNLV---------------QGNWIRSSSWNTILD  427
              +R  H+  FAT++ E+ISGS PAEV N V               QG WI+S++WN I+D
Sbjct  24    ASRWLHTPAFATVSPEEISGSSPAEVQNFVKYAISPHPLTKLSSVQGKWIKSANWNWIVD  83

Query  428   PLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLP  607
             PLNGE FIKVAEVQ +E++PF+ES+ KCPKHGLHNP +APERYLM GDISTKAAHML  P
Sbjct  84    PLNGEKFIKVAEVQGSEIKPFVESLSKCPKHGLHNPLRAPERYLMYGDISTKAAHMLGQP  143

Query  608   EVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHG  787
             EV DFF +L+QRVSPKSYQQAL EV V+QKFLENF GDQVRFLARSF VPGNH+GQ S+G
Sbjct  144   EVLDFFAKLVQRVSPKSYQQALLEVQVSQKFLENFCGDQVRFLARSFAVPGNHVGQMSNG  203

Query  788   FRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLP  967
             +RWP+GPVAI+TPFNFPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH+CGLP
Sbjct  204   YRWPFGPVAIITPFNFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHECGLP  263

Query  968   LEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGP  1147
              EDVDF+NSDG TMNKLLLE  P+MTLFTGSSRVAEKLA DL+GRIKLEDAGFDWKILGP
Sbjct  264   AEDVDFINSDGITMNKLLLEANPKMTLFTGSSRVAEKLAADLQGRIKLEDAGFDWKILGP  323

Query  1148  DVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVG  1327
             DV EVDYI+WVCDQDAYACSGQKCSAQS+LFMH+NWS S L+  M  L+ RRKL+DLT+G
Sbjct  324   DVQEVDYISWVCDQDAYACSGQKCSAQSMLFMHKNWSSSGLLEKMKKLSERRKLEDLTIG  383

Query  1328  PVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDE  1507
             PVLT TT  M++HMN LL+IPGSK+LFGGEPL NHSIP IYGAI+PTAVFVPL EILK +
Sbjct  384   PVLTVTTATMIEHMNNLLKIPGSKVLFGGEPLGNHSIPEIYGAIKPTAVFVPLVEILKSD  443

Query  1508  NYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNG  1687
             N++LVT E+FGPF                                     QEV+G SVNG
Sbjct  444   NFELVTKEIFGPF-------------------------------------QEVLGRSVNG  466

Query  1688  TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP
Sbjct  467   TTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKKWALP  526

Query  1868  QAT  1876
              AT
Sbjct  527   AAT  529



>ref|XP_010934383.1| PREDICTED: probable aldehyde dehydrogenase isoform X3 [Elaeis 
guineensis]
Length=519

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/523 (75%), Positives = 436/523 (83%), Gaps = 35/523 (7%)
 Frame = +2

Query  308   HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
             HS PFAT+ VE+ISGS PAEV+NLVQG+W  S++WN + DPLNGE FIKVA VQ+AE++P
Sbjct  32    HSPPFATIAVEEISGSHPAEVYNLVQGDWKASANWNWVPDPLNGEPFIKVANVQEAEIKP  91

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F+ES+ KCPK+GLHNP +  ERYL+LGD+S KAAHML+ PEVSDFF+RLIQRVSPKSY+Q
Sbjct  92    FVESLSKCPKYGLHNPLRGQERYLLLGDVSAKAAHMLAQPEVSDFFSRLIQRVSPKSYKQ  151

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
             AL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPV+IV         
Sbjct  152   ALGEVHVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVSIV---------  202

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
                                       MEQMLRLLH CGLP EDVDF+NSDG TMNK LLE
Sbjct  203   --------------------------MEQMLRLLHYCGLPEEDVDFINSDGVTMNKFLLE  236

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
              KPRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV EVDY+AWVCDQDA+ACS
Sbjct  237   AKPRMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQEVDYVAWVCDQDAHACS  296

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILFMHENW  S LI  M  LA RRKL+DLT+GPVLT TT++ML+H++KLL I
Sbjct  297   GQKCSAQSILFMHENWVSSELIPKMLCLAKRRKLEDLTIGPVLTVTTESMLEHIDKLLNI  356

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             PGSKLLFGGEPLENHSIP IYGA++PTAVF+PL EILK  N+DLVT E+FGPFQI+T+YK
Sbjct  357   PGSKLLFGGEPLENHSIPKIYGALKPTAVFIPLTEILKSNNFDLVTKEIFGPFQIITDYK  416

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
              +QL +VL A ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNHWFG
Sbjct  417   HDQLSMVLEACERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQNHWFG  476

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+    ++P AT
Sbjct  477   PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPQHGEIPSAT  519



>ref|XP_008437559.1| PREDICTED: probable aldehyde dehydrogenase isoform X2 [Cucumis 
melo]
Length=511

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 435/526 (83%), Gaps = 44/526 (8%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R  HS+ F+T+ V+ ISGS+P +V NLVQG WI SS WNTI+DPLNGE FI+VAE+ + E
Sbjct  30    RTVHSMVFSTVEVDQISGSKPGDVLNLVQGKWIGSSGWNTIVDPLNGEPFIRVAEIDETE  89

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             +QPF++S+ KCPKHGLHNPFK+PERYL+ GD+S+KAA +LS PEV+DFF RLIQRVSPKS
Sbjct  90    IQPFVKSLTKCPKHGLHNPFKSPERYLLFGDVSSKAADVLSKPEVTDFFARLIQRVSPKS  149

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             YQQA AEV VT KFL NFSGDQVRFLARSF VPG+HLGQQSHGFRWPYGPVAIVTPFNFP
Sbjct  150   YQQACAEVNVTVKFLRNFSGDQVRFLARSFAVPGDHLGQQSHGFRWPYGPVAIVTPFNFP  209

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIPVLQLMGALYMGNKPVLKVDSKV IVMEQM+RLLH CGLPLED+DF+N DGKTMNKL
Sbjct  210   LEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMIRLLHHCGLPLEDLDFINCDGKTMNKL  269

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             L+                                            E DY+AWVCDQDAY
Sbjct  270   LM--------------------------------------------EEDYVAWVCDQDAY  285

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILFMHENWS + LI+ +  LA RR L DLT+GPVLT TT+A+LDHMNKL
Sbjct  286   ACSGQKCSAQSILFMHENWSTTSLISKIKDLAERRNLTDLTIGPVLTLTTEAILDHMNKL  345

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             L+IPG+KLLFGGEPL+NHSIPSIYGAI+PTA+++PLEE++KDENY+LVT E+FGPFQIVT
Sbjct  346   LKIPGAKLLFGGEPLKNHSIPSIYGAIKPTALYIPLEEMMKDENYELVTKEIFGPFQIVT  405

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             EYK +QL +VL+ALERM A+LTAAVVSND LFLQEVIG +VNGTTY G+RARTTGAPQNH
Sbjct  406   EYKRDQLSVVLDALERMHAHLTAAVVSNDPLFLQEVIGKTVNGTTYVGLRARTTGAPQNH  465

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   WK+P AT
Sbjct  466   WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPSHWKIPSAT  511



>gb|EMS51321.1| putative aldehyde dehydrogenase [Triticum urartu]
Length=540

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/554 (70%), Positives = 436/554 (79%), Gaps = 63/554 (11%)
 Frame = +2

Query  293   GTRASHSLPFATLNVEDISGSQPAEVHNLV--------------------------QGNW  394
              +R  H+  FAT++ E+ISGS PAEV N V                          QG W
Sbjct  24    ASRWLHTPAFATVSPEEISGSSPAEVQNFVSSMTIMFPTEVKYAMSPHPLTKLNSVQGKW  83

Query  395   IRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDI  574
             I+S++WN I+DPLNGE FIKV EVQ +E++PF+ES+ KCPKHGLHNP +APERYLM GDI
Sbjct  84    IKSANWNWIVDPLNGEKFIKVGEVQGSEIKPFVESLSKCPKHGLHNPLRAPERYLMYGDI  143

Query  575   STKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGV  754
             STKAAHML  PEV DFF +L+QRVSPKSYQQAL EV V+QKFLENF GDQVRFLARSF V
Sbjct  144   STKAAHMLGQPEVLDFFAKLVQRVSPKSYQQALLEVQVSQKFLENFCGDQVRFLARSFAV  203

Query  755   PGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQ  934
             PGNH+GQ S+G+RWP+GPVAI+TPFNFPLEIP+LQLMGALYMGNKPVLKVDSKV IVMEQ
Sbjct  204   PGNHVGQMSNGYRWPFGPVAIITPFNFPLEIPLLQLMGALYMGNKPVLKVDSKVSIVMEQ  263

Query  935   MLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLE  1114
             M+RLLH+CGLP EDVDF+NSDG TMNKLLLE  P+MTLFTGSSRVAEKLA DL+GRIKLE
Sbjct  264   MIRLLHECGLPAEDVDFINSDGITMNKLLLEANPKMTLFTGSSRVAEKLAADLQGRIKLE  323

Query  1115  DAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLA  1294
             DAGFDWKILGPDV EVDYI+WVCDQDAYACSGQKCSAQS+LFMH+NWS S L+  M  L+
Sbjct  324   DAGFDWKILGPDVQEVDYISWVCDQDAYACSGQKCSAQSMLFMHKNWSSSGLLEKMKRLS  383

Query  1295  ARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAV  1474
              RRKL+DLT+GPVLT TT  M++HMN LL+IPGSK+LFGGEPLENHSIP IYGA +PTAV
Sbjct  384   ERRKLEDLTIGPVLTVTTATMIEHMNNLLKIPGSKVLFGGEPLENHSIPEIYGAFKPTAV  443

Query  1475  FVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLF  1654
             FVPL EILK+ N++LVT E+FGPF                                    
Sbjct  444   FVPLVEILKNGNFELVTKEIFGPF------------------------------------  467

Query  1655  LQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD  1834
              QEV+G SVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD
Sbjct  468   -QEVLGRSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD  526

Query  1835  IGPVSPAWKLPQAT  1876
             IGP+   W LP AT
Sbjct  527   IGPLPKKWALPAAT  540



>ref|XP_010934450.1| PREDICTED: probable aldehyde dehydrogenase isoform X4 [Elaeis 
guineensis]
Length=516

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/523 (74%), Positives = 433/523 (83%), Gaps = 38/523 (7%)
 Frame = +2

Query  308   HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
             HS PFAT+ VE+ISGS PAEV+NLVQG+W  S++WN + DPLNGE FIKVA VQ+AE++P
Sbjct  32    HSPPFATIAVEEISGSHPAEVYNLVQGDWKASANWNWVPDPLNGEPFIKVANVQEAEIKP  91

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F+ES+ KCPK+GLHNP +  ERYL+LGD+S KAAHML+ PEV                  
Sbjct  92    FVESLSKCPKYGLHNPLRGQERYLLLGDVSAKAAHMLAQPEV------------------  133

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
                                 RFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNFPLEI
Sbjct  134   --------------------RFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNFPLEI  173

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
             P+LQLMGALYMGNKP LKVDSKV IVMEQMLRLLH CGLP EDVDF+NSDG TMNK LLE
Sbjct  174   PLLQLMGALYMGNKPTLKVDSKVSIVMEQMLRLLHYCGLPEEDVDFINSDGVTMNKFLLE  233

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
              KPRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV EVDY+AWVCDQDA+ACS
Sbjct  234   AKPRMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQEVDYVAWVCDQDAHACS  293

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILFMHENW  S LI  M  LA RRKL+DLT+GPVLT TT++ML+H++KLL I
Sbjct  294   GQKCSAQSILFMHENWVSSELIPKMLCLAKRRKLEDLTIGPVLTVTTESMLEHIDKLLNI  353

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             PGSKLLFGGEPLENHSIP IYGA++PTAVF+PL EILK  N+DLVT E+FGPFQI+T+YK
Sbjct  354   PGSKLLFGGEPLENHSIPKIYGALKPTAVFIPLTEILKSNNFDLVTKEIFGPFQIITDYK  413

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
              +QL +VL A ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNHWFG
Sbjct  414   HDQLSMVLEACERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIRARTTGAPQNHWFG  473

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+    ++P AT
Sbjct  474   PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPQHGEIPSAT  516



>ref|XP_006439641.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
 gb|ESR52881.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
Length=485

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/455 (82%), Positives = 424/455 (93%), Gaps = 0/455 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R++H+LPFATL  ++ISGS+P EV+NLVQG W  SS+W+T+LDPLNGE FI++AEV + 
Sbjct  26    SRSAHTLPFATLEADEISGSKPGEVYNLVQGKWTGSSNWSTLLDPLNGEQFIRIAEVGEK  85

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E+QP++ES+ KCPKHGLHNPFK+PERYL+ GDISTKAAHMLSLP+VS+FFTRLIQRVSPK
Sbjct  86    EIQPYVESLSKCPKHGLHNPFKSPERYLLYGDISTKAAHMLSLPKVSNFFTRLIQRVSPK  145

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL+EV VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNF
Sbjct  146   SYQQALSEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNF  205

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK
Sbjct  206   PLEIPLLQLMGALYMGNKPILKVDSKVSIVMEQMIRLLHYCGLPVEDVDFINSDGKTMNK  265

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL+E  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY++WVCDQDA
Sbjct  266   LLMEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVNEVDYVSWVCDQDA  325

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWS + L++ M  LA RRKL+DLTVGPVLTFTT+AML+HMNK
Sbjct  326   YACSGQKCSAQSVLFMHENWSSTSLLSKMKDLADRRKLEDLTVGPVLTFTTEAMLEHMNK  385

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+FGPFQIV
Sbjct  386   LLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIV  445

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ  1660
             TEYK +QLPLVLNALERM A+LTAAVVSND LFLQ
Sbjct  446   TEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ  480



>ref|XP_007037250.1| Aldehyde dehydrogenase 12A1 isoform 4, partial [Theobroma cacao]
 gb|EOY21751.1| Aldehyde dehydrogenase 12A1 isoform 4, partial [Theobroma cacao]
Length=453

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/453 (83%), Positives = 416/453 (92%), Gaps = 0/453 (0%)
 Frame = +2

Query  383   QGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLM  562
             QG W  S++WNT+LDPLNGE FIKVAEV +  +QPF+ES+ KCPKHGLHNPFK+PERYL+
Sbjct  1     QGKWTGSAAWNTLLDPLNGEPFIKVAEVDETGVQPFVESLSKCPKHGLHNPFKSPERYLL  60

Query  563   LGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLAR  742
              GDIS KAAHMLSLP+VSDFFTRLIQRVSPKSYQQAL EV+VT+KFLENFSGDQVRFLAR
Sbjct  61    YGDISAKAAHMLSLPKVSDFFTRLIQRVSPKSYQQALGEVYVTRKFLENFSGDQVRFLAR  120

Query  743   SFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCI  922
              F VPGNH+GQQSHG+RWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKP+LKVDSKV I
Sbjct  121   CFAVPGNHIGQQSHGYRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPILKVDSKVSI  180

Query  923   VMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGR  1102
             VMEQM+RLLH CGLP+EDVDF+NSDGKTMNKLL+E  PRMTLFTGSSRVAEKLA DLKG 
Sbjct  181   VMEQMMRLLHYCGLPVEDVDFINSDGKTMNKLLMEANPRMTLFTGSSRVAEKLAVDLKGC  240

Query  1103  IKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLM  1282
             IKLEDAGFDWKILGPDV+EVDY+AWVCDQDAYACSGQKCSAQSILFMHENWS S LI  M
Sbjct  241   IKLEDAGFDWKILGPDVEEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWSASSLIPKM  300

Query  1283  SSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIR  1462
               LA RRKL DLT+GPVLT TT+AML+H  KLLQI GSKLLFGGEPLENHSIP IYGA++
Sbjct  301   KYLAERRKLADLTIGPVLTVTTEAMLEHKKKLLQISGSKLLFGGEPLENHSIPPIYGALK  360

Query  1463  PTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSN  1642
             PTA+++PLEEILKD+NY+LVT E+FGPFQI+T+YK +QLP+VL+ALERM A+LTAAVVSN
Sbjct  361   PTAIYIPLEEILKDDNYELVTKEIFGPFQIITDYKKDQLPMVLDALERMHAHLTAAVVSN  420

Query  1643  DQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             D +FLQ VIGN+VNGTTYAG+RARTTGAPQNHW
Sbjct  421   DPIFLQGVIGNTVNGTTYAGLRARTTGAPQNHW  453



>ref|XP_006439644.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
 gb|ESR52884.1| hypothetical protein CICLE_v10019562mg [Citrus clementina]
Length=487

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/455 (82%), Positives = 424/455 (93%), Gaps = 0/455 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R++H+LPFATL  ++ISGS+P EV+NLVQG W  SS+W+T+LDPLNGE FI++AEV + 
Sbjct  26    SRSAHTLPFATLEADEISGSKPGEVYNLVQGKWTGSSNWSTLLDPLNGEQFIRIAEVGEK  85

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E+QP++ES+ KCPKHGLHNPFK+PERYL+ GDISTKAAHMLSLP+VS+FFTRLIQRVSPK
Sbjct  86    EIQPYVESLSKCPKHGLHNPFKSPERYLLYGDISTKAAHMLSLPKVSNFFTRLIQRVSPK  145

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQAL+EV VTQKFLENF GDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNF
Sbjct  146   SYQQALSEVQVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNF  205

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP+EDVDF+NSDGKTMNK
Sbjct  206   PLEIPLLQLMGALYMGNKPILKVDSKVSIVMEQMIRLLHYCGLPVEDVDFINSDGKTMNK  265

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LL+E  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV+EVDY++WVCDQDA
Sbjct  266   LLMEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVNEVDYVSWVCDQDA  325

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWS + L++ M  LA RRKL+DLTVGPVLTFTT+AML+HMNK
Sbjct  326   YACSGQKCSAQSVLFMHENWSSTSLLSKMKDLADRRKLEDLTVGPVLTFTTEAMLEHMNK  385

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+FGPFQIV
Sbjct  386   LLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIV  445

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ  1660
             TEYK +QLPLVLNALERM A+LTAAVVSND LFLQ
Sbjct  446   TEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ  480



>ref|XP_002989905.1| hypothetical protein SELMODRAFT_184908 [Selaginella moellendorffii]
 gb|EFJ08918.1| hypothetical protein SELMODRAFT_184908 [Selaginella moellendorffii]
Length=526

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/519 (74%), Positives = 431/519 (83%), Gaps = 0/519 (0%)
 Frame = +2

Query  302   ASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAEL  481
             +S +L FAT+  +D+S + P +V NLV+G W +S   + + DPLNG  FI V E    EL
Sbjct  3     SSSALAFATVYPDDLSTAHPYQVENLVRGKWGKSLKSSKLPDPLNGGEFITVPEATGHEL  62

Query  482   QPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSY  661
               ++ES++ CPK GLHNP K PERYL+ GDIS +AA  L   EV  FF RLIQRVSPKSY
Sbjct  63    PEYIESLQSCPKSGLHNPLKNPERYLLYGDISARAASSLKHREVGHFFARLIQRVSPKSY  122

Query  662   QQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPL  841
             QQA AEV VTQKFLENFSGDQVRFLA+SF  PGNHLGQQS G+RWPYGPVAI+TPFNFPL
Sbjct  123   QQAQAEVTVTQKFLENFSGDQVRFLAKSFAAPGNHLGQQSIGYRWPYGPVAIITPFNFPL  182

Query  842   EIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLL  1021
             EIPVLQLMGALYMGNK ++KVDSKV +VMEQMLRLLH CGLP  D DF+N DG  MNKLL
Sbjct  183   EIPVLQLMGALYMGNKALVKVDSKVSVVMEQMLRLLHACGLPPNDTDFINCDGPVMNKLL  242

Query  1022  LEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYA  1201
             +E KP MTLFTGSSRVAEKLA DLKGRIKLEDAGFDWKILGPDV+E+DY+AWVCDQDAYA
Sbjct  243   VEAKPSMTLFTGSSRVAEKLALDLKGRIKLEDAGFDWKILGPDVNEIDYVAWVCDQDAYA  302

Query  1202  CSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLL  1381
             CSGQKCSAQSILFMHENWS    +  +   AA+RKLDDLT+GPVLT TTK MLDHM KLL
Sbjct  303   CSGQKCSAQSILFMHENWSSRNFVEKLKQQAAKRKLDDLTIGPVLTVTTKTMLDHMEKLL  362

Query  1382  QIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
              IPGS + FGG+PLENHSIP +YGAI PTAVFVPL+EILKDE++DLVT E+FGPFQ++TE
Sbjct  363   SIPGSSIAFGGKPLENHSIPDVYGAIEPTAVFVPLKEILKDEHFDLVTKEIFGPFQVITE  422

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             YK  +LPLVL A ERM A+LTAAVVSND  FLQEV+G +VNGTTYAGIRARTTGAPQNHW
Sbjct  423   YKQCELPLVLRACERMHAHLTAAVVSNDVEFLQEVLGETVNGTTYAGIRARTTGAPQNHW  482

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAW  1858
             FGPAGDP GAGIGTPEAIKLVWSCHREII D GPV   W
Sbjct  483   FGPAGDPLGAGIGTPEAIKLVWSCHREIIQDFGPVPKNW  521



>ref|XP_002968656.1| hypothetical protein SELMODRAFT_90262 [Selaginella moellendorffii]
 gb|EFJ29772.1| hypothetical protein SELMODRAFT_90262 [Selaginella moellendorffii]
Length=526

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/519 (74%), Positives = 432/519 (83%), Gaps = 0/519 (0%)
 Frame = +2

Query  302   ASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAEL  481
             +S +L FAT+  +D+S + P +V NLV+G W +S   + + DPLNG  FI V E    EL
Sbjct  3     SSSALAFATVYPDDLSTAHPYQVENLVRGRWGKSLKSSKLPDPLNGGEFITVPEATGHEL  62

Query  482   QPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSY  661
               ++ES++ CPK GLHNP K PERYL+ GDIS +AA  L   EV  FF RLIQRVSPKSY
Sbjct  63    PEYIESLQSCPKSGLHNPLKNPERYLLYGDISARAASSLKHREVGHFFARLIQRVSPKSY  122

Query  662   QQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPL  841
             QQA AEV VTQKFLENFSGDQVRFLA+SF  PGNHLGQQS G+RWPYGPVAI+TPFNFPL
Sbjct  123   QQAQAEVTVTQKFLENFSGDQVRFLAKSFAAPGNHLGQQSIGYRWPYGPVAIITPFNFPL  182

Query  842   EIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLL  1021
             EIPVLQLMGALYMGNK ++KVDSKV +VMEQMLRLLH CGLP  D DF+N DG  MNKLL
Sbjct  183   EIPVLQLMGALYMGNKALVKVDSKVSVVMEQMLRLLHACGLPPNDTDFINCDGPVMNKLL  242

Query  1022  LEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYA  1201
             +E KP MTLFTGSSRVAEKLA DLKGRIKLEDAGFDWKILGPDV+E+DY+AWVCDQDAYA
Sbjct  243   VEAKPSMTLFTGSSRVAEKLALDLKGRIKLEDAGFDWKILGPDVNEIDYVAWVCDQDAYA  302

Query  1202  CSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLL  1381
             CSGQKCSAQSILFMHENWS    +  +  LAA+RKLDDLT+GPVLT TTK MLDHM KLL
Sbjct  303   CSGQKCSAQSILFMHENWSSRNFVEKLKQLAAKRKLDDLTIGPVLTVTTKTMLDHMEKLL  362

Query  1382  QIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
              IPGS + FGG+PLENHSIP +YGAI PTA+FVPL+EILKDE++DLVT E+FGPFQ++TE
Sbjct  363   SIPGSSVAFGGKPLENHSIPDVYGAIEPTAIFVPLKEILKDEHFDLVTKEIFGPFQVITE  422

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             +K  +LPLVL A ERM A+LTAAVVSND  FLQEV+G +VNGTTYAGIRARTTGAPQNHW
Sbjct  423   FKQCELPLVLRACERMHAHLTAAVVSNDVEFLQEVLGETVNGTTYAGIRARTTGAPQNHW  482

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAW  1858
             FGPAGDP GAGIGTPEAIKLVWSCHREII D GPV   W
Sbjct  483   FGPAGDPLGAGIGTPEAIKLVWSCHREIIQDFGPVPKNW  521



>ref|XP_001760169.1| mitochondrial P5CDH [Physcomitrella patens]
 gb|EDQ74925.1| mitochondrial P5CDH [Physcomitrella patens]
Length=571

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/527 (70%), Positives = 431/527 (82%), Gaps = 1/527 (0%)
 Frame = +2

Query  299   RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
             R   SL FA+ + + +S +   ++HNLVQG W ++S    +LDPLNGE FI V +    E
Sbjct  45    RPQSSLSFASCDADKLSEAHQYQMHNLVQGKWEQTSKSIELLDPLNGEKFISVPDTSIDE  104

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             + PF++S+R C K GLHNP K PERYL+ GDI  KAAH+L  P+V  FF RLIQRV+PKS
Sbjct  105   ISPFVQSLRACSKSGLHNPLKNPERYLLYGDIMAKAAHLLKQPQVETFFARLIQRVAPKS  164

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
             + QA+ EV VTQKFLENFSGDQVRFLARSF VPGN+ GQQS+G RWPYGPVAI+TPFNFP
Sbjct  165   FAQAVGEVTVTQKFLENFSGDQVRFLARSFVVPGNYQGQQSNGMRWPYGPVAIITPFNFP  224

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIP LQ +GAL+MGNKP+LKVDSKV IVMEQ +RLLH CG+P  D+DF+NSDG  MNKL
Sbjct  225   LEIPALQALGALFMGNKPILKVDSKVSIVMEQFIRLLHKCGMPPTDMDFINSDGPVMNKL  284

Query  1019  LLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAY  1198
             LLE +P+ TLFTGSS+VAEKLA DLKGR+KLEDAGFDWKILGPDV   DY+AWVCDQDAY
Sbjct  285   LLEAEPKTTLFTGSSKVAEKLALDLKGRVKLEDAGFDWKILGPDVQNEDYVAWVCDQDAY  344

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILFMHENW+    +  +  LA++RKL+DLTVGPVLT TT+ MLDH+  L
Sbjct  345   ACSGQKCSAQSILFMHENWANQNFLERLKKLASKRKLEDLTVGPVLTVTTERMLDHVKNL  404

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILK-DENYDLVTTEVFGPFQIV  1555
             L IPG+++ FGG+PL NH+IP +YGA+ PTAVFVPL+EIL+ +EN+ L TTE+FGPFQI+
Sbjct  405   LAIPGARVEFGGKPLTNHTIPDVYGALEPTAVFVPLKEILRNEENFALATTEIFGPFQIL  464

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             TEYK   LPLV  A ERM A+LTAAVVSND  FLQEV+ N+VNGTTYAGIRARTTGAPQN
Sbjct  465   TEYKHEDLPLVFEACERMHAHLTAAVVSNDVHFLQEVLSNTVNGTTYAGIRARTTGAPQN  524

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPRGAGIGTPEAIKLVWSCHREII D+GP+   W  PQ T
Sbjct  525   HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIQDVGPIPNGWSTPQCT  571



>ref|XP_008649934.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial isoform X4 [Zea mays]
 gb|AFW78898.1| hypothetical protein ZEAMMB73_854970 [Zea mays]
Length=457

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/442 (81%), Positives = 399/442 (90%), Gaps = 0/442 (0%)
 Frame = +2

Query  551   RYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR  730
             RYLM GDIS KAAHML  P V DFF +LIQRVSPKSYQQALAEV V+QKFLENF GDQVR
Sbjct  16    RYLMYGDISAKAAHMLGQPAVLDFFAKLIQRVSPKSYQQALAEVQVSQKFLENFCGDQVR  75

Query  731   FLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDS  910
             FLARSF VPGNHLGQ+S+G+RWPYGPVAI+TPFNFPLEIP+LQLMGALYMGNKPVLKVDS
Sbjct  76    FLARSFAVPGNHLGQRSNGYRWPYGPVAIITPFNFPLEIPLLQLMGALYMGNKPVLKVDS  135

Query  911   KVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGD  1090
             KV IVMEQM+RLLHDCGLP ED+DF+NSDG  MNKLLLE  P+MTLFTGSSRVAEKLA D
Sbjct  136   KVSIVMEQMIRLLHDCGLPAEDMDFINSDGAVMNKLLLEANPKMTLFTGSSRVAEKLAAD  195

Query  1091  LKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPL  1270
             LKGR+KLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQS+LFMH+NWS S L
Sbjct  196   LKGRVKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSVLFMHKNWSSSGL  255

Query  1271  INLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIY  1450
             +  M  L+ RRKL+DLT+GPVLT TT+AM++HMN LL+I GSK+LFGGEPL NHSIP IY
Sbjct  256   LEKMKKLSERRKLEDLTIGPVLTVTTEAMIEHMNNLLKIRGSKVLFGGEPLANHSIPKIY  315

Query  1451  GAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAA  1630
             GA++PTAVFVPLEEILK  N++LVT E+FGPFQ+VTEY ++QL LVL A ERM+A+LTAA
Sbjct  316   GAMKPTAVFVPLEEILKSGNFELVTKEIFGPFQVVTEYSEDQLELVLEACERMNAHLTAA  375

Query  1631  VVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWS  1810
             VVSND LFLQ+V+G SVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWS
Sbjct  376   VVSNDPLFLQDVLGRSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWS  435

Query  1811  CHREIIYDIGPVSPAWKLPQAT  1876
             CHRE+IYD+GPV  +W LP AT
Sbjct  436   CHREVIYDVGPVPESWALPSAT  457



>gb|KEH31911.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Medicago truncatula]
Length=485

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/455 (78%), Positives = 408/455 (90%), Gaps = 0/455 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R+  S+P AT+  E+ISG++PAEV NLV G W+ SS+WNTI+DPLNGE FIKVAEV + 
Sbjct  27    SRSVSSIPLATVEAEEISGARPAEVLNLVHGKWVGSSNWNTIVDPLNGEPFIKVAEVDET  86

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF+ES+  CPKHGLHNPFKAPERYLM GDIS KAA MLSLP+VS+FF +LIQRVSPK
Sbjct  87    GVQPFVESLSSCPKHGLHNPFKAPERYLMYGDISAKAAQMLSLPKVSEFFAKLIQRVSPK  146

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA AEV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  147   SYQQAFAEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  206

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLP+EDVDF+N DGKTMNK
Sbjct  207   PLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHSCGLPVEDVDFINCDGKTMNK  266

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + DY AWVCDQDA
Sbjct  267   LLLEANPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVHQEDYTAWVCDQDA  326

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LFMHENWSK+ LI+ +  LA RRKL DLT+GPVLTFTT+++L+H   
Sbjct  327   YACSGQKCSAQSLLFMHENWSKTSLISKLKELAERRKLSDLTIGPVLTFTTESLLEHTKN  386

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPG+KLLFGG+PLE+HSIP +YGAI+PTAV+VP+EEI+KD+NY+LVT E+FGPFQ++
Sbjct  387   LLEIPGAKLLFGGQPLEDHSIPHVYGAIKPTAVYVPIEEIVKDKNYELVTKEIFGPFQVI  446

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ  1660
             T+YK +QLP+VL  LE+M A+LTAAVVSND LFLQ
Sbjct  447   TDYKGSQLPIVLEVLEKMHAHLTAAVVSNDPLFLQ  481



>gb|KDO34277.1| aldehyde dehydrogenase [Saprolegnia parasitica CBS 223.65]
Length=547

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/519 (69%), Positives = 431/519 (83%), Gaps = 0/519 (0%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             +A ++ E++SG+ PAE+HNL+ G W+ +S    I DPL GE F+ V   Q  EL+PF+++
Sbjct  29    WAKVDAENVSGAAPAEIHNLLNGEWVSASKAEGIKDPLTGEVFMNVPLTQKDELKPFIDN  88

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             M   PKHGLHNPFK  ERYL+ GD+S KAA  L  P V  +FTRLIQRV+PKSY+QA AE
Sbjct  89    MLATPKHGLHNPFKNVERYLLYGDVSHKAAAELRKPHVLHYFTRLIQRVAPKSYEQAKAE  148

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V VT+KFLENFSGDQVRFLARSFGVPG+HLGQ S G RWPYGPVA++TPFNFP EIP+LQ
Sbjct  149   VVVTRKFLENFSGDQVRFLARSFGVPGDHLGQMSTGHRWPYGPVALITPFNFPFEIPMLQ  208

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             LMGALYMGN+  +K+DSKV +VM + LR+LH CG+P  DVDF+NSDG  MN+LLL+GKP+
Sbjct  209   LMGALYMGNRVTMKLDSKVAVVMYEALRMLHACGMPTTDVDFINSDGPVMNELLLKGKPK  268

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
              TLFTGSS VAEKLA DLKGRIKLEDAGFDWKILGPDV + DY+A+VCDQDAYACSGQKC
Sbjct  269   NTLFTGSSVVAEKLASDLKGRIKLEDAGFDWKILGPDVSDEDYVAFVCDQDAYACSGQKC  328

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSILFMHENW+K+ +   + +LAARR LD+LT+GPVLT TTK MLDH++ LL+IPG++
Sbjct  329   SAQSILFMHENWTKAGIEAKLKALAARRNLDELTIGPVLTVTTKRMLDHVDNLLKIPGAR  388

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             ++FGG+ L+NH+IPS YGAI PTAV+VPL E  K EN++LVTTE+FGPFQI+TEYKD ++
Sbjct  389   VVFGGKELKNHTIPSCYGAIEPTAVYVPLAEAAKPENFELVTTEIFGPFQILTEYKDGEV  448

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
               VLN LERM+A+LTA+VVSND  F Q ++ NSVNGTTY GIRARTTGAPQNHWFGPAGD
Sbjct  449   DTVLNMLERMEAHLTASVVSNDIGFQQHILANSVNGTTYNGIRARTTGAPQNHWFGPAGD  508

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PR   IGTPEAIKLVWSCHREII D GP++ +W  P+AT
Sbjct  509   PRAGAIGTPEAIKLVWSCHREIINDFGPINASWTTPKAT  547



>ref|XP_008912633.1| hypothetical protein PPTG_16640 [Phytophthora parasitica INRA-310]
 gb|ETI35683.1| hypothetical protein F443_18028 [Phytophthora parasitica P1569]
 gb|ETK75929.1| hypothetical protein L915_17547 [Phytophthora parasitica]
 gb|ETL29374.1| hypothetical protein L916_17439 [Phytophthora parasitica]
 gb|ETL82587.1| hypothetical protein L917_17279 [Phytophthora parasitica]
 gb|ETM35834.1| hypothetical protein L914_17342 [Phytophthora parasitica]
 gb|ETN01952.1| hypothetical protein PPTG_16640 [Phytophthora parasitica INRA-310]
 gb|ETO64415.1| hypothetical protein F444_18051 [Phytophthora parasitica P1976]
 gb|ETP05509.1| hypothetical protein F441_17898 [Phytophthora parasitica CJ01A1]
 gb|ETP33636.1| hypothetical protein F442_17867 [Phytophthora parasitica P10297]
Length=547

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/530 (68%), Positives = 433/530 (82%), Gaps = 2/530 (0%)
 Frame = +2

Query  290   VGTRASHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEV  466
             +G RA  SLP FAT++  + SG+ P +  NLV G W +++   TI+DPLNGE+F+ +   
Sbjct  19    LGARAMSSLPSFATVD-PNFSGANPTDGFNLVNGKWTKTAKTETIVDPLNGEAFMTMPLT  77

Query  467   QDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRV  646
             Q  EL PF+ESM  CPKHGLHNP K  ERY+M G++S KA  ML   +V+D+F +L+QR 
Sbjct  78    QKDELAPFVESMTSCPKHGLHNPLKNVERYVMYGEVSAKAGAMLREEKVADYFAKLVQRT  137

Query  647   SPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTP  826
             SPKSY QA  EV VT KFLENFSGDQVRFLARSFGVPG+H GQ S+G RWPYGPVA++TP
Sbjct  138   SPKSYFQARNEVRVTGKFLENFSGDQVRFLARSFGVPGDHQGQTSNGHRWPYGPVALITP  197

Query  827   FNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKT  1006
             FNFP+EIPVLQ+MGALYMGNK +LKVDSKV IVM++ LR+LH+CG+P+ DVDF+NSDG  
Sbjct  198   FNFPIEIPVLQMMGALYMGNKVLLKVDSKVSIVMQETLRMLHECGMPMTDVDFINSDGAV  257

Query  1007  MNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCD  1186
             MN LL++ KPR TLFTGS  VAEKLA DL GRIKLEDAGFDWK+LGPDV + DY+AW  D
Sbjct  258   MNDLLMQVKPRNTLFTGSQAVAEKLAKDLSGRIKLEDAGFDWKVLGPDVRDFDYVAWTSD  317

Query  1187  QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDH  1366
             QDAYACSGQKCSAQS+LFMH+NW+K+ L   ++ LAARRKL DLT+GPVLT TTK MLDH
Sbjct  318   QDAYACSGQKCSAQSVLFMHKNWTKAGLEKKLAELAARRKLSDLTIGPVLTVTTKRMLDH  377

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
                LL+IPG+++ FG E LENH+IP  YGA++PTA+FVPL+E +K EN++LVTTE+FGPF
Sbjct  378   AAALLKIPGARVAFGAEELENHTIPEKYGAVKPTAIFVPLKEFVKPENFELVTTEIFGPF  437

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGA  1726
             QI+TEY D +LP VL+ALERM+A+LTAAVVSNDQ F  EV+  +VNGTTY+GIRARTTGA
Sbjct  438   QILTEYDDKELPEVLDALERMEAHLTAAVVSNDQEFTNEVLSATVNGTTYSGIRARTTGA  497

Query  1727  PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PQNHWFGPAGDP   GIGTPEAIKLVWSCHREII D+GPV   W +P++T
Sbjct  498   PQNHWFGPAGDPCAGGIGTPEAIKLVWSCHREIINDVGPVPANWTIPEST  547



>ref|XP_008611922.1| aldehyde dehydrogenase [Saprolegnia diclina VS20]
 gb|EQC34516.1| aldehyde dehydrogenase [Saprolegnia diclina VS20]
Length=547

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/519 (69%), Positives = 430/519 (83%), Gaps = 0/519 (0%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             +A ++ E++SG+ P E+HNL+ G W+ +S    I DPL GE F+ V   Q  EL+PF+++
Sbjct  29    WAKVDAENVSGAAPTEIHNLLNGEWVSASKVEGIKDPLTGEVFMNVPLTQKDELKPFIDN  88

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             M   PKHGLHNPFK  ERYL+ GD+S KAA  L  P V  +FTRLIQRV+PKSY+QA AE
Sbjct  89    MLATPKHGLHNPFKNVERYLLYGDVSHKAAAELRKPHVLHYFTRLIQRVAPKSYEQAKAE  148

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V VT+KFLENFSGDQVRFLARSFGVPG+HLGQ S G RWPYGPVA++TPFNFP EIP+LQ
Sbjct  149   VVVTRKFLENFSGDQVRFLARSFGVPGDHLGQMSTGHRWPYGPVALITPFNFPFEIPMLQ  208

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             LMGALYMGN+  +K+DSKV +VM + LR+LH CG+P  DVDF+NSDG  MN+LLL+GKP+
Sbjct  209   LMGALYMGNRVTMKLDSKVAVVMYEALRMLHACGMPTSDVDFINSDGPVMNELLLKGKPK  268

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
              TLFTGSS VAEKLA DLKGRIKLEDAGFDWKILGPDV + DY+A+VCDQDAYACSGQKC
Sbjct  269   NTLFTGSSVVAEKLASDLKGRIKLEDAGFDWKILGPDVSDEDYVAFVCDQDAYACSGQKC  328

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSILFMHENW+K+ +   + +LAARR LD+LT+GPVLT TTK MLDH++ LL+IPG++
Sbjct  329   SAQSILFMHENWTKAGIEAKLKTLAARRNLDELTIGPVLTVTTKRMLDHVDNLLKIPGAR  388

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             ++FGG+ L+NHSIPS YGAI PTAV+VPL E  K EN++LVTTE+FGPFQI+TEYKD ++
Sbjct  389   VVFGGKELKNHSIPSCYGAIEPTAVYVPLAEAAKPENFELVTTEIFGPFQILTEYKDGEV  448

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
               VLN LERM+A+LTA+VVSND  F Q ++ N+VNGTTY GIRARTTGAPQNHWFGPAGD
Sbjct  449   DTVLNMLERMEAHLTASVVSNDIGFQQHILANTVNGTTYNGIRARTTGAPQNHWFGPAGD  508

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PR   IGTPEAIKLVWSCHREII D GP++ +W  P+AT
Sbjct  509   PRAGAIGTPEAIKLVWSCHREIINDFGPINTSWTTPKAT  547



>ref|XP_009519821.1| hypothetical protein PHYSODRAFT_481340 [Phytophthora sojae]
 gb|EGZ24533.1| hypothetical protein PHYSODRAFT_481340 [Phytophthora sojae]
Length=530

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/529 (68%), Positives = 431/529 (81%), Gaps = 2/529 (0%)
 Frame = +2

Query  293   GTRASHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQ  469
              TRA  SLP FAT++  D SG+ P +  NLV G W +++   TILDPLNGE+F+ +   Q
Sbjct  3     ATRAVSSLPSFATVD-PDFSGANPTDGFNLVNGKWTKTAKTETILDPLNGEAFMTMPLTQ  61

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
               EL PF+ESM  CPKHGLHNP K  ERY+M G+I  KA  +    +V+D+F RL+QR S
Sbjct  62    KDELAPFVESMTSCPKHGLHNPLKNVERYVMYGEICAKAGALFREDKVADYFARLVQRTS  121

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSY QA  EV VT KFLENFSGDQVRFLARSFGVPG+H GQ SHG+RWPYGPVA++TPF
Sbjct  122   PKSYFQARNEVKVTGKFLENFSGDQVRFLARSFGVPGDHQGQASHGYRWPYGPVALITPF  181

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFP+EIPVLQ+MGAL+MGNK +LKVDSKV IVM++ LRLLH+CG+PL DVDF+NSDG  M
Sbjct  182   NFPIEIPVLQMMGALFMGNKVLLKVDSKVSIVMQETLRLLHECGMPLTDVDFINSDGAVM  241

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             N LLL+ KPR TLFTGS  VAEKLA DL GRIKLEDAGFDWK+LGPDV + DY+AW  DQ
Sbjct  242   NDLLLQIKPRNTLFTGSQAVAEKLAKDLSGRIKLEDAGFDWKVLGPDVRDFDYVAWTADQ  301

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYACSGQKCSAQS+LFMH+NW  + +   ++ LA+RRKL DLT+GPVLT TTK MLDH 
Sbjct  302   DAYACSGQKCSAQSVLFMHKNWVDAGIEKKLAELASRRKLSDLTIGPVLTVTTKRMLDHA  361

Query  1370  NKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
               LL+IPG+++ FG E LENH+IP  YGAI+PTA++VPL+E +K EN++LVTTE+FGPFQ
Sbjct  362   AALLKIPGARVAFGAEELENHTIPEKYGAIKPTAIYVPLKEFVKPENFELVTTEIFGPFQ  421

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             ++T+Y D++LPLVL+ALERM+A+LTAAVVSNDQ F  EV+  +VNGTTY+GIRARTTGAP
Sbjct  422   VLTDYDDSELPLVLDALERMEAHLTAAVVSNDQHFANEVLSATVNGTTYSGIRARTTGAP  481

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDP   GIGTPEAIKLVWSCHREII DIGPV   W +P+AT
Sbjct  482   QNHWFGPAGDPCAGGIGTPEAIKLVWSCHREIINDIGPVPANWTIPEAT  530



>ref|XP_008865914.1| hypothetical protein H310_03722 [Aphanomyces invadans]
 gb|ETW06137.1| hypothetical protein H310_03722 [Aphanomyces invadans]
Length=548

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/526 (69%), Positives = 430/526 (82%), Gaps = 2/526 (0%)
 Frame = +2

Query  305   SHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAEL  481
             +H+LP +A +N E +SGS PAE+HNLV G W+ +     I DP+ GE F+ V   Q  EL
Sbjct  23    AHALPSWAKVNPETLSGSAPAEIHNLVNGEWVSTRKTEGIKDPMTGEVFMHVPLTQKDEL  82

Query  482   QPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSY  661
             QPF++++R  PKHGLHNPFK  ERYL+ G+IS +AA ML  P +  +F RLIQRV+PKSY
Sbjct  83    QPFIDNLRSTPKHGLHNPFKNVERYLLYGEISNRAAAMLREPHIEHYFVRLIQRVAPKSY  142

Query  662   QQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPL  841
              QA  EV VT+KFLENFSGDQVRFLARSFGVPG+HLGQ S+G RWPYGPVA+VTPFNFPL
Sbjct  143   IQAKNEVVVTRKFLENFSGDQVRFLARSFGVPGDHLGQMSNGHRWPYGPVALVTPFNFPL  202

Query  842   EIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLL  1021
             EIPVLQ++GALYMGN+P LK+DSKV +VM + LR+LH CG+PL DVDF+NSDG  MN+LL
Sbjct  203   EIPVLQMLGALYMGNRPTLKLDSKVAVVMYEALRMLHACGMPLNDVDFINSDGPVMNELL  262

Query  1022  LEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYA  1201
             L+G P+ TLFTGSS VAEKLA +LKGRIKLEDAGFDWKILGPDV +VDY+AWV DQDAYA
Sbjct  263   LKGNPKNTLFTGSSVVAEKLAAELKGRIKLEDAGFDWKILGPDVADVDYVAWVSDQDAYA  322

Query  1202  CSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLL  1381
             CSGQKCSAQSILF H+NW+K+ +   +  LAARRKLDDLTVGPVLT TTK MLDH++ LL
Sbjct  323   CSGQKCSAQSILFYHKNWAKAGIEEKIKKLAARRKLDDLTVGPVLTVTTKRMLDHIDALL  382

Query  1382  QIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             +IPG+++ FGG+ L+NHSIPS YGA+ PTAVFVPL E  K EN+DLVTTE+FGPFQI+TE
Sbjct  383   KIPGARVAFGGKELKNHSIPSEYGALEPTAVFVPLSEATKPENFDLVTTEIFGPFQIITE  442

Query  1562  Y-KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             Y  D  +  +L+ LERM+A+LTA+VVSND  F Q ++ ++VNGTTY GIRARTTGAPQNH
Sbjct  443   YDTDADVETILSMLERMEAHLTASVVSNDFAFQQHILAHTVNGTTYNGIRARTTGAPQNH  502

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPR   IGTPEAIKLVWSCHREII D GP+S  W  P AT
Sbjct  503   WFGPAGDPRAGAIGTPEAIKLVWSCHREIINDYGPISKDWTTPTAT  548



>ref|XP_008649932.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial isoform X3 [Zea mays]
 ref|XP_008649933.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial isoform X3 [Zea mays]
Length=473

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/458 (79%), Positives = 399/458 (87%), Gaps = 16/458 (3%)
 Frame = +2

Query  551   RYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR  730
             RYLM GDIS KAAHML  P V DFF +LIQRVSPKSYQQALAEV V+QKFLENF GDQVR
Sbjct  16    RYLMYGDISAKAAHMLGQPAVLDFFAKLIQRVSPKSYQQALAEVQVSQKFLENFCGDQVR  75

Query  731   FLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDS  910
             FLARSF VPGNHLGQ+S+G+RWPYGPVAI+TPFNFPLEIP+LQLMGALYMGNKPVLKVDS
Sbjct  76    FLARSFAVPGNHLGQRSNGYRWPYGPVAIITPFNFPLEIPLLQLMGALYMGNKPVLKVDS  135

Query  911   KVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGD  1090
             KV IVMEQM+RLLHDCGLP ED+DF+NSDG  MNKLLLE  P+MTLFTGSSRVAEKLA D
Sbjct  136   KVSIVMEQMIRLLHDCGLPAEDMDFINSDGAVMNKLLLEANPKMTLFTGSSRVAEKLAAD  195

Query  1091  LKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPL  1270
             LKGR+KLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQS+LFMH+NWS S L
Sbjct  196   LKGRVKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSVLFMHKNWSSSGL  255

Query  1271  INLMSSLAARRKLDDLTVGPVLT----------------FTTKAMLDHMNKLLQIPGSKL  1402
             +  M  L+ RRKL+DLT+GPVLT                 TT+AM++HMN LL+I GSK+
Sbjct  256   LEKMKKLSERRKLEDLTIGPVLTVSQGRSQPFFGGQLTPVTTEAMIEHMNNLLKIRGSKV  315

Query  1403  LFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLP  1582
             LFGGEPL NHSIP IYGA++PTAVFVPLEEILK  N++LVT E+FGPFQ+VTEY ++QL 
Sbjct  316   LFGGEPLANHSIPKIYGAMKPTAVFVPLEEILKSGNFELVTKEIFGPFQVVTEYSEDQLE  375

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
             LVL A ERM+A+LTAAVVSND LFLQ+V+G SVNGTTYAGIRARTTGAPQNHWFGPAGDP
Sbjct  376   LVLEACERMNAHLTAAVVSNDPLFLQDVLGRSVNGTTYAGIRARTTGAPQNHWFGPAGDP  435

Query  1763  RGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             RGAGIGTPEAIKLVWSCHRE+IYD+GPV  +W LP AT
Sbjct  436   RGAGIGTPEAIKLVWSCHREVIYDVGPVPESWALPSAT  473



>emb|CCA15825.1| predicted protein putative [Albugo laibachii Nc14]
Length=551

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/527 (68%), Positives = 432/527 (82%), Gaps = 1/527 (0%)
 Frame = +2

Query  299   RASHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             R   +LP +AT++   ++ ++P    NLV G W  +     I+DPLNGE+F+K+      
Sbjct  25    RDFSALPSWATVDPNGLTRNEPGIGQNLVNGKWTNTKMMEDIVDPLNGETFLKIPSTSKT  84

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             E++PF++S+R+ PK+GLHNP    +RY++ GDIS KAA ML  P+V+DFFTRLIQRVSPK
Sbjct  85    EIEPFIQSLRQTPKYGLHNPLNNVDRYILYGDISHKAAAMLRDPQVADFFTRLIQRVSPK  144

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SY QA  EV VT+KF ENFSGDQVRFLA+SFG PGNH GQ S G+RWPYGPVA++TPFNF
Sbjct  145   SYTQAETEVIVTEKFFENFSGDQVRFLAKSFGAPGNHAGQTSVGYRWPYGPVALITPFNF  204

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             P EIP+LQLMGALYMGNK ++KVDSKV IVM++ LR+LH C LPL+DVD ++S+G+ MN+
Sbjct  205   PFEIPLLQLMGALYMGNKVLIKVDSKVSIVMQEALRMLHACDLPLKDVDLIHSNGQVMNE  264

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             +L   KPR TLFTGSS VAEKLA D+ GRIKLEDAGFDWKILGPDV E DY+AW CDQDA
Sbjct  265   VLTAAKPRNTLFTGSSAVAEKLALDMVGRIKLEDAGFDWKILGPDVHEQDYVAWTCDQDA  324

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQSIL MH+NW  + L + +  LA RRKL +LT+GPVLT TT+ ML H+  
Sbjct  325   YACSGQKCSAQSILLMHQNWVDNGLEDKLQQLAERRKLSNLTIGPVLTVTTERMLGHVKS  384

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPG++L FGG+ L+NHSIP +YGAIRPTAVFVPL+EILK+EN++LVTTE+FGPFQI+
Sbjct  385   LLKIPGARLSFGGKELDNHSIPKVYGAIRPTAVFVPLKEILKEENFELVTTEIFGPFQIL  444

Query  1556  TEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQN  1735
             T+Y DNQ+ LVL  LE+M A+LTAAVVSND+LF Q+V+ +SVNGTTYAGIRARTTGAPQN
Sbjct  445   TKYNDNQVDLVLELLEKMHAHLTAAVVSNDELFRQKVLSHSVNGTTYAGIRARTTGAPQN  504

Query  1736  HWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             HWFGPAGDPR  GIGTPEAIKLVWSCHREII DIGPV  AW +P+AT
Sbjct  505   HWFGPAGDPRAGGIGTPEAIKLVWSCHREIIQDIGPVPKAWTIPEAT  551



>gb|AFK43067.1| unknown [Lotus japonicus]
Length=472

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/435 (82%), Positives = 398/435 (91%), Gaps = 0/435 (0%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
             +R +HSL FAT+  E++SGS+PAEV NLVQG W+ SS+ NTI+DPLNG+SFIKVAEV +A
Sbjct  25    SRYAHSLQFATVEAEEVSGSRPAEVLNLVQGKWVGSSNCNTIVDPLNGDSFIKVAEVDEA  84

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
              +QPF+ES+  CPKHGLHNPFKAPERYLMLGD++TKAAHML LP+VSDFFTRLIQRVSPK
Sbjct  85    GIQPFVESLSSCPKHGLHNPFKAPERYLMLGDVTTKAAHMLLLPKVSDFFTRLIQRVSPK  144

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             SYQQA  EV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNF
Sbjct  145   SYQQAQGEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNF  204

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPVLQLMGALYMGNKPVLKVDSKV I MEQMLRLLH+CGLP EDVDF+NSDGK MNK
Sbjct  205   PLEIPVLQLMGALYMGNKPVLKVDSKVSIAMEQMLRLLHNCGLPAEDVDFINSDGKAMNK  264

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDA  1195
             LLLE  PRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDV + DYIAWVCDQDA
Sbjct  265   LLLEANPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVHQEDYIAWVCDQDA  324

Query  1196  YACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNK  1375
             YACSGQKCSAQS+LF+HENWSK+ LI+ +  LA RRKL DLT+GPVLT TT+ ML+H+NK
Sbjct  325   YACSGQKCSAQSLLFVHENWSKTSLISKLKDLAERRKLADLTIGPVLTVTTETMLEHVNK  384

Query  1376  LLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIV  1555
             LL+IPGSKLLFGG PLE+HSIPSIYGAI+PTAV+VPLEEI+KD+NY+LVT E+FGPFQIV
Sbjct  385   LLEIPGSKLLFGGRPLEDHSIPSIYGAIKPTAVYVPLEEIVKDKNYELVTKEIFGPFQIV  444

Query  1556  TEYKDNQLPLVLNAL  1600
             T+YK +QL +VL+AL
Sbjct  445   TDYKSSQLSIVLDAL  459



>ref|XP_009825076.1| hypothetical protein H257_02935 [Aphanomyces astaci]
 gb|ETV85058.1| hypothetical protein H257_02935 [Aphanomyces astaci]
Length=548

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/526 (67%), Positives = 428/526 (81%), Gaps = 2/526 (0%)
 Frame = +2

Query  305   SHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAEL  481
             +++LP +A +N E +SG+ PAE+HNLV G W+ +     I DPL GE F++V   Q  EL
Sbjct  23    AYALPSWAKVNPETLSGASPAEIHNLVNGEWVSTKKSEGIKDPLTGEVFLQVPLTQKDEL  82

Query  482   QPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSY  661
             +PF++++R  PKHGLHNPFK  ERYL+ GDIS KAA ML  P +  +F RLIQRV+PKSY
Sbjct  83    KPFIDNLRSTPKHGLHNPFKNVERYLLYGDISHKAAAMLREPHIEHYFIRLIQRVAPKSY  142

Query  662   QQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPL  841
              QA  EV VT+KFLENFSGDQVRFLARSFGVPG+HLGQ S G RWPYGPVA++TPFNFP 
Sbjct  143   IQAKNEVVVTRKFLENFSGDQVRFLARSFGVPGDHLGQMSTGHRWPYGPVALITPFNFPF  202

Query  842   EIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLL  1021
             EIP+LQL+GALYMGN+  LK+DSKV +VM + LR+ H CG+PL DVDF+NSDG  MN+LL
Sbjct  203   EIPILQLLGALYMGNRVTLKLDSKVAVVMYEALRMFHACGMPLTDVDFINSDGPVMNELL  262

Query  1022  LEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYA  1201
             L+G P+ TLFTGSS VAEKLA +LKGRIKLEDAGFDWKILGPDV +VDY+AWV DQDAYA
Sbjct  263   LKGNPKNTLFTGSSVVAEKLATELKGRIKLEDAGFDWKILGPDVSDVDYVAWVSDQDAYA  322

Query  1202  CSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLL  1381
             CSGQKCSAQSILF H+NW+K+ + + + +LA+RR+LDDLT+GPVLT TTK MLDH++ LL
Sbjct  323   CSGQKCSAQSILFYHKNWAKAGIEDKLKTLASRRQLDDLTIGPVLTVTTKRMLDHVDDLL  382

Query  1382  QIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             +IPG++L FGG+ L+NHSIPSIYGAI PTAVFVPL E  K E+++LVT E+FGPFQ++TE
Sbjct  383   KIPGARLAFGGKELKNHSIPSIYGAIEPTAVFVPLSEAAKPEHFELVTKEIFGPFQVITE  442

Query  1562  Y-KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             Y  D  +  VL  LERM+A+LTA+VVS+D  F Q ++ N+VNGTTY GIRARTTGAPQNH
Sbjct  443   YDSDADVETVLGMLERMEAHLTASVVSSDIAFQQHILANTVNGTTYNGIRARTTGAPQNH  502

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             WFGPAGDPR   IGTPEAIKLVWSCHREII D GP+   W  P+AT
Sbjct  503   WFGPAGDPRAGAIGTPEAIKLVWSCHREIINDFGPIGADWTTPKAT  548



>ref|XP_006600682.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like isoform X2 [Glycine max]
Length=448

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/441 (80%), Positives = 392/441 (89%), Gaps = 1/441 (0%)
 Frame = +2

Query  554   YLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRF  733
             Y    DIS    ++L       F  RLIQRVSPKSYQQA  EV+VTQKFLENF GDQVRF
Sbjct  9     YKSFADISCLERYLLRQLTCYHFL-RLIQRVSPKSYQQAFGEVYVTQKFLENFCGDQVRF  67

Query  734   LARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSK  913
             LARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKPVLKVDSK
Sbjct  68    LARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPVLKVDSK  127

Query  914   VCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDL  1093
             V IVMEQMLRLLH CGLPLEDVDF+NSDGKTMNKLLLEG PRMTLFTGSSRVAEKLA DL
Sbjct  128   VSIVMEQMLRLLHTCGLPLEDVDFINSDGKTMNKLLLEGNPRMTLFTGSSRVAEKLAVDL  187

Query  1094  KGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLI  1273
             KGR+KLEDAGFDWKILGPDV + DY+AWVCDQDAYACSGQKCSAQS+LFMHENWSK+ L+
Sbjct  188   KGRVKLEDAGFDWKILGPDVHQEDYVAWVCDQDAYACSGQKCSAQSLLFMHENWSKTSLL  247

Query  1274  NLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYG  1453
             + +  LA RRKL DLT+GPVLT TT +ML+H+NKLL+IPGSKLLFGG PLENHSIP IYG
Sbjct  248   SKLKDLAERRKLADLTIGPVLTVTTDSMLEHVNKLLEIPGSKLLFGGSPLENHSIPPIYG  307

Query  1454  AIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAV  1633
             AI+PTAV+VPLEEI+KD+N++LVT E+FGPFQ++T+Y+++QL +VL+ALERM  +LTAAV
Sbjct  308   AIKPTAVYVPLEEIMKDKNFELVTKEIFGPFQVITDYQNSQLAVVLDALERMHNHLTAAV  367

Query  1634  VSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  1813
             VSND LFLQEVIG SVNGTTYAG+RARTTGAPQNHWFGPAGD RGAGIGTPEAIKLVWSC
Sbjct  368   VSNDPLFLQEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDARGAGIGTPEAIKLVWSC  427

Query  1814  HREIIYDIGPVSPAWKLPQAT  1876
             HREIIYD GPV   W++P +T
Sbjct  428   HREIIYDFGPVPKNWEVPPST  448



>ref|XP_006600683.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like isoform X3 [Glycine max]
 ref|XP_006600684.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like isoform X4 [Glycine max]
Length=446

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/418 (83%), Positives = 385/418 (92%), Gaps = 0/418 (0%)
 Frame = +2

Query  623   FTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPY  802
             F RLIQRVSPKSYQQA  EV+VTQKFLENF GDQVRFLARSF VPGNHLGQQSHGFRWPY
Sbjct  29    FLRLIQRVSPKSYQQAFGEVYVTQKFLENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPY  88

Query  803   GPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVD  982
             GPVAI+TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKV IVMEQMLRLLH CGLPLEDVD
Sbjct  89    GPVAIITPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVSIVMEQMLRLLHTCGLPLEDVD  148

Query  983   FLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEV  1162
             F+NSDGKTMNKLLLEG PRMTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV + 
Sbjct  149   FINSDGKTMNKLLLEGNPRMTLFTGSSRVAEKLAVDLKGRVKLEDAGFDWKILGPDVHQE  208

Query  1163  DYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTF  1342
             DY+AWVCDQDAYACSGQKCSAQS+LFMHENWSK+ L++ +  LA RRKL DLT+GPVLT 
Sbjct  209   DYVAWVCDQDAYACSGQKCSAQSLLFMHENWSKTSLLSKLKDLAERRKLADLTIGPVLTV  268

Query  1343  TTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLV  1522
             TT +ML+H+NKLL+IPGSKLLFGG PLENHSIP IYGAI+PTAV+VPLEEI+KD+N++LV
Sbjct  269   TTDSMLEHVNKLLEIPGSKLLFGGSPLENHSIPPIYGAIKPTAVYVPLEEIMKDKNFELV  328

Query  1523  TTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAG  1702
             T E+FGPFQ++T+Y+++QL +VL+ALERM  +LTAAVVSND LFLQEVIG SVNGTTYAG
Sbjct  329   TKEIFGPFQVITDYQNSQLAVVLDALERMHNHLTAAVVSNDPLFLQEVIGKSVNGTTYAG  388

Query  1703  IRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             +RARTTGAPQNHWFGPAGD RGAGIGTPEAIKLVWSCHREIIYD GPV   W++P +T
Sbjct  389   LRARTTGAPQNHWFGPAGDARGAGIGTPEAIKLVWSCHREIIYDFGPVPKNWEVPPST  446



>emb|CCI44680.1| unnamed protein product [Albugo candida]
Length=528

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/525 (68%), Positives = 427/525 (81%), Gaps = 1/525 (0%)
 Frame = +2

Query  305   SHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAEL  481
             ++S+P +AT++  +++ S+P    N V G W  +     I+DPLNGE+F+K+      E+
Sbjct  4     ANSIPSWATVDPNNLTSSKPGIGQNFVNGQWTNTEMTEEIVDPLNGETFLKMPSTSTKEI  63

Query  482   QPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSY  661
             +PF++S+R+ PK+GLHNP    ERY++ GDIS KAA ML  P+V+DFFTRLIQRVSPKSY
Sbjct  64    EPFIQSLRQTPKYGLHNPLNNVERYVLYGDISHKAAAMLRDPQVADFFTRLIQRVSPKSY  123

Query  662   QQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPL  841
              QA  EV VT+KF ENF GDQVRFLA+SFG PGNH+GQ S G+RWPYGPVA++TPFNFP 
Sbjct  124   MQAETEVIVTEKFFENFGGDQVRFLAKSFGAPGNHVGQTSVGYRWPYGPVALITPFNFPF  183

Query  842   EIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLL  1021
             EIP+LQLMGALYMGNK ++KVDSKV IVM++ LR+LH CGLP  DVD ++S+G+ MN +L
Sbjct  184   EIPLLQLMGALYMGNKVLIKVDSKVSIVMQEALRMLHACGLPPRDVDLIHSNGQVMNAVL  243

Query  1022  LEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYA  1201
                KPR TLFTGSS VAEKLA D+ GRIKLEDAGFDWKILGPDV E +Y+AW CDQDAYA
Sbjct  244   TAAKPRNTLFTGSSAVAEKLALDMVGRIKLEDAGFDWKILGPDVHEQEYVAWTCDQDAYA  303

Query  1202  CSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLL  1381
             CSGQKCSAQSILFMH+NW    +   +  LA RRKL +LT+GPVLT TT+ ML H+  LL
Sbjct  304   CSGQKCSAQSILFMHQNWVDVGIEEKLGQLAERRKLSNLTIGPVLTVTTERMLGHVETLL  363

Query  1382  QIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             +IPG++L FGG+ LENHSIP +YGAIRPTAVFVPLEEILK EN++LVTTE+FGPFQI+T+
Sbjct  364   KIPGARLSFGGKELENHSIPKVYGAIRPTAVFVPLEEILKKENFELVTTEIFGPFQILTK  423

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             Y D+QL LVL  LE+M A+LTAAVVSND LF Q+V+  SVNGTTYAGIRARTTGAPQNHW
Sbjct  424   YSDDQLDLVLQLLEKMHAHLTAAVVSNDDLFRQKVLARSVNGTTYAGIRARTTGAPQNHW  483

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             FGPAGDPR  GIGTPEAIKLVWSCHREII DIGP+  AW +P+AT
Sbjct  484   FGPAGDPRAGGIGTPEAIKLVWSCHREIIQDIGPIPKAWTIPEAT  528



>ref|XP_001696928.1| aldehyde dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP00620.1| aldehyde dehydrogenase [Chlamydomonas reinhardtii]
Length=548

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/518 (66%), Positives = 410/518 (79%), Gaps = 0/518 (0%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             +AT++ + +SG+ PA   NLV G W  S     + DPLNGE FI V   Q  E+ PF+ES
Sbjct  31    WATVDPKKLSGAAPASCQNLVAGRWTGSRESRQLPDPLNGEPFISVPHTQVDEITPFVES  90

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             +R  PK GLHNP K P+RYL+ GD+S + A  +  P V DFF RLIQRV+PKSY QAL E
Sbjct  91    LRAVPKSGLHNPLKNPQRYLLYGDVSFRVAAEMRKPAVEDFFARLIQRVAPKSYDQALGE  150

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V VT+KF ENF+GDQVRFLAR F  PG+H GQ S G RWPYGPVA++TPFNFPLEIP LQ
Sbjct  151   VRVTRKFFENFTGDQVRFLARGFTNPGDHAGQTSSGTRWPYGPVALITPFNFPLEIPALQ  210

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             LMGALYMGNKP+L VD +V +V EQ++RLL  CG+P  D+D L+  G T+ +++   +PR
Sbjct  211   LMGALYMGNKPLLHVDQRVSVVAEQLVRLLAHCGMPASDLDLLHGPGATVGEVIKRAEPR  270

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
              TLFTGS RVAE+LA +  G++ LEDAGFDWKI+GPDV  VDY+AW CDQDAYACSGQKC
Sbjct  271   STLFTGSQRVAERLAVETHGKVFLEDAGFDWKIMGPDVSNVDYVAWQCDQDAYACSGQKC  330

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSILF H NW ++ L+N M++ AA+R+L DLT+GPVLT+TT+A+L H NKLLQIPG+K
Sbjct  331   SAQSILFAHSNWVQAGLLNKMAAAAAQRQLSDLTIGPVLTWTTEAILAHTNKLLQIPGAK  390

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             +LFGG+PL  HSIP++YGA++PTAVFVPL E LK E++  VTTEVFGPFQ+VTEY D QL
Sbjct  391   VLFGGKPLTGHSIPAVYGAVQPTAVFVPLVEALKPEHFGTVTTEVFGPFQVVTEYGDGQL  450

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
             PLVL A ERM  +LTAA+VSND  F+Q V+ ++VNGTTYAGIRARTTGAPQNHWFGPAGD
Sbjct  451   PLVLEACERMTHHLTAAIVSNDINFIQHVLAHTVNGTTYAGIRARTTGAPQNHWFGPAGD  510

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQA  1873
             PRGAGIGTPEAI++VWSCHREII D GPV PA  L Q+
Sbjct  511   PRGAGIGTPEAIRMVWSCHREIITDFGPVPPASGLKQS  548



>ref|XP_005844734.1| hypothetical protein CHLNCDRAFT_32475 [Chlorella variabilis]
 gb|EFN52632.1| hypothetical protein CHLNCDRAFT_32475 [Chlorella variabilis]
Length=542

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/518 (65%), Positives = 407/518 (79%), Gaps = 0/518 (0%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             ++  N   +SGS PA+  NLV G W+++     I DPLNGE FI+V + Q  E++PF+ S
Sbjct  25    WSKFNPAAMSGSNPAQASNLVYGEWVQAEKTMAIPDPLNGEPFIQVPDTQLYEVEPFVAS  84

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             M+  PK G+HNPFK PERYLM GDI+ + A  +  PEV D F RLIQR SPKSY QA  E
Sbjct  85    MKATPKSGMHNPFKQPERYLMWGDITARVAAEMRRPEVEDHFARLIQRTSPKSYAQASGE  144

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V VT+KFLENFSGDQVRFLAR F VPG+H GQQSHG+RWPYGPV ++TPFNFPLEIPVLQ
Sbjct  145   VRVTRKFLENFSGDQVRFLARGFSVPGDHPGQQSHGYRWPYGPVTLITPFNFPLEIPVLQ  204

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             +MGALYMGNKP++  D KVC+V+E+ +RLLH CG+ L ++D  N  G T+N+++ +G PR
Sbjct  205   MMGALYMGNKPLVHSDHKVCLVLEEFVRLLHHCGMSLTELDICNGRGATVNEIMAQGHPR  264

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
              TLFTGS  VAEKLA D  GRI LEDAGFDWKILGPDV E DY+AW CDQDAYACSGQKC
Sbjct  265   NTLFTGSKGVAEKLARDFHGRIFLEDAGFDWKILGPDVHEFDYVAWQCDQDAYACSGQKC  324

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSILFMH+NW ++ L   ++  AA RKL+DLTVGPVL+  T+ ML H  +LLQIPG++
Sbjct  325   SAQSILFMHDNWVEAGLEKALAQRAATRKLEDLTVGPVLSVKTETMLAHKERLLQIPGAR  384

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             LLFGGE L  HSIP  YGAI+PTAVFVPL E+LK+ N+++ T E+FGPFQ+VT+Y D  +
Sbjct  385   LLFGGEALTGHSIPERYGAIQPTAVFVPLSELLKEANFEVATKEIFGPFQVVTQYSDRDV  444

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
             P VL A ERM+A+LTAAVVSND  F+Q ++G++VNGTTYAGIRARTTGAPQNHWFGPAGD
Sbjct  445   PHVLEACERMEAHLTAAVVSNDARFVQHILGSTVNGTTYAGIRARTTGAPQNHWFGPAGD  504

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQA  1873
             PR AGIGTPEAI+LVWS HRE+I D GPV     L Q+
Sbjct  505   PRAAGIGTPEAIRLVWSTHREVIQDFGPVPHGLHLLQS  542



>ref|XP_005643005.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18461.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=542

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 411/509 (81%), Gaps = 0/509 (0%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             +A+++   ISGS P + +NLV G W   +   TI DPLNGE FIK+ + Q  E+ PF++S
Sbjct  25    WASVDPSAISGSNPGQAYNLVNGEWGLPAKSKTIPDPLNGEPFIKLPDTQLDEIDPFVQS  84

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             +R  PK GLHNP K PERY M G +  KAA  +  PEV D+FT+L+QRV+PK   QA AE
Sbjct  85    LRAVPKSGLHNPLKNPERYNMYGAVIAKAAEEMRKPEVEDYFTKLVQRVAPKHDAQARAE  144

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V VT++FLENFSGDQVRF ARSFGV G+H GQ S G RWPYGPV ++TPFNFPLEIP LQ
Sbjct  145   VVVTRRFLENFSGDQVRFTARSFGVAGDHAGQMSTGHRWPYGPVGLITPFNFPLEIPALQ  204

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             L+GA+ MGNKP++ VD +V IV E  LR+LH  G+P+ D D+++  G  +N++L+  +PR
Sbjct  205   LIGAVMMGNKPLVHVDHRVSIVAEAFLRMLHHVGMPMTDADYVHGHGSVVNEILVRARPR  264

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
              TLFTGS RVAEKL  DL G++ LEDAGFDWK+LGPDV E DYIAW CDQDAYACSGQKC
Sbjct  265   STLFTGSQRVAEKLCADLHGKVFLEDAGFDWKVLGPDVFEPDYIAWQCDQDAYACSGQKC  324

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSILF H NW K+ L   ++  AA+RKLDDL++GPVLT+TT AML H++KLL+IPG++
Sbjct  325   SAQSILFQHSNWVKAGLEEKLAQRAAQRKLDDLSIGPVLTWTTDAMLAHVDKLLKIPGAR  384

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             + FGG+PLE HSIP +YGAI+PTAVFVPL++ILKDEN+ LVTTEVFGPFQ++TEY D QL
Sbjct  385   VAFGGKPLEGHSIPDVYGAIQPTAVFVPLDQILKDENFGLVTTEVFGPFQVLTEYSDEQL  444

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
             PLVL ALE+++A+LTAAVVSND +F Q+V+ N+VNGTTYAGIRARTTGAPQNHWFGPAGD
Sbjct  445   PLVLEALEKLEAHLTAAVVSNDPVFTQKVLANTVNGTTYAGIRARTTGAPQNHWFGPAGD  504

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPV  1846
             PR AGIGTPEAI+LVWSCHREII D+GP+
Sbjct  505   PRSAGIGTPEAIRLVWSCHREIISDVGPI  533



>ref|XP_002958122.1| aldehyde dehydrogenase [Volvox carteri f. nagariensis]
 gb|EFJ40853.1| aldehyde dehydrogenase [Volvox carteri f. nagariensis]
Length=550

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/521 (65%), Positives = 406/521 (78%), Gaps = 17/521 (3%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             +AT++ E +SGS PA   NLV G+W+ S +   + DPLNGE F++V   Q  E+ PF++S
Sbjct  29    WATVDPERMSGSAPAACLNLVGGHWLPSGASRQLPDPLNGEHFLQVPHTQPDEIGPFVQS  88

Query  500   MRKCPKHGLHNPFKAPER---------YLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSP  652
             +R  PK GLHNP K P+R         YL+ GD+S + A  L LPEV  FF RLIQRV+P
Sbjct  89    LRAVPKSGLHNPLKDPQRQAGGGKGPLYLLYGDVSFRVAAELRLPEVEQFFARLIQRVAP  148

Query  653   KSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFN  832
             KS  QAL EV VT+KF ENFSGDQVRFLAR F  PG+H GQ S G RWPYGPVA++TPFN
Sbjct  149   KSQVQALGEVRVTRKFFENFSGDQVRFLARGFTNPGDHSGQTSSGNRWPYGPVALITPFN  208

Query  833   FPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMN  1012
             FPLEIP LQLMGALYMGNKP+L VD +V +V EQ+LRLLH CG+P  DVD L+  G T+ 
Sbjct  209   FPLEIPALQLMGALYMGNKPLLHVDQRVSVVAEQLLRLLHHCGMPPADVDLLHGPGATVG  268

Query  1013  KLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQD  1192
             ++L   +PR TLFTGS RVAE+LA +  G++ LEDAGFDWKILGPDV ++DY+AW CDQD
Sbjct  269   EVLRAAQPRSTLFTGSQRVAERLAVETHGKVFLEDAGFDWKILGPDVRDLDYVAWQCDQD  328

Query  1193  AYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMN  1372
             AYACSGQKCSA        NW  + L++ +SSLA+RR+L DLTVGPVL++TT+AML+H N
Sbjct  329   AYACSGQKCSAH-------NWIAAGLLDRLSSLASRRQLYDLTVGPVLSWTTRAMLEHTN  381

Query  1373  KLLQIP-GSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
             KLL IP G+KLLFGG+PL  HSIP +YGA+ PTAVFVPL+++L  E +DLVTTEVFGPFQ
Sbjct  382   KLLAIPAGAKLLFGGKPLSGHSIPEVYGAVEPTAVFVPLDQMLLPEYFDLVTTEVFGPFQ  441

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
             +VTE+++ QLP VL A ERM  +LTAAVVSND  F+Q V+ ++VNGTTYAGIRARTTGAP
Sbjct  442   VVTEWREGQLPAVLEACERMSHHLTAAVVSNDINFVQHVLAHTVNGTTYAGIRARTTGAP  501

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSP  1852
             QNHWFGPAGDPRGAGIGTPEAI+LVWSCHREII D GPV P
Sbjct  502   QNHWFGPAGDPRGAGIGTPEAIRLVWSCHREIITDFGPVPP  542



>gb|KFM25939.1| putative aldehyde dehydrogenase [Auxenochlorella protothecoides]
Length=548

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/512 (64%), Positives = 409/512 (80%), Gaps = 0/512 (0%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             ++ ++   +SGS PA + NLV G W +++   +++DP+NGE F+ V + Q  E+QPF++S
Sbjct  31    WSRVDPAQLSGSSPAALSNLVAGEWTQTAQSLSVVDPMNGEPFLAVPDTQLDEIQPFIDS  90

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             +R  PK GLHNP K PERYL+ G++S  AA  L  PEV+D F RLIQRV+PKSY QA AE
Sbjct  91    LRSVPKSGLHNPLKLPERYLLYGNVSRNAAAELLKPEVADHFARLIQRVAPKSYPQAEAE  150

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V VT+ FLENFSGDQVRFLARSFGVPG+H GQQS+G+RWP+GPVA++ PFNFPLEIP LQ
Sbjct  151   VSVTRIFLENFSGDQVRFLARSFGVPGDHPGQQSNGYRWPFGPVALIAPFNFPLEIPALQ  210

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             LMGAL+MGNKP++  D KV +V+E+ +RLLH CG+P  D+D ++  G T+N++LL G+PR
Sbjct  211   LMGALFMGNKPLVHADHKVAVVLEEFVRLLHACGMPRADLDLVHGRGSTVNEILLRGEPR  270

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
              TLFTGS RVAEKLA DL+G++ LEDAGFDWKILGPDV   D++AW CDQDAYACSGQKC
Sbjct  271   STLFTGSKRVAEKLAVDLRGKVFLEDAGFDWKILGPDVQAFDHVAWQCDQDAYACSGQKC  330

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSILFMH+ W+++ L   +++ AA R L+DLTVGPVL++TT+A+  H+  LL IPG++
Sbjct  331   SAQSILFMHDAWAEAGLEAALAARAATRGLEDLTVGPVLSWTTEAIQAHVADLLAIPGAR  390

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             L +GGE L  H+IP  Y AI+PTAVFVPL+++L+ E++  VT EVFGPFQ++T Y D  L
Sbjct  391   LAWGGEALTGHAIPPRYAAIQPTAVFVPLDQVLRPEHWPTVTREVFGPFQVLTRYGDASL  450

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
             P VL A ERMDA+LTAAVVSN   FLQ V+ N+VNGTTYAGIR RTTGAPQNHWFGPA D
Sbjct  451   PDVLAACERMDAHLTAAVVSNSIPFLQHVLANTVNGTTYAGIRGRTTGAPQNHWFGPAND  510

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPVSPA  1855
             PRGAGIGTPEAIKLVWS HREII D+GPV  A
Sbjct  511   PRGAGIGTPEAIKLVWSTHREIIQDVGPVPDA  542



>ref|XP_001417108.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95401.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=521

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/511 (63%), Positives = 394/511 (77%), Gaps = 8/511 (2%)
 Frame = +2

Query  359   PAEVHNLVQGNWIRSSSWNT---ILDPLNGESFIKVA--EVQDAELQPFLESMRKCPKHG  523
             PA   NL+ G W   S+  T   ++DP+  +  + VA     + E+     S+  CPK G
Sbjct  8     PATCANLINGTWRAPSTGETTERVVDPMAKDDVVVVAPKTNTEGEIAEVARSLASCPKSG  67

Query  524   LHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFL  703
             LHNPFKAPERYL  G++S K A  +  P V +FF RLIQRV+PKS+ QALAEV VT+KFL
Sbjct  68    LHNPFKAPERYLKYGEVSAKLAEEMRKPAVEEFFARLIQRVAPKSHAQALAEVVVTRKFL  127

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF+GD VRFLAR F V G+HLGQ SHG RWPYGPV+++TPFNFPLEIPVLQLMGAL+MG
Sbjct  128   ENFAGDNVRFLARGFSVSGDHLGQTSHGLRWPYGPVSVITPFNFPLEIPVLQLMGALFMG  187

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSS  1063
             NK ++K D+KV IV+EQ +RL+ +CG P  D+DF+N DG TMN++L   KP+MTLFTGS 
Sbjct  188   NKALVKSDTKVSIVLEQFIRLMLECGAPATDLDFINCDGATMNEILRRAKPKMTLFTGSQ  247

Query  1064  RVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             +VA  L  +L G +KLEDAGFDWKILGPDV +VDY+A VCDQDAYACSGQKCSAQSILFM
Sbjct  248   KVAHHLTKELDGNVKLEDAGFDWKILGPDVGDVDYVAHVCDQDAYACSGQKCSAQSILFM  307

Query  1244  HENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL  1423
             HENW K+ +   ++SLAA+R L DLTVGPVLT TT+ MLDH  KL ++PG+++ FGG  L
Sbjct  308   HENWVKAGIEAKIASLAAQRNLSDLTVGPVLTVTTQTMLDHAKKLAELPGARVAFGGREL  367

Query  1424  E--NHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTEYKDNQLPLVLN  1594
                 H+IPS YGAI PTA+FVPL+ I+  DEN+ L TTE+FGP Q++T Y D+++ LVL+
Sbjct  368   NEGEHNIPSQYGAIEPTAIFVPLKTIMASDENFKLATTEIFGPLQVLTSYCDDEVSLVLD  427

Query  1595  ALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAG  1774
             A E+MDA+LTAAVVS+D+LF+Q V+G++VNGTTYAG RARTTGAPQNHWFGPAG P   G
Sbjct  428   ACEKMDAHLTAAVVSSDELFVQRVLGSTVNGTTYAGRRARTTGAPQNHWFGPAGTPLAGG  487

Query  1775  IGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             IGT EAI+LVWSCHRE+IYD GPV   W  P
Sbjct  488   IGTIEAIRLVWSCHREVIYDRGPVEAGWTTP  518



>emb|CEF97382.1| Aldehyde dehydrogenase, C-terminal [Ostreococcus tauri]
Length=577

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/508 (64%), Positives = 397/508 (78%), Gaps = 10/508 (2%)
 Frame = +2

Query  374   NLVQGNW---IRSSSWNTILDPLNG---ESFIKVAEVQ-DAELQPFLESMRKCPKHGLHN  532
             NL+ G W      S    I+DP+N    ++FI +       E+     S+  CPK GLHN
Sbjct  67    NLIAGAWREITDESRATKIVDPMNKSETDAFIVLPSTDTKQEIDEVARSLASCPKSGLHN  126

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
              FKAPERY+M GD+S + A     PEV ++F RLIQRV+PKS+ QALAEV VT+KFLENF
Sbjct  127   AFKAPERYVMWGDVSMRLAQEFRKPEVEEYFARLIQRVAPKSHAQALAEVVVTRKFLENF  186

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +GD VRF+AR F V G+HLGQQSHG RWPYGPVA++TPFNFPLEIPVLQLMGAL+MGNK 
Sbjct  187   AGDNVRFMARGFSVSGDHLGQQSHGLRWPYGPVAVITPFNFPLEIPVLQLMGALFMGNKA  246

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVA  1072
             ++K DSKV +V+EQ +RL+ +CG P  D+DF++SDG TMN +L   KP+MTLFTGS +VA
Sbjct  247   LVKSDSKVSVVLEQFIRLMIECGAPATDLDFIHSDGVTMNSILSAAKPKMTLFTGSQKVA  306

Query  1073  EKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHEN  1252
               LA +L+G +KLEDAGFDWKILGPDV +VDY+A VCDQDAYACSGQKCSAQSILFMH+N
Sbjct  307   HHLARELEGNVKLEDAGFDWKILGPDVGDVDYVAHVCDQDAYACSGQKCSAQSILFMHKN  366

Query  1253  WSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLE--  1426
             W    + + +++LA  R L+DLTVGPVLT TTK MLDH+++L  +PG+++ FGG+ L+  
Sbjct  367   WVDVGIESKLAALAGERNLEDLTVGPVLTLTTKTMLDHVDRLAALPGARVAFGGKELKDG  426

Query  1427  NHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALE  1603
             NHSIPS YGAI PTAVFVPL+ I+  +EN+ LVTTE+FGP Q++T Y D +LPLVL+A E
Sbjct  427   NHSIPSQYGAIEPTAVFVPLKTIMASEENFKLVTTEIFGPMQVLTSYDDEELPLVLDACE  486

Query  1604  RMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGT  1783
             RMDA+LTAAVVS+D++F Q V+G++VNGTTYAG RARTTGAPQNHWFGPAG P   GIGT
Sbjct  487   RMDAHLTAAVVSSDEMFSQRVLGSTVNGTTYAGRRARTTGAPQNHWFGPAGTPMAGGIGT  546

Query  1784  PEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
              EAI+LVWSCHREII+D GPV   WK P
Sbjct  547   IEAIRLVWSCHREIIFDRGPVESDWKTP  574



>ref|XP_003078494.1| delta-1-pyrroline-5-carboxylate dehydrogenase precursor (ISS) 
[Ostreococcus tauri]
Length=522

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/508 (64%), Positives = 396/508 (78%), Gaps = 10/508 (2%)
 Frame = +2

Query  374   NLVQGNW---IRSSSWNTILDPLNG---ESFIKVAEVQ-DAELQPFLESMRKCPKHGLHN  532
             NL+ G W      S    I+DP+N    ++FI +       E+     S+  CPK GLHN
Sbjct  12    NLIAGAWREITDESRATKIVDPMNKSETDAFIVLPSTDTKQEIDEVARSLASCPKSGLHN  71

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
              FKAPERY+M GD+S + A     PEV ++F RLIQRV+PKS+ QALAEV VT+KFLENF
Sbjct  72    AFKAPERYVMWGDVSMRLAQEFRKPEVEEYFARLIQRVAPKSHAQALAEVVVTRKFLENF  131

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +GD VRF+AR F V G+HLGQQSHG RWPYGPVA++TPFNFPLEIPVLQLMGAL+MGNK 
Sbjct  132   AGDNVRFMARGFSVSGDHLGQQSHGLRWPYGPVAVITPFNFPLEIPVLQLMGALFMGNKA  191

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVA  1072
             ++K DSKV +V+EQ +RL+ +CG P  D+DF++SDG TMN +L   KP+MTLFTGS +VA
Sbjct  192   LVKSDSKVSVVLEQFIRLMIECGAPATDLDFIHSDGVTMNSILSAAKPKMTLFTGSQKVA  251

Query  1073  EKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHEN  1252
               LA +L+G +KLEDAGFDWKILGPDV +VDY+A VCDQDAYACSGQKCSAQSILFMH+N
Sbjct  252   HHLARELEGNVKLEDAGFDWKILGPDVGDVDYVAHVCDQDAYACSGQKCSAQSILFMHKN  311

Query  1253  WSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLE--  1426
             W    + + +++LA  R L+DLTVGPVLT TTK MLDH+++L  +PG+++ FGG+ L+  
Sbjct  312   WVDVGIESKLAALAGERNLEDLTVGPVLTLTTKTMLDHVDRLAALPGARVAFGGKELKDG  371

Query  1427  NHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALE  1603
             NHSIPS YGAI PTAVFVPL+ I+  +EN+ LVTTE FGP Q++T Y D +LPLVL+A E
Sbjct  372   NHSIPSQYGAIEPTAVFVPLKTIMASEENFKLVTTEFFGPMQVLTSYDDEELPLVLDACE  431

Query  1604  RMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGT  1783
             RMDA+LTAAVVS+D++F Q V+G++VNGTTYAG RARTTGAPQNHWFGPAG P   GIGT
Sbjct  432   RMDAHLTAAVVSSDEMFSQRVLGSTVNGTTYAGRRARTTGAPQNHWFGPAGTPMAGGIGT  491

Query  1784  PEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
              EAI+LVWSCHREII+D GPV   WK P
Sbjct  492   IEAIRLVWSCHREIIFDRGPVESDWKTP  519



>ref|XP_005834032.1| hypothetical protein GUITHDRAFT_94019 [Guillardia theta CCMP2712]
 gb|EKX47052.1| hypothetical protein GUITHDRAFT_94019 [Guillardia theta CCMP2712]
Length=588

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/537 (60%), Positives = 401/537 (75%), Gaps = 10/537 (2%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSS--SWNTILDPLNGESFIKVAEVQ  469
             T  S  L FAT + + +    PA+VHN++QG WI+ +  ++  I DP++G  FI+V+E+Q
Sbjct  52    TYHSKKLDFATCDPDSLGSGAPAKVHNIIQGEWIQGTDGAYEVIPDPIDGRPFIEVSEIQ  111

Query  470   DAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVS  649
                L  F+ S+  CPK+G+HNP    +RYL+ G+IS KAA+ML  PEV  FF RLIQRVS
Sbjct  112   QNSLNAFVRSLNSCPKYGMHNPLLNVDRYLLYGEISLKAANMLRDPEVERFFARLIQRVS  171

Query  650   PKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPF  829
             PKSY QA  EV VT+KFLENFSGDQVRFLARSF VPG+H GQQS G+RWPYGPVA++TPF
Sbjct  172   PKSYAQARGEVVVTRKFLENFSGDQVRFLARSFSVPGDHTGQQSQGYRWPYGPVALITPF  231

Query  830   NFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
             NFPLEIPVLQ MGALYMGN+P+LKVDSKV IVM+Q +RLLH CG+P+ D+DF+N  G  M
Sbjct  232   NFPLEIPVLQTMGALYMGNRPLLKVDSKVSIVMDQFIRLLHSCGMPMGDLDFINCHGPMM  291

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDE----VDYIAW  1177
               LL + +PR TLFTGSS+VA  LA  L+GR+K+E AGF WK+LGPDV      +DY+A 
Sbjct  292   QTLLEKARPRTTLFTGSSKVANILAERLEGRVKVESAGFGWKVLGPDVPSDPAVIDYVAH  351

Query  1178  VCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAM  1357
             VCDQDAYA SGQKCSAQSILF+H+NWSK+ L++ +  LA++R+LDDLTVGP L+ TT+  
Sbjct  352   VCDQDAYASSGQKCSAQSILFVHKNWSKTNLLDKLQQLASQRRLDDLTVGPTLSVTTQTF  411

Query  1358  LDHMNKLLQIPGSKLLFGGEPLE--NHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTT  1528
              +H+  L +IPG+++LFGG  +    H+IP  YGA++PTAV VPL  +    EN  L TT
Sbjct  412   TNHVEALKKIPGARVLFGGVEINEGKHNIPRQYGAMKPTAVMVPLSSLTASKENLQLATT  471

Query  1529  EVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIR  1708
             EVF PFQ+VTE+ D+ +P VL+ LE +  +LTAA+VSND  F +   G SVNGTTY G+R
Sbjct  472   EVFAPFQVVTEFDDSDIPAVLDVLEFVQNHLTAAIVSNDVSFQRLFQGRSVNGTTYVGMR  531

Query  1709  ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIG-PVSPAWKLPQAT  1876
             ARTTGAPQNHWFGPAGDPR AGIGT EAI + WSCHRE I+D        WKLP  T
Sbjct  532   ARTTGAPQNHWFGPAGDPRAAGIGTKEAIHVTWSCHREFIHDNDLSFIKNWKLPART  588



>emb|CBJ33088.1| Aldehyde Dehydrogenase [Ectocarpus siliculosus]
Length=541

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/533 (62%), Positives = 393/533 (74%), Gaps = 34/533 (6%)
 Frame = +2

Query  380   VQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYL  559
             V G W+ SS+  T+ DPLNGE F+KV      E Q F+ S+  C K GLHNPFK+PERYL
Sbjct  9     VGGRWVESSAHETLPDPLNGEPFLKVPATTPGEAQAFVASLELCSKSGLHNPFKSPERYL  68

Query  560   MLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLA  739
               G  + KAA ++++PEV DFFTRLI RV+PKSY QA  EV VT++FLENFSGD VR LA
Sbjct  69    AYGSATAKAAALMAVPEVEDFFTRLIMRVAPKSYAQANGEVVVTRRFLENFSGDNVRMLA  128

Query  740   RSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPL--------------------------  841
             RSF VPG+H+GQ S G+RWP+GPVAIV+PFNFPL                          
Sbjct  129   RSFSVPGDHVGQASTGYRWPFGPVAIVSPFNFPLGEQPSNEGTSVYQVLVAGLVDSVVMA  188

Query  842   ----EIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTM  1009
                 EIPVLQLMGALYMGNK + K DSKV +VMEQ LRL H CG P+EDVDF+N DG  M
Sbjct  189   YLCIEIPVLQLMGALYMGNKVIFKTDSKVSVVMEQTLRLFHHCGAPVEDVDFINCDGPVM  248

Query  1010  NKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQ  1189
             + +L   +PR+T FTGSS+VAE LA  L G++K+EDAGFDWKILGPDV E +Y+A  CDQ
Sbjct  249   HGVLTSAQPRVTQFTGSSKVAEILAEALDGKVKVEDAGFDWKILGPDVQEEEYVAHTCDQ  308

Query  1190  DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHM  1369
             DAYA SGQKCSAQSILF+HENWSKS ++  + SLA+RR L+DLTVGPVL+ TT+  + H+
Sbjct  309   DAYAYSGQKCSAQSILFVHENWSKSGILETLKSLASRRTLEDLTVGPVLSVTTETCMKHI  368

Query  1370  NKLLQIPGSKLLFGGEPLENH---SIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVF  1537
             + LL+I G+K+LFGG+PL +     IP+ YGA  PTAVFVPL+E+LK  EN+ L TTE+F
Sbjct  369   DSLLKISGAKVLFGGKPLSSEKAKKIPAQYGAWDPTAVFVPLKEMLKSPENFALCTTEIF  428

Query  1538  GPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRART  1717
             GPFQ+VTEY DN+L  VL A ERM+ +LTAAVVSND  F + V+  +VNGTTY GIRART
Sbjct  429   GPFQVVTEYDDNELDAVLEACERMNNHLTAAVVSNDVSFQRRVLEATVNGTTYCGIRART  488

Query  1718  TGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TGAPQNHWFGPAGDPR AGIGT EAI++VWSCHRE+I D GPV   W  P  T
Sbjct  489   TGAPQNHWFGPAGDPRAAGIGTIEAIRMVWSCHREVIMDEGPVPEGWTTPART  541



>gb|EJK62218.1| hypothetical protein THAOC_17178, partial [Thalassiosira oceanica]
Length=638

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/523 (62%), Positives = 391/523 (75%), Gaps = 4/523 (1%)
 Frame = +2

Query  317   PFATLNVEDISGSQ-PAEVHNLVQGNWIRSSSWNTILDPLNGES--FIKVAEVQDAELQP  487
             P+ATL+   +   + P  V N+V G W  SS   TI +PL+ ++     V + Q+ EL P
Sbjct  117   PWATLDPAALGADRTPYAVSNIVAGEWGGSSMTLTIPNPLDRDAPAVCTVPDTQEGELAP  176

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F++S+R  PK GLHNP K  ERYL  G+IS KA   LS P ++DFF + IQR  PKSY Q
Sbjct  177   FVDSLRSVPKSGLHNPLKNNERYLQYGEISRKAGAALSDPAIADFFAKSIQRTVPKSYAQ  236

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
             A+ EV VT  FL NF+GD VRFLARSFGVPG+H GQ SHG RWP+GPVAIV PFNFPLEI
Sbjct  237   AMGEVKVTADFLNNFAGDNVRFLARSFGVPGDHYGQFSHGHRWPFGPVAIVAPFNFPLEI  296

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
             PVLQLMGAL+MGNKPVLK   K  +VMEQ L LLHDCG+   DVD LN  G    +L+L+
Sbjct  297   PVLQLMGALFMGNKPVLKPAEKCSLVMEQFLHLLHDCGMDRRDVDLLNCQGPVAERLILD  356

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
                ++T FTGSSRVA++L    KG++K+EDAGFDWKILGPDV ++DY+AW CDQDAYAC+
Sbjct  357   ADVKLTQFTGSSRVADRLLEVTKGKVKIEDAGFDWKILGPDVGDLDYVAWQCDQDAYACA  416

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSA+SIL  HENW ++ L + + + AA R LDDL+V PVLT TT  +LDH ++LL+I
Sbjct  417   GQKCSAESILLAHENWEEAGLFDRLKANAATRSLDDLSVAPVLTHTTADILDHTSRLLEI  476

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             PG++LLFGG  L+ H+IP IYGA+ PTAV+VPL E+LKDEN+ + TTE+F PFQ+VT + 
Sbjct  477   PGARLLFGGRELDGHNIPEIYGAVEPTAVYVPLREMLKDENFGVCTTELFAPFQVVTTFG  536

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
             D+++ LVL A ERM  +LTAAVVSND  F   V+ N+VNGTTYAG RARTTGAPQNHWFG
Sbjct  537   DDEVCLVLEACERMSHHLTAAVVSNDVEFQTTVLANTVNGTTYAGRRARTTGAPQNHWFG  596

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PAGD RGAGIGTPEAIKLVWSCHREII D   V   W  P+AT
Sbjct  597   PAGDARGAGIGTPEAIKLVWSCHREIILDT-VVPKDWTQPKAT  638



>ref|XP_002295441.1| aldehyde dehydrogenase [Thalassiosira pseudonana CCMP1335]
 gb|ACI64158.1| aldehyde dehydrogenase [Thalassiosira pseudonana CCMP1335]
Length=537

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/537 (59%), Positives = 400/537 (74%), Gaps = 5/537 (1%)
 Frame = +2

Query  278   ANEEVGTRASHSLP-FATLNVEDI-SGSQPAEVHNLVQGNWIRSSSWNTILDPL--NGES  445
             ++  + T++  +LP +ATL+   + + + P  V NLV G+W  ++S   I +PL  N   
Sbjct  2     SSRTIHTKSLSTLPTWATLDPLSLGTSTTPHSVSNLVSGSWTTAASSLIIPNPLDKNAPP  61

Query  446   FIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFF  625
               +V + Q  ELQPF+ES+R  PK G+HNP K  ERY+  G+IS KA   LS P+ ++FF
Sbjct  62    VCEVPDTQVGELQPFVESLRGVPKSGVHNPLKNVERYVQFGEISRKAGEALSDPQTAEFF  121

Query  626   TRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYG  805
              + I +  PKS+ QA+ EV VT  FL+NF GD VRFLARSFGVPG+H GQ SHG RWP+G
Sbjct  122   AQSIIKTVPKSHAQAMGEVKVTADFLKNFGGDNVRFLARSFGVPGDHYGQFSHGHRWPFG  181

Query  806   PVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDF  985
              VAIV PFNFPLEIPVLQLMGAL+MGNKP LK   K  +VMEQ L LLH+CG+  +DVD 
Sbjct  182   AVAIVAPFNFPLEIPVLQLMGALFMGNKPTLKPAEKCALVMEQFLHLLHECGMDKKDVDL  241

Query  986   LNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVD  1165
             LN  G    +L+L+   R+T FTGSSRVAE L     G++++EDAGFDWKI+GPDVD VD
Sbjct  242   LNCQGPVAERLILDADVRLTQFTGSSRVAEMLLQRTNGKVRIEDAGFDWKIIGPDVDNVD  301

Query  1166  YIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFT  1345
             Y+AW CDQDAYAC+GQKCSAQSILF HENW  + L + M   AA R LDDL++ PVLT T
Sbjct  302   YVAWQCDQDAYACAGQKCSAQSILFAHENWENAGLFDKMKKNAATRSLDDLSIAPVLTHT  361

Query  1346  TKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVT  1525
             T+++LDH  +LL+IPG+++LFGG+ L+NH+IP  YGA+ PTAVFVPL+E+LKDEN+ + T
Sbjct  362   TQSILDHTARLLEIPGARVLFGGKELDNHTIPECYGAVEPTAVFVPLKEMLKDENFGVCT  421

Query  1526  TEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGI  1705
             TE+FGPFQ+VT +K++++  VL+A ERM  +LTAAVVSND  F   ++ ++VNGTTYAG 
Sbjct  422   TEIFGPFQVVTTFKEDEMCHVLDACERMSHHLTAAVVSNDVDFQSAILAHTVNGTTYAGR  481

Query  1706  RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             RARTTGAPQNHWFGPAGD RGAGIGTPEAIKLVWSCHREII D   V   W  P+AT
Sbjct  482   RARTTGAPQNHWFGPAGDARGAGIGTPEAIKLVWSCHREIIMD-SVVPKDWVQPKAT  537



>ref|XP_001031541.1| aldehyde dehydrogenase (NAD) family protein [Tetrahymena thermophila]
 gb|EAR83878.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Tetrahymena thermophila 
SB210]
Length=539

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/519 (58%), Positives = 386/519 (74%), Gaps = 3/519 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             +AT +   +S S+P  + NLV G W  +  + T++DP+NG+ F++V + +  E+  F+ +
Sbjct  24    WATCDPYTLSESKPYTLQNLVSGKWKDAKEYTTVVDPMNGDKFLRVPDTKGDEINEFIVN  83

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
              +K PK GLHNP K PERY + G++  K A  +  PE+  F  +  QRV PKS  Q   E
Sbjct  84    AKKVPKSGLHNPIKNPERYQLYGNVCGKIAEEMKKPEIESFLCKATQRVMPKSDVQIKGE  143

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             + VT++F ENF+GD  RFL RSF V G+H GQQS G+RWPYG VA++ PFNFP+EIP LQ
Sbjct  144   IVVTRRFFENFAGDNPRFLCRSFNVAGDHQGQQSSGYRWPYGSVALIAPFNFPIEIPCLQ  203

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             L G L  GN+P LK+DSKV +VMEQ LRL  DCG+P EDVD ++S  + M K++L+   R
Sbjct  204   LFGCLIAGNRPTLKIDSKVSLVMEQFLRLAIDCGMPAEDVDLIHSGPQAMEKIILDTNYR  263

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKC  1219
             +  FTGSS VAE+L+    G++K+EDAGFDWKILGPDV ++DY+AW CDQDAYA SGQKC
Sbjct  264   VIQFTGSSTVAERLSKLTHGKVKIEDAGFDWKILGPDVSDIDYVAWQCDQDAYAASGQKC  323

Query  1220  SAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
             SAQSIL+ HENW K+  ++ + SLAARRKL DLTVGPVLT+  + + +H++ +L +PG+K
Sbjct  324   SAQSILYAHENWMKAGFVDKIKSLAARRKLSDLTVGPVLTWDNQKIKNHIDSILALPGAK  383

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             +LFGG+PL NHSIPSIYG+  PTA+FVPLE I K  N+D+V  E+FGPFQIVTEYKDNQL
Sbjct  384   VLFGGKPLTNHSIPSIYGSYEPTAIFVPLETISK--NFDIVCKELFGPFQIVTEYKDNQL  441

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
               VL+ LE+M+ +LTAAVVSND  FL  V  N+VNG TY GIRARTTGAPQNHWFGP GD
Sbjct  442   DTVLSHLEKMENHLTAAVVSNDVKFLNYVTSNTVNGVTYTGIRARTTGAPQNHWFGPCGD  501

Query  1760  PRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PRGAGIGTPEAI  VW+ HREII DI  +   WK+PQA+
Sbjct  502   PRGAGIGTPEAILSVWTSHREIITDID-IPKNWKVPQAS  539



>ref|XP_002177243.1| aldehyde dehydrogenase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51706.1| aldehyde dehydrogenase [Phaeodactylum tricornutum CCAP 1055/1]
Length=551

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/532 (59%), Positives = 389/532 (73%), Gaps = 4/532 (1%)
 Frame = +2

Query  290   VGTRASHSLPFATLNVEDI-SGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESF--IKVA  460
             V  R+  S+P+AT++ + + + ++P  V N+V G    +S    I+ PL+ +++    V 
Sbjct  21    VRRRSMSSIPWATMDPKALGTTAEPYAVPNIVDGKLTSTSKTIEIIHPLDRDAYPIFTVP  80

Query  461   EVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQ  640
             + Q  E+QPFL+S+RK  K G+HNP K PERYL  G+IS KA   L  P++++FF + IQ
Sbjct  81    DTQTGEIQPFLDSLRKVTKSGMHNPLKNPERYLDYGEISRKAGDALMQPDIAEFFIQTIQ  140

Query  641   RVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIV  820
                PKS+ QA  EV VT  FL NF GD VR LA+SFGVPG+H GQ S G RWPYGPVAIV
Sbjct  141   ACVPKSHAQAAGEVRVTAAFLNNFGGDNVRRLAKSFGVPGDHYGQMSVGHRWPYGPVAIV  200

Query  821   TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDG  1000
             TPFNFPLEIPVLQLMGALYMGNKPVLK   +V IVMEQ LRLLH CG+   DVDFLN  G
Sbjct  201   TPFNFPLEIPVLQLMGALYMGNKPVLKPSEQVSIVMEQFLRLLHHCGMDEGDVDFLNCRG  260

Query  1001  KTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWV  1180
                  ++ +   R+T FTGSS+V E LA   KG+++LEDAGFDWKI+GPDV +VDY+AW 
Sbjct  261   PVAQAVITQTPVRLTQFTGSSKVGELLAEATKGKVRLEDAGFDWKIIGPDVGDVDYVAWQ  320

Query  1181  CDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAML  1360
             CDQDAYA  GQKCSAQSI F+HENW K  L+  + S+  +R L+DLT GP LT +TK  L
Sbjct  321   CDQDAYATIGQKCSAQSICFIHENWKKVGLVEKIKSITEKRNLNDLTAGPTLTVSTKTFL  380

Query  1361  DHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFG  1540
             DH N+L  IPG+ +L+GGE LENH IP  YGA++PTAVFVPLEE++K+EN++   TE+F 
Sbjct  381   DHTNRLASIPGASVLWGGEELENHKIPEKYGAVKPTAVFVPLEEMIKEENFESCVTEIFA  440

Query  1541  PFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTT  1720
             PFQ+++ Y D+ +  VL+ALE+M  +LTAAVVSND  F  +V+ N+VNGTTYAG RARTT
Sbjct  441   PFQVISFYNDDTIDDVLSALEKMSHHLTAAVVSNDVSFQTKVLANTVNGTTYAGRRARTT  500

Query  1721  GAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             GAPQNHWFGPAGDPRGAGIGT EAI+LVWSCHREII D   V   W  PQ +
Sbjct  501   GAPQNHWFGPAGDPRGAGIGTQEAIQLVWSCHREIIND-NLVPTNWNQPQQS  551



>ref|XP_007508262.1| aldehyde dehydrogenase [Bathycoccus prasinos]
 emb|CCO20366.1| aldehyde dehydrogenase [Bathycoccus prasinos]
Length=584

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/525 (61%), Positives = 393/525 (75%), Gaps = 9/525 (2%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSS--WNTILDPL--NGESFIKVAEVQDAELQP  487
             +AT+  E +S + PA    +V G +  S+   + T  DP+  N +SF+ V E+   EL  
Sbjct  57    WATVEPETMSNAIPAIASCIVDGQFALSAKKEYKTFPDPMDKNQDSFLLVPEITREELGH  116

Query  488   FLES-MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQ  664
             FL+S + K PK G HN FK PERYL  GD++ K A  L       +F +LIQRV+PKSY 
Sbjct  117   FLQSRVAKTPKSGAHNAFKHPERYLKYGDVTMKLAEALRDASNVTYFAKLIQRVAPKSYA  176

Query  665   QALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLE  844
             QA AEV VT+KFLENF+GD VRFL+R F VPG+H GQ S G+RWPYG V I+TPFNFPLE
Sbjct  177   QAEAEVVVTRKFLENFTGDNVRFLSRGFSVPGDHTGQTSFGYRWPYGKVCIITPFNFPLE  236

Query  845   IPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLL  1024
             IPVLQL+GALYMGN+ +L VDS+V IVMEQ LRL+H CG+P EDVD ++ DG+ M +LL 
Sbjct  237   IPVLQLLGALYMGNRVLLHVDSRVSIVMEQFLRLMHACGMPTEDVDLIHCDGQIMGELLE  296

Query  1025  EGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDV--DEVDYIAWVCDQDAY  1198
             + +PRMTLFTGS  VAE+LA  LKGR+KLEDAGFDWKILGPD   +E+ + A+ CDQDAY
Sbjct  297   QLQPRMTLFTGSQGVAERLALQLKGRVKLEDAGFDWKILGPDAKEEELQFTAYQCDQDAY  356

Query  1199  ACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
             ACSGQKCSAQSILF H NW +  + + M+SLA +R L DLTVGPVLT TT+ ML H+ ++
Sbjct  357   ACSGQKCSAQSILFAHANWMRLGVCDAMASLAKKRNLTDLTVGPVLTKTTEQMLTHVRQI  416

Query  1379  L-QIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGPFQI  1552
             L QI GSK+LFGG+ L+NH+IP  YGAI PTAVFVPL+E++K  +N++LVTTE+FGPFQI
Sbjct  417   LSQIEGSKVLFGGKELQNHNIPERYGAIEPTAVFVPLKEMMKTRDNFELVTTEIFGPFQI  476

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQ  1732
             V EY D+ LP VL A+E+M+ +LTAA+VSND  F ++V+  +VNGTTY G RARTTGAPQ
Sbjct  477   VVEYDDSTLPDVLKAMEKMENHLTAAIVSNDVDFRRKVLSETVNGTTYVGNRARTTGAPQ  536

Query  1733  NHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             NHWFGPAGDPR  GIGT EAI+LVWS HRE+I D       W  P
Sbjct  537   NHWFGPAGDPRAGGIGTKEAIQLVWSSHREVIVDDNESKKNWTQP  581



>emb|CAN63138.1| hypothetical protein VITISV_034571 [Vitis vinifera]
Length=424

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/500 (64%), Positives = 356/500 (71%), Gaps = 114/500 (23%)
 Frame = +2

Query  377   LVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERY  556
             LVQG W  S+S  TI+DPLNGE FI+VAEV +  +Q                        
Sbjct  39    LVQGKWTGSTSGETIVDPLNGEPFIQVAEVDETGIQ------------------------  74

Query  557   LMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFL  736
                               VSDFFTRLIQRV+PKSYQQAL EV+VTQKFLENFSGDQVRFL
Sbjct  75    ------------------VSDFFTRLIQRVAPKSYQQALGEVYVTQKFLENFSGDQVRFL  116

Query  737   ARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKV  916
             ARSF VPGNHLGQQSHGFRWPYGPV+IV                                
Sbjct  117   ARSFAVPGNHLGQQSHGFRWPYGPVSIV--------------------------------  144

Query  917   CIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLK  1096
                MEQM+RLLH CGLP+ED+DF+NSDGKTMNKLLLE  PRMTLFTGSSRVA+KLA DLK
Sbjct  145   ---MEQMIRLLHHCGLPMEDLDFINSDGKTMNKLLLEANPRMTLFTGSSRVADKLAVDLK  201

Query  1097  GRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLIN  1276
             GRIKLEDAGFDWKILGPDV EVDY+AWVCDQDAYACSGQKCSAQSI+FMHENW KS LI+
Sbjct  202   GRIKLEDAGFDWKILGPDVQEVDYVAWVCDQDAYACSGQKCSAQSIVFMHENWFKSSLIS  261

Query  1277  LMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA  1456
              M  LAARRKL+DLT+GPVL+FTT+AML+HMNKLLQIPGS+LLFGG+ LENHSIP IYGA
Sbjct  262   RMKDLAARRKLEDLTIGPVLSFTTEAMLEHMNKLLQIPGSELLFGGKALENHSIPPIYGA  321

Query  1457  IRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVV  1636
             ++PTA+++PLEE+LKD NY+LVT E+FGPF                              
Sbjct  322   LKPTAIYIPLEEMLKDGNYELVTREIFGPF------------------------------  351

Query  1637  SNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCH  1816
                    QEVIG SVNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCH
Sbjct  352   -------QEVIGKSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCH  404

Query  1817  REIIYDIGPVSPAWKLPQAT  1876
             REIIYDIGP+   W++P AT
Sbjct  405   REIIYDIGPLPSHWEIPPAT  424



>ref|XP_002769289.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER02007.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Perkinsus 
marinus ATCC 50983]
Length=552

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/507 (58%), Positives = 374/507 (74%), Gaps = 3/507 (1%)
 Frame = +2

Query  356   QPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNP  535
             +  ++HN + G W+ ++    I+DPL G+  +K+     +EL PF++SMR  PK GLHNP
Sbjct  43    EAVKLHNFLNGKWVHTAKTTDIVDPLTGKPMLKMPNTSVSELDPFVKSMRAIPKSGLHNP  102

Query  536   FKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFS  715
              +  ERY + GDIS K A  L   EV D F + IQRV+PKS+ Q++AEV + + FLENFS
Sbjct  103   LRNVERYRLYGDISHKLAAELRKKEVMDHFAKCIQRVAPKSWTQSVAEVDIVRIFLENFS  162

Query  716   GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPV  895
             GDQVRFLAR F V G+  GQQS G+RWPYGP A++ PFNFPLEIPVLQLMGALYMGN   
Sbjct  163   GDQVRFLARGFTVSGDRDGQQSQGYRWPYGPTALIAPFNFPLEIPVLQLMGALYMGNHVT  222

Query  896   LKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAE  1075
             LK  S   +VME+ LRL+   G P  DV+ ++  GK    LL+EGKPR+TLFTGSS VAE
Sbjct  223   LKCASMTSMVMEEWLRLMQKVGAPSSDVNMIHCGGKVAEALLMEGKPRVTLFTGSSVVAE  282

Query  1076  KLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
             +LA    GRIK+EDAGFDWKILGP  +   +++++AW CDQDAYA +GQKCSAQSILF H
Sbjct  283   RLATVTAGRIKIEDAGFDWKILGPVRNISSQLEHVAWTCDQDAYAHTGQKCSAQSILFAH  342

Query  1247  ENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLE  1426
              +W ++ +   M  +A  R LD+LT+GPVL+ TT  +  H  +LL+IPG+K+LFGG+PL 
Sbjct  343   HDWVEAGIFQKMGQIARERSLDNLTIGPVLSHTTADIRSHQEELLKIPGAKVLFGGKPLT  402

Query  1427  NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALER  1606
              H+IP  YGA  PTAVFVPLEE++K  ++++ T E+FGPFQ+ TE+K +QL LVL+A ER
Sbjct  403   GHTIPQCYGAYEPTAVFVPLEELVKPGHFEVCTKEIFGPFQVCTEWKSDQLKLVLDATER  462

Query  1607  MDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTP  1786
             M A+LTAAVVS+D      ++G +VNGTTYAG+RARTTGAPQNHWFGPAGDPR AGIG+P
Sbjct  463   MSAHLTAAVVSDDPQVKNAILGVTVNGTTYAGVRARTTGAPQNHWFGPAGDPRAAGIGSP  522

Query  1787  EAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             EAI+LVWSCHREII D GPV   W  P
Sbjct  523   EAIRLVWSCHREIIQDDGPVPEGWVRP  549



>ref|XP_002781067.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER12862.1| 1-pyrroline-5-carboxylate dehydrogenase, putative [Perkinsus 
marinus ATCC 50983]
Length=552

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/507 (58%), Positives = 373/507 (74%), Gaps = 3/507 (1%)
 Frame = +2

Query  356   QPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNP  535
             +  ++HN + G W+ ++    I+DPL G+  +K+     +EL PF++SMR  PK GLHNP
Sbjct  43    EAVKLHNFLNGKWVHTAKTTDIVDPLTGKPMLKMPNTSVSELDPFVKSMRAIPKSGLHNP  102

Query  536   FKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFS  715
              +  ERY + GDIS K A  L   EV D F + IQRV+PKS+ Q++AEV + + FLENFS
Sbjct  103   LRNVERYRLYGDISHKLAAELRKKEVMDHFAKCIQRVAPKSWAQSVAEVDIVRIFLENFS  162

Query  716   GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPV  895
             GDQVRFLAR F V G+  GQQS G+RWPYGP A++ PFNFPLEIPVLQLMGALYMGN   
Sbjct  163   GDQVRFLARGFTVSGDRDGQQSQGYRWPYGPTALIAPFNFPLEIPVLQLMGALYMGNHVT  222

Query  896   LKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAE  1075
             LK  S   +VME+ LRL+   G P  DV+ ++  GK    LL++GKPR+TLFTGSS VAE
Sbjct  223   LKCASMTSMVMEEWLRLMQKVGAPSSDVNMIHCGGKVAEALLMDGKPRVTLFTGSSVVAE  282

Query  1076  KLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
             +LA    GRIK+EDAGFDWKILGP  +   +++++AW CDQDAYA +GQKCSAQSILF H
Sbjct  283   RLATVTAGRIKIEDAGFDWKILGPVRNISSQLEHVAWTCDQDAYAHTGQKCSAQSILFAH  342

Query  1247  ENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLE  1426
              +W ++ +   M  +A  R LD+LT+GPVL+ TT  +  H  +LL+IPG+K+LFGG+PL 
Sbjct  343   HDWVEAGIFQKMGQIARERSLDNLTIGPVLSHTTADIQSHQEELLKIPGAKVLFGGKPLI  402

Query  1427  NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALER  1606
              H+IP  YGA  PTAVFVPLEE++K  ++++ T E+FGPFQ+ TE+K +QL LVL+A ER
Sbjct  403   GHTIPQCYGAYEPTAVFVPLEELVKPGHFEVCTKEIFGPFQVCTEWKSDQLKLVLDATER  462

Query  1607  MDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTP  1786
             M A+LTAAVVS+D      ++G +VNGTTYAG+RARTTGAPQNHWFGPAGDPR AGIG+P
Sbjct  463   MSAHLTAAVVSDDPQVKNAILGVTVNGTTYAGVRARTTGAPQNHWFGPAGDPRAAGIGSP  522

Query  1787  EAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             EAI+LVWSCHREII D G V   W  P
Sbjct  523   EAIRLVWSCHREIIQDDGGVPEGWVRP  549



>gb|ABZ06724.1| putative aldehyde dehydrogenase family protein [uncultured marine 
microorganism HF4000_141E02]
Length=535

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/529 (56%), Positives = 393/529 (74%), Gaps = 10/529 (2%)
 Frame = +2

Query  305   SHSLPFATLN-VEDISGSQPAEVHNLVQGNWIRSSSW-NTILDPLNGESFIKVAEVQDAE  478
             S+ L F T++ +  ++   P +  NL+ G W+ +S + + I DP++GE FI + +  D  
Sbjct  10    SNLLKFTTVDPISGMNSKNPGKAQNLLSGEWLDTSKYFDNIPDPVSGEYFIDIPDTDD--  67

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             L  F++++  CPK GLHNP K  ERY+MLG++  KAA +LS  EV DFF  LIQRV PKS
Sbjct  68    LSGFIQNLDICPKSGLHNPIKNVERYVMLGNVCAKAAALLSNKEVEDFFVYLIQRVMPKS  127

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
               Q L EV VT+KFLENFSGD VRFLARSF  PG+HLGQ+S G+RWP+G V IVTPFNFP
Sbjct  128   SNQCLGEVTVTRKFLENFSGDGVRFLARSFSNPGDHLGQESSGYRWPFGSVVIVTPFNFP  187

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIP LQ +GAL+MGN+P++K  + V IV EQ LRLL  CGLP  D D ++  G  M KL
Sbjct  188   LEIPALQFLGALFMGNRPLIKSATTVGIVFEQFLRLLIHCGLPATDADMVHCRGSKMGKL  247

Query  1019  LLEG--KPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDE--VDYIAWVCD  1186
             + +   K RM  FTGS  VAE++A D  G++++EDAGF+WK++GPD D    DY+AW CD
Sbjct  248   ISDASDKIRMVQFTGSCAVAERIAADTNGKVRVEDAGFNWKLIGPDYDPSWSDYVAWQCD  307

Query  1187  QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDH  1366
             +DAY  SGQKCSAQSILF+H+NW +  L+  +  LA RRKL++L++GPVLT+    + +H
Sbjct  308   EDAYNASGQKCSAQSILFVHKNW-EQDLLLKLKQLAERRKLENLSIGPVLTWNNDQLFNH  366

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
             +N LL+IPG+  LFGG  LE+H+IP IYG+I+PTAV +P+ ++L  ++++L+T+EVFGP 
Sbjct  367   INSLLEIPGTTCLFGGTELESHNIPKIYGSIKPTAVSIPVNQLLG-KDFELITSEVFGPV  425

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGA  1726
             Q++  Y+D  LP ++ ALE++  NLTAAVVSND  F Q+V+G +VNGTTYAG+RARTTGA
Sbjct  426   QVIVVYEDQDLPTIMEALEKIPQNLTAAVVSNDVYFQQKVLGYTVNGTTYAGMRARTTGA  485

Query  1727  PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQA  1873
             PQNHWFGP+GDPR AGIGTPEAI L WS HREII D+GP++P W++P +
Sbjct  486   PQNHWFGPSGDPRSAGIGTPEAITLTWSGHREIIKDVGPLNPNWEIPDS  534



>gb|ABZ06182.1| putative aldehyde dehydrogenase family protein [uncultured marine 
microorganism HF4000_006O13]
Length=535

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/529 (56%), Positives = 390/529 (74%), Gaps = 10/529 (2%)
 Frame = +2

Query  305   SHSLPFATLN-VEDISGSQPAEVHNLVQGNWIRSSSW-NTILDPLNGESFIKVAEVQDAE  478
             S+ L F T++ +  ++   P +  NL+ G W+ +S + + I DP++GE FI + +  D  
Sbjct  10    SNLLEFTTVDPISGMNSKNPGKAQNLLSGEWLDTSKYFDNIPDPVSGEYFIDIPDTDD--  67

Query  479   LQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKS  658
             L  F++++  CPK GLHNP K  ERY+MLG++  KAA +LS  EV DFF  LIQRV PKS
Sbjct  68    LSGFIQNLDICPKSGLHNPIKNVERYVMLGNVCAKAAALLSNKEVEDFFVHLIQRVMPKS  127

Query  659   YQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFP  838
               Q L EV VT+KFLENFSGD VRFLARSF  PG+HLGQ+S G+RWP+G V IV PFNFP
Sbjct  128   SNQCLGEVTVTRKFLENFSGDGVRFLARSFSNPGDHLGQESSGYRWPFGSVVIVAPFNFP  187

Query  839   LEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKL  1018
             LEIP LQ +GAL+MGN+P++K  + V IV EQ LRLL  CGLP  D D ++  G  M KL
Sbjct  188   LEIPALQFLGALFMGNRPLIKSATTVGIVFEQFLRLLIHCGLPATDADMVHCRGSKMGKL  247

Query  1019  L--LEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDE--VDYIAWVCD  1186
             +     K RM  FTGS  VAE++A D  G++++EDAGF+WK++GPD D    DY+AW CD
Sbjct  248   ISAASDKIRMVQFTGSCAVAERIAADTNGKVRVEDAGFNWKLIGPDYDPSWSDYVAWQCD  307

Query  1187  QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDH  1366
             +DAY  SGQKCSAQSILF+H+NW +  L+  +  LA RRKL++L++GPVLT+    + +H
Sbjct  308   EDAYNASGQKCSAQSILFVHKNW-EQDLLLKLKQLAERRKLENLSIGPVLTWNNDQLFNH  366

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
             +N LL+IPG+  LFGG  LE+H+IP IYG+I+PTAV +P+ ++L  ++++L+T+EVFGP 
Sbjct  367   INSLLEIPGTTCLFGGTELESHNIPKIYGSIKPTAVSIPVNQLLG-KDFELITSEVFGPV  425

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGA  1726
             Q++  Y+D  LP ++ ALE++  NLTAAVVSND  F Q+V+G +VNGTTYAG+RARTTGA
Sbjct  426   QVIVVYEDQDLPTIMEALEKIPQNLTAAVVSNDVHFQQKVLGYTVNGTTYAGMRARTTGA  485

Query  1727  PQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQA  1873
             PQNHWFGP+GDPR AGIGTPEAI L WS HREII D+GP+ P W++P +
Sbjct  486   PQNHWFGPSGDPRSAGIGTPEAITLTWSGHREIIKDVGPLDPNWEIPDS  534



>ref|XP_010934527.1| PREDICTED: probable aldehyde dehydrogenase isoform X5 [Elaeis 
guineensis]
Length=484

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/359 (79%), Positives = 316/359 (88%), Gaps = 0/359 (0%)
 Frame = +2

Query  308   HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
             HS PFAT+ VE+ISGS PAEV+NLVQG+W  S++WN + DPLNGE FIKVA VQ+AE++P
Sbjct  32    HSPPFATIAVEEISGSHPAEVYNLVQGDWKASANWNWVPDPLNGEPFIKVANVQEAEIKP  91

Query  488   FLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQ  667
             F+ES+ KCPK+GLHNP +  ERYL+LGD+S KAAHML+ PEVSDFF+RLIQRVSPKSY+Q
Sbjct  92    FVESLSKCPKYGLHNPLRGQERYLLLGDVSAKAAHMLAQPEVSDFFSRLIQRVSPKSYKQ  151

Query  668   ALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEI  847
             AL EV VTQKFLENFSGDQVRFLARSF VPGNHLGQQSHG+RWPYGPVAI+TPFNFPLEI
Sbjct  152   ALGEVHVTQKFLENFSGDQVRFLARSFAVPGNHLGQQSHGYRWPYGPVAIITPFNFPLEI  211

Query  848   PVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLE  1027
             P+LQLMGALYMGNKP LKVDSKV IVMEQMLRLLH CGLP EDVDF+NSDG TMNK LLE
Sbjct  212   PLLQLMGALYMGNKPTLKVDSKVSIVMEQMLRLLHYCGLPEEDVDFINSDGVTMNKFLLE  271

Query  1028  GKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACS  1207
              KPRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWKILGPDV EVDY+AWVCDQDA+ACS
Sbjct  272   AKPRMTLFTGSSRVAEKLAADLKGRIRLEDAGFDWKILGPDVQEVDYVAWVCDQDAHACS  331

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQ  1384
             GQKCSAQSILFMHENW  S LI  M  LA RRKL+DLT+GPVLT  T    D ++ +L+
Sbjct  332   GQKCSAQSILFMHENWVSSELIPKMLCLAKRRKLEDLTIGPVLTIITDYKHDQLSMVLE  390


 Score =   187 bits (476),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +2

Query  1532  VFGP-FQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIR  1708
               GP   I+T+YK +QL +VL A ERM A+LTAAVVSND LFLQEV+G SVNGTTYAGIR
Sbjct  369   TIGPVLTIITDYKHDQLSMVLEACERMHAHLTAAVVSNDPLFLQEVLGKSVNGTTYAGIR  428

Query  1709  ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+    ++P AT
Sbjct  429   ARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPQHGEIPSAT  484



>gb|EJY76707.1| Delta-1-pyrroline-5-carboxylate dehydrogenase [Oxytricha trifallax]
Length=550

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/523 (54%), Positives = 377/523 (72%), Gaps = 11/523 (2%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQ--PFL  493
             FAT++ E++S +      NL++G W  + ++  +LDP+NG+   +V   Q AE Q    +
Sbjct  29    FATVDPENLSKTNKG--FNLIKGQWQATENYTELLDPMNGQVMCQVPNTQYAEQQVTDLV  86

Query  494   ESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQAL  673
             E ++  PK GLHNPFK  ERYLMLG+++ +    +  PEV  FF RL+QR  PKSY QA 
Sbjct  87    EDLQNTPKSGLHNPFKNKERYLMLGEVNRRLVESMQDPEVYKFFVRLLQRTCPKSYTQAD  146

Query  674   AEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPV  853
              E+ VT  F +NF GD VR+LA     PG+H GQ + G+R+PYG  A++TPFNFPLEIPV
Sbjct  147   GELKVTVDFFKNFCGDNVRYLASGQRSPGDHAGQFATGYRFPYGASAVITPFNFPLEIPV  206

Query  854   LQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGK  1033
             LQ+MGALYMGNK V+K D+K  + +EQ +RLLH+CGLP ED+ F+++DG T  K+L+ G 
Sbjct  207   LQMMGALYMGNKVVVKPDTKTALPLEQFIRLLHECGLPKEDLSFIHADGPTTEKILINGD  266

Query  1034  PRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDV----DEVDYIAWVCDQDAYA  1201
              R TLFTGSSRVAE L   L G++++EDAGFDWKI+GPDV     E+DY+AW CDQDAY 
Sbjct  267   VRQTLFTGSSRVAEHLCKKLHGKVRIEDAGFDWKIIGPDVPKTQQEIDYVAWQCDQDAYG  326

Query  1202  CSGQKCSAQSILFMHENWS-KSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKL  1378
              SGQKCSAQSILF+H+NW+ K+ L   +   A +R L DLT+GP+LT+    + +H++  
Sbjct  327   HSGQKCSAQSILFVHKNWTKKTNLFKTLEQQAGKRNLKDLTIGPILTWNNTQIKEHIDAC  386

Query  1379  LQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             LQIPG+++LFGG+PLENH IP IYG+ +PTAV VP++     +N   + TE+FGPFQ++ 
Sbjct  387   LQIPGAQILFGGKPLENHQIPEIYGSYQPTAVTVPIQRFKMRKNAKTLLTELFGPFQVIV  446

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
             EYK+  +  VL   E+M  +LTAAVVSND +F   V+ N+VNG TY G+RARTTGAPQNH
Sbjct  447   EYKE--IDDVLQVCEQMTHHLTAAVVSNDPVFTDYVLQNTVNGCTYHGMRARTTGAPQNH  504

Query  1739  WFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             WFGP+GDPRGAGIGT EAI+LVWS HREI+ D+GP+   W +P
Sbjct  505   WFGPSGDPRGAGIGTAEAIQLVWSHHREIVSDVGPIKADWAIP  547



>ref|XP_002908669.1| aldehyde dehydrogenase, putative [Phytophthora infestans T30-4]
 gb|EEY57483.1| aldehyde dehydrogenase, putative [Phytophthora infestans T30-4]
Length=526

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/457 (62%), Positives = 352/457 (77%), Gaps = 11/457 (2%)
 Frame = +2

Query  194   QLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLP-FATLNVEDISGSQPAEV  370
             ++RN+  R++     S  T+R           +  R   SLP FAT++  D SG+ P + 
Sbjct  70    KIRNKMLRSSSLRAVSAHTSR---------RALNARTMSSLPSFATVD-PDFSGANPTDG  119

Query  371   HNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPE  550
              NLV G W +++   TI+DPLNGE+F+ +   Q  EL PF+ESM  CPKHGLHNP K  E
Sbjct  120   FNLVNGEWTKTAKTETIVDPLNGEAFMTMPLTQKNELAPFVESMTSCPKHGLHNPLKNVE  179

Query  551   RYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR  730
             RY+M G++S KA  M    +V+D+F +L+QR SPKSY QA  EV VT KFLENFSGDQVR
Sbjct  180   RYVMYGEVSAKAGAMFREDKVADYFAKLVQRTSPKSYFQARNEVKVTGKFLENFSGDQVR  239

Query  731   FLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDS  910
             FLA SFGVPG+H GQ S+G RWPYGPVA++TPFNFP+EIPVLQ+MGAL+MGNK +LKVDS
Sbjct  240   FLASSFGVPGDHQGQTSNGHRWPYGPVALITPFNFPIEIPVLQMMGALFMGNKVLLKVDS  299

Query  911   KVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGD  1090
             KV IVM++ LRLLH+CG+PL DVDF+NSDG  MN LL++ KPR TLFTGS  VAEKLA D
Sbjct  300   KVSIVMQETLRLLHECGMPLTDVDFINSDGAVMNDLLMQIKPRNTLFTGSQAVAEKLAKD  359

Query  1091  LKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPL  1270
             L GRIKLEDAGFDWK+LGPDV + DY+AW  DQDAYACSGQKCSAQS+LFMH+NW+K+ L
Sbjct  360   LSGRIKLEDAGFDWKVLGPDVRDFDYVAWTSDQDAYACSGQKCSAQSVLFMHKNWAKAGL  419

Query  1271  INLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIY  1450
                ++ LAARRKL DLT+GPVLT +TK MLDH   LL++PG+++ FG E LENH+IP  Y
Sbjct  420   EKKLAELAARRKLSDLTIGPVLTVSTKRMLDHAAALLKLPGARVAFGAEELENHTIPEKY  479

Query  1451  GAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             GA++PTA+FVPL+E +K EN++LVTTE+FGPFQ++TE
Sbjct  480   GAVKPTAIFVPLKEFVKPENFELVTTEIFGPFQVITE  516



>emb|CDW82503.1| probable aldehyde dehydrogenase-like [Stylonychia lemnae]
Length=548

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/520 (53%), Positives = 374/520 (72%), Gaps = 6/520 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FAT++  ++S  +  +  NLV G W  + +   ++DP+NG      A+    E++PF++ 
Sbjct  28    FATVDPNNLS--KKDQGLNLVNGVWSSTKATTQLIDPMNGNVIATQADTSLDEIKPFVDE  85

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             M + PK GLHNPFK  ERYLML +++ K     +  EV DFF + IQRV PKS  QA  E
Sbjct  86    MAQTPKTGLHNPFKNKERYLMLAEVNRKLVESFNDKEVFDFFIKAIQRVCPKSTAQATGE  145

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             + VT  F +NF GD VR+LA SFG PG+H GQ ++ +R+PYG V+++TPFNFPLEIPVLQ
Sbjct  146   LQVTIDFFKNFCGDNVRYLASSFGSPGDHQGQSTNAYRFPYGAVSVITPFNFPLEIPVLQ  205

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
             +MGALYMGNK ++K D K  + +EQ +RLLH CGLP  D+  + S+G  M K+L +G  R
Sbjct  206   MMGALYMGNKVLVKPDVKTALPLEQFIRLLHHCGLPKTDLSLIYSNGPVMEKILQQGNVR  265

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDV----DEVDYIAWVCDQDAYACS  1207
              TLFTGSS++AE+L+ +L+G++++EDAGFDWKILGPDV     E+DY+AW CDQDAY  +
Sbjct  266   QTLFTGSSKIAEQLSKNLRGKVRIEDAGFDWKILGPDVPKSQQEIDYVAWQCDQDAYGHT  325

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILF+H+NW K+   + + S A +R L+D T+GPVL++T + + DH++K+  +
Sbjct  326   GQKCSAQSILFVHKNWKKTNFYDTLKSQAEKRSLEDQTIGPVLSWTNQQIQDHVDKVKSM  385

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
               ++LLFGGE L+ HSIP  YGA +PTA+ VP+      +    + TE+FGPFQ++ EY 
Sbjct  386   KAAELLFGGEALQGHSIPPQYGAYKPTAIKVPIYRFANRKQRSTLLTELFGPFQVIVEYG  445

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
             D  +  VL  +E M  +LTAAVVSN+  F+ +++ N+VNGTTY G+RARTTGAPQNHWFG
Sbjct  446   DQNVDQVLKIMENMTHHLTAAVVSNNPQFVDKILQNTVNGTTYTGLRARTTGAPQNHWFG  505

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             P+GDPRGAGIG+ EAIKLVWS HREII DIGP+  +W LP
Sbjct  506   PSGDPRGAGIGSKEAIKLVWSHHREIISDIGPIKESWSLP  545



>ref|XP_009033417.1| hypothetical protein AURANDRAFT_52250 [Aureococcus anophagefferens]
 gb|EGB12381.1| hypothetical protein AURANDRAFT_52250 [Aureococcus anophagefferens]
Length=544

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/533 (54%), Positives = 380/533 (71%), Gaps = 3/533 (1%)
 Frame = +2

Query  287   EVGTRASHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAE  463
             ++ T  S  LP +AT++   +SG+ P +  NLV G W  +++   + DPLNGE+ + V +
Sbjct  12    QIRTFQSGPLPSWATVDPWAMSGASPQQGMNLVDGEWSAAAATKPVPDPLNGEAMLFVPD  71

Query  464   VQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQR  643
              + +EL PF+ SM+  PK GLHNP   P  Y  +G+++ +A+  L  PEV +FF  L+QR
Sbjct  72    TRPSELAPFVASMKAVPKSGLHNPINNPGAYFEMGEVNGRASVELRKPEVHNFFAELLQR  131

Query  644   VSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVT  823
             V PK   QA+ EV V +K+L+ ++GD VR LA S  +PG+H GQ++  +RWPYGP +++T
Sbjct  132   VVPKHDVQAMGEVTVVRKWLDGYAGDGVRRLANSAALPGDHAGQETRSYRWPYGPTSVIT  191

Query  824   PFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGK  1003
             PFNFPLEIP LQ + +++MGNK  +KVD KV IV EQ  RL+  CGL  + +D +  DG 
Sbjct  192   PFNFPLEIPALQSLSSVWMGNKCTVKVDEKVQIVYEQFARLMIHCGLDPKCLDLIYCDGP  251

Query  1004  TMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVC  1183
             T N+LLL G  +MTLFTGS  VAEKL  DL+GR+KLEDAGFDWKI+GPDV + D++ W  
Sbjct  252   TFNELLLAGDSKMTLFTGSQAVAEKLTIDLRGRVKLEDAGFDWKIMGPDVQDEDFVVWQA  311

Query  1184  DQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLD  1363
             DQDAYA SGQKCSAQSI FMHENW  + L+  +   AARR L D + GPVL++TT  ML 
Sbjct  312   DQDAYAFSGQKCSAQSICFMHENWVAAGLVGKLERQAARRSLADYSSGPVLSWTTDQMLA  371

Query  1364  HMNKLLQIPGSKLLFGGEPLE-NHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVF  1537
             H+ +   +PG+K+ FGG  L  + + P+ YG + PTAV VPL+ +L   EN+D VTTE+F
Sbjct  372   HVERTAALPGAKVAFGGSKLPGSEAFPACYGGLVPTAVEVPLDTMLASQENFDAVTTELF  431

Query  1538  GPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRART  1717
             GPFQI+  YKD+++  VL A ERM ++LTAAVVSND  F  +V+G +VNGTTY+G+RART
Sbjct  432   GPFQILVPYKDDEIDKVLEACERMTSHLTAAVVSNDTRFCNKVLGATVNGTTYSGVRART  491

Query  1718  TGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TGAPQNHWFGPAGDPR AGI TPEAI+L WS HREII+D+GPV+  W +P  T
Sbjct  492   TGAPQNHWFGPAGDPRSAGIHTPEAIRLCWSSHREIIHDVGPVADEWTMPSPT  544



>ref|XP_008889035.1| aldehyde dehydrogenase (NAD) family protein [Hammondia hammondi]
 gb|KEP60173.1| aldehyde dehydrogenase (NAD) family protein [Hammondia hammondi]
Length=635

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/565 (51%), Positives = 381/565 (67%), Gaps = 21/565 (4%)
 Frame = +2

Query  236   GSLGTTRPNHSRPY---------ANEEVGTRASHS------LPFATLNVEDISGSQPAEV  370
              SLG+    HS+P           N   G RA +S        FA +++  +SG+ P  V
Sbjct  68    ASLGSHPSYHSKPLVRACASMCSTNMGAGYRAFNSSSWSAVRAFANVDLGKLSGASPHTV  127

Query  371   HNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPE  550
              NLV G W  S     ++DP+NGE+FIK    +D EL+PF+ S++  PK GLHNP K PE
Sbjct  128   QNLVNGKWSESRETYDVVDPMNGEAFIKSPYTKDDELEPFIASIKAVPKSGLHNPLKNPE  187

Query  551   RYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR  730
             RY++ G +  K A ML    V DFFT  I R  PKSY QA AEV V Q F ENFSGD +R
Sbjct  188   RYVLYGQVLQKTAAMLHDDRVFDFFTTCIVRTFPKSYGQAAAEVRVVQAFCENFSGDGIR  247

Query  731   FLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDS  910
             FLAR F VPG+H GQ S+GFRWP+GPVA+++PFNFPLEIPV+Q + A  +GNKPV+K ++
Sbjct  248   FLARGFSVPGDHHGQMSNGFRWPFGPVAVISPFNFPLEIPVMQFLAAAMVGNKPVVKTEA  307

Query  911   KVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGD  1090
                + +EQ LRLLH CG+P +DVD LN+ G  +++LL +   R+  FTG S  A+ L   
Sbjct  308   TQALPVEQFLRLLHYCGMPTKDVDLLNTRGPVVSELLCKAPVRLLQFTGGSATAQHLVRL  367

Query  1091  LKGRIKLEDAGFDWKILGPD--VDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKS  1264
             L GR+K+ED+GFDWKILGPD   +E+DYIAW CDQDAYA SGQKCSAQS+L +H +W + 
Sbjct  368   LNGRVKVEDSGFDWKILGPDAKAEELDYIAWQCDQDAYALSGQKCSAQSLLAVHTSWKEL  427

Query  1265  PLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL---ENHS  1435
              L+ ++  LA+RR   +LT+ P+L+ +   +  H++ LL++PG+ LLFGG+ +   +  +
Sbjct  428   GLVAILKRLASRRSYQNLTLSPILSHSNSEIQKHVDALLKLPGASLLFGGKAVKTTQTSA  487

Query  1436  IPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMD  1612
             IP  YGA  PTAVFVPL  IL  +EN +L TTE+FGP Q+VTE+       +L  +E M 
Sbjct  488   IPRKYGAYEPTAVFVPLASILMNNENLELATTELFGPVQVVTEWGAGDENTLLRLMESMK  547

Query  1613  ANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEA  1792
               LTAA+VS D  F   ++ N++NGTTYAGIRARTTGAPQNHWFGPAGDP GAGIG+PEA
Sbjct  548   HPLTAAIVSRDPEFQNLILANTINGTTYAGIRARTTGAPQNHWFGPAGDPLGAGIGSPEA  607

Query  1793  IKLVWSCHREIIYDIGPVSPAWKLP  1867
             +   W+CHREI++D GP+  +W  P
Sbjct  608   VLSTWTCHREIVFDQGPIPGSWTTP  632



>gb|EPT27849.1| aldehyde dehydrogenase (NAD) family protein [Toxoplasma gondii 
ME49]
Length=637

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/522 (53%), Positives = 368/522 (70%), Gaps = 6/522 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FA +++  +SG  P  V NLV G W  +     ++DP+NGE+FIK    +DAEL+PF+ S
Sbjct  113   FANVDLGKLSGDSPHTVQNLVNGKWSGTRETYDVVDPMNGEAFIKSPYTKDAELEPFIAS  172

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             ++  PK GLHNP K PERY++ G +  K A ML    V DFFT  I R  PKSY QA AE
Sbjct  173   IKGVPKSGLHNPLKRPERYVLYGQVLQKTAAMLHDERVFDFFTTCIMRTFPKSYGQAAAE  232

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V V + F ENFSGD +RFLAR F VPG+H GQ S+GFRWP+GPVA+++PFNFPLEIPV+Q
Sbjct  233   VRVVRTFCENFSGDGIRFLARGFSVPGDHHGQMSNGFRWPFGPVAVISPFNFPLEIPVMQ  292

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
              + A  +GNKPV+K ++   + +EQ LRLLH CG+P +DVD +N+ G  +++LL +   R
Sbjct  293   FLAAAMVGNKPVVKTEATQALPVEQFLRLLHYCGMPTKDVDLINTRGPVVSELLCKAPVR  352

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPD--VDEVDYIAWVCDQDAYACSGQ  1213
             +  FTG S  A+ L   L GR+K+EDAGF+WKILGPD   +E+DYIAW CDQDAYA SGQ
Sbjct  353   LLQFTGGSATAQHLIRLLNGRVKVEDAGFNWKILGPDAKAEELDYIAWQCDQDAYALSGQ  412

Query  1214  KCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPG  1393
             KCSAQS+L +H +W +  L+  +  LA+RR  ++LT+ PVL+ +   +  H++ LL++PG
Sbjct  413   KCSAQSLLAVHTSWKELGLLEKLKRLASRRSYENLTLSPVLSHSNSEIQKHVDALLKLPG  472

Query  1394  SKLLFGGEPL---ENHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTE  1561
             + LLFGG+ +   +  +IP  YGA  PTAVFVPL  IL  +EN +L TTE+FGP Q+VTE
Sbjct  473   ASLLFGGKAVKTAKTSAIPRKYGAYEPTAVFVPLASILMNNENLELATTELFGPVQVVTE  532

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             +       +L  ++ M  +LTAA+VS D  F   ++ N++NGTTYAGIRARTTGAPQNHW
Sbjct  533   WGAGDENTLLRLMDIMKHHLTAAIVSRDPEFQNRILANTINGTTYAGIRARTTGAPQNHW  592

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             FGPAGDP GAGIG+PEA+   W+CHREI++D GP+  +W  P
Sbjct  593   FGPAGDPLGAGIGSPEAVLSTWTCHREIVFDQGPIPGSWTTP  634



>gb|KFG62570.1| putative mitochondrial P5CDH [Toxoplasma gondii RUB]
Length=637

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/522 (53%), Positives = 368/522 (70%), Gaps = 6/522 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FA +++  +SG  P  V NLV G W  +     ++DP+NGE+FIK    +DAEL+PF+ S
Sbjct  113   FANVDLGKLSGDSPHTVQNLVNGKWSGTRETYDVVDPMNGEAFIKSPYTKDAELEPFIAS  172

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             ++  PK GLHNP K PERY++ G +  K A ML    V DFFT  I R  PKSY QA AE
Sbjct  173   IKGVPKSGLHNPLKRPERYVLYGQVLQKTAAMLHDERVFDFFTTCIMRTFPKSYGQAAAE  232

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V V + F ENFSGD +RFLAR F VPG+H GQ S+GFRWP+GPVA+++PFNFPLEIPV+Q
Sbjct  233   VRVVRTFCENFSGDGIRFLARGFSVPGDHHGQMSNGFRWPFGPVAVISPFNFPLEIPVMQ  292

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
              + A  +GNKPV+K ++   + +EQ LRLLH CG+P +DVD +N+ G  +++LL +   R
Sbjct  293   FLAAAMVGNKPVVKTEATQALPVEQFLRLLHYCGMPTKDVDLINTRGPVVSELLCKAPVR  352

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPD--VDEVDYIAWVCDQDAYACSGQ  1213
             +  FTG S  A+ L   L GR+K+EDAGF+WKILGPD   +E+DYIAW CDQDAYA SGQ
Sbjct  353   LLQFTGGSATAQHLIRLLNGRVKVEDAGFNWKILGPDAKAEELDYIAWQCDQDAYALSGQ  412

Query  1214  KCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPG  1393
             KCSAQS+L +H +W +  L+  +  LA+RR  ++LT+ PVL+ +   +  H++ LL++PG
Sbjct  413   KCSAQSLLAVHTSWKELGLLEKLKRLASRRSYENLTLSPVLSHSNSEIQKHVDALLKLPG  472

Query  1394  SKLLFGGEPL---ENHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTE  1561
             + LLFGG+ +   +  +IP  YGA  PTAVFVPL  IL  +EN +L TTE+FGP Q+VTE
Sbjct  473   ASLLFGGKAVKTAKTSAIPRKYGAYEPTAVFVPLASILMNNENLELATTELFGPVQVVTE  532

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             +       +L  ++ M  +LTAA+VS D  F   ++ N++NGTTYAGIRARTTGAPQNHW
Sbjct  533   WGAGDENTLLRLMDIMKHHLTAAIVSRDPEFQTRILANTINGTTYAGIRARTTGAPQNHW  592

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             FGPAGDP GAGIG+PEA+   W+CHREI++D GP+  +W  P
Sbjct  593   FGPAGDPLGAGIGSPEAVLSTWTCHREIVFDQGPIPGSWTTP  634



>gb|KFH08793.1| putative mitochondrial P5CDH [Toxoplasma gondii VAND]
Length=637

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/522 (53%), Positives = 368/522 (70%), Gaps = 6/522 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FA +++  +SG  P  V NLV G W  +     ++DP+NGE+FIK    +DAEL+PF+ S
Sbjct  113   FANVDLGKLSGDSPHTVQNLVNGRWSGTRETYDVVDPMNGEAFIKSPYTKDAELEPFIAS  172

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             ++  PK GLHNP K PERY++ G +  K A ML    V DFFT  I R  PKSY QA AE
Sbjct  173   IKGVPKSGLHNPLKRPERYVLYGQVLQKTAAMLHDERVFDFFTTCIMRTFPKSYGQAAAE  232

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V V + F ENFSGD +RFLAR F VPG+H GQ S+GFRWP+GPVA+++PFNFPLEIPV+Q
Sbjct  233   VRVVRTFCENFSGDGIRFLARGFSVPGDHHGQMSNGFRWPFGPVAVISPFNFPLEIPVMQ  292

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
              + A  +GNKPV+K ++   + +EQ LRLLH CG+P +DVD +N+ G  +++LL +   R
Sbjct  293   FLAAAMVGNKPVVKTEATQALPVEQFLRLLHYCGMPTKDVDLINTRGPVVSELLCKAPVR  352

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPD--VDEVDYIAWVCDQDAYACSGQ  1213
             +  FTG S  A+ L   L GR+K+EDAGF+WKILGPD   +E+DYIAW CDQDAYA SGQ
Sbjct  353   LLQFTGGSATAQHLIRLLNGRVKVEDAGFNWKILGPDAKAEELDYIAWQCDQDAYALSGQ  412

Query  1214  KCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPG  1393
             KCSAQS+L +H +W +  L+  +  LA+RR  ++LT+ PVL+ +   +  H++ LL++PG
Sbjct  413   KCSAQSLLAVHTSWKELGLLEKLKRLASRRSYENLTLSPVLSHSNSEIQKHVDALLKLPG  472

Query  1394  SKLLFGGEPL---ENHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTE  1561
             + LLFGG+ +   +  +IP  YGA  PTAVFVPL  IL  +EN +L TTE+FGP Q+VTE
Sbjct  473   ASLLFGGKAVKTAKTSAIPRKYGAYEPTAVFVPLASILMNNENLELATTELFGPVQVVTE  532

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             +       +L  ++ M  +LTAA+VS D  F   ++ N++NGTTYAGIRARTTGAPQNHW
Sbjct  533   WGAGDENTLLRLMDIMKHHLTAAIVSRDPEFQTRILANTINGTTYAGIRARTTGAPQNHW  592

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             FGPAGDP GAGIG+PEA+   W+CHREI++D GP+  +W  P
Sbjct  593   FGPAGDPLGAGIGSPEAVLSTWTCHREIVFDQGPIPGSWTTP  634



>gb|EPR59889.1| aldehyde dehydrogenase (NAD) family protein [Toxoplasma gondii 
GT1]
 gb|ESS33811.1| aldehyde dehydrogenase (NAD) family protein [Toxoplasma gondii 
VEG]
 gb|KFG28906.1| putative mitochondrial P5CDH [Toxoplasma gondii p89]
 gb|KFG42870.1| putative mitochondrial P5CDH [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG53222.1| putative mitochondrial P5CDH [Toxoplasma gondii FOU]
 gb|KFH12148.1| putative mitochondrial P5CDH [Toxoplasma gondii MAS]
Length=637

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/522 (53%), Positives = 367/522 (70%), Gaps = 6/522 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FA +++  +SG  P  V NLV G W  +     ++DP+NGE+FIK    +DAEL+PF+ S
Sbjct  113   FANVDLGKLSGDSPHTVQNLVNGKWSGTRETYDVVDPMNGEAFIKSPYTKDAELEPFIAS  172

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             ++  PK GLHNP K PERY++ G +  K A ML    V DFFT  I R  PKSY QA AE
Sbjct  173   IKGVPKSGLHNPLKRPERYVLYGQVLQKTAAMLHDERVFDFFTTCIMRTFPKSYGQAAAE  232

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V V + F ENFSGD +RFL R F VPG+H GQ S+GFRWP+GPVA+++PFNFPLEIPV+Q
Sbjct  233   VRVVRTFCENFSGDGIRFLTRGFSVPGDHHGQMSNGFRWPFGPVAVISPFNFPLEIPVMQ  292

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
              + A  +GNKPV+K ++   + +EQ LRLLH CG+P +DVD +N+ G  +++LL +   R
Sbjct  293   FLAAAMVGNKPVVKTEATQALPVEQFLRLLHYCGMPTKDVDLINTRGPVVSELLCKAPVR  352

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPD--VDEVDYIAWVCDQDAYACSGQ  1213
             +  FTG S  A+ L   L GR+K+EDAGF+WKILGPD   +E+DYIAW CDQDAYA SGQ
Sbjct  353   LLQFTGGSVTAQHLIRLLNGRVKVEDAGFNWKILGPDAKAEELDYIAWQCDQDAYALSGQ  412

Query  1214  KCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPG  1393
             KCSAQS+L +H +W +  L+  +  LA+RR  ++LT+ PVL+ +   +  H++ LL++PG
Sbjct  413   KCSAQSLLAVHTSWKELGLLEKLKRLASRRSYENLTLSPVLSHSNSEIQKHVDALLKLPG  472

Query  1394  SKLLFGGEPLE---NHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTE  1561
             + LLFGG+ ++     +IP  YGA  PTAVFVPL  IL  +EN +L TTE+FGP Q+VTE
Sbjct  473   ASLLFGGKAVKTATTSAIPRKYGAYEPTAVFVPLASILMNNENLELATTELFGPVQVVTE  532

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             +       +L  ++ M  +LTAA+VS D  F   ++ N++NGTTYAGIRARTTGAPQNHW
Sbjct  533   WGAGDENTLLRLMDIMKHHLTAAIVSRDPEFQNRILANTINGTTYAGIRARTTGAPQNHW  592

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLP  1867
             FGPAGDP GAGIG+PEA+   W+CHREI++D GP+  +W  P
Sbjct  593   FGPAGDPLGAGIGSPEAVLSTWTCHREIVFDQGPIPGSWTTP  634



>ref|XP_001441466.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK74069.1| unnamed protein product [Paramecium tetraurelia]
Length=531

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/506 (55%), Positives = 367/506 (73%), Gaps = 6/506 (1%)
 Frame = +2

Query  329   LNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAE-VQDAELQPFLESMR  505
             LNV+++S + P    N + G W  +S++  ILDPLNG+ FI V   + + E+  + ++  
Sbjct  21    LNVKELSENSPYRAMNFINGIWKCASNYLEILDPLNGDKFILVPNNLTEEEINEYRDAAI  80

Query  506   KCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVF  685
             +CPK GLHNP K P+RY + G+I  + + +L LP+V D+F  LIQRV+PKS  QA  EV 
Sbjct  81    QCPKSGLHNPLKNPDRYNLYGEIFHRVSFLLGLPQVEDYFVHLIQRVAPKSDIQARGEVK  140

Query  686   VTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLM  865
             VTQ+FL NFSGDQ RFL RSF V G+  GQQS G+R+PYG VAI+ PFNFPLEIP LQ+M
Sbjct  141   VTQRFLMNFSGDQCRFLTRSFNVSGDVQGQQSSGYRFPYGHVAIIAPFNFPLEIPALQMM  200

Query  866   GALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMT  1045
             GAL  GN+  +K D +V +V+E  LRLLH  GLP  D D ++ DG  M  LL +   R+ 
Sbjct  201   GALLAGNRLTIKGDQRVSVVLEMFLRLLHLAGLPPTDCDLIHCDGPQMESLLKKSNFRLL  260

Query  1046  LFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSA  1225
              FTGSS +AE+L   + G+IK+EDAGFDWKILGPDV E DY+A+  DQDAYA SGQKCSA
Sbjct  261   QFTGSSGIAERLCNVMNGKIKIEDAGFDWKILGPDVIEFDYVAYQSDQDAYAFSGQKCSA  320

Query  1226  QSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
             QSILF H+NW ++ +++ +  LA +R L +LT+ P+LT+  + +  H++KLL I G+K+L
Sbjct  321   QSILFAHKNWVQAGILDKIKLLAEQRSLQNLTICPILTWNNQRIQTHLDKLLAIQGAKVL  380

Query  1406  FGGEPL-ENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLP  1582
             FGG+P+ E H IP  YG+  PTAV++PL++I   EN++LVTTEVFGPFQ+VTEY++    
Sbjct  381   FGGKPINEQHKIPECYGSYLPTAVYIPLQQI--KENFELVTTEVFGPFQVVTEYENED--  436

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
              V+  LE +  NLTA VVSND  F+Q+++ N++NG TYAGI+ARTTGAPQNHWFGP GDP
Sbjct  437   HVIEILENIPHNLTAGVVSNDIRFVQKILANTINGVTYAGIKARTTGAPQNHWFGPCGDP  496

Query  1763  RGAGIGTPEAIKLVWSCHREIIYDIG  1840
             RG GIG+PEAI   W+ HREII DIG
Sbjct  497   RGTGIGSPEAIVQTWTTHREIIMDIG  522



>gb|KHN18531.1| Putative aldehyde dehydrogenase [Glycine soja]
Length=374

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 323/422 (77%), Gaps = 51/422 (12%)
 Frame = +2

Query  188   FTQLRNRATRTAITYLGSLGTTRPNHSRPYANEEVGTRASHSLPFATLNVEDISGSQPAE  367
             F  L +RAT+ +I+          NH+   A+    +R +HSL FAT+  E++SGS+PAE
Sbjct  2     FKSLVSRATKDSISR---------NHN-AIASFAFSSRCAHSLSFATVEAEEVSGSRPAE  51

Query  368   VHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             V +LVQG W+ SS+WNTI DPLNG+SFIKVAEV +  +QPF++S+  CPKHG+HNPFKAP
Sbjct  52    VLHLVQGKWVGSSNWNTIADPLNGDSFIKVAEVDETGIQPFIKSLSSCPKHGVHNPFKAP  111

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ERYLM GDISTKAAHMLSLP                                      +V
Sbjct  112   ERYLMYGDISTKAAHMLSLP--------------------------------------KV  133

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             RFLARSFGVPGNHL QQSHGFRWPYGPVAI+TPFNFPLEI VLQLMGALYMGNKPVLKVD
Sbjct  134   RFLARSFGVPGNHLRQQSHGFRWPYGPVAIITPFNFPLEIAVLQLMGALYMGNKPVLKVD  193

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAG  1087
             SK  I MEQML LLH CGLP+ED DF+NSDGKTMNKLLLE  PRMTLFTGSSRVAEKL  
Sbjct  194   SKATI-MEQMLCLLHTCGLPVEDADFINSDGKTMNKLLLEAHPRMTLFTGSSRVAEKLTV  252

Query  1088  DLKGRIKLEDAGFDWKILGPDV--DEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSK  1261
             DLKGR+KLEDAGFDWKILGPDV  D  DYIAWVCDQDAYACSGQKCSAQS+LFMH+NWSK
Sbjct  253   DLKGRVKLEDAGFDWKILGPDVHQDLEDYIAWVCDQDAYACSGQKCSAQSLLFMHKNWSK  312

Query  1262  SPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIP  1441
             + L++ +  LA RRKL+DLT+GPVLT TT  ML+H NKLL+IPGSKLLFGG PL+NHSIP
Sbjct  313   TSLLSKLKDLAERRKLEDLTIGPVLTCTTDLMLEHKNKLLEIPGSKLLFGGSPLDNHSIP  372

Query  1442  SI  1447
             SI
Sbjct  373   SI  374



>ref|XP_003881052.1| putative aldehyde dehydrogenase [Neospora caninum Liverpool]
 emb|CBZ51019.1| putative aldehyde dehydrogenase [Neospora caninum Liverpool]
Length=584

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/558 (50%), Positives = 367/558 (66%), Gaps = 42/558 (8%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FA ++ E +SG+ P  V NLV G W  +     ++DPLNGE FIK    +  EL+PF+ S
Sbjct  24    FANVDTEKLSGASPHTVRNLVNGKWSGTRETYDVVDPLNGEVFIKSPCTKGDELEPFIAS  83

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             ++  PK GLHNP K PERY++ G +  K A ML    V DFFTR I R  PKSY QA  E
Sbjct  84    LKAVPKSGLHNPLKNPERYVLYGQVLQKTAAMLHDERVFDFFTRCIMRTFPKSYAQAAGE  143

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V V + F ENFSGD +RF+AR F VPG+H GQ S+GFRWP+GPVA+V+PFNFPLEIPV+Q
Sbjct  144   VRVVRAFCENFSGDGIRFVARGFSVPGDHHGQISNGFRWPFGPVAVVSPFNFPLEIPVMQ  203

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
              + A+ MGNKP +K ++   + +EQ+LRLLH CG+P++DVDFLN+ G  +++LL +   R
Sbjct  204   FLAAVMMGNKPFVKTEATQALPVEQLLRLLHYCGMPMQDVDFLNTRGPIVSELLTKAPVR  263

Query  1040  MT------------------------------------LFTGSSRVAEKLAGDLKGRIKL  1111
             +                                      FTG S  AE L   +KGR+K+
Sbjct  264   LLQFTGRVASKRDAGFAAAETKAGKKHESMRSLPGECGFFTGGSATAEHLIRLMKGRVKV  323

Query  1112  EDAGFDWKILGPDV--DEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMS  1285
             EDAGFDWKILGPD    ++DY+AW CDQDAYA SGQKCSAQS+L +H +W +  L+  + 
Sbjct  324   EDAGFDWKILGPDAKPQDLDYVAWQCDQDAYALSGQKCSAQSLLAVHTSWKELGLLEKLR  383

Query  1286  SLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL---ENHSIPSIYGA  1456
             SLA+RR  +DLT+ PV++ + + +  H++ LL++P + LLFGG+ +   +  SIP  YGA
Sbjct  384   SLASRRSYEDLTLSPVMSHSNEGIQKHVDALLKLPNASLLFGGKAVKTAQTSSIPCKYGA  443

Query  1457  IRPTAVFVPLEE-ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAV  1633
               PTAVFVPL   +L  EN DL TTE+FGP Q+VTE++      +L  +E M  +LTAAV
Sbjct  444   YEPTAVFVPLTSMLLSQENLDLATTELFGPVQVVTEWRTGDEKDLLRLMEGMKLHLTAAV  503

Query  1634  VSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  1813
             V+ D  F   ++ N+VNGTTYAGIRARTTGAPQNHWFGPAGDP  AGIG+PEA+   W+C
Sbjct  504   VARDVEFQNRILANTVNGTTYAGIRARTTGAPQNHWFGPAGDPLAAGIGSPEAVLCTWTC  563

Query  1814  HREIIYDIGPVSPAWKLP  1867
             HREI++D G +   W  P
Sbjct  564   HREIVFDHGQIPEFWTTP  581



>ref|XP_002368285.1| aldehyde dehydrogenase, putative [Toxoplasma gondii ME49]
Length=529

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/506 (53%), Positives = 357/506 (71%), Gaps = 6/506 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLES  499
             FA +++  +SG  P  V NLV G W  +     ++DP+NGE+FIK    +DAEL+PF+ S
Sbjct  24    FANVDLGKLSGDSPHTVQNLVNGKWSGTRETYDVVDPMNGEAFIKSPYTKDAELEPFIAS  83

Query  500   MRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAE  679
             ++  PK GLHNP K PERY++ G +  K A ML    V DFFT  I R  PKSY QA AE
Sbjct  84    IKGVPKSGLHNPLKRPERYVLYGQVLQKTAAMLHDERVFDFFTTCIMRTFPKSYGQAAAE  143

Query  680   VFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQ  859
             V V + F ENFSGD +RFLAR F VPG+H GQ S+GFRWP+GPVA+++PFNFPLEIPV+Q
Sbjct  144   VRVVRTFCENFSGDGIRFLARGFSVPGDHHGQMSNGFRWPFGPVAVISPFNFPLEIPVMQ  203

Query  860   LMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPR  1039
              + A  +GNKPV+K ++   + +EQ LRLLH CG+P +DVD +N+ G  +++LL +   R
Sbjct  204   FLAAAMVGNKPVVKTEATQALPVEQFLRLLHYCGMPTKDVDLINTRGPVVSELLCKAPVR  263

Query  1040  MTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPD--VDEVDYIAWVCDQDAYACSGQ  1213
             +  FTG S  A+ L   L GR+K+EDAGF+WKILGPD   +E+DYIAW CDQDAYA SGQ
Sbjct  264   LLQFTGGSATAQHLIRLLNGRVKVEDAGFNWKILGPDAKAEELDYIAWQCDQDAYALSGQ  323

Query  1214  KCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPG  1393
             KCSAQS+L +H +W +  L+  +  LA+RR  ++LT+ PVL+ +   +  H++ LL++PG
Sbjct  324   KCSAQSLLAVHTSWKELGLLEKLKRLASRRSYENLTLSPVLSHSNSEIQKHVDALLKLPG  383

Query  1394  SKLLFGGEPL---ENHSIPSIYGAIRPTAVFVPLEEIL-KDENYDLVTTEVFGPFQIVTE  1561
             + LLFGG+ +   +  +IP  YGA  PTAVFVPL  IL  +EN +L TTE+FGP Q+VTE
Sbjct  384   ASLLFGGKAVKTAKTSAIPRKYGAYEPTAVFVPLASILMNNENLELATTELFGPVQVVTE  443

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
             +       +L  ++ M  +LTAA+VS D  F   ++ N++NGTTYAGIRARTTGAPQNHW
Sbjct  444   WGAGDENTLLRLMDIMKHHLTAAIVSRDPEFQNRILANTINGTTYAGIRARTTGAPQNHW  503

Query  1742  FGPAGDPRGAGIGTPEAIKLVWSCHR  1819
             FGPAGDP GAGIG+PEA+   W+CHR
Sbjct  504   FGPAGDPLGAGIGSPEAVLSTWTCHR  529



>ref|XP_001439437.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72040.1| unnamed protein product [Paramecium tetraurelia]
Length=521

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/509 (55%), Positives = 356/509 (70%), Gaps = 20/509 (4%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQD-AELQPFLE  496
             + +L+   +S   P +  N + G WI +  + TI+DPLNGE FI V +VQD  ELQ F++
Sbjct  16    YFSLDPNQLSARNPHKAQNFLSGKWIDAHKYQTIVDPLNGEPFITVPDVQDRQELQKFID  75

Query  497   SMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALA  676
             S ++CP  GLHNP K P++ L L   +      L   EV DF  +LIQRV PK + QA  
Sbjct  76    SAKECPISGLHNPLKNPQKILNLWGTAE-----LKKKEVHDFLVKLIQRVVPKHFAQASG  130

Query  677   EVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVL  856
             EV VT++F +NFSG        SF V G+  GQQS G+RWPYG  A+V PFNFPLEIP L
Sbjct  131   EVVVTERFFQNFSG--------SFNVAGDRPGQQSSGYRWPYGSCAVVAPFNFPLEIPSL  182

Query  857   QLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP  1036
             Q+ GAL  GNK   K DS+V +VMEQMLRL   CGLP  DVD L  +G+    +L +G  
Sbjct  183   QIFGALITGNKVFFKGDSRVNVVMEQMLRLALHCGLPATDVDMLFGNGEATEFILKQGNF  242

Query  1037  RMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVD---YIAWVCDQDAYACS  1207
             R T FTGSS+VAE L   L G+IK+EDAGFDWKILGPDV +VD   Y+AW  DQDAY  +
Sbjct  243   RNTQFTGSSKVAEHLTKVLNGKIKIEDAGFDWKILGPDVPDVDTQNYVAWQSDQDAYGST  302

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILF+HENW K+  ++ +  LA+ RKL DL+ GP++T+    +  H++ +L+I
Sbjct  303   GQKCSAQSILFVHENWVKAGFLDKIKQLASTRKLQDLSNGPIITWNNTQIKQHIDNILKI  362

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             P SK+LFGG+ L+NH+IPSIYGA  PTA++VPL++I K++    VT E+FGPFQIVT Y 
Sbjct  363   PQSKVLFGGQELKNHTIPSIYGAFEPTALYVPLDQIQKNK---AVTNELFGPFQIVTTYS  419

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
              +Q+  VL+ +  ++ +LTA +VSND  FL+ V  N+ NG TY+GIRARTTGAPQNHWFG
Sbjct  420   SDQINQVLDVINNLENHLTAGIVSNDVNFLRHVQSNTTNGVTYSGIRARTTGAPQNHWFG  479

Query  1748  PAGDPRGAGIGTPEAIKLVWSCHREIIYD  1834
             P GDPRGAGIGTPEAI  VW+CHREII+D
Sbjct  480   PCGDPRGAGIGTPEAILSVWTCHREIIHD  508



>ref|XP_001444818.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK77421.1| unnamed protein product [Paramecium tetraurelia]
Length=505

 Score =   527 bits (1358),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 257/470 (55%), Positives = 332/470 (71%), Gaps = 7/470 (1%)
 Frame = +2

Query  320   FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA-ELQPFLE  496
             + TL+   IS   P +  N ++G WI S  + TI+DPLNGE FI V +VQD  ELQ F++
Sbjct  16    YFTLDPNQISARNPHKAQNFLRGKWIDSHKYQTIIDPLNGEPFITVPDVQDKQELQKFID  75

Query  497   SMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALA  676
             S ++CP  GLHNP K P+RY + G++  K A  L   EV DF  RLIQRV PK + QA  
Sbjct  76    SAKECPISGLHNPLKNPQRYQLYGEVCHKIAAELKKKEVHDFLVRLIQRVVPKHFAQASG  135

Query  677   EVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVL  856
             EV VT++F +NFSGDQ RFL RSF V G+  GQQS G+RWP+G  A+V PFNFPLEIP L
Sbjct  136   EVVVTERFFQNFSGDQPRFLTRSFNVAGDRPGQQSSGYRWPFGSCAVVAPFNFPLEIPSL  195

Query  857   QLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP  1036
             Q+ GAL  GNK   K DS+V +VMEQMLRL   CGLP  DVD L  +G+    +L +G  
Sbjct  196   QIFGALITGNKVFFKGDSRVNVVMEQMLRLALHCGLPATDVDMLFGNGEATEFILKQGNF  255

Query  1037  RMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVD---YIAWVCDQDAYACS  1207
             R T FTGSS+VAE L   L G+I++EDAGFDWKILGPDV +VD   Y+AW  DQDAY  +
Sbjct  256   RNTQFTGSSKVAEHLTKVLNGKIRIEDAGFDWKILGPDVPDVDTQNYVAWQSDQDAYGST  315

Query  1208  GQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQI  1387
             GQKCSAQSILF+HENW K+  ++ +  LA+ RKL DL+ GP++T+    +  H++ +L+I
Sbjct  316   GQKCSAQSILFVHENWVKAGFLDKIKQLASTRKLQDLSNGPIITWNNTQIKQHIDNILKI  375

Query  1388  PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             P SK+LFGG+ L+NH+IPSIYGA  PTA++VPL++I K++    VTTE+FGPFQIVT Y 
Sbjct  376   PQSKVLFGGQELKNHTIPSIYGAFEPTALYVPLDQIQKNK---AVTTELFGPFQIVTTYS  432

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRART  1717
              +Q+  VL+ +  ++ +LTA +VSND  FL+ V  N+ NG TY+GIRART
Sbjct  433   SDQINQVLDVINNLENHLTAGIVSNDVNFLRHVQSNTTNGVTYSGIRART  482



>gb|AGT17067.1| aldehyde dehydrogenase [Saccharum hybrid cultivar R570]
Length=304

 Score =   452 bits (1164),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 217/292 (74%), Positives = 246/292 (84%), Gaps = 13/292 (4%)
 Frame = +2

Query  296   TRASHSLPFATLNVEDISGSQP---AEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEV  466
             +R  H+  FAT++ +++SGS P   AE    VQG+W  S++WN I+DPLNG+ FIKVAEV
Sbjct  23    SRWLHTPSFATVSPQEVSGSSPRGSAEFCGSVQGSWTASANWNWIVDPLNGDQFIKVAEV  82

Query  467   QDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRV  646
             Q  E++PF+ES+ KCPKHGLHNP KAPERYLM GDIS KAAHML  P VSDFF +LIQRV
Sbjct  83    QGTEIKPFVESLSKCPKHGLHNPLKAPERYLMYGDISAKAAHMLGQPAVSDFFAKLIQRV  142

Query  647   SPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTP  826
             SPKSYQQALAEV V+QKFLENF GDQVRFLARSF VPGNHLGQ+S+G+RWPYGPVAI+TP
Sbjct  143   SPKSYQQALAEVQVSQKFLENFCGDQVRFLARSFAVPGNHLGQRSNGYRWPYGPVAIITP  202

Query  827   FNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKT  1006
             FNFPLEIP+LQ+MGALYMGNKPVLKVDSKV IVMEQM+RLLHDCGLP ED+DF+NSD   
Sbjct  203   FNFPLEIPLLQVMGALYMGNKPVLKVDSKVSIVMEQMIRLLHDCGLPAEDMDFINSD---  259

Query  1007  MNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEV  1162
                      P+MTLFTGSSRVAEKLA DLKGR+KLEDAGFDWKILGPDV EV
Sbjct  260   -------ANPKMTLFTGSSRVAEKLAADLKGRVKLEDAGFDWKILGPDVQEV  304



>emb|CDY30725.1| BnaA02g33470D [Brassica napus]
Length=388

 Score =   446 bits (1146),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 243/296 (82%), Gaps = 33/296 (11%)
 Frame = +2

Query  452   KVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTR  631
             +++EV ++   PF+ES+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+VSDFFTR
Sbjct  19    EISEVDES--GPFVESLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKVSDFFTR  76

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LIQRV+PKSYQQA  EVFVT KFLENF GDQVRFLARSF VPGNH GQQSHG+RWPYGPV
Sbjct  77    LIQRVAPKSYQQAAGEVFVTLKFLENFCGDQVRFLARSFAVPGNHHGQQSHGYRWPYGPV  136

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
              I+TPFNFPLEIP+LQLMGALY         DSKV IVMEQM+RLLH CGLP+EDVDF+N
Sbjct  137   TIITPFNFPLEIPLLQLMGALYF--------DSKVSIVMEQMMRLLHYCGLPVEDVDFIN  188

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYI  1171
             SDGKTMNK+LLE                       GRI+LEDAGFDWK+LGPDV EVDY+
Sbjct  189   SDGKTMNKILLE-----------------------GRIRLEDAGFDWKVLGPDVQEVDYV  225

Query  1172  AWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLT  1339
             AWVCDQDAYACSGQKCSAQS+LFMHENW+K+ L++ +  LA RRKL+DLT+GPVLT
Sbjct  226   AWVCDQDAYACSGQKCSAQSMLFMHENWAKTSLVSKLKDLAGRRKLEDLTIGPVLT  281



>gb|KDD74557.1| aldehyde dehydrogenase, partial [Helicosporidium sp. ATCC 50920]
Length=395

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 211/383 (55%), Positives = 282/383 (74%), Gaps = 8/383 (2%)
 Frame = +2

Query  293   GTRASHSLPFATLNVED--------ISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESF  448
             G R+ H+   +  N+++        +S + PAE+ NLV G W  + +  +++DPLNGE F
Sbjct  12    GLRSLHAASTSLSNIKEWSKVDPVTLSAANPAELSNLVNGEWTGTPAKISVVDPLNGEVF  71

Query  449   IKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFT  628
             I+  + +  +   F+E +R  PK G HNP K PERYL+ G ++ +AA  +  PEV + F 
Sbjct  72    IQAPDTRPEQCAGFIEGLRSTPKSGRHNPLKRPERYLLYGRVAAEAAARMREPEVEEHFV  131

Query  629   RLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGP  808
             RLIQRV PKS  QA AEV VT+ FLENFSGDQVRFLAR F  PG+H GQ SHG+RWPYG 
Sbjct  132   RLIQRVVPKSTAQAQAEVRVTRAFLENFSGDQVRFLARGFSNPGDHPGQSSHGYRWPYGG  191

Query  809   VAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFL  988
             VA++ PFNFPLEIP LQ+MGAL+MGN+PV+  D KV +V+E+ +RLLH CG+P++D+D  
Sbjct  192   VAVIAPFNFPLEIPALQMMGALFMGNRPVVHADVKVAVVLEEFVRLLHACGMPVDDLDLF  251

Query  989   NSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDY  1168
             +  G  M  +LL+G+PR TLFTGS RVAE+L+  L GR+ LEDAGFDWKILGPDV +V++
Sbjct  252   HGRGDAMEHVLLQGRPRSTLFTGSQRVAERLSLKLGGRVFLEDAGFDWKILGPDVRDVEH  311

Query  1169  IAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTT  1348
             +AW CDQDAYAC+GQKCSAQSILFMHENW+++ L   +++LAARR L+D TVGPVL++TT
Sbjct  312   VAWQCDQDAYACTGQKCSAQSILFMHENWARAGLEARLAALAARRSLEDFTVGPVLSWTT  371

Query  1349  KAMLDHMNKLLQIPGSKLLFGGE  1417
              A+L H+ +L  I G+++ +GG 
Sbjct  372   PAILAHVERLAAIAGARVAWGGR  394



>gb|EPS58308.1| hypothetical protein M569_16507, partial [Genlisea aurea]
Length=208

 Score =   390 bits (1002),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +2

Query  551   RYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR  730
             RYLMLGD+STKAA  LSLPEVSDFF RLIQRVSPKSYQQAL EVFVTQKFLENF GDQVR
Sbjct  1     RYLMLGDVSTKAAIKLSLPEVSDFFARLIQRVSPKSYQQALGEVFVTQKFLENFCGDQVR  60

Query  731   FLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDS  910
             FL+RSF VPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMGNKP+LKVDS
Sbjct  61    FLSRSFAVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMGNKPLLKVDS  120

Query  911   KVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGD  1090
             KVCIVMEQMLRLLH+CGLP EDVDF+NSDGK MNKLLLE +PRMTLFTGSSRVAEKLA D
Sbjct  121   KVCIVMEQMLRLLHECGLPAEDVDFVNSDGKVMNKLLLEAQPRMTLFTGSSRVAEKLAAD  180

Query  1091  LKGRIKLEDAGFDWKILGPDVDEVDYIA  1174
             L+GRIKLEDAGFDWKILGPDV EV + A
Sbjct  181   LRGRIKLEDAGFDWKILGPDVHEVVHFA  208



>emb|CDJ43534.1| aldehyde dehydrogenase, putative, partial [Eimeria tenella]
Length=373

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 247/371 (67%), Gaps = 13/371 (4%)
 Frame = +2

Query  476   ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             EL PF++S+ KCPKHGLHNP K P RYL+ G I   AA  L   +V  FFT+ IQ   PK
Sbjct  3     ELSPFVQSLAKCPKHGLHNPLKNPSRYLLYGRICAAAAAALQQQQVFSFFTKCIQLTMPK  62

Query  656   SYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNF  835
             S QQA  EV V + F ENFSGD VRF  +   V G+  GQQ+  +RWPYGPVAI++PFNF
Sbjct  63    SQQQAEGEVKVLRSFFENFSGDNVRFALKGHFVAGDREGQQTQSYRWPYGPVAIISPFNF  122

Query  836   PLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK  1015
             PLEIPV+Q+MGAL+ GNKPV+K +S+  + +EQ  R LH CG+PLED D +++ G  M++
Sbjct  123   PLEIPVMQMMGALFAGNKPVVKAESRQGLPLEQFFRFLHYCGMPLEDADLISARGPVMSE  182

Query  1016  LLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVD-----EVDYIAWV  1180
             LL     R+  FTGS+ VA +L+  L+GR+++ED GF++K+LG D++      + Y+AW 
Sbjct  183   LLRRSPIRLLQFTGSTSVARELSLLLQGRVRIEDGGFNFKVLGKDINPSEQQTLAYVAWQ  242

Query  1181  CDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAML  1360
              D+DAYA SGQKCSAQS+LF+H NW  + L+ L+++ AARR L  LT+ P+L+   + M 
Sbjct  243   ADEDAYALSGQKCSAQSLLFVHRNWVAAGLLELLAAAAARRSLQTLTICPLLSLNNQQMH  302

Query  1361  DHMNKLLQIPGSKLLFGGEPL-------ENHSIPSIYGAIRPTAVFVPLEEILKDENYDL  1519
              H+  LL + G+ LLFGG PL       + HS+P  +G   PTAV +PL+ +  D     
Sbjct  303   RHVQALLSLKGACLLFGGYPLQQQQQQQQQHSVPPQFGLYAPTAVLLPLQTLAFDAAARK  362

Query  1520  VT-TEVFGPFQ  1549
             V   EVFGP Q
Sbjct  363   VALQEVFGPLQ  373



>ref|XP_010485285.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Camelina sativa]
Length=192

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  611   VSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGF  790
             V+DFF RLIQRV+PKSYQQA  EVFVT+KFLENF GDQVRFLARSF +PGNHLGQQSHG+
Sbjct  7     VADFFARLIQRVAPKSYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSHGY  66

Query  791   RWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPL  970
             RWPYGPV IVTPFNFPLEIP+LQLMGALYMGNKP+LKVDSKV IVMEQM+RLLH CGLP 
Sbjct  67    RWPYGPVTIVTPFNFPLEIPLLQLMGALYMGNKPLLKVDSKVSIVMEQMMRLLHYCGLPA  126

Query  971   EDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPD  1150
             EDVDF+NSDGKTMNK+LLE  PRMTLFTGSSRVAEKLA DLKGRI+LEDAGFDWK+LGPD
Sbjct  127   EDVDFINSDGKTMNKILLEANPRMTLFTGSSRVAEKLALDLKGRIRLEDAGFDWKVLGPD  186

Query  1151  VDEV  1162
             V E+
Sbjct  187   VQEI  190



>gb|EPS72192.1| delta-1-pyrroline-5-carboxylate dehydrogenase 1 protein, partial 
[Genlisea aurea]
Length=211

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 184/211 (87%), Gaps = 2/211 (1%)
 Frame = +2

Query  1250  NWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPL-E  1426
             NWS++ L+  +  LAA+RKL+DLT+GPVLTFTT+AMLDH  KLL I GSKLLFGG+PL +
Sbjct  1     NWSRTSLVQKLRDLAAKRKLEDLTIGPVLTFTTEAMLDHTRKLLDIKGSKLLFGGKPLGD  60

Query  1427  NHSIPSIYGAIRPTAVFVPLEEILKDE-NYDLVTTEVFGPFQIVTEYKDNQLPLVLNALE  1603
             NHSIPS+YGA  PTAVFVPLE+ILKD+ +++LVT E+FGPFQIVTEY+D +L  VLNA+E
Sbjct  61    NHSIPSVYGAFEPTAVFVPLEQILKDDRHFELVTREIFGPFQIVTEYRDEELHWVLNAVE  120

Query  1604  RMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGT  1783
             RM A+LTAAVVSND LF QEVIGNSVNGTTY G+RARTTGAPQNHWFGPAGDPRGAGIGT
Sbjct  121   RMKAHLTAAVVSNDPLFQQEVIGNSVNGTTYVGLRARTTGAPQNHWFGPAGDPRGAGIGT  180

Query  1784  PEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             PEAIKLVWSCHRE+IYD+GPV   W+ P  T
Sbjct  181   PEAIKLVWSCHREVIYDVGPVPANWRTPPPT  211



>gb|KDO76060.1| hypothetical protein CISIN_1g030638mg [Citrus sinensis]
Length=174

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  1355  MLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEV  1534
             ML+HMNKLL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+
Sbjct  1     MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI  60

Query  1535  FGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRAR  1714
             FGPFQIVTEYK +QLPLVLNALERM A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RAR
Sbjct  61    FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRAR  120

Query  1715  TTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             TTGAPQNHWFGP+GDPRGAGIGTPEAIKLVWS HREIIYD GPV   W++P +T
Sbjct  121   TTGAPQNHWFGPSGDPRGAGIGTPEAIKLVWSSHREIIYDYGPVPGNWEIPPST  174



>ref|XP_004035148.1| hypothetical protein IMG5_104840 [Ichthyophthirius multifiliis]
 gb|EGR31662.1| hypothetical protein IMG5_104840 [Ichthyophthirius multifiliis]
Length=241

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 186/291 (64%), Gaps = 51/291 (18%)
 Frame = +2

Query  1007  MNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCD  1186
             M +++LE K R+  FTGSS+VAEKL+    G++K+EDAGFDWK+ GPDV  +DY+AW CD
Sbjct  1     MERVILESKYRLIQFTGSSKVAEKLSKLTHGKVKIEDAGFDWKLQGPDVSNIDYVAWQCD  60

Query  1187  QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDH  1366
             QDAYA +GQKCSAQSIL+ H+NW K+  ++ + +L +RRKL DLT+GPVLT+  + +  H
Sbjct  61    QDAYAATGQKCSAQSILYCHQNWIKNGFLDKLKALQSRRKLSDLTIGPVLTWNNQQIQHH  120

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
             +++LL++ G+KLLFG                                             
Sbjct  121   VDQLLKLEGAKLLFG---------------------------------------------  135

Query  1547  QIVTEYK-DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTG  1723
                 EYK DN+L  VL    +M+ +LTAAVVSND +F+ ++  N++NG TY GIRARTTG
Sbjct  136   ----EYKDDNELNEVLQHFNQMENHLTAAVVSNDMVFINKIASNTINGVTYTGIRARTTG  191

Query  1724  APQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             APQNHWFGP GDPRGAGIGT EAI  VW+ HRE+I DI  +   WK P  +
Sbjct  192   APQNHWFGPCGDPRGAGIGTKEAILHVWTTHREVIQDIA-IEDGWKTPDCS  241



>gb|EWM24081.1| delta-1-pyrroline-5-carboxylate dehydrogenase 1 protein, partial 
[Nannochloropsis gaditana]
Length=309

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 172/231 (74%), Gaps = 7/231 (3%)
 Frame = +2

Query  1205  SGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAMLDHMNKLL-  1381
             +GQKCSAQSILF HENW ++ L + + +LAARR L D T+GPVLT TT+  L H   LL 
Sbjct  79    TGQKCSAQSILFAHENWQQAGLESKLRTLAARRSLADFTLGPVLTVTTERFLAHCQALLD  138

Query  1382  QIPGSKLLFGGEPLEN-----HSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGP  1543
              IPG+K+L+GG+ L       H IP+ YGA  PTAV+VPLE +L   + + L TTE+FGP
Sbjct  139   TIPGTKILWGGKALSKAAMAPHEIPTCYGAFEPTAVYVPLEGMLASPDAFHLATTEIFGP  198

Query  1544  FQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTG  1723
             F I T +KD +LPLVL ALERM+ +LTAAVVSND +F + V+G++VNGTTY G RARTTG
Sbjct  199   FYIYTTWKDGELPLVLEALERMENHLTAAVVSNDVVFTRAVVGSTVNGTTYIGRRARTTG  258

Query  1724  APQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             APQNHWFGP GDPRGAGIGTPEAIK VWS HRE++ D GPV   W +P  T
Sbjct  259   APQNHWFGPCGDPRGAGIGTPEAIKSVWSAHREVVTDEGPVGEGWTMPGPT  309



>ref|XP_008378843.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Malus domestica]
Length=242

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  926   MEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI  1105
             MEQM+RLLH CGLP EDVDF+NSDG+TMNKLLLEG P++TLFTGSSR+A++LAGDLKGR+
Sbjct  1     MEQMMRLLHYCGLPTEDVDFINSDGETMNKLLLEGNPQITLFTGSSRMADELAGDLKGRV  60

Query  1106  KLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMS  1285
             KLEDAGFDWKILGPDV E DY+A VCDQDAYACSGQKCSAQS+LFMHENWSK+ +I+   
Sbjct  61    KLEDAGFDWKILGPDVQEEDYVARVCDQDAYACSGQKCSAQSMLFMHENWSKTSIISKRK  120

Query  1286  SLAARRKLDDLTVGPVLTFTTKAMLDHMNKLLQIP  1390
             +LA RR L+DLT+GPVL FTT+A L+H NKLLQIP
Sbjct  121   NLAERRNLEDLTIGPVLAFTTEARLEHKNKLLQIP  155



>emb|CDY30724.1| BnaA02g33460D [Brassica napus]
Length=146

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 133/171 (78%), Gaps = 26/171 (15%)
 Frame = +2

Query  1367  MNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKD-ENYDLVTTEVFGP  1543
             M  LLQI GSKLLFGG+PL+NHSIPS+YGA+ PTAV+VP+EEILKD +NY+LVT E+FGP
Sbjct  1     MENLLQIQGSKLLFGGKPLKNHSIPSVYGALEPTAVYVPIEEILKDSKNYELVTKEIFGP  60

Query  1544  FQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTG  1723
             FQIVTEYK +QLPL                         EVIGNSVNGTTYAG+R RTTG
Sbjct  61    FQIVTEYKKDQLPL-------------------------EVIGNSVNGTTYAGLRGRTTG  95

Query  1724  APQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             APQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYD GPV   W+LP +T
Sbjct  96    APQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDYGPVPQGWELPAST  146



>ref|XP_004035149.1| hypothetical protein IMG5_104850 [Ichthyophthirius multifiliis]
 gb|EGR31663.1| hypothetical protein IMG5_104850 [Ichthyophthirius multifiliis]
Length=241

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 152/219 (69%), Gaps = 1/219 (0%)
 Frame = +2

Query  284  EEVGTRASHSLP-FATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVA  460
            ++V  R    +P +AT N   ++ S P ++ N V+G W  +  + TI+DPLNGE  ++V 
Sbjct  7    QKVLQRNFSEIPSWATCNPYKLNKSNPYKLQNFVKGEWRFTREYTTIVDPLNGEKILQVP  66

Query  461  EVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQ  640
            E +D EL  F+ ++++ P  GLHNP K P+RY   G +  K +  L  PE+  FFT L Q
Sbjct  67   ETKDDELTDFINNVKQVPLSGLHNPLKNPQRYQQYGQLLLKLSEELRKPEIEKFFTVLTQ  126

Query  641  RVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIV  820
            RV PKSY QA  EV VT++FLENF+GD  RFL++SF VPG+H GQQS G+RWPYGPV+I+
Sbjct  127  RVMPKSYIQAQGEVVVTRRFLENFTGDNPRFLSKSFSVPGDHQGQQSTGYRWPYGPVSII  186

Query  821  TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQM  937
             PFNFP+EIPVLQL GAL  GN+P L+VDSKV +VMEQ 
Sbjct  187  CPFNFPIEIPVLQLFGALITGNRPTLRVDSKVALVMEQF  225



>gb|KDD71694.1| hypothetical protein H632_c4546p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=151

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  1421  LENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNAL  1600
             L  HSIPS +GA+ PTAVFVPL+E L  E+++ VTTE+FGPFQ++T Y D +LPLVL A 
Sbjct  1     LAQHSIPSCFGAVEPTAVFVPLKEALSAEHWEAVTTELFGPFQVITTYSDAELPLVLEAC  60

Query  1601  ERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  1780
             ERM+A+LTAAVVSND  F+  V+ N+VNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG
Sbjct  61    ERMEAHLTAAVVSNDARFVDHVLANTVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIG  120

Query  1781  TPEAIKLVWSCHREIIYDIGPVSPAWKLPQA  1873
             TPEAI+LVWSCHREII DIGP + A  L Q+
Sbjct  121   TPEAIRLVWSCHREIIRDIGPAADAADLVQS  151



>gb|KDO76061.1| hypothetical protein CISIN_1g030638mg [Citrus sinensis]
Length=132

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  1355  MLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEV  1534
             ML+HMNKLL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+
Sbjct  1     MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI  60

Query  1535  FGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRAR  1714
             FGPFQIVTEYK +QLPLVLNALERM A+LTAAVVSND LFLQEVIGN+VNGTTYAG+RAR
Sbjct  61    FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRAR  120

Query  1715  TTGAPQNHWF  1744
             TTGAPQNHW+
Sbjct  121   TTGAPQNHWW  130



>gb|AFK43124.1| unknown [Lotus japonicus]
Length=205

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  296  TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
            +R +HSL FAT+  E++SGS+PAEV NLVQG W+ SS+ NTI+DPLNG+SFIKVAEV +A
Sbjct  25   SRYAHSLQFATVEAEEVSGSRPAEVSNLVQGKWVGSSNCNTIVDPLNGDSFIKVAEVDEA  84

Query  476  ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPK  655
             +QPF+ES+  CPKHGLHNPFKAPERYLMLGD++TKAAHMLSLP+VSDFFTRLIQRVSPK
Sbjct  85   GIQPFVESLSSCPKHGLHNPFKAPERYLMLGDVTTKAAHMLSLPKVSDFFTRLIQRVSPK  144

Query  656  SYQQALAEVFVTQKFLENFSGD  721
            SYQQA  EV+VTQ      +GD
Sbjct  145  SYQQAQGEVYVTQNHWFGPAGD  166


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  1730  QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPV   W++P +T
Sbjct  157   QNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVPEHWEIPPST  205



>emb|CDY66231.1| BnaAnng21870D [Brassica napus]
Length=160

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  338  EDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPK  517
            E ISG+ PAEV + VQG WI SS++NT+LDPLNGE FIKV+EV ++ +QPF+ES+ +CPK
Sbjct  23   EVISGAHPAEVQSFVQGKWIGSSNYNTLLDPLNGEPFIKVSEVDESGVQPFVESLSQCPK  82

Query  518  HGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQK  697
            HGLHNPFK+PERYL+  DISTKAAHML+LP+VSDFFTRLIQRV+PKSYQQA  EVFVT+K
Sbjct  83   HGLHNPFKSPERYLLYCDISTKAAHMLALPKVSDFFTRLIQRVAPKSYQQAAGEVFVTRK  142

Query  698  FLENFSGDQV  727
            FL+NF GDQV
Sbjct  143  FLDNFCGDQV  152



>gb|AAT45086.1| pyrroline-5-carboxylate dehydrogenase [Medicago sativa]
Length=100

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  704   ENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             ENF GDQVRFLARSF VPGNHLGQQSHGFRWPYGPVAI+TPFNFPLEIPVLQLMGALYMG
Sbjct  1     ENFCGDQVRFLARSFAVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPVLQLMGALYMG  60

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGK  1003
             NKPVLKVDSKV IVMEQMLRLLH CGLP+EDVDF+N DGK
Sbjct  61    NKPVLKVDSKVSIVMEQMLRLLHSCGLPVEDVDFINCDGK  100



>emb|CCI41062.1| unnamed protein product [Albugo candida]
Length=346

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 124/187 (66%), Gaps = 30/187 (16%)
 Frame = +2

Query  1178  VCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVLTFTTKAM  1357
             V   DAYA SGQKCSAQS LFMH+NW           +    KL       VLT TT+ M
Sbjct  133   VTSLDAYAYSGQKCSAQSTLFMHQNWV---------DVGIEEKL-------VLTVTTERM  176

Query  1358  LDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVF  1537
             L  +  LL+IPG++L FGG+ LENHSI  +YGAIRPTAVFVPLEEIL+ EN++L      
Sbjct  177   LGRVETLLKIPGARLSFGGKELENHSISKVYGAIRPTAVFVPLEEILEKENFEL------  230

Query  1538  GPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRART  1717
                     Y D+QL LVL  LE+M A LTAAVVSND LF ++V+  SVNGT YAGIRART
Sbjct  231   --------YSDDQLDLVLQFLEKMHARLTAAVVSNDDLFRRKVLARSVNGTIYAGIRART  282

Query  1718  TGAPQNH  1738
             TGAPQNH
Sbjct  283   TGAPQNH  289


 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +2

Query  419  ILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHML  598
            I+DP NGE+F+K+      E++PF +S+R+ PK+GLHNP    ERY++ GDIS KAA ML
Sbjct  5    IVDPFNGETFLKMPSTSTKEIEPFTQSLRQTPKYGLHNPLNNAERYVLYGDISHKAAAML  64

Query  599  SLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRF  733
              P+V+DFF         +SY QA  EV VT+KF ENF GDQVRF
Sbjct  65   RDPQVADFFHTTYPTSLTQSYTQAETEVIVTEKFTENFGGDQVRF  109



>ref|XP_002299716.2| hypothetical protein POPTR_0001s18510g [Populus trichocarpa]
 gb|EEE84521.2| hypothetical protein POPTR_0001s18510g [Populus trichocarpa]
Length=198

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 112/147 (76%), Gaps = 10/147 (7%)
 Frame = +2

Query  308  HSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQP  487
            HSLPFAT++ E ISGSQPA+VHNLVQG WI SS+WNTI+DPLNGE FIK+AEV +   Q 
Sbjct  54   HSLPFATVDAEGISGSQPAKVHNLVQGKWIGSSTWNTIVDPLNGEPFIKIAEVDETGTQR  113

Query  488  ------FLESMRKCP-KHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRV  646
                   ++ +   P K  L   F    RYL+ GDI+ KAAHMLS+P+VSDFFTRLIQRV
Sbjct  114  GFFYALLIDYIMIVPWKWNLMTIFG---RYLLYGDITAKAAHMLSVPKVSDFFTRLIQRV  170

Query  647  SPKSYQQALAEVFVTQKFLENFSGDQV  727
            +PKSYQQAL EV VTQKFLENFSGDQV
Sbjct  171  APKSYQQALGEVQVTQKFLENFSGDQV  197



>gb|KDO76064.1| hypothetical protein CISIN_1g030638mg [Citrus sinensis]
Length=121

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  1355  MLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEV  1534
             ML+HMNKLL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+
Sbjct  1     MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI  60

Query  1535  FGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ  1660
             FGPFQIVTEYK +QLPLVLNALERM A+LTAAVVSND LFLQ
Sbjct  61    FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ  102



>gb|KDO76062.1| hypothetical protein CISIN_1g030638mg [Citrus sinensis]
Length=102

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  1355  MLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEV  1534
             ML+HMNKLL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+
Sbjct  1     MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI  60

Query  1535  FGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ  1660
             FGPFQIVTEYK +QLPLVLNALERM A+LTAAVVSND LFLQ
Sbjct  61    FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ  102



>gb|KDO76063.1| hypothetical protein CISIN_1g030638mg [Citrus sinensis]
Length=109

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  1355  MLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEV  1534
             ML+HMNKLL++PGSKLLFGGE L+NHSIPSIYGA++PTAVFVPLEEILKD NY+LVT E+
Sbjct  1     MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREI  60

Query  1535  FGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQ  1660
             FGPFQIVTEYK +QLPLVLNALERM A+LTAAVVSND LFLQ
Sbjct  61    FGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQ  102



>ref|XP_005856054.1| 1-pyrroline-5-carboxylate dehydrogenase, partial [Nannochloropsis 
gaditana CCMP526]
 gb|EKU20301.1| 1-pyrroline-5-carboxylate dehydrogenase, partial [Nannochloropsis 
gaditana CCMP526]
Length=119

 Score =   168 bits (426),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 1/116 (1%)
 Frame = +2

Query  1430  HSIPSIYGAIRPTAVFVPLEEILKDEN-YDLVTTEVFGPFQIVTEYKDNQLPLVLNALER  1606
             H IP+ YGA  PTAV+VPLE +L   + + L TTE+FGPF I T +KD +LPLVL ALER
Sbjct  4     HEIPTCYGAFEPTAVYVPLEGMLASPDAFHLATTEIFGPFYIYTTWKDGELPLVLEALER  63

Query  1607  MDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAG  1774
             M+ +LTAAVVSND +F + V+G++VNGTTY G RARTTGAPQNHWFGP GDPRGAG
Sbjct  64    MENHLTAAVVSNDVVFTRAVVGSTVNGTTYIGRRARTTGAPQNHWFGPCGDPRGAG  119



>ref|XP_008385272.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Malus domestica]
Length=90

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  1607  MDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTP  1786
             M A+LTAAVVSND LFLQ+VIGN+VNGTTYAG+RARTTGAPQNHWFGPAGDPRGAGIGTP
Sbjct  1     MHAHLTAAVVSNDPLFLQDVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTP  60

Query  1787  EAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             EAIKLVWSCHREIIYD+GP+   W+ P +T
Sbjct  61    EAIKLVWSCHREIIYDVGPLPKQWQTPPST  90



>ref|NP_001174503.1| Os05g0536400 [Oryza sativa Japonica Group]
 dbj|BAH93231.1| Os05g0536400, partial [Oryza sativa Japonica Group]
Length=91

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  1619  LTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIK  1798
             LTAAVVSND LFLQEV+G SVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIK
Sbjct  6     LTAAVVSNDPLFLQEVLGRSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIK  65

Query  1799  LVWSCHREIIYDIGPVSPAWKLPQAT  1876
             LVWSCHREIIYDIGP+     LP AT
Sbjct  66    LVWSCHREIIYDIGPLPKNRALPSAT  91



>ref|XP_010483964.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, 
mitochondrial-like [Camelina sativa]
Length=146

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  296  TRASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDA  475
            +R +HS+PFAT++ E++SG+ PA+V + VQG WI S + NT+LDPLNGE FIKVAEV ++
Sbjct  29   SRLNHSIPFATVDAEELSGAHPAQVQSFVQGTWIGSYNHNTLLDPLNGEPFIKVAEVDES  88

Query  476  ELQPFLESMRKCPKHGLHNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLI  637
            + + F++S+ +CPKHGLHNPFK+PERYL+ GDISTKAAHML+LP+   +  R +
Sbjct  89   DTKLFVDSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHMLALPKFCSYIWRFL  142



>emb|CDJ67549.1| aldehyde dehydrogenase, putative [Eimeria necatrix]
Length=362

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 113/378 (30%), Positives = 170/378 (45%), Gaps = 95/378 (25%)
 Frame = +2

Query  962   LPLEDVDFLNSDGKTMNKLLLEGKPRMTLFTG----------------------------  1057
             +PLED D +++ G  M++LL     R+  FTG                            
Sbjct  1     MPLEDADLISARGPVMSELLRRSPIRLLQFTGIAAAAASALCTPASSLPFPFPRLPPQHS  60

Query  1058  ----------------------SSRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVD--  1165
                                   SS VA +L+  L+GR+++ED GF++K+LG D++  +  
Sbjct  61    SSSSSSSSSSSSKSGACVAAAGSSSVARELSLLLQGRVRIEDGGFNFKVLGKDINPSEQQ  120

Query  1166  ---YIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPVL  1336
                Y+AW  D+DAYA SGQKCSAQS+L +H NW  + L+ L+++ AARR L  LT+ P+L
Sbjct  121   TLAYVAWQADEDAYALSGQKCSAQSLLLVHRNWVAAGLLQLLAAAAARRSLQTLTICPLL  180

Query  1337  TFTTKAMLDHMNKLLQIPGSKLLFGGEPL--------------------ENHSIPSIYGA  1456
             +   + M  H+  LL + G++LLFGG PL                    + HS+P  +G 
Sbjct  181   SLNNQQMHRHVQALLALKGARLLFGGYPLQQQQQQQQQQQQQQQQQQQQQQHSVPPQFGL  240

Query  1457  IRPTAVFVPLEEILKDENYDLVT-TEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAV  1633
               PTAV +PL+ +  D     V   EVFGP Q+ +                  ++ +++ 
Sbjct  241   YAPTAVSLPLQTLAFDAAARQVALQEVFGPLQVSSSS--------------SSSSSSSSS  286

Query  1634  VSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSC  1813
              S+     Q     +  G   A +     G+P+    G AG  R    G    ++L    
Sbjct  287   SSSSSSSKQHQRTAAAEGAPRAPVEGPLWGSPEAPQRGFAGGSRLLPPGGLGPVEL----  342

Query  1814  HREIIYDIGPVSPAWKLP  1867
               EII+D GPV   WK P
Sbjct  343   -GEIIFDNGPVPADWKWP  359



>gb|KHN24897.1| Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial 
[Glycine soja]
Length=125

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 71/118 (60%), Gaps = 38/118 (32%)
 Frame = +2

Query  560  MLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLA  739
            M G+IS KAAHMLSLP                                      +VRFL 
Sbjct  1    MFGEISAKAAHMLSLP--------------------------------------KVRFLV  22

Query  740  RSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSK  913
            RSF VPGNH+GQ+ HGFRWPYGPV I+TPFNFPLEI  LQLMGALYM NKPVLK+DSK
Sbjct  23   RSFAVPGNHVGQRCHGFRWPYGPVTIITPFNFPLEIHALQLMGALYMANKPVLKIDSK  80



>gb|EPS63147.1| hypothetical protein M569_11639, partial [Genlisea aurea]
Length=114

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  RASHSLPFATLNVEDISGSQPAEVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAE  478
            R    L FAT+  E+ISGSQPAEV NLV G+W +SS WNTI+DPLNGE FI VAEV +  
Sbjct  31   RFCRLLSFATVKAEEISGSQPAEVLNLVNGSWRKSSGWNTIVDPLNGEPFINVAEVDENG  90

Query  479  LQPFLESMRKCPKHGLHNPFKAPE  550
            +QPF+ES+ +CPKHGLHNPFK+PE
Sbjct  91   IQPFVESLSRCPKHGLHNPFKSPE  114



>ref|WP_008639741.1| MULTISPECIES: aldehyde dehydrogenase [Bacillaceae]
 gb|ELK44672.1| aldehyde dehydrogenase [Halobacillus sp. BAB-2008]
Length=498

 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 121/490 (25%), Positives = 222/490 (45%), Gaps = 45/490 (9%)
 Frame = +2

Query  356   QPAEVHNLVQGNW--IRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             Q   + N + G W  I+S +   +++P   E+ + V      E+   +++ +K  +    
Sbjct  5     QTETLRNFIGGKWEEIKSGAAVPVVNPATSETIVHVPLSTRKEVSDAVKAAKKAQRKWAL  64

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
              P  AP+R  +L  +  +      + E  +  ++L+   + K  ++A  EV         
Sbjct  65    VP--APQRAEILYKVGQR------MKEEKERLSQLLTMENGKVIEEARGEVQEGIDMAFY  116

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
              +G+  R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN 
Sbjct  117   MAGEGRRLFGQT--TPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPAIVAGNA  174

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSR  1066
              V K  ++  I+  ++ R+  DCGLP   ++ +   G T+ + ++E +  R+  FTGS++
Sbjct  175   VVWKPATETPIMAFELARIFEDCGLPEGVLNVVFGSGSTVGEAMIEEEDIRVISFTGSNQ  234

Query  1067  VAEKLAGDLKGRIK---LEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQ  1228
             V   +AG    R+K   LE  G +  I+  D D    V+ I W     AY  SGQ+C+A 
Sbjct  235   VGRTIAGKCGERLKKVSLEMGGKNAVIVMDDADLDLAVEGILW----SAYGTSGQRCTAC  290

Query  1229  SILFMHE---NWSKSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGS  1396
             S + +HE   N  +  L   ++ L+    LD+ + VGP++  +    +     + +  G+
Sbjct  291   SRVMVHEKVKNELEERLQKAIARLSIGNGLDESIKVGPIINRSGLEKIKGYVDVGKAEGA  350

Query  1397  KLLFGGEPLENHSIPSIYGAIRPTAVFVP--LEEILKDENYDLVTTEVFGPFQIVTEYKD  1570
             KLL GG  +EN       G+ +    F P    ++ KD    +   E+FGP   +   + 
Sbjct  351   KLLTGGYIMEN-------GSHKKGNYFAPTLFTDVTKD--MRIAKEEIFGPVVSLIPVQS  401

Query  1571  NQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGP  1750
              +  + +N    ++  L++++ + D   +     +   G  Y  + A TTGA + H   P
Sbjct  402   FEEAVDIN--NSVEYGLSSSIFTKDVNKVFTAQRDLDTGIVY--VNAGTTGA-EIHL--P  454

Query  1751  AGDPRGAGIG  1780
              G  +G G G
Sbjct  455   FGGTKGTGNG  464



>ref|WP_026576908.1| aldehyde dehydrogenase [Bacillus sp. UNC438CL73TsuS30]
Length=493

 Score =   115 bits (288),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 120/493 (24%), Positives = 218/493 (44%), Gaps = 57/493 (12%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W  SS+  +  +L+P NG+   +V +    ++   +++ +   K     P 
Sbjct  3     KILNYINGEWCPSSTGKFTPVLNPANGQVLAEVTQSTQEDVDRAVQAAKNAQKEWRLVP-  61

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              APER     DI  K  ++L   E  +   +++     K  ++   EV          +G
Sbjct  62    -APER----ADILYKVGYLLK--ERKEKLAQILTSEMGKVIEEGRGEVQEAIDMAFYVAG  114

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +  VP     + +   R P G   ++TP+NFP+ I   + + AL  GN  V 
Sbjct  115   EGRRLFGDT--VPSELRNKFAMSVRVPIGIAGLITPWNFPIAIASWKSLPALVTGNAVVW  172

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVA  1072
             K  ++  +V E+ +++  D GLP   ++ +N  G  +   ++E  P + L  FTGS+ V 
Sbjct  173   KPATETPMVAEEFVKIYEDAGLPKGLLNLVNGSGSVVGNAMVE-HPDIDLISFTGSNEVG  231

Query  1073  EKL---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSI  1234
             +++   AG L  R  LE  G +   +  D D    V+ I W     A+  +GQ+C+A S 
Sbjct  232   KEINGRAGALLKRTSLEMGGKNAITVLEDADLDLAVEGILW----GAFGTAGQRCTATSR  287

Query  1235  LFMHENWSKSPLINLMSSLAARRKLDDL----TVGPVLTFTTKAMLDHMNKLLQIPGSKL  1402
             + +H++        L++S+   +  D L     VGPV+  ++   +D   K+ Q  G+KL
Sbjct  288   VIVHKDVKAELERKLLASIDGLKMGDGLDESVKVGPVINRSSLERIDEYVKIGQEEGAKL  347

Query  1403  LFGGEPLENHSI-------PSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             L GG  +  + +       P+I+  + P                 +   E+FGP  +V+ 
Sbjct  348   LTGGRIVSENGLDQGNFYAPTIFTDVTP--------------EMRIAKEEIFGP--VVSI  391

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
                  L   +     ++  L++A+ S D   + + + +   G  Y  + A T+GA + H 
Sbjct  392   IAVTSLEEAIEVNNSVEFGLSSAIYSADVNRIFQAMRDLDTGLVY--VNAGTSGA-EIHL  448

Query  1742  FGPAGDPRGAGIG  1780
               P G  +G G G
Sbjct  449   --PFGGTKGTGNG  459



>ref|WP_013144236.1| aldehyde dehydrogenase [Geobacillus sp. C56-T3]
 ref|YP_003670060.1| aldehyde dehydrogenase [Geobacillus sp. C56-T3]
 gb|ADI25483.1| Aldehyde Dehydrogenase [Geobacillus sp. C56-T3]
Length=493

 Score =   115 bits (288),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 121/492 (25%), Positives = 213/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  K     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +  +  + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLEEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_014194855.1| MULTISPECIES: aldehyde dehydrogenase [Geobacillus]
 ref|YP_004980900.1| betaine aldehyde dehydrogenase [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|AEV17800.1| Betaine aldehyde dehydrogenase [Geobacillus thermoleovorans CCB_US3_UF5]
 dbj|GAD14873.1| betaine aldehyde dehydrogenase [Geobacillus kaustophilus GBlys]
 dbj|GAJ60434.1| aldehyde dehydrogenase [Geobacillus thermoleovorans B23]
Length=493

 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  K     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   R++     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARMLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   IGGHRLREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_025783419.1| aldehyde dehydrogenase [Sporosarcina sp. D27]
Length=493

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 126/486 (26%), Positives = 211/486 (43%), Gaps = 49/486 (10%)
 Frame = +2

Query  374   NLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W  SSS  +  +L+P NG+   KVA+  D +L   + + +K  K     P  AP
Sbjct  6     NYIDGEWCESSSGKFVDVLNPANGKVLGKVAQSTDEDLNRAVLAAKKAQKEWRLVP--AP  63

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ER   L  I+        L E  +  ++++     K   +A  EV          +G+  
Sbjct  64    ERAEYLYTIANL------LKERKEELSQILTSEMGKVIDEARGEVQEAIDMAYYMAGEGR  117

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +  VP     + +   R P G   ++TP+NFP+ I   +   AL  GN  V K  
Sbjct  118   RLFGDT--VPSELRDKFAMSVRVPIGVAGLITPWNFPIAIASWKSFPALVSGNAVVWKPA  175

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVAEKL  1081
             ++  I+  +  ++  + GLP   ++ +N  G+ +   ++E  P + L  FTGS+ V   +
Sbjct  176   TETPIIAYEFAKIFEEAGLPKGLLNLVNGSGREVGNAMVE-HPDIDLISFTGSNEVGSAI  234

Query  1082  ---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
                AG+L  R  LE  G +  I+  D D    VD I W     A+  SGQ+C+A S + +
Sbjct  235   NARAGELLKRTSLEMGGKNAVIVLKDADLDLAVDGILW----GAFGTSGQRCTATSRIIV  290

Query  1244  HENWSKSPLINLMSSLAARRKLDD-----LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLF  1408
             H++  K  L N +        L D     + VGPV+  ++   +    K+    G+ LL 
Sbjct  291   HQD-VKEDLENKLVERVGELSLGDGADESVKVGPVINRSSLGKIHEFVKIGLAEGATLLA  349

Query  1409  GGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDL--VTTEVFGPFQIVTEYKDNQLP  1582
             GG  + +  +  + G      +F        D   D+     E+FGP   +   K  +  
Sbjct  350   GGRMVTDSGL--VTGNFYAPTIFT-------DATVDMRIAQEEIFGPVVSIIPVKSLKEA  400

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
             + +N    +   L++++ ++D     + + +   G  Y  I A TTGA + H   P G  
Sbjct  401   IEVN--NSVKFGLSSSIFTSDVNLAFQAMRDLDTGIVY--INAGTTGA-EIHL--PFGGT  453

Query  1763  RGAGIG  1780
             +G G G
Sbjct  454   KGTGNG  459



>ref|WP_033844634.1| aldehyde dehydrogenase [Geobacillus subterraneus]
Length=493

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 123/491 (25%), Positives = 209/491 (43%), Gaps = 55/491 (11%)
 Frame = +2

Query  368   VHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFK  541
             + N + G W   S+  W  +++P  GE+  K       ++   +++ ++  K     P  
Sbjct  3     IQNYINGKWKDPSTGRWAPVINPATGETIAKAPRSGAQDIDEAVQAAKEAQKRWALVP--  60

Query  542   APERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGD  721
             AP+R  +L  + T       L E  +   RL+     K  ++A  EV          +G+
Sbjct  61    APKRAEILYRVGT------LLQERKEALARLLTMEMGKVIEEARGEVQEGIDMAFYMAGE  114

Query  722   QVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLK  901
               R    +   P     + +   R P G V I+TP+NFP+ I   +   AL  GN  V K
Sbjct  115   GRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPALVAGNAVVWK  172

Query  902   VDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAEK  1078
                +  I+ +++ R+  + GLP      ++ DG T    L+E    ++  FTGS+ V   
Sbjct  173   PALETPIMAQELARIFAEAGLPPGVFHVVHGDGPTAGNALVEHPDVKVISFTGSNEVGRM  232

Query  1079  LA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILF  1240
             +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S + 
Sbjct  233   IAEKCGRLLKKVSLEMGGKNAVIVMDDADLSLAVDGIIW----SAFGTSGQRCTACSRVI  288

Query  1241  MHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLF  1408
             +HE   +     L+  +++L     LD+ + VGPV+       +D   ++    G+KLL 
Sbjct  289   VHERVKQELERRLLEAVNTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLV  348

Query  1409  GGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             GG  L         +  P+I+  + P                 +   E+FGP  +V+   
Sbjct  349   GGYILREGDYARGFYYAPTIFTDVTP--------------KMRIAREEIFGP--VVSILS  392

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
                L   ++    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H   
Sbjct  393   VRSLDEAIDVNNSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL--  447

Query  1748  PAGDPRGAGIG  1780
             P G  +G G G
Sbjct  448   PFGGTKGTGNG  458



>ref|WP_016837670.1| aldehyde dehydrogenase [Ureibacillus thermosphaericus]
Length=492

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 122/492 (25%), Positives = 214/492 (43%), Gaps = 56/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSSWNT-ILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFK  541
             ++ N + G WI        +++P  GE   KV      E++  + S ++  K     P  
Sbjct  2     DLKNYINGRWIEQDLEKVAVINPATGEELAKVPLSTKNEVEEAVRSAKQAQKEWALIP--  59

Query  542   APERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGD  721
             AP+R   L +I  K      L E  ++  +++ +   K  ++A  EV          +G+
Sbjct  60    APKRAEYLYEIGYK------LKEKKEYLAQILTKEMGKVIEEARGEVQEGIDMAFYMAGE  113

Query  722   QVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLK  901
               R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V K
Sbjct  114   GRRLFGET--TPSELPNKFAMSVRSPVGVVGIITPWNFPIAIATWKSFPAIVAGNTVVWK  171

Query  902   VDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAEK  1078
               ++  ++  ++ ++  + GLP   V+ +   G T+   L+E    ++  FTGS+    K
Sbjct  172   PSTETPLMAYELGKIFEEVGLPEGVVNIVFGSGSTVGTALIEHPDVKVISFTGSNETGRK  231

Query  1079  LAGDLKGR----IKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
             +A +L GR    + LE  G +  I+  D D    V+ I W     A+  +GQ+C+A S +
Sbjct  232   VA-ELGGRHLKKVSLEMGGKNAIIVMDDADLNLAVEGILW----SAFGTTGQRCTACSRV  286

Query  1238  FMHENWS---KSPLINLMSSLAARRKLD-DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +H+N     +  L+  +S+L     LD D+ VGPV+       + H  ++ +  G++LL
Sbjct  287   IVHKNVKNELEERLVAALSNLTIGNGLDPDVKVGPVINRAALEKIYHYVQIGKNEGARLL  346

Query  1406  FGGE----PLENHSI---PSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GGE    P  N      P+I+  ++P              +  +   E+FGP   + E 
Sbjct  347   TGGEIITTPPYNQGFFFEPTIFTDVKP--------------DMTIAQEEIFGPVLSIIEV  392

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
               N L   +     +   L++++ S D   + +   +   G  Y  + A T GA + H  
Sbjct  393   --NSLDEAIEVNNSVKFGLSSSIYSQDVNRIFKAQRDLDTGIVY--VNAGTIGA-EIHL-  446

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  447   -PFGGTKGTGNG  457



>ref|WP_033009542.1| aldehyde dehydrogenase [Geobacillus stearothermophilus]
 gb|KFL16420.1| aldehyde dehydrogenase [Geobacillus stearothermophilus]
 gb|KFX37002.1| aldehyde dehydrogenase [Geobacillus stearothermophilus]
Length=493

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  +     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEVLYRVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   IGGHRLREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIMSV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_033018492.1| aldehyde dehydrogenase [Geobacillus sp. G1w1]
 gb|KFX35669.1| aldehyde dehydrogenase [Geobacillus sp. G1w1]
Length=493

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 123/491 (25%), Positives = 209/491 (43%), Gaps = 55/491 (11%)
 Frame = +2

Query  368   VHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFK  541
             + N + G W   S+  W  +++P  GE+  K       ++   +++ ++  K     P  
Sbjct  3     IQNYINGKWKEPSTGRWAPVINPATGETIAKAPMSGAQDIDEAVQAAKEAQKRWALVP--  60

Query  542   APERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGD  721
             AP+R  +L  + T       L E  +   RL+     K  ++A  EV          +G+
Sbjct  61    APKRAEILYRVGTL------LQERKEALARLLTMEMGKVIEEARGEVQEGIDMAFYMAGE  114

Query  722   QVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLK  901
               R    +   P     + +   R P G V I+TP+NFP+ I   +   AL  GN  V K
Sbjct  115   GRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPALVAGNAVVWK  172

Query  902   VDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAEK  1078
                +  I+ +++ R+  + GLP      ++ DG T    L+E    ++  FTGS+ V   
Sbjct  173   PALETPIMAQELARIFAEAGLPPGVFHVVHGDGPTAGNALVEHPDVKVISFTGSNEVGRM  232

Query  1079  LA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILF  1240
             +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S + 
Sbjct  233   IAETCGRLLKKVSLEMGGKNAVIVMDDADLSLAVDGIIW----SAFGTSGQRCTACSRVI  288

Query  1241  MHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLF  1408
             +HE   +     L+  +++L     LD+ + VGPV+       +D   ++    G+KLL 
Sbjct  289   VHERVKQELERRLLEAVNTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLV  348

Query  1409  GGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYK  1567
             GG  L         +  P+I+  + P                 +   E+FGP  +V+   
Sbjct  349   GGYILREGDYARGFYYAPTIFTDVTP--------------KMRIAREEIFGP--VVSILS  392

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
                L   ++    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H   
Sbjct  393   VRSLDEAIDVNNSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL--  447

Query  1748  PAGDPRGAGIG  1780
             P G  +G G G
Sbjct  448   PFGGTKGTGNG  458



>ref|WP_013986248.1| aldehyde dehydrogenase [Sulfobacillus acidophilus]
 ref|YP_004719251.1| aldehyde dehydrogenase [Sulfobacillus acidophilus TPY]
 ref|YP_005257475.1| Aldehyde Dehydrogenase [Sulfobacillus acidophilus DSM 10332]
 gb|AEJ39508.1| Aldehyde Dehydrogenase [Sulfobacillus acidophilus TPY]
 gb|AEW05803.1| Aldehyde Dehydrogenase [Sulfobacillus acidophilus DSM 10332]
Length=486

 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 207/492 (42%), Gaps = 70/492 (14%)
 Frame = +2

Query  368   VHNLVQGNWIRS-SSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKA  544
             + N + G W+    +W   ++P      I            + ES R+     +    +A
Sbjct  3     IANYIGGEWVEGDGAWQQDVNPSRPRHMIA----------EYRESSRRLAGQAVEAANRA  52

Query  545   PERY----------LMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQ  694
              E +          L+L   +  AAH        + +  L+ +   K+  +A  E     
Sbjct  53    WEAWSSTPAPTRGRLLLAVHARLAAH-------RERYVDLMVQEQGKTRPEAEGEFQKGL  105

Query  695   KFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGAL  874
               +E F+G+  R    +  +P       ++  R   GPVA++TP+NFP  IP+ ++  AL
Sbjct  106   NLVEFFAGEGFRLNGET--IPSESPKTLTYTLRQSVGPVAVITPWNFPFAIPLWKISPAL  163

Query  875   YMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNK-LLLEGKPRMTLF  1051
               GN  V K  S    +  Q++    + GLP   ++ +   G+ + + +  + +     F
Sbjct  164   VAGNPVVFKPASYTPAIAAQLVSDFSEAGLPAGVLNLILGSGREVGESVAADERIHAVSF  223

Query  1052  TGSSRVAEKLAGDLKGR---IKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCS  1222
             TGS+ V  +LA  L GR   + +E  G +  ++ P  D +D  A    Q AY  +GQ+C+
Sbjct  224   TGSNPVGRRLAEILAGRPVKVTMEMGGKNAVVVTPSAD-LDLAAGGIVQGAYGAAGQRCT  282

Query  1223  AQSILFMHENWSKSPLINLMSSLAARRKLDDLTVGPV----LTFTTKAMLDHMNKLLQI-  1387
             A S +F+HE    + +  L+      R ++ + VGP     +T       D  ++ L   
Sbjct  283   ATSRVFVHEEVKDALVERLV------RHVEGIVVGPSDDPRVTMGPLISADQRDQCLVYV  336

Query  1388  -----PGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQI  1552
                   G+++++GG      ++P     + PT V V       D    LV  E+FGP   
Sbjct  337   AEAAEAGAQVVYGG-----RALPRDGYFLEPTLVTV------DDSRLRLVQEEIFGPVLA  385

Query  1553  VTEYKDNQLPLVLNALERMDANLTAAVVSND----QLFLQEV-IGN-SVNGTTYAGIRAR  1714
             +  Y+   L   + A+ ++   L+AA+ S D    QLF+Q V +G   VN  T  G    
Sbjct  386   LLTYRS--LSEAIEAVNQVPYGLSAAIYSRDLLETQLFIQRVAVGMVHVNNPTIGGEAQM  443

Query  1715  TTGAPQNHWFGP  1750
               G  +    GP
Sbjct  444   PFGGMKGSGLGP  455



>ref|WP_023633780.1| aldehyde dehydrogenase [Geobacillus sp. MAS1]
 gb|ESU72631.1| aldehyde dehydrogenase [Geobacillus sp. MAS1]
Length=493

 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  K     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   R++     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARMLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_033024653.1| aldehyde dehydrogenase [Geobacillus sp. CAMR5420]
 gb|KDE50217.1| aldehyde dehydrogenase [Geobacillus sp. CAMR5420]
Length=493

 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  +     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEVLYRVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKALKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNHVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_015373898.1| putative aldehyde dehydrogenase [Geobacillus sp. GHH01]
 ref|YP_007400711.1| putative aldehyde dehydrogenase [Geobacillus sp. GHH01]
 gb|AGE20960.1| putative aldehyde dehydrogenase [Geobacillus sp. GHH01]
Length=493

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  +     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEVLYRVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKALKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIMSV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNHVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_021321355.1| aldehyde dehydrogenase [Geobacillus sp. A8]
 gb|EQB97466.1| aldehyde dehydrogenase [Geobacillus sp. A8]
Length=493

 Score =   113 bits (282),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  +     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_011229878.1| aldehyde dehydrogenase [Geobacillus kaustophilus]
 ref|YP_146227.1| aldehyde dehydrogenase [Geobacillus kaustophilus HTA426]
 dbj|BAD74659.1| aldehyde dehydrogenase [Geobacillus kaustophilus HTA426]
Length=493

 Score =   113 bits (282),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 212/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  K     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   R++     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARMLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_026800912.1| aldehyde dehydrogenase [Pontibacillus halophilus]
 gb|KGX91120.1| aldehyde dehydrogenase [Pontibacillus halophilus JSM 076056 = 
DSM 19796]
Length=497

 Score =   113 bits (282),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 117/487 (24%), Positives = 214/487 (44%), Gaps = 40/487 (8%)
 Frame = +2

Query  356   QPAE-VHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHN  532
             +P E + N V G W RS S+  + +P NGE   +V      E+   +E+     K     
Sbjct  4     KPVEKLANFVNGEWHRSESYTVVRNPANGEKLTEVPLSTWKEVDYAVEAAVAAQKQWALV  63

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
             P  AP+R  +L  + +       + E  +  ++L+   + K  ++A  EV          
Sbjct  64    P--APQRAEVLYRVGSL------MKERKETLSQLLTMENGKVIEEARGEVQEGIDMAYYM  115

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +G+  R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  
Sbjct  116   AGEGRRLFGQT--TPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPAIVAGNAV  173

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRV  1069
             V K  ++  ++  ++++++ + GLP   ++ +   G  +   L+E    R+  FTGS+  
Sbjct  174   VWKPATETPLMAFELVKIMEEAGLPSGVLNVVFGSGSEVGTSLVEHPDIRVISFTGSNDT  233

Query  1070  AEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQS  1231
                +A   G+   ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S
Sbjct  234   GRTIASKCGEQLKKVSLEMGGKNAVIVLEDADLDLAVEGILW----SAFGTSGQRCTACS  289

Query  1232  ILFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
              + +HEN     ++ L+  M +L+    LD+ + VGP++   +   ++    + +  G++
Sbjct  290   RVIVHENVKEELENRLLQQMETLSIGNGLDEGIKVGPIINEKSLMKIEEYMDVAKQDGAR  349

Query  1400  LLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQL  1579
             LL GG  LE       Y        F P       ++  +   E+FGP  +V+      L
Sbjct  350   LLAGGHVLEGEGFTGGY-------YFAPTLFTDATKDMRIAQEEIFGP--VVSLISVKSL  400

Query  1580  PLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGD  1759
                +     +   L++++ + D   + +   +   G  Y  + A TTGA  +    P G 
Sbjct  401   AEAVEVNNSVSFGLSSSIFTKDVNRVFQAQRDLDTGIVY--VNAGTTGAEIHL---PFGG  455

Query  1760  PRGAGIG  1780
              +G G G
Sbjct  456   TKGTGNG  462



>ref|WP_025949046.1| aldehyde dehydrogenase [Geobacillus thermocatenulatus]
Length=493

 Score =   113 bits (282),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 123/486 (25%), Positives = 214/486 (44%), Gaps = 43/486 (9%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  +     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARLLTMEMGKVVEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALRKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPL-ENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLP  1582
              GG  L E       Y A  PT +F  +       N  +   E+FGP   +   +  +  
Sbjct  348   VGGYILREGDYARGFYYA--PT-IFTDV-----TSNMSIAREEIFGPVVSIISVRSLEEA  399

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
             + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H   P G  
Sbjct  400   IAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL--PFGGT  452

Query  1763  RGAGIG  1780
             +G G G
Sbjct  453   KGTGNG  458



>ref|WP_031405803.1| aldehyde dehydrogenase [Geobacillus vulcani]
Length=493

 Score =   112 bits (281),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 121/492 (25%), Positives = 211/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  K     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKRWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEVLYRVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++ R+  + GLP      ++ DG T    L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTAGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLRIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYAHGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_003395837.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus flavithermus]
 gb|EMT46484.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus flavithermus 
AK1]
Length=491

 Score =   112 bits (281),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 118/492 (24%), Positives = 219/492 (45%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             +V N + G WI S+S  + +I++P  GES  +V    + +++  + + ++  K     P 
Sbjct  2     KVLNYMDGRWIPSTSGQFVSIINPATGESIGEVTLSNEQDVKQAVSAAKRAQKTWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEVLYKVG------MLLQERKEQLARLLTMEMGKVIEEAKGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V ++TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELPNKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIIAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRVAE  1075
             K   +  I+ +Q+ ++  + GLP    + ++  G  + + L+E +  ++  FTGS+ V  
Sbjct  172   KPALETPIMAQQLAQIFEEAGLPNGVFNVVHGRGSVVGEALVEHRDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
             ++A   G    ++ LE  G +  I+  D +    V+ I W     A+  SGQ+C+A S +
Sbjct  232   RIAETCGRHLKKVSLEMGGKNAIIVMDDANITLAVEAIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   K     L++ M +L     L++ + VGPV+       +DH  ++ +  G+ LL
Sbjct  288   IVHERVKKQVEERLLSAMKTLTVGNGLEEGVKVGPVINRDALQKIDHYVQIGKNEGATLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  ++        +  P+++  + PT                +   E+FGP   +   
Sbjct  348   AGGHVMQGEQYKNGFYYAPTLFTNVTPT--------------MTIAREEIFGPVTSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +  +  + +N    +D  L++A+ + D       + +   G  Y  + A TTGA + H  
Sbjct  394   RSLEEAIEVN--NSVDYGLSSAIFTRDIHRAFTAMRDFDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_018661901.1| aldehyde dehydrogenase [Bacillus acidiproducens]
Length=493

 Score =   112 bits (281),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 125/492 (25%), Positives = 215/492 (44%), Gaps = 61/492 (12%)
 Frame = +2

Query  374   NLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W   S+  +  +++P  GE   +VA+    ++   +E+ ++  K     P  AP
Sbjct  6     NFIDGKWCEPSTGRYVPVINPATGEQMGEVAQSAKTDVSRAVEAAKQAQKQWRLVP--AP  63

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ER   L     K A +L   +  +   R++     K   +A  EV          +G+  
Sbjct  64    ERAGYL----YKVAELLK--QRKEQIARVLTSEMGKVISEARGEVQEAIDMAYYMAGEG-  116

Query  728   RFLARSFG--VPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLK  901
                 R FG  VP     + +   R P G   ++TP+NFP+ I   + + AL  GN  + K
Sbjct  117   ---RRQFGDTVPSELRNKFAMSVRVPVGVAGLITPWNFPIAIASWKSLPALVTGNAVIWK  173

Query  902   VDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVAE  1075
               ++      + +++  + GLP   V+ +N  G  + + ++E  P + L  FTGS+ V  
Sbjct  174   PATETPATACEFVKIYEEAGLPKGLVNLVNGSGSEVGEAMVE-HPGIDLISFTGSNEVGR  232

Query  1076  KL---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
             K+   AG L  R  LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  233   KINERAGGLLKRTSLEMGGKNAVIVLEDADLNLAVDGILW----GAFGTSGQRCTATSRV  288

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +H++  K     L+   ++L +   LD+ + VGPV+       +D   ++ +  G+KLL
Sbjct  289   IVHQDIKKELEDKLVKRTAALKSGNGLDETVAVGPVIHAAALRRIDEYVEIGRKEGAKLL  348

Query  1406  FGGE-----PLEN--HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG       LEN  +  P+I+  + P                 +   E+FGP   +   
Sbjct  349   AGGHVQSGGGLENGFYYAPTIFTDVTP--------------QMAIAQEEIFGPVVSIIPV  394

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +  +  + +N    ++  L++ + + D     E + +   G  Y  + A TTGA + H  
Sbjct  395   RSLEEAVEVN--NSVEFGLSSGIFTKDVNRAFEAMRDLDTGIVY--VNAGTTGA-EIHL-  448

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  449   -PFGGTKGTGNG  459



>gb|EZP78455.1| aldehyde dehydrogenase [Geobacillus stearothermophilus NUB3621]
Length=493

 Score =   112 bits (281),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 121/490 (25%), Positives = 218/490 (44%), Gaps = 57/490 (12%)
 Frame = +2

Query  374   NLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W  S S  +  +++P NGE+  +V    +A++   +++ +   K     P  AP
Sbjct  5     NFINGEWKESVSKQFAPVINPANGEAIGEVTVSIEADVDEAVKAAKTAQKEWALVP--AP  62

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             +R     ++  K  ++L   E  +   RL+     K  ++A  EV          +G+  
Sbjct  63    KR----AEVLYKVGYLLK--ERKEQLARLLTMEMGKVLEEARGEVQEGIDMAFYMAGEGR  116

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V K  
Sbjct  117   RLFGDT--TPSELKDKFAMSIRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPA  174

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRV----A  1072
              +   + +++ ++  + GLP    + ++ DG T    L+E    ++  FTGS+ V    A
Sbjct  175   LETPFMAQELAKIFEEAGLPKGVFNVVHGDGPTTGNALVEHPDVQVISFTGSNEVGRMIA  234

Query  1073  EKLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             EK    LK ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S + +
Sbjct  235   EKCGRRLK-KVSLEMGGKNAVIVMDDADLSLAVEGILW----SAFGTSGQRCTACSRVIV  289

Query  1244  HENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFG  1411
             HE      ++ L+  M +L     LD+ + VGPV++      +D   ++ +  G+KLL G
Sbjct  290   HEKVKEELENRLLEAMKTLTVGNGLDESVKVGPVISEEALQKIDRYVRIGKEEGAKLLTG  349

Query  1412  GEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKD  1570
             G  L +       +  P+++  ++PT                +   E+FGP   +     
Sbjct  350   GYILRDGEYQKGYYYAPTLFTDVQPT--------------MRIAREEIFGPVVSIISVSS  395

Query  1571  NQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGP  1750
              +  + +N    +D  L++++ + D   + + + +   G  Y  + A TTGA + H   P
Sbjct  396   LEEAIAVN--NSVDYGLSSSIFTRDVNKVFKAMRDLDTGIVY--VNAGTTGA-EIHL--P  448

Query  1751  AGDPRGAGIG  1780
              G  +G G G
Sbjct  449   FGGTKGTGNG  458



>ref|WP_039044162.1| aldehyde dehydrogenase [Sporosarcina sp. ZBG7A]
Length=495

 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 121/485 (25%), Positives = 216/485 (45%), Gaps = 47/485 (10%)
 Frame = +2

Query  374   NLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W  SSS  +  +L+P NG+   +V +  D ++   +++ +K  K     P  AP
Sbjct  8     NYIDGEWCESSSGKFVDVLNPANGKVLGEVTQSTDEDVDRAVQAAKKAQKEWRLVP--AP  65

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ER   L  I+T       L +  +  ++++     K   +A  EV          +G+  
Sbjct  66    ERAEYLYTIATL------LKDRKEELSQILTSEMGKVIDEARGEVQEAIDMAYYMAGEGR  119

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +  VP     + +   R P G   ++TP+NFP+ I   +   AL  GN  V K  
Sbjct  120   RLFGDT--VPSELRNKFAMSVRVPIGVAGLITPWNFPIAIASWKSFPALVSGNAVVWKPA  177

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVAEKL  1081
             ++  I+  +  ++  + GLP   ++ +N  G+ +   ++E  P + L  FTGS+ V   +
Sbjct  178   TETPIIAYEFAKIFEEAGLPKGLMNLVNGSGREVGNAMVE-HPDIDLISFTGSNEVGSAI  236

Query  1082  ---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
                AG+L  R  LE  G +  I+  D D    VD I W     A+  SGQ+C+A S + +
Sbjct  237   NSRAGELLKRTSLEMGGKNAVIVLEDADLDLAVDGILW----GAFGTSGQRCTATSRIIV  292

Query  1244  HENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFG  1411
             H++     ++ L++ +  L+     D+ + VGPV+  ++   +    K+    G+ LL G
Sbjct  293   HQDVKEDLENKLVDRIGELSLGDGADETVKVGPVINRSSLGKIHEYVKIGLEEGATLLAG  352

Query  1412  GEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDL--VTTEVFGPFQIVTEYKDNQLPL  1585
             G  + +  +  + G      +F        D   D+     E+FGP  +V+    N L  
Sbjct  353   GSMITDSGL--VTGNFYAPTIFT-------DATVDMRIAQEEIFGP--VVSIIPVNSLEE  401

Query  1586  VLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPR  1765
              +     ++  L++++ + +     + + +   G  Y  I A TTGA + H   P G  +
Sbjct  402   AIEVNNSVEFGLSSSIFTANVNLAFQAMRDLDTGIVY--INAGTTGA-EIHL--PFGGTK  456

Query  1766  GAGIG  1780
             G G G
Sbjct  457   GTGNG  461



>ref|WP_013522926.1| MULTISPECIES: aldehyde dehydrogenase [Geobacillus]
 ref|YP_003252385.1| aldehyde dehydrogenase [Geobacillus sp. Y412MC61]
 ref|YP_004131019.1| aldehyde dehydrogenase [Geobacillus sp. Y412MC52]
 gb|ACX77903.1| Aldehyde Dehydrogenase [Geobacillus sp. Y412MC61]
 gb|ADU92876.1| Aldehyde Dehydrogenase [Geobacillus sp. Y412MC52]
Length=493

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 211/492 (43%), Gaps = 55/492 (11%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W   S+  +  +++P  GE+  +VA     ++   +++ ++  K     P 
Sbjct  2     KIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       + L E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKRAEILYKVG------MLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAE  1075
             K   +  I+ +++  +  + GLP      ++ DG T+   L+E    ++  FTGS+ V  
Sbjct  172   KPAPETPIMAQELAGIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGR  231

Query  1076  KLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +A   G L  ++ LE  G +  I+  D D    VD I W     A+  SGQ+C+A S +
Sbjct  232   MIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIW----SAFGTSGQRCTACSRV  287

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLL  1405
              +HE   +     L+  + +L     LD+ + VGPV+       +D   ++    G+KLL
Sbjct  288   IVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLL  347

Query  1406  FGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEY  1564
              GG  L         +  P+I+  + P              N  +   E+FGP   +   
Sbjct  348   VGGYILREGDYARGFYYAPTIFTDVTP--------------NMRIAREEIFGPVVSIISV  393

Query  1565  KDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWF  1744
             +     + +N    +D  L++A+ + D   +   + +   G  Y  + A TTGA + H  
Sbjct  394   RSLDEAIAVN--NSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVY--VNAGTTGA-EIHL-  447

Query  1745  GPAGDPRGAGIG  1780
              P G  +G G G
Sbjct  448   -PFGGTKGTGNG  458



>ref|WP_013877527.1| aldehyde dehydrogenase [Geobacillus thermoglucosidasius]
 ref|YP_004589425.1| aldehyde dehydrogenase [Geobacillus thermoglucosidasius C56-YS93]
 gb|AEH49344.1| Aldehyde Dehydrogenase [Geobacillus thermoglucosidasius C56-YS93]
Length=493

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 124/486 (26%), Positives = 221/486 (45%), Gaps = 43/486 (9%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             +V N + G W  S S  +  +++P NGE+  +V    +A++   ++S +   K     P 
Sbjct  2     KVLNFIHGEWKASISRQFAPVINPANGETIGEVTVSIEADVDEAVKSAKAAQKGWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R     ++  K  ++L   E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKR----AEVLYKVGYLLK--ERKEQLARLLTTEMGKVLEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +  +P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--MPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRV--  1069
             K   +  ++ +++ ++  + GLP    + ++ DG T    L+E    ++  FTGS+ V  
Sbjct  172   KPALETPLMAQELAKIFEEAGLPKGVFNVVHGDGPTTGNALVEHPDVQVISFTGSNEVGR  231

Query  1070  --AEKLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSI  1234
               AEK    LK ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S 
Sbjct  232   IIAEKCGRRLK-KVSLEMGGKNAVIVMDDADLSLAVEGILW----SAFGTSGQRCTACSR  286

Query  1235  LFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKL  1402
             + +HE      ++ L+  M +L     LD+ + VGPV++      +D   ++ +  G+KL
Sbjct  287   VLVHEKVKEELENRLLEAMKTLTIGNGLDESVKVGPVISEEALQNIDRYVQIGKEEGAKL  346

Query  1403  LFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLP  1582
             L GG  L +      Y    PT +F  ++  ++     +   E+FGP   +      +  
Sbjct  347   LTGGYILRDGEYQKGY-YYAPT-LFTDVQATMR-----IAREEIFGPVVSIISVNSLEEA  399

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
             +V+N    +D  L++++ + D     + + +   G  Y  + A T GA + H   P G  
Sbjct  400   IVVN--NSVDYGLSSSIFTRDVNKAFQAMRDLDTGIVY--VNAGTIGA-EIHL--PFGGT  452

Query  1763  RGAGIG  1780
             +G G G
Sbjct  453   KGTGNG  458



>ref|WP_003253054.1| MULTISPECIES: aldehyde dehydrogenase [Geobacillus]
 ref|YP_003990675.1| aldehyde dehydrogenase [Geobacillus sp. Y4.1MC1]
 gb|ADP76064.1| Aldehyde Dehydrogenase [Geobacillus sp. Y4.1MC1]
 gb|EID42947.1| aldehyde dehydrogenase [Geobacillus thermoglucosidans TNO-09.020]
 dbj|GAJ43073.1| putative aldehyde dehydrogenase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=493

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 124/486 (26%), Positives = 220/486 (45%), Gaps = 43/486 (9%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             +V N + G W  S S  +  +++P NGE+  +V    +A++   ++S +   K     P 
Sbjct  2     KVLNFIHGEWKASISRQFAPVINPANGETIGEVTVSIEADVDEAVKSAKAAQKGWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R     ++  K  ++L   E  +   RL+     K  ++A  EV          +G
Sbjct  61    -APKR----AEVLYKVGYLLK--ERKEQLARLLTTEMGKVLEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRV--  1069
             K   +  ++ +++ ++  + GLP    + ++ DG T    L+E    ++  FTGS+ V  
Sbjct  172   KPALETPLMAQELAKIFEEAGLPKGVFNVVHGDGPTTGNALVEHPDVQVISFTGSNEVGR  231

Query  1070  --AEKLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSI  1234
               AEK    LK ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S 
Sbjct  232   IIAEKCGRRLK-KVSLEMGGKNAVIVMDDADLSLAVEGILW----SAFGTSGQRCTACSR  286

Query  1235  LFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKL  1402
             + +HE      ++ L+  M +L     LD+ + VGPV++      +D   ++ +  G+KL
Sbjct  287   VLVHEKVKEELENRLLEAMKTLTIGNGLDESVKVGPVISEEALQNIDRYVQIGKEEGAKL  346

Query  1403  LFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLP  1582
             L GG  L +      Y    PT +F  ++  ++     +   E+FGP   +      +  
Sbjct  347   LTGGYILRDGEYQKGY-YYAPT-LFTDVQATMR-----IAREEIFGPVVSIISVNSLEEA  399

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
             +V+N    +D  L++++ + D     + + +   G  Y  + A T GA + H   P G  
Sbjct  400   IVVN--NSVDYGLSSSIFTRDVNKAFQAMRDLDTGIVY--VNAGTIGA-EIHL--PFGGT  452

Query  1763  RGAGIG  1780
             +G G G
Sbjct  453   KGTGNG  458



>ref|WP_035067573.1| aldehyde dehydrogenase [Anoxybacillus gonensis]
 gb|KGP59573.1| aldehyde dehydrogenase [Anoxybacillus gonensis]
Length=491

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 123/494 (25%), Positives = 217/494 (44%), Gaps = 59/494 (12%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESF--IKVAEVQDAELQPFLESMRKCPKHGLHN  532
             +V N + G W+ S S  +  I++P NGE    + ++  QD E Q  L + R      L  
Sbjct  2     KVLNYIDGRWVSSVSNRFVPIVNPANGECIGEVTISNEQDVE-QAVLAAKRAQKAWAL--  58

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
                AP+R  +L  +       + L E  +   RL+     K  ++A  EV          
Sbjct  59    -VPAPKRAEVLYKVG------MLLQERKEQMARLLTMEMGKVIEEARGEVQEGIDMAFYM  111

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +G+  R    +   P     + +   R P G V ++TP+NFP+ I   +   A+  GN  
Sbjct  112   AGEGRRLFGDT--TPSELPNKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNAV  169

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRV  1069
             V K   +  I+ +Q+ ++  + GLP    + ++  G  + + L+E +  ++  FTGS+ V
Sbjct  170   VWKPALETPIMAQQLAQIFEEAGLPNGVFNVVHGRGSVVGEALVEHRDVKVISFTGSNEV  229

Query  1070  AEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQS  1231
               ++A   G    ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S
Sbjct  230   GRRIAETCGRHLKKVSLEMGGKNAIIVMDDADVALAVEAIIW----SAFGTSGQRCTACS  285

Query  1232  ILFMHENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
              + +HE+  K     L+  +S+L     L++ + VGPV+       + H  ++ +  G+ 
Sbjct  286   RVIVHEHVKKQVEERLLAAISTLTVGNGLEEGIKVGPVINQDALQKIHHYVQIGRNEGAT  345

Query  1400  LLFGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             LL GG  L++       +  P+++  + PT                +   E+FGP   + 
Sbjct  346   LLAGGYMLQDEPYKGGFYYAPTLFTNVTPT--------------MRIAREEIFGPVTSII  391

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
               +  +  + +N    +D  L++A+ + D       I +   G  Y  + A TTGA + H
Sbjct  392   SVRSLEEAIEVN--NSVDYGLSSAIFTRDIHRAFTAIRDFDTGIVY--VNAGTTGA-EIH  446

Query  1739  WFGPAGDPRGAGIG  1780
                P G  +G G G
Sbjct  447   L--PFGGTKGTGNG  458



>ref|WP_033829055.1| aldehyde dehydrogenase [Bacillus sp. KW-12]
Length=491

 Score =   110 bits (276),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 114/486 (23%), Positives = 212/486 (44%), Gaps = 45/486 (9%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKA  544
             ++ N + G WI    +  +++P  G+  + V    +  +   + S ++  K     P  A
Sbjct  3     QLKNYIDGKWIEGKQFIPVINPATGKKIVNVPLSSEETVDYAVSSAKRAQKDWALVP--A  60

Query  545   PERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQ  724
             P+R  ++ D+ T       L E  +   RL+   + K  ++A  EV          +G+ 
Sbjct  61    PKRAEIIYDVGT------LLKERKETLARLLTMENGKILEEARGEVQEGIDMAFYMAGEG  114

Query  725   VRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKV  904
              R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V K 
Sbjct  115   RRLFGQT--TPAELKDKFAMSMRVPVGVVGIITPWNFPIAIATWKAFPAIVAGNAVVWKP  172

Query  905   DSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAEKL  1081
              ++  ++  ++ ++  + GLP    + ++  G  + +  +     R+  FTGS+     +
Sbjct  173   ATETPMMAYELAKIFEEAGLPPGVFNVVHGSGAVVGQRFVHHPDIRVISFTGSNETGRMI  232

Query  1082  AGDLKGRIK---LEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             AG+   ++K   LE  G +  I+  D D     D I W     A+  SGQ+C+A S + +
Sbjct  233   AGECGKQLKKVSLEMGGKNAVIVMDDADLELAADGIIW----SAFGTSGQRCTACSRVIV  288

Query  1244  HENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---PGSKL  1402
             HEN  +     L+  +++L+    LD+ + VGP++    KA ++ +   ++I    G+KL
Sbjct  289   HENVKEKLEERLLEKIATLSIGNGLDETIRVGPII---NKASIEKIKSFIEIGKEEGAKL  345

Query  1403  LFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLP  1582
             L GG  L      + +        F P        N  +   E+FGP   +   K+    
Sbjct  346   LTGGYELTGEQYKNGH-------FFAPTLFTNVTANMRIAQEEIFGPVVSIISVKNFTEA  398

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDP  1762
             + +N    +   L++++ ++D   +     +   G  Y  + A TTGA + H   P G  
Sbjct  399   IEVN--NSVTYGLSSSIFTHDVNQVFRATRDLDTGIVY--VNAGTTGA-EIHL--PFGGT  451

Query  1763  RGAGIG  1780
             +G G G
Sbjct  452   KGTGNG  457



>gb|AAZ91465.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum aestivum]
 gb|AAZ91466.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum turgidum]
 gb|AAZ91467.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum turgidum]
 gb|AAZ91468.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum monococcum]
 gb|AAZ91469.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum aestivum]
 gb|AAZ91470.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Triticum aestivum]
 gb|AAZ91471.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Aegilops tauschii]
 gb|AAZ91472.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Aegilops tauschii]
Length=52

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  1721  GAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPVSPAWKLPQAT  1876
             GAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGP+   W LP AT
Sbjct  1     GAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREIIYDIGPLPKKWALPAAT  52



>ref|WP_039230283.1| aldehyde dehydrogenase [Bacillus thermotolerans]
 gb|KIA70666.1| Aldehyde dehydrogenase B [Bacillus thermotolerans]
 gb|KIG06520.1| Aldehyde dehydrogenase B [Bacillaceae bacterium MTCC 8252]
 gb|KIG08951.1| Aldehyde dehydrogenase B [Bacillaceae bacterium MTCC 10057]
Length=500

 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 122/483 (25%), Positives = 217/483 (45%), Gaps = 43/483 (9%)
 Frame = +2

Query  374   NLVQGNWIRSSSWNTI--LDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W+ S S   I  ++P NGE   +VA    A++   +++ ++  K     P  AP
Sbjct  13    NFINGEWVESESGKFIKNINPANGEVLGEVAASTKADVDRAVQAAKRAQKEWRLVP--AP  70

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ER     D   K A +L   E  +   +++ +   K   +A  EV          +G+  
Sbjct  71    ER----ADYIYKVAGLLK--ERKEELAQVLTKEMGKVIAEARGEVQEAIDMAFYMAGEGR  124

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +  VP     + +   R P G   ++TP+NFP+ I   + + AL  GN  V K  
Sbjct  125   RMFGDT--VPSELRNKFAMSVRVPVGIAGLITPWNFPIAIASWKSLPALVTGNAVVWKPA  182

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVAEKL  1081
             S+   +  + +++    GLP   V+ ++  G  +   ++E  P + +  FTGS+ V +++
Sbjct  183   SETPFLAGEFVKIYEAAGLPKGLVNLVHGSGSEVGNAIVE-HPDIDIVSFTGSNEVGKQI  241

Query  1082  ---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
                AG+L  R  LE  G +   +  D D    VD I W     A+  SGQ+C+A S + +
Sbjct  242   NGRAGELLKRTSLEMGGKNAVTVLEDADLDLAVDGIVW----SAFGTSGQRCTACSRIIV  297

Query  1244  HENWSKSPLINL---MSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFG  1411
             HE+  +     L   M +L     LD+ + VGPV+  ++   +    ++ +  G+KLL G
Sbjct  298   HESVKEELEEKLLKRMETLKLGDGLDESVDVGPVINQSSLKKIHEYVRIGKEEGAKLLKG  357

Query  1412  GEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVL  1591
             GE +  + +    G      +F  ++  ++     +   E+FGP   +   K  +  + +
Sbjct  358   GEIVTENELGR--GNFYAPTLFTDVKSDMR-----IAQEEIFGPVTCIIPVKSLEEAIEV  410

Query  1592  NALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPRGA  1771
             N    ++  L++++ + D     + + +   G  Y  I A TTGA + H   P G  +G 
Sbjct  411   N--NSVEFGLSSSIFTGDINRAFQAMRDLDTGIVY--INAGTTGA-EIHL--PFGGTKGT  463

Query  1772  GIG  1780
             G G
Sbjct  464   GNG  466



>gb|KDE57201.1| aldehyde dehydrogenase [Halostagnicola sp. A56]
Length=483

 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 209/470 (44%), Gaps = 42/470 (9%)
 Frame = +2

Query  359   PAEVHNLVQGNWIRSSSWNT--ILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH-  529
             P    N V G WI S S ++  +L+P N +  I   E Q +       ++          
Sbjct  2     PTAHRNYVDGEWIESRSGDSFEVLNPANSDEVI--GEFQSSTAADAEAAVEAAVAAEDEW  59

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
             +    PER  +L + +T       L E  D  T  + R   K+  +A  EV   Q+ ++ 
Sbjct  60    SSTPGPERGAILQEAATI------LEEQHDELTETLTREEGKTRSEASGEV---QRAIDI  110

Query  710   FS--GDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMG  883
             F     +   L  +   P +   ++ +    P G VA++TP+N+P+ IP  +L  AL  G
Sbjct  111   FYYYAQKASDLGGTVKSP-SGTDKELYTKHEPLGTVALITPWNYPIAIPAWKLAPALAAG  169

Query  884   NKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLL--EGKPRMTLFTG  1057
             N  VLK  S   +V   ++  L + GLP    +++   G  +  +L   EG   ++ FTG
Sbjct  170   NTAVLKPASAAPLVSWTLIEALDEAGLPDGVANYVTGSGSEVGGVLTDHEGVDAVS-FTG  228

Query  1058  S----SRVAEKLAGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSA  1225
             S    + VA+  A DLK R++ E  G +  ++ P  D VD    +    A+  +GQ C+A
Sbjct  229   STAVGTHVAQAAADDLK-RVQCEMGGKNPTVVMPSAD-VDEAVDIVGVGAFGTTGQSCTA  286

Query  1226  QSILFMHENWSKS---PLINLMSSLAARRKLDDLTVGPVLTFTT-KAMLDHMNKLLQIPG  1393
              S   +HE+        +++   +L     +DD  +GP +T +  +  L++++ + +  G
Sbjct  287   TSRAIVHEDVYDEFVDAIVDYAETLEVGPGIDDPDMGPHVTESELEGSLEYID-VAESEG  345

Query  1394  SKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDN  1573
             +KL+ GGE L        Y  + PT VF  +E  ++     +   EVFGP   V   K +
Sbjct  346   AKLVAGGEALTEGEYADGY-YVEPT-VFADVENDMR-----IAQEEVFGPVLAV--LKVS  396

Query  1574  QLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTG  1723
                  L     +D  L+A++V+ D         N  +G   A +  +TTG
Sbjct  397   SFEEGLAVANDIDYGLSASIVTQDLSEANRFAENVQSGV--AKVNEKTTG  444



>ref|WP_021095278.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus sp. SK3-4]
 gb|EPZ38051.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus sp. SK3-4]
Length=491

 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 123/488 (25%), Positives = 219/488 (45%), Gaps = 47/488 (10%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESF--IKVAEVQDAELQPFLESMRKCPKHGLHN  532
             +V N + G W+ S S  +  I++P NGE    + ++  QD E Q  L + R      L  
Sbjct  2     KVLNYIDGRWVSSVSNQFVPIVNPANGECIGEVTISNEQDVE-QAVLAAKRAQKAWAL--  58

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
                AP+R  +L  +       + L E  +   RL+     K  ++A  EV          
Sbjct  59    -VPAPKRAEVLYKVG------MLLQERKEQMARLLTMEMGKVIEEARGEVQEGIDMAFYM  111

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +G+  R    +   P     + +   R P G V ++TP+NFP+ I   +   A+  GN  
Sbjct  112   AGEGRRLFGDT--TPSELPNKFAMSVRAPIGVVGLITPWNFPIAIATWKAFPAIVTGNAV  169

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRV  1069
             V K   +  I+ +Q+ ++  + GLP    + ++  G  + + L+E +  ++  FTGS+ V
Sbjct  170   VWKPALETPIMAQQLAQIFEEAGLPNGVFNVVHGRGSVVGEALVEHRDVKVISFTGSNEV  229

Query  1070  AEKLAGDLKGR----IKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQ  1228
               ++A ++ GR    + LE  G +  I+  D D    V+ I W     A+  SGQ+C+A 
Sbjct  230   GRRIA-EMCGRHLKKVSLEMGGKNAIIVMDDADVALAVEAIIW----SAFGTSGQRCTAC  284

Query  1229  SILFMHENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGS  1396
             S + +HE+  K     L+  +S+L     L++ + VGPV+       + H  ++ +  G+
Sbjct  285   SRVIVHEHVKKQVEERLLAAISTLTVGNGLEEGVKVGPVINQDALQKIHHYVQIGKNEGA  344

Query  1397  KLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQ  1576
              LL GG  L++   P   G      +F  +  +++     +   E+FGP   +   +  +
Sbjct  345   TLLAGGYMLQDE--PYKGGFYYAPTLFTNVTPMMR-----IAREEIFGPVTSIISVRSLE  397

Query  1577  LPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAG  1756
               + +N    +D  L++A+ + D       + +   G  Y  + A TTGA + H   P G
Sbjct  398   EAIEVN--NSVDYGLSSAIFTRDIHRAFTAMRDFDTGIVY--VNAGTTGA-EIHL--PFG  450

Query  1757  DPRGAGIG  1780
               +G G G
Sbjct  451   GTKGTGNG  458



>ref|WP_019381264.1| aldehyde dehydrogenase [Bacillus oceanisediminis]
Length=493

 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 118/493 (24%), Positives = 215/493 (44%), Gaps = 57/493 (12%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSSWNT--ILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             +V N + G W  SS+     +L+P  GE   +V +    ++   + + +   K     P 
Sbjct  3     KVLNFINGEWCDSSTGKVAPVLNPATGEVLAEVTQSAKEDVDRAVAAAKTAQKSWRLVP-  61

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              APER  +L  ++        L E  +   +++     K   +   EV          +G
Sbjct  62    -APERAEILYHVA------FLLKERKEALAQILTSEMGKVIDEGRGEVQEAIDMAYYMAG  114

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +  VP     + +   R P G   ++TP+NFP+ I   + + AL  GN  V 
Sbjct  115   EGRRMFGDT--VPSELRNKFAMSVRVPVGVAGLITPWNFPIAIASWKSLPALVTGNALVW  172

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVA  1072
             K  ++  I+  + +++  + GLP   ++ ++  G  +   ++E  P + L  FTGS+ V 
Sbjct  173   KPATETPILAAEFVKIYEEAGLPKGLINLVHGSGSVVGNAMVE-HPDIDLISFTGSNEVG  231

Query  1073  EKL---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSI  1234
               +   AG L  R  LE  G +   +  D D    V+ I W     A+  SGQ+C+A S 
Sbjct  232   RDINGKAGALLKRTSLEMGGKNAITVLEDADLDLAVEGILW----GAFGTSGQRCTATSR  287

Query  1235  LFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKL  1402
             + +H +     +  L++ +  L     LD+ + VGPV+  ++   +D   K+ Q  G+KL
Sbjct  288   VLVHNDVKEKLEGKLLDRIGELKLGNGLDETVKVGPVINRSSLERIDEYVKIGQEEGAKL  347

Query  1403  LFGGEPLE-------NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             L GG+  +       N+ +P+I+  + P              N  +   E+FGP   +  
Sbjct  348   LAGGKIADDEDLKEGNYYLPTIFTDVMP--------------NMRIAMEEIFGPVVSIIP  393

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
              +  +  + +N +  ++  L++A+ + +     E + +   G  Y  + A TTGA + H 
Sbjct  394   IQSMEEAIEINNM--VEFGLSSAIYTQNVNQAFEAMRDLDTGIVY--VNAGTTGA-EIHL  448

Query  1742  FGPAGDPRGAGIG  1780
               P G  +G G G
Sbjct  449   --PFGGTKGTGNG  459



>ref|WP_027417390.1| aldehyde dehydrogenase [Aneurinibacillus terranovensis]
Length=493

 Score =   110 bits (274),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 118/485 (24%), Positives = 220/485 (45%), Gaps = 47/485 (10%)
 Frame = +2

Query  374   NLVQGNWIRSSSWNTI--LDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W+ SSS   I   +P NG+   +V +    ++   +++ +   K     P  AP
Sbjct  6     NFINGEWMESSSGRFIPVTNPANGDVLGEVTQSTKEDVDRAVQAAKTAQKSWRLVP--AP  63

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ER     +I  K AH+L   E  +  ++++     K   +A  EV          +G+  
Sbjct  64    ER----AEILYKVAHLLK--ERKEELSQILTSEMGKVIAEARGEVQEAIDMAYYMAGEGR  117

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +  VP     + +   R P G   ++TP+NFP+ I   + + AL  GN  + K  
Sbjct  118   RLFGDT--VPSELRNKFAMSIRVPIGIAGLITPWNFPIAIASWKSLPALVAGNAVIWKPA  175

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAEKL-  1081
             S+   + ++ +R+  + GLP   ++ +N  G  +   +++     +  FTGS+ V +++ 
Sbjct  176   SETPAIAQEFVRIYEEAGLPKGLINLVNGSGSIVGNAMVDHLDIDLISFTGSNEVGKQIN  235

Query  1082  --AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
               AG +  R  LE  G +   +  D +    VD I W     A+  SGQ+C+A S + +H
Sbjct  236   ERAGVMLKRTSLEMGGKNAVTVLEDANLDLAVDGILW----GAFGTSGQRCTATSRVIVH  291

Query  1247  ENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---PGSKLL  1405
             E+  +     L+  +  L     LD+ + VGPV+    ++ L+ +N+ ++I    G+KLL
Sbjct  292   ESVKEELERKLMERIGELKLGNGLDESVKVGPVI---NRSSLERINEYVKIGVNEGAKLL  348

Query  1406  FGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPL  1585
              GG  +  +++    G      +F  ++  ++     +   E+FGP   +   K  +  +
Sbjct  349   TGGNIVTENNLDK--GNFYAPTIFTDVKADMR-----IAKEEIFGPVVSIIPVKSLEEAI  401

Query  1586  VLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPR  1765
              +N    ++  L++A+ + D     + + +   G  Y  + A TTGA + H   P G  +
Sbjct  402   EVN--NSVEFGLSSAIFTADVNRAFQAMRDLDTGIVY--VNAGTTGA-EIHL--PFGGTK  454

Query  1766  GAGIG  1780
             G G G
Sbjct  455   GTGNG  459



>ref|WP_012574867.1| aldehyde dehydrogenase [Anoxybacillus flavithermus]
 ref|YP_002315601.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus flavithermus 
WK1]
 gb|ACJ33616.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus flavithermus 
WK1]
Length=491

 Score =   109 bits (273),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 122/494 (25%), Positives = 217/494 (44%), Gaps = 59/494 (12%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESF--IKVAEVQDAELQPFLESMRKCPKHGLHN  532
             +V N + G W+ S S  +  I++P NGE    + ++  QD E Q  L + R      L  
Sbjct  2     KVLNYIDGRWVSSVSNQFVPIVNPANGECIGEVTISNEQDVE-QAVLAAKRAQKAWAL--  58

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
                AP+R  +L  +       + L E  +   RL+     K  ++A  EV          
Sbjct  59    -VPAPKRAEVLYKVG------MLLQERKEQMARLLTMEMGKVIEEARGEVQEGIDMAFYM  111

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +G+  R    +   P     + +   R P G V ++TP+NFP+ I   +   A+  GN  
Sbjct  112   AGEGRRLFGDT--TPSELPNKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNAV  169

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRV  1069
             V K   +  I+ +Q+ ++  + GLP    + ++  G  + + L+E +  ++  FTGS+ V
Sbjct  170   VWKPALETPIMAQQLAQIFEEAGLPNGVFNVVHGRGSVVGEALVEHRDVKVISFTGSNEV  229

Query  1070  AEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQS  1231
               ++A   G    ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S
Sbjct  230   GRRIAETCGRHLKKVSLEMGGKNAIIVMDDADVALAVEAIIW----SAFGTSGQRCTACS  285

Query  1232  ILFMHENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
              + +HE+  K     L+  +S+L     L++ + VGPV+       + H  ++ +  G+ 
Sbjct  286   RVIVHEHVKKQVEERLLAAISTLTVGNGLEEGIKVGPVINQDALQKIHHYVQIGRNEGAT  345

Query  1400  LLFGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             LL GG  L++       +  P+++  + PT                +   E+FGP   + 
Sbjct  346   LLAGGYMLQDEPYKGGFYYAPTLFTNVTPT--------------MRIAREEIFGPVTSII  391

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
               +  +  + +N    +D  L++A+ + D       + +   G  Y  + A TTGA + H
Sbjct  392   SVRSLEEAIEVN--NSVDYGLSSAIFTRDIHRAFTAMRDFDTGIVY--VNAGTTGA-EIH  446

Query  1739  WFGPAGDPRGAGIG  1780
                P G  +G G G
Sbjct  447   L--PFGGTKGTGNG  458



>ref|WP_019417797.1| aldehyde dehydrogenase [Anoxybacillus kamchatkensis]
Length=491

 Score =   109 bits (273),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 122/494 (25%), Positives = 217/494 (44%), Gaps = 59/494 (12%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESF--IKVAEVQDAELQPFLESMRKCPKHGLHN  532
             +V N + G W+ S S  +  I++P NGE    + ++  QD E Q  L + R      L  
Sbjct  2     KVLNYIDGRWVSSVSNQFVPIVNPANGECIGEVTISNEQDVE-QAVLAAKRAQKAWAL--  58

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
                AP+R  +L  +       + L E  +   RL+     K  ++A  EV          
Sbjct  59    -VPAPKRAEVLYKVG------MLLQERKEQMARLLTMEMGKVIEEARGEVQEGIDMAFYM  111

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +G+  R    +   P     + +   R P G V ++TP+NFP+ I   +   A+  GN  
Sbjct  112   AGEGRRLFGDT--TPSELPNKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNAV  169

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRV  1069
             V K   +  I+ +Q+ ++  + GLP    + ++  G  + + L+E +  ++  FTGS+ V
Sbjct  170   VWKPALETPIMAQQLAQIFEEAGLPNGVFNVVHGRGSVVGEALVEHRDVKVISFTGSNEV  229

Query  1070  AEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQS  1231
               ++A   G    ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S
Sbjct  230   GRRIAETCGRHLKKVSLEMGGKNAIIVMDDADVALAVEAIIW----SAFGTSGQRCTACS  285

Query  1232  ILFMHENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSK  1399
              + +HE+  K     L+  +S+L     L++ + VGPV+       + H  ++ +  G+ 
Sbjct  286   RIIVHEHVKKQVEERLLAAISTLTVGNGLEEGVKVGPVINQDALQKIHHYVQIGRNEGAT  345

Query  1400  LLFGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVT  1558
             LL GG  L++       +  P+++  + PT                +   E+FGP   + 
Sbjct  346   LLAGGYMLQDEPYKGGFYYAPTLFTNVTPT--------------MRIAREEIFGPVTSII  391

Query  1559  EYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNH  1738
               +  +  + +N    +D  L++A+ + D       + +   G  Y  + A TTGA + H
Sbjct  392   SVRSLEEAIEVN--NSVDYGLSSAIFTRDIHRAFTAMRDFDTGIVY--VNAGTTGA-EIH  446

Query  1739  WFGPAGDPRGAGIG  1780
                P G  +G G G
Sbjct  447   L--PFGGTKGTGNG  458



>ref|WP_027445523.1| aldehyde dehydrogenase [Pontibacillus marinus]
 gb|KGX90808.1| aldehyde dehydrogenase [Pontibacillus marinus BH030004 = DSM 
16465]
Length=500

 Score =   109 bits (273),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 121/490 (25%), Positives = 223/490 (46%), Gaps = 51/490 (10%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W+ SSS  + ++ +P   ES ++V    + E+   ++  ++  K     P 
Sbjct  10    KLKNYMDGEWVDSSSGQYASVTNPATLESLVQVPLSSEGEVDQAVQIAKRAQKSWALVP-  68

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R  +L  +       L + E  +  ++++   + K  ++A  EV          +G
Sbjct  69    -APQRAEVLHRVG------LLMKERKEDLSQILTMENGKVIEEARGEVQEGIDMAFYMAG  121

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  + 
Sbjct  122   EGRRLFGQT--TPSELKDKFAMSVRSPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVIW  179

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRVAE  1075
             K  ++  ++  ++ ++  + GLP   ++ +   G T+   ++E    R+  FTGS+ V  
Sbjct  180   KPATETPLMAYELTKIFEEAGLPKGVLNLVFGSGSTVGDAMVEHDDIRVISFTGSNDVGR  239

Query  1076  KLAGDLKGRIK---LEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSIL  1237
              +AG    ++K   LE  G +   +  D D    V+ I W     A+  SGQ+C+A S +
Sbjct  240   NVAGKCGQKLKKVSLEMGGKNAITVMDDADLSLAVEGILW----SAFGTSGQRCTACSRV  295

Query  1238  FMHENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---PGS  1396
              +HE+  +     L+N M+ L+    LD+ + VGP++    KA L+ + K ++I    G+
Sbjct  296   IVHEDIKEKLEEQLLNEMAKLSIGNGLDESVKVGPII---NKAGLEKIEKYMEIGKSEGA  352

Query  1397  KLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDL--VTTEVFGPFQIVTEYKD  1570
             KLL GG  L +    S Y        F P   +  D   D+     E+FGP   +   K 
Sbjct  353   KLLAGGYVLNDDKHASGY-------YFAPT--LFTDATPDMRIAQEEIFGPVVSLIPVKS  403

Query  1571  NQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGP  1750
              +  + +N    ++  L++++ + D   +     +   G  Y  + A TTGA + H   P
Sbjct  404   FEEAIEVN--NGVEYGLSSSIFTKDVNKVFAAQRDLDTGIVY--VNAGTTGA-EIHL--P  456

Query  1751  AGDPRGAGIG  1780
              G  +G G G
Sbjct  457   FGGTKGTGNG  466



>ref|WP_033072266.1| transcriptional regulator [Pectobacterium wasabiae]
Length=1322

 Score =   111 bits (278),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 163/370 (44%), Gaps = 46/370 (12%)
 Frame = +2

Query  641   RVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIV  820
             R + KS+  A+AEV     FL  ++G QVR          +     +H    P GPV  +
Sbjct  731   REAGKSFSNAIAEVREAVDFLRYYAG-QVR----------DTFTNDTH---RPLGPVVCI  776

Query  821   TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDG  1000
             +P+NFPL I   Q+  AL  GN  + K   +  ++  Q +R+LH+ G+PL  +  L   G
Sbjct  777   SPWNFPLAIFTGQISAALAAGNSVLAKPAEQTPLIAAQAVRILHEAGIPLGVLQLLPGQG  836

Query  1001  KTMNKLLL-EGKPRMTLFTGSSRVAEKLAGDLKGRIK---------LEDAGFDWKILGPD  1150
             +T+   L+ + + R  +FTGS+ VA+ L   + GR+           E  G +  I    
Sbjct  837   ETIGASLVNDERVRGVVFTGSTAVAKTLQRSIAGRLDPQGRLTPLIAETGGLNAMI----  892

Query  1151  VDEVDYIAWVCDQ---DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLD---  1312
             VD       V +     A+  +GQ+CSA  +L + E+ +   L  L  ++A  R  D   
Sbjct  893   VDSSALTEQVVNDVIASAFDSAGQRCSALRLLCLQEDIADRTLAMLRGAMAECRMGDPER  952

Query  1313  -DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA-IRPTAVFVPL  1486
                 +GP++    K  +D   + ++  G  +     P +  +   ++G  ++PT      
Sbjct  953   LSTDIGPLIDAEAKENVDQHIQTMRAKGHTVFQAAHPQDEETW--LHGTFVKPT------  1004

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               +++  N D +  EVFGP   V  Y+  QL  V+  +      LT  V +     +Q V
Sbjct  1005  --LIELGNIDELKKEVFGPVLHVIRYQSQQLDTVIEQINAAGYGLTLGVHTRIDETIQRV  1062

Query  1667  IGNSVNGTTY  1696
                +  G  Y
Sbjct  1063  TNRAKVGNQY  1072



>ref|WP_035199972.1| transcriptional regulator [Agrobacterium tumefaciens]
Length=1228

 Score =   111 bits (277),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 162/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  +    +                 P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARKTFKAN---------------ETPLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  757   GDGKTGAALVGSALTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDSL  875

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H++ +  +        G  +E  S+    G       FVP  
Sbjct  876   SVDVGPVITAEAKGIIEKHVDSMRAL--------GHRIEQISLAGETG----KGTFVP-P  922

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  923   TIIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  982

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  983   SRVAAGNLY  991



>ref|WP_032488791.1| proline dehydrogenase [Agrobacterium tumefaciens]
 ref|YP_009074728.1| proline dehydrogenase [Agrobacterium tumefaciens]
 gb|AAC43980.1| proline dehydrogenase [Agrobacterium tumefaciens]
 prf||2209368C Pro Dehydrogenase
Length=1228

 Score =   111 bits (277),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 162/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  +    +                 P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARKTFKAN---------------ETPLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  757   GDGKTGAALVGSALTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDSL  875

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H++ +  +        G  +E  S+    G       FVP  
Sbjct  876   SVDVGPVITAEAKGIIEKHVDSMRAL--------GHRIEQISLAGETG----KGTFVP-P  922

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  923   TIIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  982

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  983   SRVAAGNLY  991



>ref|WP_004432057.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens]
 gb|EHJ96068.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens 5A]
 gb|AHK03953.1| proline dehydrogenase [Agrobacterium tumefaciens LBA4213 (Ach5)]
Length=1228

 Score =   111 bits (277),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 162/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  +    +                 P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARKTFKAN---------------ETPLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  757   GDGKTGAALVGSALTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDSL  875

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H++ +  +        G  +E  S+    G       FVP  
Sbjct  876   SVDVGPVITAEAKGIIEKHVDSMRAL--------GHRIEQISLAGETG----KGTFVP-P  922

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  923   TIIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  982

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  983   SRVAAGNLY  991



>gb|EGP55704.1| proline dehydrogenase [Agrobacterium tumefaciens F2]
Length=1213

 Score =   111 bits (277),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 103/368 (28%), Positives = 160/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  637   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKSG---------------ETPLGPV  681

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  682   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  741

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  742   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  801

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  802   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDRL  860

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  S+    G       FVP   
Sbjct  861   SVDVGPVITAEAKGIIEK-----HIDGMRTL--GHRIEQISLAGETG----KGTFVP-PT  908

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  909   IIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDDINATGYGLTFGLHTRLDDTIQHVLS  968

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  969   RVAAGNLY  976



>ref|WP_006313920.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium sp. ATCC 31749]
 gb|EGL64039.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium sp. ATCC 31749]
Length=1228

 Score =   111 bits (277),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 103/368 (28%), Positives = 163/368 (44%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R          N    ++     P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARR----------NFTAGET-----PLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVAAALVAGNTVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIK---------LEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR +          E  G +  I+ 
Sbjct  757   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRAQANGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDQL  875

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  ++    G       FVP   
Sbjct  876   SVDVGPVITAEAKGIIEK-----HIDGMRSL--GHRIEQIALAGETG----KGTFVP-PT  923

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  924   IIEMKSLADLKREVFGPVLHVIRFKRDHLDRLIDEINATGYGLTFGLHTRLDDTIQHVLS  983

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  984   RVAAGNLY  991



>ref|WP_035509759.1| MULTISPECIES: aldehyde dehydrogenase [Halobacillus]
Length=495

 Score =   109 bits (272),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 120/500 (24%), Positives = 223/500 (45%), Gaps = 65/500 (13%)
 Frame = +2

Query  356   QPAEVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             Q  ++ N + GNW+  S+     +++P   ES ++V      +++   ++ +   K    
Sbjct  2     QEEQLKNFINGNWVEPSTGKLTAVINPATSESLVQVPLSASEDVRAATKAAKSAQKKWAL  61

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
              P  AP+R  +L  +       L + E  +  ++L+   + K  ++A  EV         
Sbjct  62    VP--APQRAEVLYRVG------LIMKERKERLSQLLTMENGKVIEEARGEVQEGIDMAFY  113

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
              +G+  R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN 
Sbjct  114   MAGEGRRLFGQT--TPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPAIVAGNA  171

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSR  1066
              V K  ++  I+  ++ ++  + GLP   ++ +   G T+   ++E K  R+  FTGS+ 
Sbjct  172   VVWKPATETPIMANELAKIFEEAGLPEGVMNVVFGSGSTVGDAMVEQKDIRVISFTGSNE  231

Query  1067  VAEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQ  1228
             V   +A   G    ++ LE  G +  I+  D D    V+ I W     AY  SGQ+C+A 
Sbjct  232   VGRGIASKCGQHLKKVSLEMGGKNGVIVMDDADLSLAVEGILW----SAYGTSGQRCTAC  287

Query  1229  SILFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---  1387
             S + +HE+     +  L   ++ L+    LD+ + VGP++    ++ L+ +   + I   
Sbjct  288   SRVMVHESVKDELEERLQKEIAKLSIGNGLDESIKVGPII---NRSGLEKVKSYISIGKE  344

Query  1388  PGSKLLFGGEPLE-------NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
              G+KLL GG  LE       N+  P+++  ++P                 +   E+FGP 
Sbjct  345   EGAKLLTGGYILENGDHKKGNYFAPTLFTDVKP--------------EMRIAQEEIFGPV  390

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSND--QLFLQEVIGNSVNGTTYAGIRARTT  1720
               +   K     + +N    ++  L++++ + D  Q+F  +   +   G  Y  + A TT
Sbjct  391   VSLIPVKSFDEAVEIN--NSVEFGLSSSIFTQDVNQVFAAQR--DLDTGIVY--VNAGTT  444

Query  1721  GAPQNHWFGPAGDPRGAGIG  1780
             GA + H   P G  +G G G
Sbjct  445   GA-EIHL--PFGGTKGTGNG  461



>ref|WP_019122292.1| aldehyde dehydrogenase [Brevibacillus massiliensis]
Length=493

 Score =   109 bits (272),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 120/490 (24%), Positives = 213/490 (43%), Gaps = 57/490 (12%)
 Frame = +2

Query  374   NLVQGNWIRSSSWNTI--LDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G WI S+S   +   +P  GE   +V +    ++   +++ R+  K     P  AP
Sbjct  6     NYINGEWIASASGKFLPNTNPATGEVLAEVTQSTAEDVDRAVQAARQAQKAWRLVP--AP  63

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             ER  +L  +       L L E  +   +++     K  ++A  EV          +G+  
Sbjct  64    ERAEVLYKVG------LLLKERKEQLAQILTSEMGKVIEEAKGEVQEAIDMAFYMAGEGR  117

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +  VP     + +   R P G   ++TP+NFP+ I   + + AL  GN  V K  
Sbjct  118   RLFGDT--VPSELRDKFAMSVRVPVGIAGLITPWNFPIAIISWKSLPALVAGNAIVWKPA  175

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FTGSSRVAEKL  1081
             S+  ++  + +++  + GLP   ++ +   G  +   +++  P++ L  FTGS+ V  ++
Sbjct  176   SETPMIAAEFVKIYEEAGLPKGLINLVYGSGSVVGNAMVD-HPQIDLISFTGSNEVGREI  234

Query  1082  ---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
                AG +  R  LE  G +   +  D D    VD I W     AY  SGQ+C+A S + +
Sbjct  235   NARAGGMLKRTSLEMGGKNAVTVLDDADIDLAVDGIIW----SAYGTSGQRCTACSRIIV  290

Query  1244  HENWS---KSPLINLMSSLAARRKLD-DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFG  1411
             HE      +S L+  ++ L     LD  + VGPV+   +   +D   K+    G+KLL G
Sbjct  291   HEAVKEELESKLLERIAKLRLGNGLDPSVDVGPVINRASLEKIDQYVKIGVEEGAKLLCG  350

Query  1412  GEPLE-------NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKD  1570
             GE          N  +P+++  ++P              +  +   E+FGP   +   K 
Sbjct  351   GEIATEGELVKGNFYMPTLFTDVKP--------------DMRIAREEIFGPVASIIPVKS  396

Query  1571  NQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGP  1750
              +  + +N    ++  L++++ + D       + +   G  Y  + A TTGA + H   P
Sbjct  397   IEEAIEVN--NSVEFGLSSSIFTQDINRAFRAMRDLDTGIVY--VNAGTTGA-EIHL--P  449

Query  1751  AGDPRGAGIG  1780
              G  +G G G
Sbjct  450   FGGTKGTGNG  459



>ref|WP_019566503.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium sp. 10MFCol1.1]
Length=1228

 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 162/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  +    +                 P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARKTFKAN---------------ETPLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  757   GDGKTGAALVGSALTAGVMFTGSTEVARLIQGQLAGRVLSNGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDSL  875

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H++ +  +        G  +E  S+    G       FVP  
Sbjct  876   SVDVGPVITAEAKGIIEKHVDSMRAL--------GHRIEQISLAGETG----KGTFVP-P  922

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  923   TIIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  982

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  983   SRVAAGNLY  991



>gb|KAJ33291.1| transcriptional regulator, partial [Agrobacterium tumefaciens]
Length=1197

 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 103/370 (28%), Positives = 166/370 (45%), Gaps = 45/370 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR-FLARSFGVPGNHLGQQSHGFRWPYGP  808
             L+ R + KS   A+AEV     FL  ++ +  R F A          G++      P GP
Sbjct  648   LVMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFTA----------GEK------PLGP  691

Query  809   VAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFL  988
             V  ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L
Sbjct  692   VVCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLL  751

Query  989   NSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKIL  1141
               DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+
Sbjct  752   PGDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIV  811

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDD  1315
                      +A V    A+  +GQ+CSA  IL + E+ +   LI L  +L   R  + D 
Sbjct  812   DSSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLIMLKGALHELRIGRTDR  870

Query  1316  LT--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPL  1486
             L+  VGPV+T   K +++ H+  +  +        G  +E  ++    G       FVP 
Sbjct  871   LSVDVGPVITAEAKGIIEKHIEDMRSL--------GHRIEQITLAGETG----KGTFVP-  917

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V
Sbjct  918   PTIIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHV  977

Query  1667  IGNSVNGTTY  1696
             +     G  Y
Sbjct  978   LSRVAAGNLY  987



>ref|WP_035210701.1| transcriptional regulator [Agrobacterium tumefaciens]
Length=1220

 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 103/370 (28%), Positives = 166/370 (45%), Gaps = 45/370 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR-FLARSFGVPGNHLGQQSHGFRWPYGP  808
             L+ R + KS   A+AEV     FL  ++ +  R F A          G++      P GP
Sbjct  648   LVMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFTA----------GEK------PLGP  691

Query  809   VAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFL  988
             V  ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L
Sbjct  692   VVCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLL  751

Query  989   NSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKIL  1141
               DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+
Sbjct  752   PGDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIV  811

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDD  1315
                      +A V    A+  +GQ+CSA  IL + E+ +   LI L  +L   R  + D 
Sbjct  812   DSSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLIMLKGALHELRIGRTDR  870

Query  1316  LT--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPL  1486
             L+  VGPV+T   K +++ H+  +  +        G  +E  ++    G       FVP 
Sbjct  871   LSVDVGPVITAEAKGIIEKHIEDMRSL--------GHRIEQITLAGETG----KGTFVP-  917

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V
Sbjct  918   PTIIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHV  977

Query  1667  IGNSVNGTTY  1696
             +     G  Y
Sbjct  978   LSRVAAGNLY  987



>ref|WP_035243018.1| transcriptional regulator [Agrobacterium tumefaciens]
Length=1224

 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 103/368 (28%), Positives = 160/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  648   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKSG---------------ETPLGPV  692

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  693   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  752

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  753   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  812

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  813   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDRL  871

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  S+    G       FVP   
Sbjct  872   SVDVGPVITAEAKGIIEK-----HIDGMRTL--GHRIEQISLAGETG----KGTFVP-PT  919

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  920   IIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDDINATGYGLTFGLHTRLDDTIQHVLS  979

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  980   RVAAGNLY  987



>ref|WP_013762129.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium sp. H13-3]
 ref|YP_004444342.1| proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Agrobacterium 
sp. H13-3]
 gb|ADY67251.1| proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Agrobacterium 
sp. H13-3]
Length=1228

 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 161/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  +                      P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARKTF---------------KADETPLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  757   GDGKTGAALVGSALTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDSL  875

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H++ +  +        G  +E  S+    G       FVP  
Sbjct  876   SVDVGPVITAEAKGIIEKHVDSMRAL--------GHRIEQISLAGETG----KGTFVP-P  922

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  923   TIIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  982

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  983   SRVAAGNLY  991



>emb|CDQ29555.1| Aldehyde dehydrogenase, thermostable [Halobacillus trueperi]
 emb|CDQ17790.1| Aldehyde dehydrogenase, thermostable [Halobacillus dabanensis]
 emb|CDQ24196.1| Aldehyde dehydrogenase, thermostable [Halobacillus karajensis]
Length=498

 Score =   108 bits (271),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 120/500 (24%), Positives = 223/500 (45%), Gaps = 65/500 (13%)
 Frame = +2

Query  356   QPAEVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLH  529
             Q  ++ N + GNW+  S+     +++P   ES ++V      +++   ++ +   K    
Sbjct  5     QEEQLKNFINGNWVEPSTGKLTAVINPATSESLVQVPLSASEDVRAATKAAKSAQKKWAL  64

Query  530   NPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLEN  709
              P  AP+R  +L  +       L + E  +  ++L+   + K  ++A  EV         
Sbjct  65    VP--APQRAEVLYRVG------LIMKERKERLSQLLTMENGKVIEEARGEVQEGIDMAFY  116

Query  710   FSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNK  889
              +G+  R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN 
Sbjct  117   MAGEGRRLFGQT--TPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPAIVAGNA  174

Query  890   PVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSR  1066
              V K  ++  I+  ++ ++  + GLP   ++ +   G T+   ++E K  R+  FTGS+ 
Sbjct  175   VVWKPATETPIMANELAKIFEEAGLPEGVMNVVFGSGSTVGDAMVEQKDIRVISFTGSNE  234

Query  1067  VAEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQ  1228
             V   +A   G    ++ LE  G +  I+  D D    V+ I W     AY  SGQ+C+A 
Sbjct  235   VGRGIASKCGQHLKKVSLEMGGKNGVIVMDDADLSLAVEGILW----SAYGTSGQRCTAC  290

Query  1229  SILFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---  1387
             S + +HE+     +  L   ++ L+    LD+ + VGP++    ++ L+ +   + I   
Sbjct  291   SRVMVHESVKDELEERLQKEIAKLSIGNGLDESIKVGPII---NRSGLEKVKSYISIGKE  347

Query  1388  PGSKLLFGGEPLE-------NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPF  1546
              G+KLL GG  LE       N+  P+++  ++P                 +   E+FGP 
Sbjct  348   EGAKLLTGGYILENGDHKKGNYFAPTLFTDVKP--------------EMRIAQEEIFGPV  393

Query  1547  QIVTEYKDNQLPLVLNALERMDANLTAAVVSND--QLFLQEVIGNSVNGTTYAGIRARTT  1720
               +   K     + +N    ++  L++++ + D  Q+F  +   +   G  Y  + A TT
Sbjct  394   VSLIPVKSFDEAVEIN--NSVEFGLSSSIFTQDVNQVFAAQR--DLDTGIVY--VNAGTT  447

Query  1721  GAPQNHWFGPAGDPRGAGIG  1780
             GA + H   P G  +G G G
Sbjct  448   GA-EIHL--PFGGTKGTGNG  464



>ref|WP_025919666.1| transcriptional regulator [Pectobacterium wasabiae]
Length=1322

 Score =   110 bits (275),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 162/370 (44%), Gaps = 46/370 (12%)
 Frame = +2

Query  641   RVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIV  820
             R + KS+  A+AEV     FL  ++G QVR          +     +H    P GPV  +
Sbjct  731   REAGKSFSNAIAEVREAVDFLRYYAG-QVR----------DTFTNDTH---RPLGPVVCI  776

Query  821   TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDG  1000
             +P+NFPL I   Q+  AL  GN  + K   +  ++  Q +R+LH+ G+PL  +  L   G
Sbjct  777   SPWNFPLAIFTGQISAALATGNSVLAKPAEQTPLIAAQAVRILHEAGIPLGVLQLLPGQG  836

Query  1001  KTMNKLLL-EGKPRMTLFTGSSRVAEKLAGDLKGRIK---------LEDAGFDWKILGPD  1150
             +T+   L+ + + R  +FTGS+ VA+ L   + GR+           E  G +  I    
Sbjct  837   ETIGSALVNDERVRGVVFTGSTAVAKTLQRSIAGRLDPQGRLTPLIAETGGLNAMI----  892

Query  1151  VDEVDYIAWVCDQ---DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLD---  1312
             VD       V +     A+  +GQ+CSA  +L + E+ +   L  L  ++A  R  D   
Sbjct  893   VDSSALTEQVVNDVIASAFDSAGQRCSALRLLCLQEDIADRTLAMLRGAMAECRMGDPER  952

Query  1313  -DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA-IRPTAVFVPL  1486
                 +GP++    K  +D   + ++  G  +     P +  +    +G  ++PT      
Sbjct  953   LSTDIGPLIDAEAKENVDQHIQTMRAKGHTVFQAAHPQDEETWR--HGTFVKPT------  1004

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               +++  N D +  EVFGP   V  Y+  QL  V+  +      LT  V +     +Q V
Sbjct  1005  --LIELGNIDELKKEVFGPVLHVIRYQSQQLDTVIEQINAAGYGLTLGVHTRIDETIQRV  1062

Query  1667  IGNSVNGTTY  1696
                +  G  Y
Sbjct  1063  TNRAKVGNQY  1072



>ref|WP_014642171.1| aldehyde dehydrogenase [Halobacillus halophilus]
 ref|YP_006179544.1| aldehyde dehydrogenase [Halobacillus halophilus DSM 2266]
 emb|CCG44267.1| aldehyde dehydrogenase [Halobacillus halophilus DSM 2266]
Length=500

 Score =   108 bits (270),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 117/491 (24%), Positives = 216/491 (44%), Gaps = 45/491 (9%)
 Frame = +2

Query  353   SQPAEVHNLVQGNWIR--SSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGL  526
             +Q  ++ N + G W+   + ++  + +P   E+ ++V      E+   +E+ +K  K   
Sbjct  6     NQEEKLQNFINGEWLEPGNGAYADVTNPATLETLVQVPLSGKEEVASAVEAAKKAQKDWA  65

Query  527   HNPFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLE  706
               P  AP+R  +L  +       L + E  ++ +R +   + K  ++A  EV        
Sbjct  66    LVP--APQRAEVLYRVG------LIMKERKEYLSRWLTMENGKVLEEARGEVQEGIDMAF  117

Query  707   NFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGN  886
               +G+  R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN
Sbjct  118   YMAGEGRRLFGQT--TPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPAIVAGN  175

Query  887   KPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLL-EGKPRMTLFTGSS  1063
               V K  S+  ++  ++ ++  + GLP   ++ +   G ++ + +L E   R+  FTGS+
Sbjct  176   AVVWKPASETPVMAFELAKIFEEAGLPKGVINVVFGSGSSVGEAMLEENDIRVISFTGSN  235

Query  1064  RVAEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSA  1225
              V   +A   G    ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A
Sbjct  236   EVGRGIASKCGQKLKKVSLEMGGKNAVIVMDDADLSLAVEGILW----SAFGTSGQRCTA  291

Query  1226  QSILFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPG  1393
              S + +HE+     +  L+  M+ L     LD+ + VGP++       +    ++    G
Sbjct  292   CSRVLVHESLKDQLEERLMYEMAKLTIGNGLDESIKVGPIINQKGLEKIKSYIRVGNAEG  351

Query  1394  SKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDL--VTTEVFGPFQIVTEYK  1567
             +KLL GG  LEN       G  +    F P   +  D   D+     E+FGP   +   K
Sbjct  352   AKLLAGGYVLEN-------GEHKKGHYFAPT--LFTDVKADMRIAQEEIFGPVVSLIPVK  402

Query  1568  DNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
               +  + +N    ++  L++++ + D   +     +   G  Y  + A TTGA  +    
Sbjct  403   SLEEAVEIN--NGVEFGLSSSIFTKDINKVFAAQRDLDTGIVY--VNAGTTGAEIHL---  455

Query  1748  PAGDPRGAGIG  1780
             P G  +G G G
Sbjct  456   PFGGTKGTGNG  466



>ref|WP_009361408.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus sp. DT3-1]
 gb|EMI11210.1| NAD-dependent aldehyde dehydrogenase [Anoxybacillus sp. DT3-1]
Length=491

 Score =   108 bits (269),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 125/497 (25%), Positives = 219/497 (44%), Gaps = 65/497 (13%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESF--IKVAEVQDAELQPFLESMRKCPKHGLHN  532
             +V N + G W+ S S  +  I++P NGE    + ++  QD E Q  L + R      L  
Sbjct  2     KVLNYIDGRWVSSVSNQFVPIVNPANGECIGEVTISNEQDVE-QAVLAAKRAQKAWAL--  58

Query  533   PFKAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENF  712
                AP+R  +L  +       + L E  +   RL+     K  ++A  EV          
Sbjct  59    -VPAPKRAEVLYKVG------MLLQERKEQMARLLTMEMGKVIEEARGEVQEGIDMAFYM  111

Query  713   SGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKP  892
             +G+  R    +   P     + +   R P G V ++TP+NFP+ I   +   A+  GN  
Sbjct  112   AGEGRRLFGDT--TPSELPNKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNAV  169

Query  893   VLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRV  1069
             V K   +  I+ +Q+ ++  + GLP    + ++  G  + + L+E +  ++  FTGS+ V
Sbjct  170   VWKPALETPIMAQQLAQIFEEAGLPNGVFNVVHGRGSVVGEALVEHRDVKVISFTGSNEV  229

Query  1070  AEKLA---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQS  1231
               ++A   G    ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S
Sbjct  230   GRRIAETGGRHLKKVSLEMGGKNAIIVMDDADVALAVEAIIW----SAFGTSGQRCTACS  285

Query  1232  ILFMHENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---P  1390
              + +HE+  K     L+  +S+L     L++ + VGPV+    +  L  ++  +QI    
Sbjct  286   RIIVHEHVKKQVEERLLAAISTLTVGNGLEEGIKVGPVI---NQDALQKIHDYVQIGRNE  342

Query  1391  GSKLLFGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQ  1549
             G+ LL GG  L++       +  P+++  + PT                +   E+FGP  
Sbjct  343   GATLLAGGYMLQDEPYKGGFYYAPTLFTNVTPT--------------MRIAREEIFGPVT  388

Query  1550  IVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAP  1729
              +   +  +  + +N    +D  L++A+ + D       I +   G  Y  + A TTGA 
Sbjct  389   SIISVRSLEEAIEVN--NSVDYGLSSAIFTRDIHRAFTAIRDFDTGIVY--VNAGTTGA-  443

Query  1730  QNHWFGPAGDPRGAGIG  1780
             + H   P G  +G G G
Sbjct  444   EIHL--PFGGTKGTGNG  458



>ref|WP_012749119.1| aldehyde dehydrogenase [Geobacillus sp. WCH70]
 ref|YP_002948571.1| aldehyde dehydrogenase [Geobacillus sp. WCH70]
 gb|ACS23305.1| Aldehyde Dehydrogenase [Geobacillus sp. WCH70]
Length=493

 Score =   108 bits (269),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 120/489 (25%), Positives = 215/489 (44%), Gaps = 55/489 (11%)
 Frame = +2

Query  374   NLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W  SSS  +  +++P  G++  +V    +A++   +++ +   K     P  AP
Sbjct  5     NFINGEWKESSSKQFAPVINPATGDAIGEVTVSIEADVDAAVKAAKAAQKKWALEP--AP  62

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             +R     ++  K  ++L   E  +   R++     K  ++A  EV          +G+  
Sbjct  63    KR----AEVLYKVGYLLK--ERKEQLARMLTMEMGKVIEEARGEVQEGIDMAFYMAGEGR  116

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R    +   P     + +   R P G V I+TP+NFP+ I   +   ++  GN  V K  
Sbjct  117   RLFGDT--TPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPSIVAGNAVVWKPA  174

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRVAEKLA  1084
              +   + +++ ++  + GLP    + +N DG T    L+E    R+  FTGS+ V  K+A
Sbjct  175   LETPFMAQELAKIFEEAGLPKGVFNVVNGDGPTTGNALVEHPDVRVISFTGSNEVGRKIA  234

Query  1085  ---GDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
                G    ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S +  H
Sbjct  235   EKCGRSLKKVSLEMGGKNAVIVMDDADLSLAVEGIVW----SAFGTSGQRCTACSRIIAH  290

Query  1247  ENWSK---SPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGG  1414
             EN  K   + L+  + +L     LD+ + VGPV+       +D   ++ +  G+KLL GG
Sbjct  291   ENIKKELENRLLEAIRTLTIGNGLDENVKVGPVINEKALQKIDQYVQIGKEEGAKLLTGG  350

Query  1415  EPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDN  1573
               L+        +  P+++  + P              N  +   E+FGP   +   K  
Sbjct  351   YILQEGEYNKGYYYAPTLFTDVMP--------------NMRIAREEIFGPVASIIPVKSL  396

Query  1574  QLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPA  1753
             +  + +N    +D  L++++ + D   +   + +   G  Y  + A TTGA + H   P 
Sbjct  397   EEAIEVN--NSVDYGLSSSIFTRDVNKVFTAMRDLDTGIVY--VNAGTTGA-EIHL--PF  449

Query  1754  GDPRGAGIG  1780
             G  +G G G
Sbjct  450   GGTKGTGNG  458



>ref|WP_035223541.1| transcriptional regulator [Agrobacterium tumefaciens]
 emb|CDN93961.1| Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens]
Length=1233

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 102/368 (28%), Positives = 160/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  657   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKSG---------------ETPLGPV  701

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  702   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  761

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  762   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  821

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  822   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDKL  880

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  ++    G       FVP   
Sbjct  881   SVDVGPVITAEAKGIIEK-----HIEGMRGL--GHRIEQITLAGETG----KGTFVP-PT  928

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  929   IIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVLS  988

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  989   RVAAGNLY  996



>ref|WP_025595193.1| transcriptional regulator [Agrobacterium tumefaciens]
Length=1228

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 99/369 (27%), Positives = 162/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  +    +                 P GPV
Sbjct  652   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARKTFKAN---------------ETPLGPV  696

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  + +RLLH+ G+P + V  L 
Sbjct  697   VCISPWNFPLAIFIGQVTAALVAGNSVLAKPAEETPLIAARGVRLLHEAGVPQDAVQLLP  756

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  757   GDGKTGAALVGSALTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  816

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  817   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDSL  875

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H++ +  +        G  +E  S+    G       FVP  
Sbjct  876   SVDVGPVITAEAKGIIEKHVDSMRAL--------GHRIEQISLAGETG----KGTFVP-P  922

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  923   TIIEMKSLADLKKEVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  982

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  983   SRVAAGNLY  991



>ref|WP_015731412.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Pectobacterium wasabiae]
 ref|YP_003261540.1| trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate 
dehydrogenase [Pectobacterium wasabiae 
WPP163]
 gb|ACX89933.1| delta-1-pyrroline-5-carboxylate dehydrogenase [Pectobacterium 
wasabiae WPP163]
Length=1322

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 162/370 (44%), Gaps = 46/370 (12%)
 Frame = +2

Query  641   RVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIV  820
             R + KS+  A+AEV     FL  ++G QVR          +     +H    P GPV  +
Sbjct  731   REAGKSFSNAIAEVREAVDFLRYYAG-QVR----------DTFTNDTH---RPLGPVVCI  776

Query  821   TPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDG  1000
             +P+NFPL I   Q+  AL  GN  + K   +  ++  Q +R+LH+ G+PL  +  L   G
Sbjct  777   SPWNFPLAIFTGQISAALATGNSVLAKPAEQTPLIAAQAVRILHEAGIPLGVLQLLPGQG  836

Query  1001  KTMNKLLL-EGKPRMTLFTGSSRVAEKLAGDLKGRIK---------LEDAGFDWKILGPD  1150
             +T+   L+ + + R  +FTGS+ VA+ L   + GR+           E  G +  I    
Sbjct  837   ETIGASLVNDERVRGVVFTGSTAVAKTLQRSIAGRLDPQGRLTPLIAETGGLNAMI----  892

Query  1151  VDEVDYIAWVCDQ---DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLD---  1312
             VD       V +     A+  +GQ+CSA  +L + E+ +   L  L  ++A  R  D   
Sbjct  893   VDSSALTEQVVNDVIASAFDSAGQRCSALRLLCLQEDIADRTLAMLRGAMAECRMGDPER  952

Query  1313  -DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA-IRPTAVFVPL  1486
                 +GP++    K  +D   + ++  G  +     P +  +    +G  ++PT      
Sbjct  953   LSTDIGPLIDAEAKENVDQHIQTMRAKGHTVFQAAHPQDEETWR--HGTFVKPT------  1004

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               +++  N D +  EVFGP   V  Y+  QL  V+  +      LT  V +     +Q V
Sbjct  1005  --LIELGNIDELKKEVFGPVLHVIRYQSQQLDTVIEQINAAGYGLTLGVHTRIDETIQRV  1062

Query  1667  IGNSVNGTTY  1696
                +  G  Y
Sbjct  1063  TNRAKVGNQY  1072



>ref|WP_020811556.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens]
 gb|EPR19367.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium radiobacter DSM 30147]
 gb|KDR88008.1| transcriptional regulator [Agrobacterium tumefaciens GW4]
Length=1224

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 102/368 (28%), Positives = 160/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  648   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKSG---------------ETPLGPV  692

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  693   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  752

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  753   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  812

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  813   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDKL  871

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  ++    G       FVP   
Sbjct  872   SVDVGPVITAEAKGIIEK-----HIEGMRGL--GHGIEQITLAGETG----KGTFVP-PT  919

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  920   IIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVLS  979

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  980   RVAAGNLY  987



>ref|WP_007084034.1| aldehyde dehydrogenase [Bacillus bataviensis]
 gb|EKN70537.1| aldehyde dehydrogenase [Bacillus bataviensis LMG 21833]
Length=493

 Score =   107 bits (268),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 125/499 (25%), Positives = 223/499 (45%), Gaps = 69/499 (14%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             ++ N + G W  SS+  +  +L+P NG+   +V +    ++   +++ +   K     P 
Sbjct  3     KILNYINGEWCESSTGKFVPVLNPANGQVLAEVIQSSKEDVDRAVQAAKIAQKSWRLVP-  61

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              APER   L     K A +L   E  +   +++     K   +   EV   Q+ +     
Sbjct  62    -APERAEFL----YKVAFLLK--ERKEHLAQILTSEMGKVIAEGRGEV---QEAI-----  106

Query  719   DQVRFLA----RSFG--VPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYM  880
             D   ++A    R FG  VP     + +   R P G   ++TP+NFP+ I   + + AL  
Sbjct  107   DMAFYMAGEGRRQFGDTVPSELRNKFAMTVRVPIGVAGLITPWNFPIAIASWKSLPALVT  166

Query  881   GNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKPRMTL--FT  1054
             GN  V K  ++  +V E+ +++  + GLP   ++ +N  G  +   +++  P + L  FT
Sbjct  167   GNAVVWKPATETPMVAEEFVKIYEEAGLPKGLINLVNGSGSEVGNAMVD-HPGIDLISFT  225

Query  1055  GSSRVAEKL---AGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQK  1216
             GS+ V   +   AG L  R  LE  G +   +  D D    VD I +     A+  SGQ+
Sbjct  226   GSNEVGSAINGRAGALLKRTSLEMGGKNAITVLEDADLDLAVDGILF----GAFGTSGQR  281

Query  1217  CSAQSILFMHENWSKSPLINLMSSLAARR---KLDD-LTVGPVLTFTTKAMLDHMNKLLQ  1384
             C+A S + +HE+  ++    L++ +   +    LD+ + VGPV+  ++   +D   K+ Q
Sbjct  282   CTATSRVIVHESVKEALTAKLVARIGEMKLGNGLDESVVVGPVINRSSLERIDEYVKIGQ  341

Query  1385  IPGSKLLFGGEPLE-------NHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGP  1543
               G+KLL GG+          N  +P+I+  + P              N  +   E+FGP
Sbjct  342   EDGAKLLTGGKIATENGLDSGNFYLPTIFTDVTP--------------NMRIAKEEIFGP  387

Query  1544  FQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTG  1723
                +   K     + +N    ++  L++A+ ++D     + + +   G  Y  I A T+G
Sbjct  388   VLSIISVKSLDEAVEVN--NNVEFGLSSAIYTSDINRAFQAMRDLDTGLVY--INAGTSG  443

Query  1724  APQNHWFGPAGDPRGAGIG  1780
             A + H   P G  +G G G
Sbjct  444   A-EIHL--PFGGTKGTGNG  459



>ref|WP_038259110.1| transcriptional regulator [Xenorhabdus bovienii]
 emb|CDH07311.1| multifunctional: transcriptional repressor of proline utilization; 
proline dehydrogenase; pyrroline-5-carboxylate dehydrogenase 
[Xenorhabdus bovienii str. oregonense]
Length=1326

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 165/370 (45%), Gaps = 38/370 (10%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             ++ R S K++  A+AEV     FL  ++ DQVR                +H    P GPV
Sbjct  731   ILVRESGKTFSNAIAEVREAVDFLYYYA-DQVR----------QDFANDTH---RPLGPV  776

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFP+ I   Q+  AL  GN  + K   +  ++    +++LH  G+P + +  L 
Sbjct  777   VCISPWNFPMAIFTGQIAAALAAGNSVLAKPAEQTPLIAAVAVKMLHQAGIPCDVLQLLP  836

Query  992   SDGKTMNKLLL-EGKPRMTLFTGSSRVAEKLAGDLKGRIK---------LEDAGFDWKIL  1141
               G+T+  LL+ + + R  +FTGS+ VA  L  ++ GR+           E  G +  I+
Sbjct  837   GQGETVGALLVGDERVRGVMFTGSTEVANLLQRNIAGRLDAQGRPTPLIAETGGLNAMIV  896

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLD---  1312
                      +  V    A+  +GQ+CSA  IL + E+ ++  L  L  ++A  R  +   
Sbjct  897   DSSALTEQVVTDVV-ASAFDSAGQRCSALRILCVQEDVAERTLTMLKGAMAECRMANPEH  955

Query  1313  -DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA-IRPTAVFVPL  1486
                 +GPV+    +A ++H  + ++  G  +       E  S  S  G  ++PT      
Sbjct  956   LSTDIGPVIDAEAQAGIEHHIQTMRTKGRTVYQAAHENEADSQESSQGTFVKPT------  1009

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               +++ E++D +  E+FGP   V  +  N+L  +L  +      LT  V +     + +V
Sbjct  1010  --LIELESFDELKKEIFGPVLHVVRFNRNELNKLLEQINASGYGLTLGVHTRIDETIAQV  1067

Query  1667  IGNSVNGTTY  1696
                +  G  Y
Sbjct  1068  TAKAKVGNLY  1077



>ref|WP_038196656.1| transcriptional regulator [Xenorhabdus bovienii]
 emb|CDH24316.1| multifunctional: transcriptional repressor of proline utilization; 
proline dehydrogenase; pyrroline-5-carboxylate dehydrogenase 
[Xenorhabdus bovienii str. kraussei Becker Underwood]
Length=1326

 Score =   109 bits (273),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 166/370 (45%), Gaps = 38/370 (10%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             ++ R S K++  A+AEV     FL  ++ DQVR                +H    P GPV
Sbjct  731   ILVRESGKTFNNAIAEVREAVDFLYYYA-DQVR----------QDFANDTH---RPLGPV  776

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFP+ I   Q+  AL  GN  + K   +  ++    +++LH  G+P + +  L 
Sbjct  777   VCISPWNFPMAIFTGQIAAALAAGNSVLAKPAEQTPLIAAVAVKMLHQAGIPRDVLQLLP  836

Query  992   SDGKTMNKLLL-EGKPRMTLFTGSSRVAEKLAGDLKGRIK---------LEDAGFDWKIL  1141
               G+T+  LL+ + + R  +FTGS+ VA  L  ++ GR+           E  G +  I+
Sbjct  837   GQGETVGALLVGDERVRGVMFTGSTEVANLLQRNIAGRLDAQGRPTPLIAETGGLNAMIV  896

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLD---  1312
                      +  V    A+  +GQ+CSA  IL + E+ ++  L  L  ++A  R  +   
Sbjct  897   DSSALTEQVVTDVV-ASAFDSAGQRCSALRILCVQEDVAERTLTMLKGAMAECRMANPEH  955

Query  1313  -DLTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGA-IRPTAVFVPL  1486
                 +GPV+    +A ++H  + ++  G  +       E  S  S  G  ++PT      
Sbjct  956   LSTDIGPVIDAEAQAGIEHHIQTMRTKGRTVYQAVHENEADSQESSQGTFVKPT------  1009

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               +++ E++D + TE+FGP   V  +  N+L  +L  +      LT  V +     + +V
Sbjct  1010  --LIELESFDELKTEIFGPVLHVVRFNRNELDNLLEQINASGYGLTLGVHTRIDETIAQV  1067

Query  1667  IGNSVNGTTY  1696
                +  G  Y
Sbjct  1068  TAKAKVGNLY  1077



>ref|WP_017436130.1| aldehyde dehydrogenase [Geobacillus caldoxylosilyticus]
 dbj|GAJ41360.1| succinate-semialdehyde dehydrogenase [Geobacillus caldoxylosilyticus 
NBRC 107762]
Length=493

 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 122/493 (25%), Positives = 221/493 (45%), Gaps = 57/493 (12%)
 Frame = +2

Query  365   EVHNLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPF  538
             +V N + G W  S S  +  +++P NGE+  +V    +A++   +++ +   K     P 
Sbjct  2     KVLNFINGEWKASISKQFAPVINPANGETIGEVTVSIEADVDEAVKAAKAAQKEWALVP-  60

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
              AP+R     ++  K  ++L   E  +   RL+ +   K  ++A  EV          +G
Sbjct  61    -APKR----AEVLYKVGYLLK--ERKEQLARLLTKEMGKVLEEARGEVQEGIDMAFYMAG  113

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +  R    +   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V 
Sbjct  114   EGRRLFGDT--TPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVW  171

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEG-KPRMTLFTGSSRV--  1069
             K   +   + +++ ++  + GLP    + ++ DG T    L+E    ++  FTGS+ V  
Sbjct  172   KPALETPFMAQELAKIFEEAGLPKGVFNVVHGDGPTTGNALVEHPDVQVISFTGSNEVGR  231

Query  1070  --AEKLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSI  1234
               AEK    LK ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S 
Sbjct  232   IIAEKCGRHLK-KVSLEMGGKNAVIVMDDADLSLAVEGILW----SAFGTSGQRCTACSR  286

Query  1235  LFMHENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKL  1402
             + +HE      ++ L+  M +L     LD+ + VGPV++      +D   ++ +  G+KL
Sbjct  287   VIVHEKVKEELENRLLEAMKTLTIGNGLDENVKVGPVISDEALQKIDRYVRIGKEEGAKL  346

Query  1403  LFGGEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE  1561
             L GG  L +       +  P+++  ++PT                +   E+FGP   +  
Sbjct  347   LTGGYILRDGEYQKGYYYAPTLFTDVQPT--------------MRIAREEIFGPVVSIIS  392

Query  1562  YKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHW  1741
                 +  + +N    +D  L++++ + D   + + + +   G  Y  + A TTGA + H 
Sbjct  393   VSSLEEAIAVN--NSVDYGLSSSIFTRDVNKVFQAMRDLDTGIVY--VNAGTTGA-EIHL  447

Query  1742  FGPAGDPRGAGIG  1780
               P G  +G G G
Sbjct  448   --PFGGTKGTGNG  458



>ref|WP_003522525.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens]
 gb|EMS96878.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens str. Cherry 2E-2-2]
Length=1224

 Score =   109 bits (272),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 101/368 (27%), Positives = 160/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             L+ R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  648   LVMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKTG---------------ETPLGPV  692

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  693   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  752

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  753   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  812

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  813   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDKL  871

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  ++    G       FVP   
Sbjct  872   SVDVGPVITAEAKGIIEK-----HIEGMRGL--GHRIEQITLAGETG----KGTFVP-PT  919

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  920   IIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVLS  979

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  980   RVAAGNLY  987



>ref|XP_005980166.1| PREDICTED: uncharacterized protein LOC102320353 [Pantholops hodgsonii]
Length=1196

 Score =   109 bits (272),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 102/368 (28%), Positives = 160/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  672   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKTG---------------ETPLGPV  716

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  717   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  776

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  777   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  836

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  837   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDRL  895

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E  ++    G       FVP   
Sbjct  896   SVDVGPVITAEAKGIIEK-----HIEGMRGL--GHRIEQITLAGETG----KGTFVP-PT  943

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  944   IIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVLS  1003

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  1004  RVAAGNLY  1011



>ref|WP_036834056.1| aldehyde dehydrogenase [Pontibacillus litoralis]
 gb|KGX86919.1| aldehyde dehydrogenase [Pontibacillus litoralis JSM 072002]
Length=500

 Score =   107 bits (267),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 111/490 (23%), Positives = 219/490 (45%), Gaps = 57/490 (12%)
 Frame = +2

Query  374   NLVQGNWIRSSS--WNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             N + G W+ ++S  +  + +P   E+ +KV      ++   ++  +   +     P  AP
Sbjct  13    NFINGEWVHATSNQYTNVTNPATLETLVKVPLSHKEDVDKAVQVAKTAQQQWALVP--AP  70

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             +R  +L  +       + + E  +  ++L+   + K  ++A  EV          +G+  
Sbjct  71    QRAEVLYKVG------MIMKERKEAISQLLTMENGKVIEEARGEVQEGIDMAFYMAGEGR  124

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V K  
Sbjct  125   RLFGQT--TPSELKDKFAMSVRSPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPA  182

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRV----A  1072
             ++  ++  ++ ++  + GLP   V+ +   G ++ + ++  K  R+  FTGS+ V    A
Sbjct  183   TETPLMAFELAKIFEEAGLPKGVVNVVYGSGASVGEAMVHHKDIRVISFTGSNEVGRHIA  242

Query  1073  EKLAGDLKGRIKLEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFM  1243
             E+    LK ++ LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S + +
Sbjct  243   ERCGQQLK-KVSLEMGGKNAVIVMDDADISLAVEGIIW----SAFGTSGQRCTACSRVIV  297

Query  1244  HENWS---KSPLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFG  1411
             HE+     +  L+  M  +     LD+ + VGP++  +    ++   +L Q  G+KL+ G
Sbjct  298   HEDVKEKLQKQLLEQMEHITIGNGLDESVKVGPIINQSALEKIESYVQLGQKEGAKLIAG  357

Query  1412  GEPLEN-------HSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKD  1570
             G  ++N       +  P+++  ++P              N  +   E+FGP   +   K 
Sbjct  358   GSVMKNGQYEKGHYFAPTVFTDVKP--------------NMRIAQEEIFGPVVSLIPVKS  403

Query  1571  NQLPLVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGP  1750
              +  + +N    ++  L++++ ++D   +     +   G  Y  + A TTGA + H   P
Sbjct  404   FEEAIEVN--NSVEFGLSSSIFTSDVHKVFAAQRDLDTGIVY--VNAGTTGA-EIHL--P  456

Query  1751  AGDPRGAGIG  1780
              G  +G G G
Sbjct  457   FGGTKGTGNG  466



>ref|WP_006698043.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Rhizobium lupini]
 gb|EKJ96255.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Rhizobium lupini HPC(L)]
Length=1248

 Score =   109 bits (272),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 102/370 (28%), Positives = 165/370 (45%), Gaps = 45/370 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR-FLARSFGVPGNHLGQQSHGFRWPYGP  808
             L+ R + KS   A+AEV     FL  ++ +  R F A          G++      P GP
Sbjct  672   LVMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFTA----------GEK------PLGP  715

Query  809   VAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFL  988
             V  ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L
Sbjct  716   VVCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLL  775

Query  989   NSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKIL  1141
               DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+
Sbjct  776   PGDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIV  835

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDD  1315
                      +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D 
Sbjct  836   DSSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDR  894

Query  1316  LT--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPL  1486
             L+  VGPV+T   K +++ H+  +  +        G  +E  ++    G       FVP 
Sbjct  895   LSVDVGPVITAEAKGIIEKHIEDMRSL--------GHRIEQITLAGETG----KGTFVP-  941

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V
Sbjct  942   PTIIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHV  1001

Query  1667  IGNSVNGTTY  1696
             +     G  Y
Sbjct  1002  LSRVAAGNLY  1011



>ref|WP_003508739.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens]
 gb|EHH03805.1| bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Agrobacterium tumefaciens CCNWGS0286]
Length=1224

 Score =   109 bits (272),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 103/368 (28%), Positives = 162/368 (44%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R          N    ++     P GPV
Sbjct  648   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARR----------NFKAGET-----PLGPV  692

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  693   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  752

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  753   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  812

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  813   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDRL  871

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E   +    G       FVP   
Sbjct  872   SVDVGPVITAEAKGIIEK-----HIEGMRGL--GHRIEQIELAGETG----KGTFVP-PT  919

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  920   IIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDQINATGYGLTFGLHTRLDDTIQHVLS  979

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  980   RVAAGNLY  987



>ref|WP_022563491.1| MULTISPECIES: Bifunctional putA protein: proline dehydrogenase; 
delta-1-pyrroline-5-carboxylate dehydrogenase [Rhizobium/Agrobacterium 
group]
 ref|YP_008648567.1| Bifunctional putA protein: proline dehydrogenase; delta-1-pyrroline-5-carboxylate 
dehydrogenase [Rhizobium sp. IRBG74]
 emb|CDI11079.1| Bifunctional putA protein: proline dehydrogenase; delta-1-pyrroline-5-carboxylate 
dehydrogenase [Rhizobium sp. IRBG74]
Length=1224

 Score =   108 bits (271),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 163/369 (44%), Gaps = 43/369 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             L+ R + KS   A+AEV     FL  ++ +  R          N    ++     P GPV
Sbjct  648   LVMREAGKSMPNAIAEVREAIDFLRYYAAEARR----------NFTAGET-----PLGPV  692

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  693   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  752

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  753   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  812

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  813   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDRL  871

Query  1319  T--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
             +  VGPV+T   K +++ H+  +  +        G  +E  ++    G       FVP  
Sbjct  872   SVDVGPVITAEAKGIIEKHIEDMRSL--------GHRIEQITLAGETG----KGTFVP-P  918

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+
Sbjct  919   TIIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVL  978

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  979   SRVAAGNLY  987



>ref|WP_020009951.1| MULTISPECIES: bifunctional proline dehydrogenase/pyrroline-5-carboxylate 
dehydrogenase [Agrobacterium]
Length=1224

 Score =   108 bits (271),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 102/368 (28%), Positives = 159/368 (43%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + KS   A+AEV     FL  ++ +  R                      P GPV
Sbjct  648   LIMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFKSG---------------ETPLGPV  692

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
               ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L 
Sbjct  693   VCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLLP  752

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKILG  1144
              DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+ 
Sbjct  753   GDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIVD  812

Query  1145  PDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDDL  1318
                     +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D L
Sbjct  813   SSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDRL  871

Query  1319  T--VGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             +  VGPV+T   K +++       I G + L  G  +E   +    G       FVP   
Sbjct  872   SVDVGPVITAEAKGIIEK-----HIEGMRGL--GHRIEQIELAGETG----KGTFVP-PT  919

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V+ 
Sbjct  920   IIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHVLS  979

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  980   RVAAGNLY  987



>ref|WP_018709087.1| aldehyde dehydrogenase [Bacillus fordii]
Length=488

 Score =   107 bits (266),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 115/475 (24%), Positives = 206/475 (43%), Gaps = 44/475 (9%)
 Frame = +2

Query  371   HNLVQGNWIRSSSWNTI--LDPLNGESFIKVAEVQDAE--LQPFLESMRKCPKHGLHNPF  538
              NL+ GNW  S S  T   ++P N E  +   +  + E   Q    + R  P+     P 
Sbjct  11    KNLIDGNWSESQSGQTFSSINPANKEEIVGAFQASNEEDVRQAIEAASRAFPQWAATAPS  70

Query  539   KAPERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSG  718
             K   R  +L     KAA +L   +  D     + R   K    A  EV  + + L  ++ 
Sbjct  71    K---RAAIL----NKAADILE--QSVDTLAEELTREEGKHVNDARNEVLRSAQTLRFYAV  121

Query  719   DQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVL  898
             +   F   +F  P +    +    R P G +A++TP+NFP+ IP  ++  AL  GN  V 
Sbjct  122   EGQSFTGETF--PHDDSNMKVSTEREPLGVIAVITPWNFPISIPARKIAPALVTGNTVVF  179

Query  899   KVDSKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRVAE  1075
             K  S   ++  +++  L D G+P   ++F+      +  LL+  +  +   FTGS+   E
Sbjct  180   KPSSDTPLIAFRLVEALQDAGIPKGVINFVTGKSSDIGDLLVTHEAIKAITFTGSTTAGE  239

Query  1076  KL--AGDLKGRIKLEDAGFDWKILGPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHE  1249
              +        R ++E  G +  I+  D D +D  A +    A++ +GQ C+  S + + +
Sbjct  240   VIHSKTSFTTRTQMELGGKNPIIIMDDAD-LDLAATLTVNGAFSLTGQACTGTSRVIVLQ  298

Query  1250  NWSKSPLINLMSSLAARRKL-----DDLTVGPVLTFTT-KAMLDHMNKLLQIPGSKLLFG  1411
             +  K   IN +       K+     + + +GPV      K +L++++  ++  G+ L++G
Sbjct  299   SV-KDAYINKLIEKTKNLKVGNGFEEGVKIGPVANHRQLKNILNYIDIGVK-EGANLVYG  356

Query  1412  GEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTE---YKDNQLP  1582
             G  + N      Y  + PT +F  ++  ++     +   E+FGP   V E   YK+    
Sbjct  357   GNQITNGKYAQGY-YVEPT-IFTDVQPDMR-----IAQEEIFGPVVAVIEVSTYKE----  405

Query  1583  LVLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFG  1747
               +     +D  L+A++V+N+     +   +   GT    +   TTG   N  FG
Sbjct  406   -AIKVANGVDYGLSASIVTNNLKVANDFTKDIQAGTVK--VNRTTTGNLMNAPFG  457



>ref|WP_034464442.1| integrase [Afipia sp. P52-10]
 gb|ETR77300.1| pyrroline-5-carboxylate dehydrogenase [Afipia sp. P52-10]
Length=1031

 Score =   108 bits (271),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 157/369 (43%), Gaps = 35/369 (9%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             L+QR   K+   A++EV     F   ++    +       +PG   G+++       G  
Sbjct  623   LLQREGGKTLDDAVSEVREAADFCRYYAAQGRKLFGADQPLPGP-TGERNVLRLRGRGVF  681

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
             A ++P+NFPL I + Q+  AL  GN  V K   +  +V  + +RLLHD G+P   + F+ 
Sbjct  682   AAISPWNFPLAIFIGQITAALMAGNTVVAKPAEQTPLVAFEAIRLLHDAGIPTSALQFVP  741

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGR------IKLEDAGFDWKILGPDV  1153
              D +    L+        +FTGS+ VA  +   L  +      +  E  G +  I    V
Sbjct  742   GDSRIGGTLVAHPDIAGVVFTGSTEVARIINRALAAKDGPIVPLIAETGGINAMI----V  797

Query  1154  DEVDYIAWVCDQ---DAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLDD---  1315
             D       V D     A+  +GQ+CSA  +LF+ ++ ++  +I +++  A    + D   
Sbjct  798   DATALPEQVADDVITSAFRSAGQRCSALRLLFLQDDVAER-MIGIITGSARELAVGDPRE  856

Query  1316  --LTVGPVLTFTTKAMLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLE  1489
                 VGPV+    K  LD     +Q   +++ F GE               P + F    
Sbjct  857   IATHVGPVIDRDAKDKLDAHIARMQT-SARVHFAGEA--------------PASGFFVAP  901

Query  1490  EILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVI  1669
              +++      +T EVFGP   V  YK + LP V+ A+ R    LT  + S     + EV+
Sbjct  902   HVIELNRASDLTEEVFGPILHVVRYKASDLPAVIEAIARSGYGLTFGLHSRIDETMDEVV  961

Query  1670  GNSVNGTTY  1696
                  G  Y
Sbjct  962   ARLATGNIY  970



>ref|WP_011065267.1| aldehyde dehydrogenase [Oceanobacillus iheyensis]
 ref|NP_691782.1| aldehyde dehydrogenase [Oceanobacillus iheyensis HTE831]
 dbj|BAC12817.1| aldehyde dehydrogenase [Oceanobacillus iheyensis HTE831]
Length=497

 Score =   107 bits (266),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 113/485 (23%), Positives = 214/485 (44%), Gaps = 47/485 (10%)
 Frame = +2

Query  368   VHNLVQGNWIRSSSWNTILDPLNGESFIKVAEVQDAELQPFLESMRKCPKHGLHNPFKAP  547
             + N + G W+  ++   + +P NGE  ++V     + ++  +++  K  K     P  AP
Sbjct  11    LKNFIDGKWVDVNNTTAVTNPANGERIVQVPLSDQSHVEEAVQAAIKAQKEWALVP--AP  68

Query  548   ERYLMLGDISTKAAHMLSLPEVSDFFTRLIQRVSPKSYQQALAEVFVTQKFLENFSGDQV  727
             +R  +L  +       + + +  +  +RL+   + K  ++A  EV          +G+  
Sbjct  69    QRAEVLYRVG------MIMKDKKERLSRLLTMENGKVLEEARGEVQEGIDMAFYMAGEGR  122

Query  728   RFLARSFGVPGNHLGQQSHGFRWPYGPVAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVD  907
             R   ++   P     + +   R P G V I+TP+NFP+ I   +   A+  GN  V K  
Sbjct  123   RLFGQT--TPAELKDKFAMSQRVPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPA  180

Query  908   SKVCIVMEQMLRLLHDCGLPLEDVDFLNSDGKTMNKLLLEGKP-RMTLFTGSSRVAEKLA  1084
             ++  I+  ++ ++  + GLP   ++ +   G  +   +++ K  R+  FTGS+     +A
Sbjct  181   TETPIMAYELAKIFEEAGLPSGVINVVFGKGSEVGDSMVQHKDIRVISFTGSNDTGRNIA  240

Query  1085  GDLKGRIK---LEDAGFDWKILGPDVD---EVDYIAWVCDQDAYACSGQKCSAQSILFMH  1246
              D   ++K   LE  G +  I+  D D    V+ I W     A+  SGQ+C+A S + +H
Sbjct  241   SDCGKQLKKVSLEMGGKNAVIVMDDADLDLAVEGILW----SAFGTSGQRCTACSRVIVH  296

Query  1247  ENWSKS---PLINLMSSLAARRKLDD-LTVGPVLTFTTKAMLDHMNKLLQI---PGSKLL  1405
                 K+    L+  M  L     L+D + VGP++    +A L+ + K +++    G+ LL
Sbjct  297   HKVKKTLEERLLAAMDHLTIGNGLEDGIKVGPII---NEAGLNKIKKYIEVGKQEGATLL  353

Query  1406  FGGEPLENHSIPSIYGAIRPTAVFVPLEEILKDENYDLVTTEVFGPFQIVTEYKDNQLPL  1585
              GG   E ++ P  Y        F P        +  +   E+FGP   + E    +  +
Sbjct  354   AGGTEWETNN-PGYY--------FTPTLFTDAKPDMRIAQEEIFGPVVSLIEVSSFEEAI  404

Query  1586  VLNALERMDANLTAAVVSNDQLFLQEVIGNSVNGTTYAGIRARTTGAPQNHWFGPAGDPR  1765
              +N   ++   L++++ + D   + +   +   G  Y  + A TTGA  +    P G  +
Sbjct  405   EVN--NQVTFGLSSSIFTKDVNRVFKAQRDLDTGIVY--VNAGTTGAEIHL---PFGGTK  457

Query  1766  GAGIG  1780
             G G G
Sbjct  458   GTGNG  462



>gb|AIQ91187.1| Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase 
[Methylobacterium oryzae CBMB20]
Length=1228

 Score =   108 bits (270),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 108/368 (29%), Positives = 161/368 (44%), Gaps = 41/368 (11%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPV  811
             LI R + K+Y  A+AE+     FL   + +  R L              +H    P GPV
Sbjct  654   LIVREAGKTYANAVAEIREAVDFLRYDAAEAERILG------------DAHA---PLGPV  698

Query  812   AIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFLN  991
             A + P+NFPL I V Q   AL  GN  + K   +  ++    +R+LH  G+P + +  L 
Sbjct  699   ACIAPWNFPLAIFVGQAAAALAAGNTVLAKPAEETPLIAAAAIRVLHAAGIPADALHLLP  758

Query  992   SDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRIKL--EDAGFDWKILGPDVDEVD  1165
              DG+    L+ + + +  +FTGS+ VA+ +   L GR+    E   F  +  G +   VD
Sbjct  759   GDGRVGAALVADPRVQGVMFTGSTAVAKAIQRALAGRLNRFGEPVPFVAETGGQNALVVD  818

Query  1166  YIAW----VCD--QDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARRKLD----D  1315
               A     V D    A+  +GQ+CSA  IL + E  +   L  L  +L   +  D     
Sbjct  819   SSALAEQVVADVIASAFDSAGQRCSALRILCLQEEIADRTLHMLKGALRELQVGDPRRLA  878

Query  1316  LTVGPVLTFTTKA-MLDHMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPLEE  1492
             + VGPV+T    A ++DH+        + L   G P+E   +P   GA      FVP   
Sbjct  879   VNVGPVITADAAARLVDHV--------ASLRARGFPVEQLPLPPEAGA----GTFVPPTL  926

Query  1493  ILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEVIG  1672
             I      D V  EVFGP   V  Y+ + L  +L A++     LT  + S     +  V+G
Sbjct  927   IEIGAVAD-VEQEVFGPVLHVLRYRRDTLDRLLAAIDATGYGLTFGLHSRVDETIDHVLG  985

Query  1673  NSVNGTTY  1696
                 G  Y
Sbjct  986   RVRAGNRY  993



>ref|WP_037090662.1| transcriptional regulator [Rhizobium sp. H41]
 gb|KGE83293.1| transcriptional regulator [Rhizobium sp. H41]
Length=1224

 Score =   108 bits (269),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 102/370 (28%), Positives = 164/370 (44%), Gaps = 45/370 (12%)
 Frame = +2

Query  632   LIQRVSPKSYQQALAEVFVTQKFLENFSGDQVR-FLARSFGVPGNHLGQQSHGFRWPYGP  808
             L+ R + KS   A+AEV     FL  ++ +  R F A          G++      P GP
Sbjct  648   LVMREAGKSMPNAIAEVREAIDFLRYYAAEARRNFTA----------GEK------PLGP  691

Query  809   VAIVTPFNFPLEIPVLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGLPLEDVDFL  988
             V  ++P+NFPL I + Q+  AL  GN  + K   +  ++  Q +RLLH+ G+P + V  L
Sbjct  692   VVCISPWNFPLAIFIGQVTAALVAGNPVLAKPAEETPLIAAQGVRLLHEAGVPQDAVQLL  751

Query  989   NSDGKTMNKLLLEGKPRMTLFTGSSRVAEKLAGDLKGRI---------KLEDAGFDWKIL  1141
               DGKT   L+        +FTGS+ VA  + G L GR+           E  G +  I+
Sbjct  752   PGDGKTGAALVGSPLTAGVMFTGSTEVARLIQGQLAGRVLANGQPVPLIAETGGQNAMIV  811

Query  1142  GPDVDEVDYIAWVCDQDAYACSGQKCSAQSILFMHENWSKSPLINLMSSLAARR--KLDD  1315
                      +A V    A+  +GQ+CSA  IL + E+ +   L  L  +L   R  + D 
Sbjct  812   DSSALAEQVVADVI-ASAFDSAGQRCSALRILCLQEDVADRTLTMLKGALHELRIGRTDR  870

Query  1316  LT--VGPVLTFTTKAMLD-HMNKLLQIPGSKLLFGGEPLENHSIPSIYGAIRPTAVFVPL  1486
             L+  VGPV+T   K  ++ H+  +  +        G  +E  ++    G       FVP 
Sbjct  871   LSVDVGPVITAEAKGTIEKHIEDMRSL--------GHRIEQITLAGETG----KGTFVP-  917

Query  1487  EEILKDENYDLVTTEVFGPFQIVTEYKDNQLPLVLNALERMDANLTAAVVSNDQLFLQEV  1666
               I++ ++   +  EVFGP   V  +K + L  +++ +      LT  + +     +Q V
Sbjct  918   PTIIEMKSLADLKREVFGPVLHVIRFKRDNLDRLIDEINATGYGLTFGLHTRLDDTIQHV  977

Query  1667  IGNSVNGTTY  1696
             +     G  Y
Sbjct  978   LSRVAAGNLY  987



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6337946833044