BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31426_g1_i1 len=1054 path=[1032:0-1053]

Length=1054
                                                                      Score     E

ref|XP_006443586.1|  hypothetical protein CICLE_v10023425mg             346   1e-114   
ref|XP_011024647.1|  PREDICTED: xyloglucan endotransglucosylase/h...    331   8e-109   
ref|XP_002301792.2|  xyloglucan endotransglucosylase/hydrolase pr...    330   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011024646.1|  PREDICTED: xyloglucan endotransglucosylase/h...    330   3e-108   
ref|XP_002521076.1|  Xyloglucan endotransglucosylase/hydrolase pr...    329   7e-108   Ricinus communis
ref|XP_007049742.1|  Xyloglucan endotransglucosylase/hydrolase 2        325   2e-106   
gb|KDP26372.1|  hypothetical protein JCGZ_17530                         320   2e-104   
ref|XP_010069639.1|  PREDICTED: xyloglucan endotransglucosylase/h...    317   4e-103   
ref|XP_011087433.1|  PREDICTED: xyloglucan endotransglucosylase/h...    313   2e-101   
ref|XP_003530856.1|  PREDICTED: xyloglucan endotransglucosylase/h...    312   3e-101   
ref|XP_003632454.1|  PREDICTED: putative xyloglucan endotransgluc...    311   5e-101   
gb|KCW58053.1|  hypothetical protein EUGRSUZ_H00788                     311   8e-101   
gb|KDO65954.1|  hypothetical protein CISIN_1g041460mg                   309   3e-100   
gb|KEH18201.1|  xyloglucan endotransglucosylase/hydrolase family ...    309   6e-100   
ref|XP_004516314.1|  PREDICTED: xyloglucan endotransglucosylase/h...    308   1e-99    
ref|XP_009766795.1|  PREDICTED: xyloglucan endotransglucosylase/h...    306   6e-99    
ref|XP_007140647.1|  hypothetical protein PHAVU_008G129900g             302   2e-97    
ref|XP_009625718.1|  PREDICTED: xyloglucan endotransglucosylase/h...    302   2e-97    
ref|XP_010913492.1|  PREDICTED: putative xyloglucan endotransgluc...    298   1e-95    
gb|EYU40615.1|  hypothetical protein MIMGU_mgv1a010970mg                298   2e-95    
ref|XP_008806512.1|  PREDICTED: xyloglucan endotransglucosylase/h...    297   3e-95    
ref|XP_010104199.1|  Xyloglucan endotransglucosylase/hydrolase pr...    296   8e-95    
ref|XP_010241425.1|  PREDICTED: xyloglucan endotransglucosylase/h...    296   8e-95    
gb|EYU40616.1|  hypothetical protein MIMGU_mgv1a010995mg                296   1e-94    
emb|CDP03889.1|  unnamed protein product                                293   9e-94    
ref|XP_002863176.1|  hypothetical protein ARALYDRAFT_359038             293   1e-93    
ref|XP_009796007.1|  PREDICTED: xyloglucan endotransglucosylase/h...    290   9e-93    
ref|XP_009622563.1|  PREDICTED: xyloglucan endotransglucosylase/h...    287   2e-91    
ref|XP_002863180.1|  predicted protein                                  286   8e-91    
ref|XP_006284203.1|  hypothetical protein CARUB_v10005358mg             285   1e-90    
gb|KHG13728.1|  Xyloglucan endotransglucosylase/hydrolase 2 -like...    284   4e-90    
emb|CAN63612.1|  hypothetical protein VITISV_032683                     303   5e-90    Vitis vinifera
ref|XP_010496005.1|  PREDICTED: xyloglucan endotransglucosylase/h...    283   6e-90    
ref|XP_010450803.1|  PREDICTED: xyloglucan endotransglucosylase/h...    283   9e-90    
ref|XP_006367860.1|  PREDICTED: xyloglucan endotransglucosylase/h...    282   1e-89    
ref|NP_193045.1|  xyloglucan endotransglucosylase/hydrolase 2           282   2e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KFK29696.1|  hypothetical protein AALP_AA7G166900                    282   2e-89    
ref|XP_009135205.1|  PREDICTED: xyloglucan endotransglucosylase/h...    281   4e-89    
ref|XP_010440650.1|  PREDICTED: xyloglucan endotransglucosylase/h...    281   5e-89    
ref|XP_002863177.1|  hypothetical protein ARALYDRAFT_359039             281   6e-89    
ref|XP_002863184.1|  predicted protein                                  279   9e-89    
ref|XP_010470043.1|  PREDICTED: putative xyloglucan endotransgluc...    280   9e-89    
emb|CDY00754.1|  BnaC03g37380D                                          280   1e-88    
ref|XP_010685035.1|  PREDICTED: xyloglucan endotransglucosylase/h...    280   1e-88    
ref|XP_010473997.1|  PREDICTED: xyloglucan endotransglucosylase/h...    283   2e-88    
emb|CAB45507.1|  endoxyloglucan transferase-like protein                280   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193044.2|  xyloglucan endotransglucosylase/hydrolase 1           280   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235463.1|  PREDICTED: xyloglucan endotransglucosylase/h...    279   3e-88    
ref|XP_010450275.1|  PREDICTED: putative xyloglucan endotransgluc...    279   4e-88    
gb|KHN10983.1|  Xyloglucan endotransglucosylase/hydrolase protein 2     276   5e-88    
ref|XP_006414974.1|  hypothetical protein EUTSA_v10026812mg             278   5e-88    
emb|CDY00753.1|  BnaC03g37370D                                          278   5e-88    
ref|XP_007199163.1|  hypothetical protein PRUPE_ppa019741mg             276   1e-87    
ref|XP_002518076.1|  Xyloglucan endotransglucosylase/hydrolase pr...    276   3e-87    Ricinus communis
ref|XP_010488614.1|  PREDICTED: xyloglucan endotransglucosylase/h...    276   6e-87    
emb|CDX73839.1|  BnaA03g32080D                                          275   1e-86    
ref|XP_009135204.1|  PREDICTED: xyloglucan endotransglucosylase/h...    275   1e-86    
ref|XP_010466925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    275   2e-86    
ref|XP_010440647.1|  PREDICTED: putative xyloglucan endotransgluc...    274   3e-86    
ref|XP_006418675.1|  hypothetical protein EUTSA_v10002629mg             273   4e-86    
ref|XP_006300154.1|  hypothetical protein CARUB_v10016385mg             273   6e-86    
ref|XP_004510291.1|  PREDICTED: xyloglucan endotransglucosylase/h...    267   2e-84    
ref|XP_010513810.1|  PREDICTED: xyloglucan endotransglucosylase/h...    269   2e-84    
ref|XP_002883570.1|  hypothetical protein ARALYDRAFT_899104             268   6e-84    
ref|XP_009372559.1|  PREDICTED: xyloglucan endotransglucosylase/h...    268   6e-84    
ref|XP_010269486.1|  PREDICTED: probable xyloglucan endotransgluc...    269   9e-84    
ref|XP_009414407.1|  PREDICTED: probable xyloglucan endotransgluc...    268   1e-83    
gb|KDP39357.1|  hypothetical protein JCGZ_01114                         266   2e-83    
gb|KFK39808.1|  hypothetical protein AALP_AA3G291100                    266   3e-83    
emb|CDY69237.1|  BnaCnng62600D                                          266   4e-83    
ref|XP_010532897.1|  PREDICTED: xyloglucan endotransglucosylase/h...    266   5e-83    
ref|NP_189141.1|  xyloglucan endotransglucosylase/hydrolase 3           265   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178708.1|  endoxyloglucan transferase A1                         266   6e-83    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28571.1|  unknown                                                 265   6e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408365.1|  PREDICTED: probable xyloglucan endotransgluc...    265   8e-83    
ref|XP_009136186.1|  PREDICTED: xyloglucan endotransglucosylase/h...    265   1e-82    
emb|CDX93096.1|  BnaA03g38180D                                          265   1e-82    
sp|Q6YDN9.1|XTH_BRAOB  RecName: Full=Xyloglucan endotransglucosyl...    265   1e-82    Brassica oleracea var. botrytis [cauliflower]
ref|XP_006285505.1|  hypothetical protein CARUB_v10006944mg             264   1e-82    
ref|XP_009102440.1|  PREDICTED: xyloglucan endotransglucosylase/h...    263   4e-82    
ref|XP_007037991.1|  Xyloglucan endotransglucosylase/hydrolase 2,...    263   6e-82    
ref|XP_002883741.1|  endo-xyloglucan transferase                        263   8e-82    
ref|XP_004510290.1|  PREDICTED: xyloglucan endotransglucosylase/h...    260   9e-82    
ref|XP_006298227.1|  hypothetical protein CARUB_v10014286mg             262   1e-81    
ref|XP_006285488.1|  hypothetical protein CARUB_v10006916mg             261   2e-81    
ref|XP_006662970.1|  PREDICTED: probable xyloglucan endotransgluc...    262   2e-81    
ref|XP_010488800.1|  PREDICTED: xyloglucan endotransglucosylase/h...    261   2e-81    
ref|XP_010467128.1|  PREDICTED: xyloglucan endotransglucosylase/h...    261   2e-81    
ref|XP_002983278.1|  hypothetical protein SELMODRAFT_118035             261   2e-81    
ref|XP_010412980.1|  PREDICTED: xyloglucan endotransglucosylase/h...    261   2e-81    
ref|XP_006396101.1|  hypothetical protein EUTSA_v10002626mg             261   2e-81    
ref|XP_010026021.1|  PREDICTED: xyloglucan endotransglucosylase/h...    260   3e-81    
ref|NP_001068033.1|  Os11g0539200                                       261   4e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449625.1|  hypothetical protein SORBIDRAFT_05g020400          261   4e-81    Sorghum bicolor [broomcorn]
dbj|BAO57274.1|  xyloglucan endotransglucosylase/hydrolase              261   4e-81    
ref|XP_002984349.1|  hypothetical protein SELMODRAFT_120108             260   5e-81    
gb|EAY81204.1|  hypothetical protein OsI_36383                          260   5e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_001234369.1|  xyloglucan endotransglycosylase precursor          260   7e-81    
sp|Q41542.1|XTH_WHEAT  RecName: Full=Probable xyloglucan endotran...    260   8e-81    Triticum aestivum [Canadian hard winter wheat]
gb|AGT17174.1|  Xyloglucan endotransglucosylase/hydrolase               260   8e-81    
ref|XP_002984470.1|  hypothetical protein SELMODRAFT_120330             259   9e-81    
gb|AGT17238.1|  xyloglucan endotransglucosylase/hydrolase precursor     260   1e-80    
emb|CDX70524.1|  BnaC03g06080D                                          259   1e-80    
ref|XP_002972773.1|  hypothetical protein SELMODRAFT_98543              259   1e-80    
ref|XP_008465167.1|  PREDICTED: probable xyloglucan endotransgluc...    259   1e-80    
ref|XP_010533047.1|  PREDICTED: xyloglucan endotransglucosylase/h...    259   1e-80    
ref|XP_008778441.1|  PREDICTED: probable xyloglucan endotransgluc...    259   2e-80    
ref|XP_002984011.1|  hypothetical protein SELMODRAFT_119243             259   2e-80    
ref|XP_002972769.1|  hypothetical protein SELMODRAFT_413363             259   2e-80    
ref|XP_010259646.1|  PREDICTED: probable xyloglucan endotransgluc...    259   2e-80    
emb|CAA62847.1|  Endoxyloglucan transferase (EXT)                       259   2e-80    Hordeum vulgare [barley]
ref|XP_002973000.1|  hypothetical protein SELMODRAFT_98674              259   2e-80    
gb|KFK39895.1|  hypothetical protein AALP_AA3G302800                    259   2e-80    
ref|XP_004292364.1|  PREDICTED: xyloglucan endotransglucosylase/h...    259   2e-80    
ref|XP_010453490.1|  PREDICTED: probable xyloglucan endotransgluc...    259   3e-80    
ref|XP_010419998.1|  PREDICTED: probable xyloglucan endotransgluc...    259   3e-80    
emb|CDX69621.1|  BnaA10g19700D                                          258   3e-80    
gb|ABK27149.1|  unknown                                                 258   3e-80    Picea sitchensis
ref|XP_004141155.1|  PREDICTED: probable xyloglucan endotransgluc...    258   3e-80    
ref|XP_007049743.1|  Xyloglucan endotransglucosylase/hydrolase pr...    258   4e-80    
ref|XP_009121720.1|  PREDICTED: probable xyloglucan endotransgluc...    258   4e-80    
ref|XP_002512792.1|  Xyloglucan endotransglucosylase/hydrolase pr...    257   5e-80    Ricinus communis
ref|XP_010910383.1|  PREDICTED: probable xyloglucan endotransgluc...    258   5e-80    
emb|CDY09832.1|  BnaC09g43290D                                          257   8e-80    
ref|XP_010492168.1|  PREDICTED: probable xyloglucan endotransgluc...    258   8e-80    
ref|XP_002873632.1|  EXGT-A4                                            257   1e-79    
ref|XP_006288357.1|  hypothetical protein CARUB_v10001606mg             257   1e-79    
gb|ACK36946.1|  xyloglucan endotransglycosylase                         257   1e-79    Annona cherimola [cherimoya]
ref|XP_003577501.1|  PREDICTED: probable xyloglucan endotransgluc...    257   1e-79    
ref|XP_010066388.1|  PREDICTED: probable xyloglucan endotransgluc...    257   1e-79    
ref|XP_008812130.1|  PREDICTED: probable xyloglucan endotransgluc...    257   1e-79    
ref|NP_196891.1|  endoxyloglucan transferase A4                         257   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002984345.1|  hypothetical protein SELMODRAFT_120242             256   2e-79    
gb|ABV46535.1|  xyloglucan endotransglucosylase hydrolase 3             256   3e-79    
ref|XP_009131365.1|  PREDICTED: probable xyloglucan endotransgluc...    256   3e-79    
ref|XP_003524704.1|  PREDICTED: probable xyloglucan endotransgluc...    256   3e-79    
gb|ADE42490.1|  xyloglucan endotransglucosylase/hydrolase 1             256   4e-79    
gb|ACF88385.1|  unknown                                                 255   6e-79    Zea mays [maize]
ref|XP_011033703.1|  PREDICTED: probable xyloglucan endotransgluc...    255   6e-79    
ref|XP_004299202.1|  PREDICTED: probable xyloglucan endotransgluc...    255   7e-79    
ref|XP_004979406.1|  PREDICTED: probable xyloglucan endotransgluc...    255   8e-79    
ref|XP_006367741.1|  PREDICTED: probable xyloglucan endotransgluc...    255   9e-79    
ref|XP_007205666.1|  hypothetical protein PRUPE_ppa009472mg             254   1e-78    
gb|ABC55454.2|  xyloglucan endotransglucosylase/hydrolase 2             254   1e-78    Rosa x borboniana [Bourbon rose]
ref|XP_002274520.1|  PREDICTED: probable xyloglucan endotransgluc...    255   1e-78    Vitis vinifera
ref|XP_006399889.1|  hypothetical protein EUTSA_v10014262mg             254   1e-78    
ref|NP_001148984.1|  LOC100282604 precursor                             254   1e-78    Zea mays [maize]
ref|XP_004509043.1|  PREDICTED: probable xyloglucan endotransgluc...    254   1e-78    
ref|XP_006423881.1|  hypothetical protein CICLE_v10028851mg             254   1e-78    
ref|NP_001289208.1|  probable xyloglucan endotransglucosylase/hyd...    254   2e-78    
ref|XP_002993371.1|  hypothetical protein SELMODRAFT_136972             254   2e-78    
ref|XP_002320401.1|  xyloglucan endo-1 family protein                   254   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_010557646.1|  PREDICTED: xyloglucan endotransglucosylase/h...    254   2e-78    
ref|XP_008779173.1|  PREDICTED: xyloglucan endotransglucosylase/h...    254   2e-78    
gb|KDP32131.1|  hypothetical protein JCGZ_12592                         254   2e-78    
gb|AHC69919.1|  xyloglucan endotransglucosylase/hydrolase 1             254   2e-78    
pdb|1UMZ|A  Chain A, Xyloglucan Endotransglycosylase In Complex W...    253   2e-78    
gb|AAN87142.1|  xyloglucan endotransglycosylase precursor               253   3e-78    Populus tremula x Populus tremuloides
ref|XP_006487657.1|  PREDICTED: probable xyloglucan endotransgluc...    254   3e-78    
ref|NP_001280965.1|  probable xyloglucan endotransglucosylase/hyd...    253   3e-78    
ref|XP_006423880.1|  hypothetical protein CICLE_v10028851mg             254   3e-78    
ref|XP_009359838.1|  PREDICTED: probable xyloglucan endotransgluc...    254   4e-78    
gb|EYU23679.1|  hypothetical protein MIMGU_mgv1a011061mg                253   4e-78    
gb|ACD03216.1|  xyloglucan endotransglucosylase/hydrolase 6             253   4e-78    Actinidia deliciosa [Chinese gooseberry]
ref|XP_002304625.1|  EXGT1 family protein                               253   4e-78    Populus trichocarpa [western balsam poplar]
gb|KHN01716.1|  Putative xyloglucan endotransglucosylase/hydrolas...    253   4e-78    
ref|XP_003549996.1|  PREDICTED: probable xyloglucan endotransgluc...    253   4e-78    
ref|XP_006385866.1|  hypothetical protein POPTR_0003s15800g             253   4e-78    
ref|XP_004288290.1|  PREDICTED: probable xyloglucan endotransgluc...    253   5e-78    
ref|XP_002972756.1|  hypothetical protein SELMODRAFT_97913              253   6e-78    
ref|XP_003624546.1|  Xyloglucan endotransglucosylase/hydrolase          253   7e-78    
ref|XP_003517365.2|  PREDICTED: probable xyloglucan endotransgluc...    253   7e-78    
ref|XP_008369587.1|  PREDICTED: probable xyloglucan endotransgluc...    254   7e-78    
ref|XP_007223252.1|  hypothetical protein PRUPE_ppa009387mg             252   8e-78    
gb|KHN36328.1|  Putative xyloglucan endotransglucosylase/hydrolas...    252   8e-78    
ref|XP_002512703.1|  Xyloglucan endotransglucosylase/hydrolase pr...    253   9e-78    Ricinus communis
gb|ACD03215.1|  xyloglucan endotransglucosylase/hydrolase 5             252   9e-78    Actinidia deliciosa [Chinese gooseberry]
gb|ACA02823.1|  XET                                                     252   9e-78    Pyrus pyrifolia [sha li]
gb|ABK92523.1|  unknown                                                 252   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010032777.1|  PREDICTED: probable xyloglucan endotransgluc...    252   1e-77    
gb|KHG12145.1|  putative xyloglucan endotransglucosylase/hydrolase B    253   1e-77    
gb|KHG08923.1|  putative xyloglucan endotransglucosylase/hydrolase B    252   1e-77    
ref|XP_006844710.1|  hypothetical protein AMTR_s00016p00250350          252   1e-77    
ref|XP_010929528.1|  PREDICTED: probable xyloglucan endotransgluc...    251   2e-77    
ref|XP_010646543.1|  PREDICTED: putative xyloglucan endotransgluc...    251   2e-77    
ref|XP_004493114.1|  PREDICTED: probable xyloglucan endotransgluc...    251   2e-77    
emb|CAN73201.1|  hypothetical protein VITISV_006604                     251   2e-77    Vitis vinifera
ref|XP_011004327.1|  PREDICTED: probable xyloglucan endotransgluc...    251   2e-77    
ref|XP_011021810.1|  PREDICTED: probable xyloglucan endotransgluc...    251   2e-77    
gb|KHG03304.1|  putative xyloglucan endotransglucosylase/hydrolas...    251   2e-77    
emb|CDP15486.1|  unnamed protein product                                251   2e-77    
ref|XP_011020925.1|  PREDICTED: probable xyloglucan endotransgluc...    251   3e-77    
ref|XP_006446867.1|  hypothetical protein CICLE_v10016123mg             251   3e-77    
ref|XP_008372631.1|  PREDICTED: uncharacterized protein LOC103435981    266   3e-77    
gb|ADE42488.1|  xyloglucan endotransglucosylase/hydrolase 1             251   3e-77    
ref|XP_008222293.1|  PREDICTED: probable xyloglucan endotransgluc...    251   4e-77    
gb|ABM91063.1|  xyloglucan endotransglycosylase/hydrolase precurs...    250   4e-77    Populus tremula x Populus tremuloides
gb|AAW27915.1|  xyloglucan endotransglucosylase/hydrolase precursor     250   4e-77    Vigna radiata [mung bean]
gb|ABB72441.1|  xyloglucan endotransglucosylase                         250   4e-77    Betula pendula [white birch]
ref|XP_007155788.1|  hypothetical protein PHAVU_003G231900g             250   5e-77    
ref|XP_001752481.1|  predicted protein                                  250   5e-77    
ref|XP_011086906.1|  PREDICTED: probable xyloglucan endotransgluc...    250   5e-77    
ref|XP_003539234.1|  PREDICTED: probable xyloglucan endotransgluc...    250   5e-77    
ref|XP_007032093.1|  Xyloglucan endotransglucosylase/hydrolase 4        254   5e-77    
gb|KDP41894.1|  hypothetical protein JCGZ_26912                         250   5e-77    
ref|XP_002297895.1|  EXGT1 family protein                               250   6e-77    Populus trichocarpa [western balsam poplar]
gb|KHN13026.1|  Putative xyloglucan endotransglucosylase/hydrolas...    250   6e-77    
dbj|BAD93485.1|  pollen major allergen No.121 isoform 2                 250   6e-77    Cryptomeria japonica
gb|AAB39950.1|  xyloglucan endotransglycosylase                         250   7e-77    Tropaeolum majus
ref|XP_008237031.1|  PREDICTED: probable xyloglucan endotransgluc...    250   7e-77    
emb|CBI33049.3|  unnamed protein product                                249   7e-77    
gb|ADO24300.1|  xyloglucan endotransglucosylase/hydrolase               249   7e-77    
ref|XP_010693035.1|  PREDICTED: probable xyloglucan endotransgluc...    250   8e-77    
ref|XP_011099425.1|  PREDICTED: probable xyloglucan endotransgluc...    249   8e-77    
ref|XP_004292365.1|  PREDICTED: xyloglucan endotransglucosylase/h...    248   1e-76    
ref|XP_007047639.1|  Xyloglucan endotransglycosylase                    249   1e-76    
gb|ABB86296.1|  xyloglucan endotransglucosylase hydrolase               249   1e-76    Rosa x borboniana [Bourbon rose]
gb|AAC09388.1|  xyloglucan endotransglycosylase precursor               249   1e-76    Actinidia deliciosa [Chinese gooseberry]
ref|XP_009397067.1|  PREDICTED: probable xyloglucan endotransgluc...    249   1e-76    
ref|NP_001240246.1|  uncharacterized protein LOC100779122 precursor     249   1e-76    
ref|XP_002310324.1|  xyloglucan endotransglycosylase hydrolase 2 ...    249   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009799936.1|  PREDICTED: probable xyloglucan endotransgluc...    249   2e-76    
gb|EPS73414.1|  hypothetical protein M569_01341                         248   2e-76    
ref|NP_001291229.1|  probable xyloglucan endotransglucosylase/hyd...    249   2e-76    
ref|NP_001265913.1|  probable xyloglucan endotransglucosylase/hyd...    249   2e-76    
ref|XP_010028049.1|  PREDICTED: probable xyloglucan endotransgluc...    249   2e-76    
gb|KEH22615.1|  xyloglucan endotransglucosylase/hydrolase family ...    248   2e-76    
dbj|BAA34946.1|  EXGT1                                                  248   2e-76    Pisum sativum [garden pea]
gb|ADO24304.1|  putative xyloglucan endotransglucosylase/hydrolase      248   3e-76    
ref|XP_003624548.1|  Xyloglucan endotransglucosylase                    248   3e-76    
gb|AGC54941.1|  xyloglucan endotransglucosylase                         248   3e-76    
gb|ABK25883.1|  unknown                                                 248   4e-76    Picea sitchensis
ref|XP_009771873.1|  PREDICTED: probable xyloglucan endotransgluc...    248   4e-76    
ref|XP_007161789.1|  hypothetical protein PHAVU_001G098200g             248   5e-76    
ref|XP_003548047.1|  PREDICTED: LOW QUALITY PROTEIN: xyloglucan e...    247   6e-76    
ref|XP_002975683.1|  hypothetical protein SELMODRAFT_267868             247   7e-76    
sp|Q8LNZ5.1|XTHB_PHAAN  RecName: Full=Probable xyloglucan endotra...    247   7e-76    Vigna angularis [azuki bean]
ref|XP_008360204.1|  PREDICTED: xyloglucan endotransglucosylase/h...    247   7e-76    
ref|XP_002993509.1|  hypothetical protein SELMODRAFT_431582             247   8e-76    
gb|ABM91069.1|  xyloglucan endotransglycosylase/hydrolase precurs...    247   8e-76    Populus trichocarpa [western balsam poplar]
gb|ABM91067.1|  xyloglucan endotransglycosylase/hydrolase precurs...    247   8e-76    Populus tremula x Populus tremuloides
gb|KDP23230.1|  hypothetical protein JCGZ_23063                         247   9e-76    
gb|AIS86132.1|  xyloglucan endo-transglycosylase                        247   1e-75    
ref|XP_004250701.1|  PREDICTED: xyloglucan endotransglucosylase/h...    247   1e-75    
gb|KHN13413.1|  Xyloglucan endotransglucosylase/hydrolase protein A     247   1e-75    
ref|XP_009611317.1|  PREDICTED: probable xyloglucan endotransgluc...    247   1e-75    
gb|AEQ37176.1|  xyloglucan endotransglucosylase/hydrolase               246   1e-75    
gb|ABK22907.1|  unknown                                                 246   1e-75    Picea sitchensis
ref|XP_009338970.1|  PREDICTED: probable xyloglucan endotransgluc...    246   2e-75    
gb|EPS65701.1|  xyloglucan endotransglycosylase                         246   2e-75    
ref|XP_009353480.1|  PREDICTED: probable xyloglucan endotransgluc...    246   2e-75    
ref|XP_003624550.1|  Xyloglucan endotransglucosylase                    246   2e-75    
gb|AIS86152.1|  xyloglucan endo-transglycosylase                        246   2e-75    
ref|XP_009612426.1|  PREDICTED: probable xyloglucan endotransgluc...    246   2e-75    
gb|AIS86114.1|  xyloglucan endo-transglycosylase                        246   2e-75    
gb|AIS86119.1|  xyloglucan endo-transglycosylase                        246   3e-75    
gb|AIS86136.1|  xyloglucan endo-transglycosylase                        246   3e-75    
ref|XP_009354613.1|  PREDICTED: probable xyloglucan endotransgluc...    246   3e-75    
ref|XP_009628114.1|  PREDICTED: probable xyloglucan endotransgluc...    245   3e-75    
gb|ABY86635.1|  xyloglucan endotransglycosylase/hydrolase               245   4e-75    Gossypium raimondii
ref|XP_007049929.1|  Xyloglucan endotransglucosylase/hydrolase 4        248   4e-75    
gb|ADO24299.1|  xyloglucan endotransglucosylase/hydrolase               245   4e-75    
ref|XP_008344375.1|  PREDICTED: probable xyloglucan endotransgluc...    245   4e-75    
ref|XP_010249375.1|  PREDICTED: probable xyloglucan endotransgluc...    245   4e-75    
dbj|BAE06060.1|  xyloglucan endotransglucosylase/hydrolase              246   4e-75    Sagittaria pygmaea
ref|NP_001242225.1|  uncharacterized protein LOC100793686 precursor     245   4e-75    
gb|AAD39086.1|AF093507_1  xyloglucan endo-transglycosylase-like p...    244   4e-75    Medicago truncatula
gb|AFK39245.1|  unknown                                                 245   5e-75    
ref|NP_001280943.1|  probable xyloglucan endotransglucosylase/hyd...    245   5e-75    
gb|AFK39987.1|  unknown                                                 245   5e-75    
gb|ABE73118.1|  endo-transglycosylase                                   245   6e-75    Dianthus caryophyllus [carnation]
dbj|BAA21107.1|  endo-xyloglucan transferase                            244   7e-75    Gossypium hirsutum [American cotton]
ref|XP_009354593.1|  PREDICTED: probable xyloglucan endotransgluc...    245   7e-75    
gb|AAU89381.1|  xyloglucan endotransglycosylase hydrolase 1             244   7e-75    Medicago truncatula
ref|XP_007156682.1|  hypothetical protein PHAVU_002G008400g             244   8e-75    
gb|ACT67416.1|  xyloglucan endotransglycosylase                         244   9e-75    Shorea parvifolia subsp. parvifolia
gb|ABI37007.2|  xyloglucan endotransglycosylase                         244   9e-75    Medicago truncatula
ref|XP_003608566.1|  Xyloglucan endotransglycosylase hydrolase          244   9e-75    
ref|NP_001233858.1|  probable xyloglucan endotransglucosylase/hyd...    244   9e-75    
gb|AIS86126.1|  xyloglucan endo-transglycosylase                        244   9e-75    
gb|AAO92743.1|  xyloglucan endotransglycosylase                         244   9e-75    
ref|XP_006343507.1|  PREDICTED: xyloglucan endotransglucosylase/h...    244   9e-75    
gb|AIS86142.1|  xyloglucan endo-transglycosylase                        244   9e-75    
gb|AIS86125.1|  xyloglucan endo-transglycosylase                        244   1e-74    
gb|ABU41234.1|  xyloglucan endotransglycosylase                         244   1e-74    
ref|XP_003608572.1|  Xyloglucan endotransglycosylase hydrolase          245   1e-74    
ref|XP_009611598.1|  PREDICTED: probable xyloglucan endotransgluc...    244   1e-74    
gb|AIS86145.1|  xyloglucan endo-transglycosylase                        244   1e-74    
gb|AIS86121.1|  xyloglucan endo-transglycosylase                        244   1e-74    
gb|ABU41235.1|  xyloglucan endotransglycosylase                         244   1e-74    
ref|XP_007161790.1|  hypothetical protein PHAVU_001G098300g             244   1e-74    
gb|AIS86117.1|  xyloglucan endo-transglycosylase                        244   1e-74    
gb|KHG00928.1|  putative xyloglucan endotransglucosylase/hydrolas...    244   1e-74    
gb|AIS86115.1|  xyloglucan endo-transglycosylase                        244   1e-74    
gb|ABU41233.1|  xyloglucan endotransglycosylase                         244   1e-74    
gb|AFT92008.1|  xyloglucan endotransglycosylase                         244   1e-74    
gb|AFT92007.1|  xyloglucan endotransglycosylase                         244   1e-74    
gb|AEQ37177.1|  xyloglucan endotransglucosylase/hydrolase               244   1e-74    
gb|AIS86124.1|  xyloglucan endo-transglycosylase                        244   1e-74    
gb|AIS86151.1|  xyloglucan endo-transglycosylase                        244   1e-74    
ref|XP_002983749.1|  hypothetical protein SELMODRAFT_422922             245   2e-74    
ref|XP_009773101.1|  PREDICTED: probable xyloglucan endotransgluc...    244   2e-74    
gb|AIS86141.1|  xyloglucan endo-transglycosylase                        244   2e-74    
sp|Q41638.1|XTHA_PHAAN  RecName: Full=Xyloglucan endotransglucosy...    244   2e-74    
ref|XP_002990508.1|  hypothetical protein SELMODRAFT_428976             245   2e-74    
ref|XP_003551387.1|  PREDICTED: xyloglucan endotransglucosylase/h...    243   2e-74    
ref|XP_010250428.1|  PREDICTED: probable xyloglucan endotransgluc...    243   2e-74    
gb|ABB72442.1|  xyloglucan endotransglucosylase                         243   2e-74    
ref|XP_009792284.1|  PREDICTED: probable xyloglucan endotransgluc...    243   3e-74    
gb|AIS86146.1|  xyloglucan endo-transglycosylase                        243   3e-74    
gb|AIS86139.1|  xyloglucan endo-transglycosylase                        243   3e-74    
ref|XP_006845717.1|  hypothetical protein AMTR_s00019p00242730          243   3e-74    
ref|XP_007151620.1|  hypothetical protein PHAVU_004G062400g             243   4e-74    
gb|AIS86133.1|  xyloglucan endo-transglycosylase                        243   4e-74    
gb|ABK22987.1|  unknown                                                 243   4e-74    
gb|ADO24303.1|  putative xyloglucan endotransglucosylase/hydrolase      243   4e-74    
gb|AIS86140.1|  xyloglucan endo-transglycosylase                        242   5e-74    
ref|XP_008344370.1|  PREDICTED: probable xyloglucan endotransgluc...    243   5e-74    
gb|AIS86123.1|  xyloglucan endo-transglycosylase                        242   7e-74    
ref|XP_006344664.1|  PREDICTED: probable xyloglucan endotransgluc...    242   7e-74    
gb|AAU89382.1|  xyloglucan endotransglycosylase hydrolase 2             241   1e-73    
ref|XP_011073659.1|  PREDICTED: probable xyloglucan endotransgluc...    241   1e-73    
gb|KHN46820.1|  Putative xyloglucan endotransglucosylase/hydrolase      242   1e-73    
ref|XP_010099402.1|  putative xyloglucan endotransglucosylase/hyd...    241   1e-73    
gb|EYU44533.1|  hypothetical protein MIMGU_mgv1a011266mg                241   1e-73    
dbj|BAA03922.1|  endo-xyloglucan transferase                            241   1e-73    
gb|AIS86130.1|  xyloglucan endo-transglycosylase                        241   1e-73    
gb|ADJ67812.1|  xyloglucan endotransglycosylase                         241   1e-73    
gb|AIE54304.1|  xyloglucan endotransglucosylase-hydrolase XTH7          241   1e-73    
gb|AFN71023.1|  xyloglucan endotransglucosylase/hydrolase               241   2e-73    
gb|AEK32594.1|  xyloglucan endotransglucosylase/hydrolase               241   2e-73    
ref|XP_010112970.1|  putative xyloglucan endotransglucosylase/hyd...    241   2e-73    
ref|XP_010245633.1|  PREDICTED: probable xyloglucan endotransgluc...    241   2e-73    
ref|XP_002438132.1|  hypothetical protein SORBIDRAFT_10g008550          241   2e-73    
gb|ABK21095.1|  unknown                                                 241   2e-73    
ref|XP_002863781.1|  predicted protein                                  238   4e-73    
ref|XP_010248304.1|  PREDICTED: probable xyloglucan endotransgluc...    240   4e-73    
ref|XP_006363788.1|  PREDICTED: probable xyloglucan endotransgluc...    240   4e-73    
gb|KEH25618.1|  xyloglucan endotransglucosylase/hydrolase family ...    240   5e-73    
ref|XP_003553991.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    240   5e-73    
ref|NP_001234475.1|  xyloglucan endotransglucosylase-hydrolase XTH7     240   5e-73    
gb|AIS86138.1|  xyloglucan endo-transglycosylase                        239   5e-73    
dbj|BAB17788.1|  xyloglucan endotransglycosylase                        239   7e-73    
ref|NP_195494.1|  xyloglucan endotransglucosylase/hydrolase prote...    239   8e-73    
gb|AIS86153.1|  xyloglucan endo-transglycosylase                        239   8e-73    
ref|XP_004489741.1|  PREDICTED: xyloglucan endotransglucosylase/h...    239   9e-73    
gb|AGL76311.1|  xyloglucan endotransglycosylase/hydrolase 1             237   9e-73    
ref|XP_003553992.1|  PREDICTED: probable xyloglucan endotransgluc...    239   9e-73    
ref|XP_001781670.1|  predicted protein                                  238   1e-72    
gb|ADO24302.1|  putative xyloglucan endotransglucosylase/hydrolase      239   1e-72    
dbj|BAO57277.1|  xyloglucan endotransglucosylase/hydrolase              239   1e-72    
gb|KGN65066.1|  Xyloglucan endotransglycosylase                         239   1e-72    
ref|XP_004172513.1|  PREDICTED: probable xyloglucan endotransgluc...    239   1e-72    
gb|ADK92389.1|  xyloglucan endotransglycosylase                         239   2e-72    
ref|XP_008458950.1|  PREDICTED: probable xyloglucan endotransgluc...    238   2e-72    
ref|NP_001242655.1|  xyloglucan endotransglucosylase/hydrolase 1 ...    238   2e-72    
emb|CAN79775.1|  hypothetical protein VITISV_013613                     238   2e-72    
gb|ABK23987.1|  unknown                                                 238   3e-72    
ref|XP_009392942.1|  PREDICTED: probable xyloglucan endotransgluc...    238   3e-72    
ref|XP_009412280.1|  PREDICTED: probable xyloglucan endotransgluc...    238   3e-72    
ref|XP_009138533.1|  PREDICTED: probable xyloglucan endotransgluc...    238   3e-72    
ref|XP_009415319.1|  PREDICTED: probable xyloglucan endotransgluc...    237   6e-72    
gb|KEH25621.1|  xyloglucan endotransglucosylase/hydrolase family ...    237   7e-72    
gb|KGN65065.1|  Xyloglucan endotransglycosylase/hydrolase               236   1e-71    
ref|XP_006411851.1|  hypothetical protein EUTSA_v10025884mg             236   1e-71    
gb|AAM62514.1|  endo-xyloglucan transferase-like protein                236   1e-71    
ref|XP_010550327.1|  PREDICTED: probable xyloglucan endotransgluc...    236   1e-71    
ref|XP_007140638.1|  hypothetical protein PHAVU_008G129100g             236   1e-71    
ref|XP_008235461.1|  PREDICTED: xyloglucan endotransglucosylase/h...    236   2e-71    
gb|ACB86852.1|  xyloglucan endotransglycosylase                         236   2e-71    
emb|CDX77377.1|  BnaA07g05150D                                          236   2e-71    
ref|XP_004965095.1|  PREDICTED: xyloglucan endotransglucosylase/h...    236   2e-71    
ref|NP_001150467.1|  xyloglucan endotransglucosylase/hydrolase pr...    236   3e-71    
ref|XP_002866931.1|  hypothetical protein ARALYDRAFT_490836             235   3e-71    
ref|XP_008781817.1|  PREDICTED: probable xyloglucan endotransgluc...    235   3e-71    
gb|ABK22955.1|  unknown                                                 235   4e-71    
ref|XP_010456523.1|  PREDICTED: probable xyloglucan endotransgluc...    241   4e-71    
ref|XP_002961421.1|  hypothetical protein SELMODRAFT_403283             235   4e-71    
ref|XP_006426162.1|  hypothetical protein CICLE_v10026210mg             235   4e-71    
ref|XP_009372549.1|  PREDICTED: LOW QUALITY PROTEIN: putative xyl...    234   6e-71    
gb|ABK21757.1|  unknown                                                 234   6e-71    
gb|ADE76172.1|  unknown                                                 233   1e-70    
ref|XP_010437183.1|  PREDICTED: probable xyloglucan endotransgluc...    234   1e-70    
ref|XP_006284228.1|  hypothetical protein CARUB_v10005387mg             233   1e-70    
gb|KDO78788.1|  hypothetical protein CISIN_1g022933mg                   233   1e-70    
ref|XP_010446621.1|  PREDICTED: probable xyloglucan endotransgluc...    233   2e-70    
ref|XP_008458951.1|  PREDICTED: probable xyloglucan endotransgluc...    233   2e-70    
ref|XP_010432029.1|  PREDICTED: probable xyloglucan endotransgluc...    233   2e-70    
ref|XP_002990282.1|  hypothetical protein SELMODRAFT_131314             233   2e-70    
ref|XP_010555436.1|  PREDICTED: probable xyloglucan endotransgluc...    233   2e-70    
ref|XP_006280895.1|  hypothetical protein CARUB_v10026888mg             233   2e-70    
ref|XP_010463516.1|  PREDICTED: probable xyloglucan endotransgluc...    233   2e-70    
ref|XP_006385865.1|  hypothetical protein POPTR_0003s15800g             230   2e-70    
ref|XP_010913699.1|  PREDICTED: probable xyloglucan endotransgluc...    233   3e-70    
ref|XP_004137572.1|  PREDICTED: xyloglucan endotransglucosylase/h...    232   3e-70    
ref|XP_002980921.1|  hypothetical protein SELMODRAFT_178522             232   3e-70    
gb|KFK30391.1|  hypothetical protein AALP_AA7G254800                    233   3e-70    
ref|XP_010646925.1|  PREDICTED: probable xyloglucan endotransgluc...    232   4e-70    
gb|AFW85196.1|  xyloglucan endotransglucosylase/hydrolase protein 1     235   4e-70    
gb|KCW49117.1|  hypothetical protein EUGRSUZ_K02715                     231   5e-70    
ref|XP_002264467.1|  PREDICTED: xyloglucan endotransglucosylase/h...    232   5e-70    
ref|XP_004139618.1|  PREDICTED: probable xyloglucan endotransgluc...    236   5e-70    
emb|CBI35290.3|  unnamed protein product                                231   5e-70    
emb|CDP02651.1|  unnamed protein product                                232   6e-70    
ref|XP_002863178.1|  predicted protein                                  230   7e-70    
ref|XP_001781705.1|  predicted protein                                  232   7e-70    
ref|XP_007199472.1|  hypothetical protein PRUPE_ppa027154mg             231   9e-70    
gb|KDO47298.1|  hypothetical protein CISIN_1g042925mg                   231   1e-69    
ref|XP_007013098.1|  Xyloglucan endotransglucosylase/hydrolase 26       231   1e-69    
ref|XP_008235460.1|  PREDICTED: xyloglucan endotransglucosylase/h...    230   2e-69    
gb|EMT31175.1|  Putative xyloglucan endotransglucosylase/hydrolase      230   2e-69    
ref|XP_002961354.1|  hypothetical protein SELMODRAFT_140273             230   2e-69    
dbj|BAC58038.1|  xyloglucan endotransglycosylase                        232   2e-69    
emb|CDY31620.1|  BnaA03g54320D                                          231   2e-69    
gb|AAM61529.1|  xyloglucan endo-transglycosylase-like protein           231   2e-69    
gb|ADE77510.1|  unknown                                                 230   2e-69    
gb|ADE75863.1|  unknown                                                 229   4e-69    
ref|XP_001752377.1|  predicted protein                                  229   4e-69    
gb|ADJ00314.1|  xyloglucan endotransglycosylase/hydrolase               230   4e-69    
gb|EMT32589.1|  Putative xyloglucan endotransglucosylase/hydrolas...    230   4e-69    
ref|XP_006436848.1|  hypothetical protein CICLE_v10033360mg             229   4e-69    
emb|CAA16685.1|  endoxyloglucan tranferase-like protein                 229   4e-69    
ref|XP_007035457.1|  Xyloglucan endotransglucosylase/hydrolase 2,...    229   5e-69    
ref|XP_006493257.1|  PREDICTED: putative xyloglucan endotransgluc...    229   5e-69    
ref|XP_010936207.1|  PREDICTED: probable xyloglucan endotransgluc...    232   5e-69    
ref|XP_002864977.1|  hypothetical protein ARALYDRAFT_496809             229   5e-69    
ref|XP_009150664.1|  PREDICTED: probable xyloglucan endotransgluc...    229   5e-69    
ref|XP_002967373.1|  hypothetical protein SELMODRAFT_86718              229   5e-69    
emb|CDY45623.1|  BnaCnng13310D                                          229   6e-69    
ref|NP_569019.1|  probable xyloglucan endotransglucosylase/hydrol...    229   7e-69    
ref|XP_010241004.1|  PREDICTED: xyloglucan endotransglucosylase/h...    229   7e-69    
ref|XP_010227807.1|  PREDICTED: putative xyloglucan endotransgluc...    229   1e-68    
gb|KFK28426.1|  hypothetical protein AALP_AA8G513200                    228   1e-68    
ref|XP_002522701.1|  Xyloglucan endotransglucosylase/hydrolase pr...    228   1e-68    
ref|XP_010522666.1|  PREDICTED: xyloglucan endotransglucosylase/h...    228   1e-68    
ref|XP_006393992.1|  hypothetical protein EUTSA_v10004708mg             228   2e-68    
gb|EMS62815.1|  Putative xyloglucan endotransglucosylase/hydrolas...    228   3e-68    
ref|XP_010547938.1|  PREDICTED: probable xyloglucan endotransgluc...    228   3e-68    
ref|XP_006360548.1|  PREDICTED: xyloglucan endotransglucosylase/h...    228   3e-68    
ref|XP_002987439.1|  hypothetical protein SELMODRAFT_126128             227   4e-68    
ref|XP_010267848.1|  PREDICTED: xyloglucan endotransglucosylase/h...    227   4e-68    
ref|XP_010542880.1|  PREDICTED: xyloglucan endotransglucosylase/h...    227   5e-68    
gb|EYU22273.1|  hypothetical protein MIMGU_mgv1a021830mg                227   6e-68    
ref|XP_006848861.1|  hypothetical protein AMTR_s00026p00217290          226   7e-68    
ref|XP_002319953.1|  Xyloglucan endotransglucosylase/hydrolase pr...    226   7e-68    
ref|XP_004243432.1|  PREDICTED: xyloglucan endotransglucosylase/h...    227   7e-68    
gb|AAT84462.1|  putative xyloglucan endotransglucosylase/hydrolase      226   7e-68    
ref|XP_007200513.1|  hypothetical protein PRUPE_ppa009365mg             226   7e-68    
ref|XP_009787021.1|  PREDICTED: xyloglucan endotransglucosylase/h...    226   1e-67    
ref|XP_006447447.1|  hypothetical protein CICLE_v10016129mg             226   1e-67    
ref|XP_009631396.1|  PREDICTED: xyloglucan endotransglucosylase/h...    225   1e-67    
ref|XP_009631323.1|  PREDICTED: xyloglucan endotransglucosylase/h...    226   1e-67    
gb|AHA84254.1|  putative xyloglucan endotransglucosylase/hydrolas...    226   1e-67    
gb|EYU18352.1|  hypothetical protein MIMGU_mgv1a011021mg                226   1e-67    
gb|AAZ08349.1|  xyloglucan endotransglycosylase/hydrolase 16 protein    224   2e-67    
ref|XP_011076837.1|  PREDICTED: xyloglucan endotransglucosylase/h...    225   3e-67    
ref|XP_008372630.1|  PREDICTED: putative xyloglucan endotransgluc...    225   3e-67    
gb|KDO47741.1|  hypothetical protein CISIN_1g022821mg                   225   3e-67    
dbj|BAD93484.1|  pollen major allergen No.121 isoform 1                 224   3e-67    
ref|XP_008438172.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   3e-67    
ref|XP_006467988.1|  PREDICTED: probable xyloglucan endotransgluc...    225   4e-67    
dbj|BAN09212.1|  xyloglucan endotransglucosylase/hydrolase              224   4e-67    
ref|XP_002960341.1|  hypothetical protein SELMODRAFT_75136              224   4e-67    
gb|EPS63747.1|  xyloglucan endotransglucosylase/hydrolase 4             224   4e-67    
ref|XP_009419605.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   5e-67    
ref|XP_011020999.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   6e-67    
ref|XP_001773859.1|  predicted protein                                  225   6e-67    
ref|XP_002980048.1|  hypothetical protein SELMODRAFT_233454             224   6e-67    
ref|XP_009622694.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   6e-67    
ref|XP_003620659.1|  Xyloglucan endotransglycosylase                    224   7e-67    
ref|XP_009605698.1|  PREDICTED: probable xyloglucan endotransgluc...    224   7e-67    
ref|XP_009356065.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   7e-67    
ref|XP_010101479.1|  putative xyloglucan endotransglucosylase/hyd...    224   7e-67    
ref|XP_008790430.1|  PREDICTED: probable xyloglucan endotransgluc...    224   7e-67    
ref|XP_009788432.1|  PREDICTED: probable xyloglucan endotransgluc...    230   7e-67    
dbj|BAJ10396.1|  xyloglucan endotransglucosylase/hydrolase              224   8e-67    
gb|AAC06021.1|  xyloglucan endotransglycosylase precursor               223   8e-67    
gb|KEH43921.1|  xyloglucan endotransglucosylase/hydrolase family ...    224   9e-67    
emb|CDO98590.1|  unnamed protein product                                224   9e-67    
ref|XP_002280688.1|  PREDICTED: probable xyloglucan endotransgluc...    223   1e-66    
gb|KDO49501.1|  hypothetical protein CISIN_1g022638mg                   224   1e-66    
gb|ABK22283.1|  unknown                                                 223   1e-66    
ref|XP_004965473.1|  PREDICTED: xyloglucan endotransglucosylase/h...    222   1e-66    
ref|XP_006422726.1|  hypothetical protein CICLE_v10029863mg             224   1e-66    
ref|XP_007015532.1|  Xyloglucan endotransglucosylase/hydrolase 4        224   1e-66    
gb|ABK23125.1|  unknown                                                 223   1e-66    
gb|AEQ37178.1|  xyloglucan endotransglucosylase/hydrolase               223   1e-66    
ref|XP_011100317.1|  PREDICTED: xyloglucan endotransglucosylase/h...    223   1e-66    
ref|XP_009364685.1|  PREDICTED: probable xyloglucan endotransgluc...    223   2e-66    
ref|XP_009631460.1|  PREDICTED: xyloglucan endotransglucosylase/h...    221   2e-66    
gb|ABM91074.1|  xyloglucan endotransglycosylase/hydrolase precurs...    223   2e-66    
gb|ADE76299.1|  unknown                                                 223   2e-66    
ref|XP_010677534.1|  PREDICTED: probable xyloglucan endotransgluc...    223   2e-66    
ref|XP_010245632.1|  PREDICTED: probable xyloglucan endotransgluc...    223   2e-66    
ref|XP_002326087.2|  Xyloglucan endotransglucosylase/hydrolase pr...    223   2e-66    
ref|XP_006449090.1|  hypothetical protein CICLE_v10015776mg             224   2e-66    
ref|XP_010065854.1|  PREDICTED: probable xyloglucan endotransgluc...    223   2e-66    
ref|XP_009346542.1|  PREDICTED: probable xyloglucan endotransgluc...    223   2e-66    
ref|XP_009405007.1|  PREDICTED: xyloglucan endotransglucosylase/h...    223   3e-66    
gb|EMT24012.1|  Xyloglucan endotransglucosylase/hydrolase protein 2     222   3e-66    



>ref|XP_006443586.1| hypothetical protein CICLE_v10023425mg [Citrus clementina]
 ref|XP_006479337.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Citrus sinensis]
 gb|ESR56826.1| hypothetical protein CICLE_v10023425mg [Citrus clementina]
Length=288

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/264 (66%), Positives = 210/264 (80%), Gaps = 4/264 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV FD NY++ WGN+HV S +QGR IQL MD+SSGSGF SK  YGSG F ++MK+P  D+
Sbjct  26   DVKFDQNYYITWGNDHVLSLNQGRAIQLSMDRSSGSGFGSKLHYGSGFFHLKMKLPDKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYLTS   D+HDELDFEFLGNRE KP+TLQTN+ A GVGNREQR++LWFDP AD
Sbjct  86   AGIVTAFYLTSQG-DKHDELDFEFLGNREGKPITLQTNVFANGVGNREQRMHLWFDPTAD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+YKILWN HQIVFYVD++PIRVFKN ENIGV YPS   +QI+ SLWN ESWATDGG+ 
Sbjct  145  FHTYKILWNPHQIVFYVDDVPIRVFKNLENIGVGYPS-KPMQIEASLWNGESWATDGGRT  203

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSN-DINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
            KI+W+ APFKA FQGF++ GC AD   N  I RC+S   YWWNS+K W L+  ++ +Y  
Sbjct  204  KIDWTHAPFKAHFQGFDISGCPADDDQNRSIQRCYS-SQYWWNSEKFWKLHSTQKAKYEN  262

Query  210  VRRNFMHYDYCADLPRFPTLPPEC  139
            VR+N+M+YDYC+D PR+P  P EC
Sbjct  263  VRKNYMYYDYCSDRPRYPHPPKEC  286



>ref|XP_011024647.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Populus euphratica]
Length=272

 Score =   331 bits (848),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 211/265 (80%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D SFD NY + WG +HV S D+GR+IQL +D SSG+GF SK S+GSG  ++R+K+PG D+
Sbjct  12   DASFDQNYDITWGYDHVKSLDEGRQIQLSLDHSSGAGFGSKLSFGSGFIDMRIKLPGKDS  71

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYLTS++ + HDELDFEFLGNRE KP+TLQTN+ A G GNREQR+YLWFDPAAD
Sbjct  72   AGVVTAFYLTSHS-NNHDELDFEFLGNREGKPITLQTNVFANGQGNREQRMYLWFDPAAD  130

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSYKILWNQ+QIVFYVD+ PIRVFKN  NIGV YPS   +QI+ SLWN +SWATDGG+ 
Sbjct  131  FHSYKILWNQYQIVFYVDDTPIRVFKNHTNIGVSYPS-QPMQIEASLWNGDSWATDGGQT  189

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APF+A FQGF+++GC+ D +  ++  C+S  +YWWN++K W+L+   +  Y  V
Sbjct  190  KTNWSHAPFQAHFQGFDINGCS-DHQEPNVEPCYST-SYWWNTQKYWTLDSAHQRAYENV  247

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ ++ YDYC+D PR+PT PPEC +
Sbjct  248  RKKYLTYDYCSDRPRYPTPPPECPQ  272



>ref|XP_002301792.2| xyloglucan endotransglucosylase/hydrolase protein 3 precursor 
[Populus trichocarpa]
 gb|EEE81065.2| xyloglucan endotransglucosylase/hydrolase protein 3 precursor 
[Populus trichocarpa]
Length=272

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 209/265 (79%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D SFD NY + WG +HV S D+GR+IQL +D SSGSGF SK  +GSG   +R+K+PG D+
Sbjct  12   DASFDQNYDITWGYDHVKSLDEGRQIQLSLDHSSGSGFGSKLGFGSGFINMRIKLPGKDS  71

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYLTS++ + HDELDFEFLGNRE KP+TLQTN+ A G GNREQR++LWFDPAAD
Sbjct  72   AGVVTAFYLTSHSNN-HDELDFEFLGNREGKPITLQTNVFANGRGNREQRMHLWFDPAAD  130

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSYKILWNQ+QIVFYVD+ PIRVFKN  NIGV YPS   +QI+ SLWN ESWATDGG  
Sbjct  131  FHSYKILWNQYQIVFYVDDTPIRVFKNHTNIGVSYPS-QPMQIEASLWNGESWATDGGHT  189

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINWS APF+A FQGF+++GC+ D +  ++  C+S  +YWWN++K W+L+   +  Y  V
Sbjct  190  KINWSHAPFQAHFQGFDINGCS-DHQQPNVQPCYST-SYWWNTRKYWTLDSARQRAYENV  247

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ ++ YDYC+D PR+PT PPEC +
Sbjct  248  RKKYLTYDYCSDRPRYPTPPPECPQ  272



>ref|XP_011024646.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2 [Populus euphratica]
Length=293

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 211/265 (80%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D SFD NY + WG +HV S D+GR+IQL +D SSG+GF SK S+GSG  ++R+K+PG D+
Sbjct  33   DASFDQNYDITWGYDHVKSLDEGRQIQLSLDHSSGAGFGSKLSFGSGFIDMRIKLPGKDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYLTS++ + HDELDFEFLGNRE KP+TLQTN+ A G GNREQR+YLWFDPAAD
Sbjct  93   AGVVTAFYLTSHSNN-HDELDFEFLGNREGKPITLQTNVFANGQGNREQRMYLWFDPAAD  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSYKILWNQ+QIVFYVD+ PIRVFKN  NIGV YPS   +QI+ SLWN +SWATDGG+ 
Sbjct  152  FHSYKILWNQYQIVFYVDDTPIRVFKNHTNIGVSYPS-QPMQIEASLWNGDSWATDGGQT  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APF+A FQGF+++GC+ D +  ++  C+S  +YWWN++K W+L+   +  Y  V
Sbjct  211  KTNWSHAPFQAHFQGFDINGCS-DHQEPNVEPCYST-SYWWNTQKYWTLDSAHQRAYENV  268

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ ++ YDYC+D PR+PT PPEC +
Sbjct  269  RKKYLTYDYCSDRPRYPTPPPECPQ  293



>ref|XP_002521076.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF41227.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=285

 Score =   329 bits (843),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 205/262 (78%), Gaps = 4/262 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD  Y V WG +HV   +QG+EIQL MDKSSG+GF SK S+GSG F +R+++P  D+AGV
Sbjct  28   FDQTYQVTWGKDHVLPLNQGKEIQLSMDKSSGAGFGSKLSFGSGFFHLRIRLPPKDSAGV  87

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT++YLTS+  D HDELDFEFLGNRE KP+TLQTN+ A G+GNREQR+YLWFDPAADFH+
Sbjct  88   VTAYYLTSHG-DNHDELDFEFLGNREGKPITLQTNVFANGLGNREQRMYLWFDPAADFHN  146

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            YKILWNQHQIVF+VD+IPIRVFKNK NIGV YPS   +QI+ SLW+ +SWATDGG+ K N
Sbjct  147  YKILWNQHQIVFFVDDIPIRVFKNKTNIGVSYPS-KPMQIEASLWDGDSWATDGGQTKTN  205

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            WS APF+A FQGF++ GC+  P++ +   C S   YWWNS K W LN  +R  Y  VR+ 
Sbjct  206  WSHAPFQAHFQGFDISGCSL-PETPNTQPCSSH-KYWWNSDKYWQLNSTQRKTYQDVRKK  263

Query  198  FMHYDYCADLPRFPTLPPECKR  133
            ++ YDYC+D PRFPT PPEC +
Sbjct  264  YLTYDYCSDRPRFPTPPPECPQ  285



>ref|XP_007049742.1| Xyloglucan endotransglucosylase/hydrolase 2 [Theobroma cacao]
 gb|EOX93899.1| Xyloglucan endotransglucosylase/hydrolase 2 [Theobroma cacao]
Length=286

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 204/262 (78%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V FD NY + WG +HV   +QGRE+QL MD SSG+GF SK  YGSG F++R+K+P  D+A
Sbjct  26   VRFDENYEITWGYDHVLLFNQGREVQLSMDISSGAGFGSKLRYGSGFFQMRIKLPPKDSA  85

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GV+T+FYLTS   D+HDELD EFLGNRE KP+TLQTN+ A+GVGNREQRI LWFDP A+F
Sbjct  86   GVITAFYLTSQG-DKHDELDLEFLGNREGKPITLQTNVFADGVGNREQRILLWFDPTANF  144

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y+ILWNQHQIVFYVDN+PIRVFKN +NIGV YPS  A+Q++ SLW+ +SWATDGGK K
Sbjct  145  HTYQILWNQHQIVFYVDNVPIRVFKNNKNIGVGYPS-QAVQVEASLWDGDSWATDGGKTK  203

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             NWS APFKA FQGF++ GC     SN +  C+S   YWWNS+K W L+ +++++   VR
Sbjct  204  TNWSMAPFKAHFQGFDIGGCPIIQNSN-VQECYSP-KYWWNSEKYWKLDSKQQIELENVR  261

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M YDYC+D PR+P  PPEC
Sbjct  262  NKYMSYDYCSDRPRYPVPPPEC  283



>gb|KDP26372.1| hypothetical protein JCGZ_17530 [Jatropha curcas]
Length=284

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 197/263 (75%), Gaps = 8/263 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D+SFD NY V WG +HV S  QGR++QL MDK SG+GF SK S+GSG F +R+K+PG+D+
Sbjct  25   DISFDQNYEVTWGYDHVLSLHQGRQVQLSMDKYSGAGFGSKLSFGSGFFHLRIKLPGNDS  84

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYLTS   D HDELDFEFLGN+E KP+TLQTN+ A G+GNREQRIYLWFDP  D
Sbjct  85   AGVVTAFYLTSQG-DNHDELDFEFLGNKEGKPITLQTNVFANGLGNREQRIYLWFDPTKD  143

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY+ILWNQHQIVF+VD IPIRVF N    GV YPS H ++++ SLW+ +SWATDGG+ 
Sbjct  144  FHSYRILWNQHQIVFFVDEIPIRVFNNNTKFGVSYPS-HPMKVEASLWDGDSWATDGGQT  202

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APFKA F GF++ GC     S+ I +C S   YWWN +K W L+  ++  Y  V
Sbjct  203  KTNWSNAPFKAHFLGFDISGC-----SSKIQQCLSPN-YWWNVQKYWKLDLAQQRAYENV  256

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R  F+ YDYC D PRFP  PPEC
Sbjct  257  RNKFLTYDYCFDRPRFPVTPPEC  279



>ref|XP_010069639.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Eucalyptus grandis]
 gb|KCW58052.1| hypothetical protein EUGRSUZ_H00787 [Eucalyptus grandis]
Length=284

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 201/262 (77%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             SFD NY + WG +H+T  D G+EIQL MD SSGSGFASK SYGSG F + MK+PG ++A
Sbjct  27   ASFDENYRITWGYDHITPLDGGQEIQLSMDASSGSGFASKKSYGSGFFHMEMKLPGRNSA  86

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYL  +  +RHDELDFEFLGNRE KP+TLQTN+ A GVGNREQR  LWFDP ADF
Sbjct  87   GVVTTFYLILHG-NRHDELDFEFLGNREGKPITLQTNVFANGVGNREQRFLLWFDPTADF  145

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSYKILWN HQIVFYVD+IPIRVFKN + IGV YP+   +QI+ +LWN +SWATDGG+ K
Sbjct  146  HSYKILWNHHQIVFYVDDIPIRVFKNNKRIGVPYPT-QPMQIEATLWNGDSWATDGGQTK  204

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS APF+A+++GFN+ GC  + +S D   C+S  AYWWNS   WSL+ E+  Q   VR
Sbjct  205  IDWSYAPFRAQYRGFNISGC--EFQSQDPRHCYS-SAYWWNSWSHWSLDEEQDRQLDNVR  261

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
            +NFM YDYC D  R+P  PPEC
Sbjct  262  KNFMSYDYCTDRSRYPVPPPEC  283



>ref|XP_011087433.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Sesamum indicum]
Length=302

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 193/263 (73%), Gaps = 3/263 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D  FD +Y V WGN+HV   DQGR +QL MDK SG+GFASK SYGSG F +R+K+P  D+
Sbjct  37   DAPFDVSYAVSWGNDHVLFLDQGRHVQLSMDKRSGAGFASKLSYGSGFFHLRIKLPNKDS  96

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGV+T+FYL S +   HDELDFEFLGN+E KP+TLQTN+ A G G+REQR +LWFDP A 
Sbjct  97   AGVITAFYLRSKSNAHHDELDFEFLGNKEGKPITLQTNLYANGKGDREQRFHLWFDPTAH  156

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+YKILWN+HQIVFYVDNIPIRVFKN   IGV YP+  A++I  SLW+ ESWATDGG+ 
Sbjct  157  FHTYKILWNEHQIVFYVDNIPIRVFKNTTKIGVMYPT-QAMKIDVSLWDGESWATDGGQT  215

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APF A+FQGFNV+GC A    +  N C++   YWWN  K W L  + +  Y + 
Sbjct  216  KTNWSCAPFTADFQGFNVNGCAAAAHQSS-NACYAS-KYWWNRSKFWKLGHKRKQIYEQA  273

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R  +M+YDYC D  R P +PPEC
Sbjct  274  RNKYMYYDYCDDRDRHPIVPPEC  296



>ref|XP_003530856.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Glycine max]
Length=286

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 198/263 (75%), Gaps = 4/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            ++SFD NY V WG+NHV S +QG+EIQL MD SSGSGF SK SYGSG F +R+KVP  ++
Sbjct  27   EISFDQNYEVTWGDNHVVSLNQGKEIQLTMDNSSGSGFGSKMSYGSGLFHLRIKVPDRNS  86

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT++YLTS     HDELDFEFLGNRE KP  LQTN+  +G GNREQRI LWFDP AD
Sbjct  87   AGVVTAYYLTSQGRS-HDELDFEFLGNREGKPYRLQTNVFVDGQGNREQRILLWFDPTAD  145

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y+ILWNQHQIVFYVDNIPIRV+KNK +IGV YP+   +QI+ SLW+ +SWAT+GGK 
Sbjct  146  FHNYRILWNQHQIVFYVDNIPIRVYKNKSDIGVGYPT-KPMQIQASLWDGDSWATNGGKT  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS APF+A FQGF+V GC   P SN    C S   YWWN++K W L+   + QY +V
Sbjct  205  KTDWSYAPFRASFQGFDVSGCQV-PTSNISQNC-SSDKYWWNTQKFWRLDSVRQRQYERV  262

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            +  +M Y YCAD  R+P +P EC
Sbjct  263  KHKYMTYGYCADRNRYPEIPLEC  285



>ref|XP_003632454.1| PREDICTED: putative xyloglucan endotransglucosylase/hydrolase 
protein 1 [Vitis vinifera]
 emb|CBI33008.3| unnamed protein product [Vitis vinifera]
Length=280

 Score =   311 bits (797),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 201/265 (76%), Gaps = 8/265 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D++FD +Y + WGN+HV S +QGR +QL +D+SSG+GFASK SYGSG F +R+K+P  D+
Sbjct  24   DITFDQSYRITWGNDHVLSLNQGRLVQLSLDQSSGAGFASKQSYGSGFFHMRIKLPPKDS  83

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT++YLTS+T++ HDELDFEFLGN+E KP TLQTN+ + G G+REQRI LWFDP AD
Sbjct  84   AGVVTAYYLTSHTKN-HDELDFEFLGNKEGKPYTLQTNVFSNGQGDREQRILLWFDPTAD  142

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSYKILWNQHQIVFYVD+IPIRVFKN  NIGV YPS   +QI+GSLWN ESWATDGG+ 
Sbjct  143  FHSYKILWNQHQIVFYVDDIPIRVFKNNSNIGVDYPS-QPMQIEGSLWNGESWATDGGQT  201

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APF+  FQGF +DGC +     D + C S    WWN KK W L+  ++  +  V
Sbjct  202  KTNWSCAPFRTHFQGFRIDGCPS-----DYSNCHSSNL-WWNQKKFWKLDSTQQKAHENV  255

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +M+YDYC+D  RF   P EC +
Sbjct  256  RNKYMNYDYCSDTNRFAVRPKECTQ  280



>gb|KCW58053.1| hypothetical protein EUGRSUZ_H00788 [Eucalyptus grandis]
Length=281

 Score =   311 bits (796),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 199/262 (76%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             SFD NY + WG +HV   D G+EIQL MD SSGSGFASK SY SG F + +K+PG ++A
Sbjct  24   TSFDENYQITWGYDHVAPLDGGQEIQLSMDASSGSGFASKKSYRSGFFNMEIKLPGRNSA  83

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+F+LTS   DR DELDFEFLGNRE KP+TLQTN+  +GVGNREQR  LWFDP ADF
Sbjct  84   GVVTTFFLTSQG-DRRDELDFEFLGNREGKPITLQTNVFVDGVGNREQRFLLWFDPTADF  142

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSYKILWN HQIVFYVD+IPIRVF+NK+ I V YP+   +QI+ SLWN +SW TDGG+ K
Sbjct  143  HSYKILWNHHQIVFYVDDIPIRVFENKKRIRVPYPT-QPMQIEASLWNGDSWVTDGGQTK  201

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS APF+A+++GF+V GC  + +S D   C+S  AYWWNS   WSL+ E+  Q   VR
Sbjct  202  IDWSYAPFQAQYRGFDVSGC--EFQSQDPRHCYS-SAYWWNSWSHWSLDEEQNRQLENVR  258

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
            +NFM+YDYC D  R+P  PPEC
Sbjct  259  KNFMNYDYCTDRSRYPVPPPEC  280



>gb|KDO65954.1| hypothetical protein CISIN_1g041460mg, partial [Citrus sinensis]
Length=262

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 190/238 (80%), Gaps = 4/238 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV FD NY++ WGN+HV S +QGR IQL MD+SSGSGF SK  YGSG F ++MK+P  D+
Sbjct  26   DVKFDQNYYITWGNDHVLSLNQGRAIQLSMDRSSGSGFGSKLHYGSGFFHLKMKLPDKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYLTS   D+HDELDFEFLGNRE KP+TLQTN+ A GVGNREQR++LWFDP AD
Sbjct  86   AGIVTAFYLTSQG-DKHDELDFEFLGNREGKPITLQTNVFANGVGNREQRMHLWFDPTAD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+YKILWN HQIVFYVD++PIRVFKN E+IGV YPS   +QI+ SLWN ESWATDGG+ 
Sbjct  145  FHTYKILWNPHQIVFYVDDVPIRVFKNLESIGVGYPS-KPMQIEASLWNGESWATDGGRT  203

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSN-DINRCFSRGAYWWNSKKLWSLNREERVQY  217
            KI+W+ APFKA FQGF++ GC AD   N  I RC+S   YWWNS+K W L+  ++ +Y
Sbjct  204  KIDWTHAPFKAHFQGFDISGCPADDDQNRSIQRCYSS-QYWWNSEKFWKLHSTQKAKY  260



>gb|KEH18201.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=287

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 197/263 (75%), Gaps = 5/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            ++ FD NY V WG+NHV S +Q +EIQL MD SSGSGFASK +YGSG F +R+KVPG D+
Sbjct  28   EIIFDQNYKVTWGDNHVISINQRKEIQLTMDYSSGSGFASKLTYGSGLFHMRIKVPGRDS  87

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT++YL S   D HDELDFEFLGNRE KP  LQTN+ A G G+REQ+I+LWFDP  D
Sbjct  88   AGVVTAYYLMSQG-DSHDELDFEFLGNREGKPYALQTNVWANGEGDREQKIHLWFDPTTD  146

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH YKILWN HQIVFYVDNIPIRV+K+  NIGV YPS  A+Q++ SLWN E+WATDGGKA
Sbjct  147  FHDYKILWNPHQIVFYVDNIPIRVYKDNSNIGVGYPS-KAMQVQASLWNGENWATDGGKA  205

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW+ APFKA FQGF+V GC +      I+   +   YWWN +K W L+   + QY  V
Sbjct  206  KINWTNAPFKANFQGFDVSGCQSQTL---IDPNCASNNYWWNEQKFWQLDPAGQRQYENV  262

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            ++N++ YDYC D  RFPT P EC
Sbjct  263  KQNYVTYDYCKDRHRFPTPPLEC  285



>ref|XP_004516314.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Cicer arietinum]
Length=290

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 196/264 (74%), Gaps = 13/264 (5%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD NY V WG+NHV S +QG+EIQL MD SSG+GFASK +YGSG F +R+KVPG D+ GV
Sbjct  34   FDQNYKVTWGDNHVMSLNQGKEIQLTMDNSSGAGFASKMTYGSGFFHMRIKVPGTDSGGV  93

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT++YL S   +RHDELDFEFLGN+E KP +LQTN+ A+G GNREQRI+LWFDP  +FH 
Sbjct  94   VTAYYLISQG-NRHDELDFEFLGNKEGKPYSLQTNVFADGEGNREQRIHLWFDPTTNFHD  152

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            YKILWN HQIVFYVDNIPIRV+KN  N+GV YPS  A+QI+ SLWN E+WATDGG+ KIN
Sbjct  153  YKILWNPHQIVFYVDNIPIRVYKNNSNLGVSYPS-KAMQIQASLWNGENWATDGGQTKIN  211

Query  378  WSQAPFKAEFQGFNVDGCTA----DPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
            WS APFKA FQGF++ GC +    DP     N       YWWN K  W L+   + QY  
Sbjct  212  WSYAPFKANFQGFDISGCQSQSLIDPNCVSYN-------YWWNDKNYWCLDPAGQRQYEN  264

Query  210  VRRNFMHYDYCADLPRFPTLPPEC  139
            V++N++ YDYC+D  R+P  P EC
Sbjct  265  VKQNYVIYDYCSDRQRYPIAPLEC  288



>ref|XP_009766795.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Nicotiana sylvestris]
Length=285

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 199/263 (76%), Gaps = 5/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D+ F+ NY + +GN HV S ++GRE+Q+ MDK+SGSGF SK++YGSG F +R+K+P  D+
Sbjct  26   DLPFNVNYHILFGNEHVVSFNRGRELQISMDKTSGSGFGSKANYGSGFFHMRIKLPDRDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL SNT + HDE+DFEFLGNRE KP TLQTNI A G GNREQR++LWFDP AD
Sbjct  86   AGVVTAFYLRSNTNNDHDEVDFEFLGNREGKPYTLQTNIFANGQGNREQRMHLWFDPTAD  145

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+YKILWNQHQIVF+VDNIP RVFKNK NIGV YPS   +QI  ++W+ ++WATDGG  
Sbjct  146  FHNYKILWNQHQIVFFVDNIPFRVFKNKANIGVNYPS-KPMQILATIWDGDNWATDGGLT  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APFKA FQ F++ GC   P S+    C S   +WWN KK W L+ ++R +Y +V
Sbjct  205  KTNWSFAPFKAHFQDFDIIGC---PISSINTNCNSPN-FWWNQKKYWKLSSKQRKKYEEV  260

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            +  +M YDYC D  RF T PPEC
Sbjct  261  KAKYMTYDYCVDKSRFSTPPPEC  283



>ref|XP_007140647.1| hypothetical protein PHAVU_008G129900g [Phaseolus vulgaris]
 gb|ESW12641.1| hypothetical protein PHAVU_008G129900g [Phaseolus vulgaris]
Length=283

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 197/263 (75%), Gaps = 5/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            + SFD NY V WG++HV S +QG+E+QL MD  SGSGF SK +YGSG F++R+KVP  ++
Sbjct  25   ETSFDQNYEVVWGDDHVVSLNQGKEVQLTMDNCSGSGFGSKMAYGSGLFQMRIKVPNRNS  84

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYL+S    RHDELDFEFLGNR+ KP  LQTN+  +G GNREQRI LWFDP A 
Sbjct  85   AGIVTAFYLSSKG-GRHDELDFEFLGNRKGKPYRLQTNVFVDGQGNREQRIRLWFDPTAH  143

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y+ILWNQHQIVF+VDN+PIRV+KNK NIGV YPS   +QI+ +LW+AESWAT+GGK 
Sbjct  144  FHTYRILWNQHQIVFFVDNVPIRVYKNKTNIGVGYPS-KGMQIEATLWDAESWATNGGKT  202

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS APF+A FQGF+V GC     +++   C S   YWWN +K W L+   + +Y ++
Sbjct  203  KTDWSYAPFRASFQGFDVSGCQV--LTSNAKNC-SSDKYWWNRQKFWQLDPVRQSEYERI  259

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            +  +M YDYC D  R+P +P EC
Sbjct  260  KHKYMTYDYCTDRKRYPEIPLEC  282



>ref|XP_009625718.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Nicotiana tomentosiformis]
Length=286

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/264 (60%), Positives = 197/264 (75%), Gaps = 6/264 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D+ FD NY++ +GN HV S +QGR +Q+ MDK+SGSGF SK +YGSG F +R+++P  D+
Sbjct  26   DLPFDVNYYILFGNEHVVSFNQGRALQISMDKTSGSGFGSKVNYGSGFFHMRIQLPDKDS  85

Query  747  AGVVTSFYLTSNTE-DRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAA  571
            AGVVT+FYL SNT  + HDE+DFEFLGNRE KP TLQTN+ A G GNREQR++LWFDP A
Sbjct  86   AGVVTAFYLRSNTNRNNHDEVDFEFLGNREGKPYTLQTNVFANGQGNREQRMHLWFDPTA  145

Query  570  DFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            DFH+YKILWN+HQIVF+VDNIPIRVFKNK NIGV YPS   +QI  ++WN ++WATDGG 
Sbjct  146  DFHNYKILWNEHQIVFFVDNIPIRVFKNKANIGVSYPS-KPMQILATIWNGDNWATDGGL  204

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K NWS APFK+ FQ F++ GC   P S+    C S   +WWN +K W L+  +R +Y +
Sbjct  205  TKTNWSFAPFKSHFQDFDIIGC---PISSINTNCNSPN-FWWNQRKYWKLSSNQRKKYAE  260

Query  210  VRRNFMHYDYCADLPRFPTLPPEC  139
            V   +M YDYC D  RF T PPEC
Sbjct  261  VTAKYMTYDYCVDKSRFSTPPPEC  284



>ref|XP_010913492.1| PREDICTED: putative xyloglucan endotransglucosylase/hydrolase 
protein 1 [Elaeis guineensis]
Length=283

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 190/260 (73%), Gaps = 7/260 (3%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            F+ NY + WG NHV+  DQGR +QL +D+SSGSGF SK  Y SG F +++K+P  D+AGV
Sbjct  29   FNQNYAITWGANHVSYLDQGRVVQLSLDRSSGSGFGSKLDYRSGFFHLKIKLPNKDSAGV  88

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            V +FYL+S T  RHDELD+EFLGNRE KP+TLQTNI A G GNREQRI+LWFDP ADFH 
Sbjct  89   VATFYLSSRTNARHDELDYEFLGNREGKPITLQTNIFANGHGNREQRIHLWFDPTADFHD  148

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            YKILWN +QIVF+VD+ PIRV+KN  +IGV YPS   +QI  S+W+ +SWATDGG+ KIN
Sbjct  149  YKILWNAYQIVFFVDDTPIRVYKNLASIGVEYPS-QPMQILASIWDGDSWATDGGRTKIN  207

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            W+ +PF A+FQGFN+DGC++D  +     C S    WWN+     LN  ++  Y  V+  
Sbjct  208  WTHSPFYAQFQGFNIDGCSSDSIT-----C-SSPNLWWNAGSYRELNPAQKAAYQHVKEK  261

Query  198  FMHYDYCADLPRFPTLPPEC  139
            +M YDYC D  R+PT PPEC
Sbjct  262  YMTYDYCYDKTRYPTPPPEC  281



>gb|EYU40615.1| hypothetical protein MIMGU_mgv1a010970mg [Erythranthe guttata]
Length=296

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 186/264 (70%), Gaps = 5/264 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGN-NHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHD  751
            DV+FD NY V WG+  H +    GR+ +L +D  SG GF  K  YGSG F +R+K+ G +
Sbjct  28   DVAFDTNYNVVWGDYKHASVLKHGRQARLSLDAQSGGGFVCKQQYGSGFFNMRIKLAGRN  87

Query  750  TAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAA  571
            TAGVVT+FYL S+    HDELDFEFLG++E KP+ LQTN+ A G GNREQ++ LWFDPAA
Sbjct  88   TAGVVTAFYLASSGNYGHDELDFEFLGDKEGKPIRLQTNVFANGKGNREQKVVLWFDPAA  147

Query  570  DFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            D+H YKILWN   I FYVD+IPIR F+N + IGV YP+  A+QI  S+WN +SWATDGG+
Sbjct  148  DYHDYKILWNHRLIAFYVDDIPIRAFRNNKKIGVEYPT-QAMQIHVSIWNGDSWATDGGR  206

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             KINW+ APF A FQ FNVDGC   P +N   +C S  +YWWN +K W+ NR  R +Y  
Sbjct  207  TKINWTYAPFTAHFQSFNVDGC---PSTNGRRKCHSASSYWWNQRKYWNFNRTMRRKYQI  263

Query  210  VRRNFMHYDYCADLPRFPTLPPEC  139
            VR  FM+YDYC D  R PT PPEC
Sbjct  264  VRDKFMNYDYCNDTTRHPTTPPEC  287



>ref|XP_008806512.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Phoenix dactylifera]
Length=295

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 193/263 (73%), Gaps = 8/263 (3%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
            SF+ NY V WG +H +  DQGR++QL +DKSSGSGF SK +Y SG F +++K+P  D+ G
Sbjct  41   SFNKNYAVAWGGDHFSYLDQGRQVQLSLDKSSGSGFGSKLAYRSGLFHLKVKLPSKDSGG  100

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYL+S+T + HDELDFEFLGNRE KP+T+QTNI A G GNREQR++LWFDP ADFH
Sbjct  101  VVTTFYLSSHT-NTHDELDFEFLGNREGKPITIQTNIFANGHGNREQRMHLWFDPTADFH  159

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
             YKILWN +QIVF+VD+ PIRVFKN  + GV YPS   +QI  S+W+ +SWATDGG+ KI
Sbjct  160  DYKILWNAYQIVFFVDDTPIRVFKNLASKGVEYPS-QPMQIMASIWDGDSWATDGGRTKI  218

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NW+ APF A FQGFNVDGC +D  +     C S    WWN+ +   LN  ++  Y +V++
Sbjct  219  NWAHAPFNARFQGFNVDGCASDSAT-----C-SSPNLWWNAGRYRELNPAQKAAYQRVKK  272

Query  201  NFMHYDYCADLPRFPTLPPECKR  133
             +M YDYC D  R PT PPEC +
Sbjct  273  KYMTYDYCYDRTRHPTPPPECNQ  295



>ref|XP_010104199.1| Xyloglucan endotransglucosylase/hydrolase protein 2 [Morus notabilis]
 gb|EXB99131.1| Xyloglucan endotransglucosylase/hydrolase protein 2 [Morus notabilis]
Length=290

 Score =   296 bits (757),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 202/262 (77%), Gaps = 6/262 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
            +FD NY V WG +HV S +QGREIQL MD SSG+GFASK +YGSG F +++K+P  D+AG
Sbjct  30   TFDQNYQVTWGFDHVLSLNQGREIQLSMDNSSGAGFASKLNYGSGFFSLKIKLPDRDSAG  89

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS+  D+HDELDFEFLGNRE KP TLQTN+ A G+GNREQR  LWFDP ADF+
Sbjct  90   VVTAFYLTSHG-DKHDELDFEFLGNREGKPYTLQTNVFANGLGNREQRTLLWFDPTADFY  148

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKE-NIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            +Y ILWN +QIVF VDN PIRVFKN E ++GV YPS   + I+ SLWN +SWATDGG+ K
Sbjct  149  NYTILWNHYQIVFLVDNTPIRVFKNNEASLGVDYPS-KPMTIEASLWNGDSWATDGGQTK  207

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS APFKA F GF+V+GC+   +++++  C+S   Y+WN++K   L+ E++  Y  VR
Sbjct  208  IDWSYAPFKAHFLGFDVNGCSL--QNSNVGDCYSN-KYFWNTEKYHKLDSEQQRAYQYVR  264

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
            + +++YDYC D  RFPT PP+C
Sbjct  265  KTYINYDYCTDKSRFPTPPPDC  286



>ref|XP_010241425.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Nelumbo nucifera]
Length=285

 Score =   296 bits (757),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 191/261 (73%), Gaps = 6/261 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
            SFD NY+V W  +HV    QG+E+Q+ MDK+SGS  ASK  Y SG F +R+KVP  D+AG
Sbjct  28   SFDKNYYVAWAQDHVQFLHQGKEVQISMDKASGSAIASKMVYASGFFNMRIKVPVGDSAG  87

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS++ D HDELDFEFLGN+E KP  LQTN+   GVGNREQR  LWFDP+A FH
Sbjct  88   VVTAFYLTSHS-DIHDELDFEFLGNKEGKPHYLQTNVYTNGVGNREQRFLLWFDPSARFH  146

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            +Y++LWN HQIVF+VD+ PIRVF+NK  IGV YPS   +Q+ GS+W+ +SWATDGG+ K+
Sbjct  147  TYRVLWNTHQIVFFVDDTPIRVFRNKAKIGVHYPS-QPMQVVGSIWDGDSWATDGGQTKV  205

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NW+ APFK  F+ F++D C   P S     C+S   +WWN  K  +LN  ++ +YL VR+
Sbjct  206  NWTVAPFKTYFRNFDIDAC---PSSKLPQLCYSP-KFWWNRDKYSNLNSTQQKRYLYVRK  261

Query  201  NFMHYDYCADLPRFPTLPPEC  139
            N+M YDYC+D  R+P  PPEC
Sbjct  262  NYMVYDYCSDKTRYPVPPPEC  282



>gb|EYU40616.1| hypothetical protein MIMGU_mgv1a010995mg [Erythranthe guttata]
Length=295

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 196/273 (72%), Gaps = 5/273 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+FD +Y + WGN+HV+  DQGRE QL +D +SG+GF SK  Y SG F +R+K+   +T
Sbjct  26   DVAFDTSYKIIWGNDHVSLLDQGREAQLSLDINSGAGFGSKLQYESGFFNMRIKLANKNT  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL S + +  DELDFEFLGN+E KP+ LQTN+ A G G+REQR+ LWFDP+AD
Sbjct  86   AGVVTAFYLAS-SGNSQDELDFEFLGNKEGKPIILQTNVFANGKGDREQRVLLWFDPSAD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+YKILWN   I FYVD IPIRVFKN   IGV+YP+  A+++  S++N + WATDGG+ 
Sbjct  145  FHTYKILWNHRLIAFYVDGIPIRVFKNNTKIGVKYPT-KAMEVHVSIFNGDDWATDGGQT  203

Query  387  KINWSQAPFKAEFQGFNVDGC--TADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYL  214
            KINW+ +PF A FQGFNVDGC  +    +N  N C++   YWWN +K W+L+R +  +Y 
Sbjct  204  KINWTSSPFTARFQGFNVDGCPLSQVSSTNSRNNCYA-SKYWWNKRKYWNLDRNQIKEYQ  262

Query  213  KVRRNFMHYDYCADLPRFPTLPPECKRH*LIIM  115
             VR  +M+YDYC D  R+P  PPEC  +  I +
Sbjct  263  NVREKYMNYDYCTDKARYPVTPPECASNQYITI  295



>emb|CDP03889.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 191/267 (72%), Gaps = 3/267 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV FD NY + +GN+HV   +QG ++QL MD  SG+GF SK +YGSG F++R+KVP  D+
Sbjct  22   DVPFDDNYSITYGNDHVAFFNQGTQLQLSMDVHSGAGFGSKVNYGSGFFDMRIKVPNKDS  81

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+SN++  HDE+DFEFLGN+E KP  LQTN+ A GVG RE+R  LWFDP AD
Sbjct  82   AGVVTTFYLSSNSQYAHDEVDFEFLGNKEGKPYALQTNVFARGVGGREERTLLWFDPTAD  141

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY+ILWN + +VFYVDNIPIR++KN    GV YPS   +QI  SLW+ + WATDGGK 
Sbjct  142  FHSYQILWNPYHVVFYVDNIPIRIYKNNTASGVGYPS-QPMQILASLWDGDGWATDGGKT  200

Query  387  KINWSQAPFKAEFQGFNVDGCT-ADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
            K +WSQAPF A +Q FNVDGC   D ++ DI RC S   YWWN +K W L+  +      
Sbjct  201  KTDWSQAPFIASYQDFNVDGCPLTDNQNMDIQRCRSPN-YWWNQRKFWKLDSNQMKAMEA  259

Query  210  VRRNFMHYDYCADLPRFPTLPPECKRH  130
            VR  +M+YDYC+D  R+P  P EC  +
Sbjct  260  VRNKYMNYDYCSDRNRYPVPPLECSSN  286



>ref|XP_002863176.1| hypothetical protein ARALYDRAFT_359038 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39435.1| hypothetical protein ARALYDRAFT_359038 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 188/264 (71%), Gaps = 3/264 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +  FD NY V WG +HV  S QG+E+QL MD SSGSGF SK+ YGSG F++R+KV G+++
Sbjct  35   EAGFDENYVVTWGQDHVFKSYQGKEVQLSMDYSSGSGFESKNHYGSGLFQMRIKVFGNNS  94

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYLTS   D  DE+DFEFLGN E KP+TLQTN+  EG GNREQR  LWFDP  D
Sbjct  95   AGVVTAFYLTSKG-DTQDEVDFEFLGNIEGKPITLQTNVYTEGKGNREQRFSLWFDPTTD  153

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y ILWN + IVFYVDNIPIRVF N  + G+ YPS   +Q+  SLWN E+WATDGGK 
Sbjct  154  FHTYGILWNPYHIVFYVDNIPIRVFNNNTSTGMSYPS-KPMQVVSSLWNGENWATDGGKT  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW+ APFKA FQGF+  GC  D  SN+   C S   YWWN+ K   L+  E+  Y  V
Sbjct  213  KINWAYAPFKANFQGFSDSGCHVDDLSNNSKACGSS-MYWWNTMKYNCLSIYEQKVYKNV  271

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            R  +M+YDYC+D  RFP  P EC+
Sbjct  272  REKYMNYDYCSDQARFPIFPNECR  295



>ref|XP_009796007.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Nicotiana sylvestris]
Length=277

 Score =   290 bits (742),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 192/264 (73%), Gaps = 7/264 (3%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD +Y + WG+N++ S + G EIQL ++  SGSG  SK SYGSG F++R+K+P  DTA
Sbjct  21   LPFDKSYKISWGDNNLKSFNNGEEIQLSLNNFSGSGIQSKLSYGSGSFKMRIKLPSKDTA  80

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVTSFYL S+T + HDELDFEFLGNRE KP TLQTN+ A G+G+REQRI LWFDP A+F
Sbjct  81   GVVTSFYLISHT-NNHDELDFEFLGNREGKPYTLQTNVFANGIGDREQRIQLWFDPTANF  139

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H Y ILWN HQIVF+VD +PIRV+KNK + GV YP+  ++Q + ++WN E+WAT+ G AK
Sbjct  140  HEYSILWNSHQIVFFVDEVPIRVYKNKSHRGVGYPT-QSMQSEATIWNGETWATENGSAK  198

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS +PF A+FQGF ++GC   P SN    C S   +WWNSK+ W L   +   Y K R
Sbjct  199  INWSNSPFTAQFQGFTIEGC---PFSNYSLNCNSTN-FWWNSKQFWKLTYAQEKSY-KDR  253

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            R +M YDYC D  RF T+PPEC +
Sbjct  254  RKYMTYDYCKDTNRFQTIPPECTK  277



>ref|XP_009622563.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Nicotiana tomentosiformis]
Length=278

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 188/264 (71%), Gaps = 6/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY + WG+ +V     G EIQL ++  SGSG  SK SYGSG F++++K+P  D+A
Sbjct  21   LPFDKNYRISWGDKNVKPFRNGEEIQLSLNNFSGSGIQSKLSYGSGSFKMKIKLPSKDSA  80

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVTSFYL S+   +HDELDFEFLGNRE KP TLQTN+ A G+G+REQRI LWFDP A+F
Sbjct  81   GVVTSFYLISH-RSQHDELDFEFLGNREGKPYTLQTNVFANGIGDREQRIQLWFDPTANF  139

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H Y ILWN HQIVF+VD +PIRV+KNK + GV YP+   +Q + ++WN E+WAT+ G AK
Sbjct  140  HEYSILWNSHQIVFFVDEVPIRVYKNKSHRGVGYPT-QPMQSEATIWNGETWATENGSAK  198

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS +PF A+FQGF ++GC   P SN    C S   +WWNSK+LW L   +   Y  +R
Sbjct  199  INWSNSPFTAQFQGFTIEGC---PFSNYSLNCNST-KFWWNSKQLWKLTSGQEKSYKDIR  254

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            R +M Y+YC D  RF TLPPEC +
Sbjct  255  RKYMTYNYCKDTNRFQTLPPECTK  278



>ref|XP_002863180.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39439.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score =   286 bits (731),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 190/263 (72%), Gaps = 6/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V FD NY V WG N+V   +QG+E+QL +D+SSGSGF SK+ Y SG F+IR+KVP  D++
Sbjct  37   VGFDDNYVVTWGQNNVLKLNQGKEVQLSLDRSSGSGFESKNHYESGFFQIRIKVPPKDSS  96

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS  E+ HDELD EFLGN+E KP+ +QTN+   G G+REQ++ LWFDP  DF
Sbjct  97   GIVTAFYLTS-KENTHDELDIEFLGNKEGKPIRVQTNVFTNGKGDREQKLVLWFDPTKDF  155

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVDNIPIRVFKN  + G+ YP+   +Q+  SLWN E WATDGGK+K
Sbjct  156  HTYAILWNPYQIVFYVDNIPIRVFKNTTSEGMNYPA-KPMQVVVSLWNGEDWATDGGKSK  214

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA FQGFN  GC A+ +    N C S  AYWWN+     L+  E+  Y  VR
Sbjct  215  INWAFAPFKANFQGFNNSGCFANGEK---NACGSS-AYWWNTGSYSKLSDSEQKAYTNVR  270

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
            + +M+YDYC+D  RF   P ECK
Sbjct  271  QKYMNYDYCSDKGRFRVPPSECK  293



>ref|XP_006284203.1| hypothetical protein CARUB_v10005358mg [Capsella rubella]
 gb|EOA17101.1| hypothetical protein CARUB_v10005358mg [Capsella rubella]
Length=300

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 186/264 (70%), Gaps = 3/264 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +  FD NY V WG +HV  S+QG++++L MD  SGSGF SK+ YGSG F++R+KV G+++
Sbjct  36   ETGFDENYVVTWGQDHVLKSNQGKDVELSMDYYSGSGFESKNHYGSGFFQMRIKVVGNNS  95

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYLTS   D  DE+DFEFLGN E KP+TLQTN+  +G GNREQR  LWFDP  D
Sbjct  96   AGVVTAFYLTSKG-DTQDEVDFEFLGNIEGKPITLQTNVYTQGRGNREQRFSLWFDPTID  154

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y ILWN + IVFYVDNIPIRVFKN    G+ YPS   +Q+  SLWN E+WATDGGK 
Sbjct  155  FHTYGILWNPYHIVFYVDNIPIRVFKNNTRDGMSYPS-KPMQVVSSLWNGENWATDGGKT  213

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW+ APFKA FQGF+  GC  D   N    C S   YWWN+ +   L+  E+  Y  V
Sbjct  214  KINWTYAPFKAHFQGFSESGCHVDEPRNVSESCGSS-MYWWNTMRYRWLSVYEQKVYKNV  272

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            R  +M+YDYC+D  RF  LP EC+
Sbjct  273  REKYMNYDYCSDQARFSILPSECR  296



>gb|KHG13728.1| Xyloglucan endotransglucosylase/hydrolase 2 -like protein [Gossypium 
arboreum]
Length=289

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 190/246 (77%), Gaps = 6/246 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V FD NY + WGN+HV S +Q  EIQL MDKSSG+GF SK SYG+G F +RMK+P  D+A
Sbjct  36   VKFDENYVITWGNDHVLSLNQDTEIQLSMDKSSGAGFGSKLSYGTGFFNMRMKLPDKDSA  95

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT++YLTS  + +H ELDFEFLGNRE KP++LQTN+ A GVGNREQR+ LWFDP+ADF
Sbjct  96   GVVTAYYLTSKGK-KHGELDFEFLGNREGKPISLQTNVFAGGVGNREQRVILWFDPSADF  154

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y+ILWNQHQIVFYVD+IPIRVFKN  NIGV YPS  A++I+ SLW+ +SWATDGG+ K
Sbjct  155  HNYRILWNQHQIVFYVDDIPIRVFKNNTNIGVGYPS-QAMKIEASLWDGDSWATDGGQTK  213

Query  384  INWSQAPFKAEFQGFNVDGCT-ADPKSNDINR--CFSRGAYWWNSKKLWSLNREERVQYL  214
            INWS APFKA FQGF++ GC   DP +N+ N   CF    +WWNS+K W+L+ +++    
Sbjct  214  INWSMAPFKAHFQGFDISGCPKTDPNNNNNNNEDCF-LPEHWWNSEKYWALDSKQKTDLK  272

Query  213  KVRRNF  196
             +   F
Sbjct  273  NITMRF  278



>emb|CAN63612.1| hypothetical protein VITISV_032683 [Vitis vinifera]
Length=1159

 Score =   303 bits (777),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 195/256 (76%), Gaps = 8/256 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D++FD +Y + WGN+HV S +QGR +QL +D+SSG+GFASK SYGSG F +R+K+P  D+
Sbjct  24   DITFDQSYRITWGNDHVLSLNQGRLVQLSLDQSSGAGFASKQSYGSGFFHMRIKLPPKDS  83

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT++YLTS+T++ HDELDFEFLGN+E KP TLQTN+ + G G+REQRI LWFDP AD
Sbjct  84   AGVVTAYYLTSHTKN-HDELDFEFLGNKEGKPYTLQTNVFSNGQGDREQRILLWFDPTAD  142

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSYKILWNQHQIVFYVD+IPIRVFKN  NIGV YPS   +QI+GSLWN ESWATDGG+ 
Sbjct  143  FHSYKILWNQHQIVFYVDDIPIRVFKNNSNIGVDYPS-QPMQIEGSLWNGESWATDGGQT  201

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APF   FQGF +DGC +     D + C S    WWN KK W L+  ++  +  V
Sbjct  202  KTNWSCAPFXTHFQGFRIDGCPS-----DYSNCHSSN-LWWNQKKFWKLDSTQQKAHENV  255

Query  207  RRNFMHYDYCADLPRF  160
            R  +M+YDYC+D  R 
Sbjct  256  RNKYMNYDYCSDTNRL  271



>ref|XP_010496005.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Camelina sativa]
Length=294

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 185/263 (70%), Gaps = 4/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY V WG NHV   +QG+E++L MD+SSGSGF SKS YGSG F++R+K+P  D+A
Sbjct  33   IDFDKNYIVTWGQNHVLKLNQGKEVELSMDQSSGSGFESKSHYGSGFFQMRIKLPPRDSA  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP   F
Sbjct  93   GVVTAFYLTSKG-DTHDEVDFEFLGNRQGKPIGIQTNVFTNGQGNREQKFVLWFDPTTSF  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN + IVFYVD IPIRVFKN    GV YPS   +Q+  SLWN E WAT+GGK K
Sbjct  152  HTYGILWNPYHIVFYVDKIPIRVFKNNR-FGVNYPS-KPMQLVASLWNGEDWATNGGKDK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA+FQGF   GC  D +SND   C S   YWWN++    L+  E+     VR
Sbjct  210  INWAYAPFKAQFQGFPEHGCRLDGQSNDRKVCGST-RYWWNNRTYSRLSANEQKAMENVR  268

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M YDYC+D PR+P  P EC+
Sbjct  269  AKYMTYDYCSDRPRYPVPPTECR  291



>ref|XP_010450803.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Camelina sativa]
Length=295

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 184/263 (70%), Gaps = 3/263 (1%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY V WG NHV   +QG E++L MD+SSGSGF SKS YGSG F++ +K+P  D+A
Sbjct  33   IDFDKNYVVTWGQNHVLKLNQGEEVELSMDQSSGSGFESKSHYGSGFFQMTIKLPPSDSA  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP   F
Sbjct  93   GVVTAFYLTSKG-DTHDEVDFEFLGNRQGKPIGIQTNVFTNGQGNREQKFVLWFDPTTSF  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVD IPIRVFKN    GV YPS   +Q+  SLWN E WAT+GGK K
Sbjct  152  HTYGILWNPYQIVFYVDKIPIRVFKNNIRFGVNYPS-KPMQLVASLWNGEEWATNGGKDK  210

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA+FQGF   GC  D +SN+   C S   YWWN++    L+  E+     VR
Sbjct  211  INWAYAPFKAQFQGFPEHGCRLDGQSNNREVCGST-RYWWNNRTYNRLSANEQKAMEDVR  269

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M YDYC+D PR+P  P EC+
Sbjct  270  AEYMQYDYCSDRPRYPVPPTECR  292



>ref|XP_006367860.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Solanum tuberosum]
Length=279

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 191/263 (73%), Gaps = 7/263 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            D+ +D NY + +GN HV S +QGRE+Q+ MD+SSGSG  SK +YG     +++K+P  D+
Sbjct  22   DIPYDVNYNIIFGNQHVVSFNQGRELQISMDQSSGSGIGSKENYG--SVHMKIKLPNRDS  79

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVV +FYL SNT + +DE+DFEFLGNRE KP +LQTN+   G GNREQR++LWFDP A+
Sbjct  80   AGVVIAFYLHSNTNN-NDEIDFEFLGNREGKPYSLQTNMFVNGGGNREQRVHLWFDPTAE  138

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+YKI+WN+HQIVFYVDNIPIRVFKN ENIGV YP    +Q+  ++W+ + WATDGG  
Sbjct  139  FHNYKIMWNEHQIVFYVDNIPIRVFKNNENIGVGYPK-QPMQLLATIWDGDGWATDGGLT  197

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APFKA FQ F + GC     +++ N C S+G YWWN +K W L+  +R  Y + 
Sbjct  198  KTNWSFAPFKAYFQDFKIGGCPI--INSNTNNCNSQG-YWWNQRKYWRLSSSQRKLYDEY  254

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R N+  YDYC D+ R+PT P EC
Sbjct  255  RVNYKTYDYCDDMIRYPTPPLEC  277



>ref|NP_193045.1| xyloglucan endotransglucosylase/hydrolase 2 [Arabidopsis thaliana]
 sp|Q9SV60.1|XTH2_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
2; Short=At-XTH2; Short=XTH-2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB45508.1| endoxyloglucan transferase-like protein [Arabidopsis thaliana]
 emb|CAB78351.1| endoxyloglucan transferase-like protein [Arabidopsis thaliana]
 gb|AAY78796.1| putative xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana]
 gb|AEE83229.1| xyloglucan endotransglucosylase/hydrolase 2 [Arabidopsis thaliana]
Length=292

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 187/263 (71%), Gaps = 3/263 (1%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY V WG +H+   +QG+E+QL MD SSGSGF SKS YGSG F++R+K+P  D+A
Sbjct  30   IDFDVNYVVTWGQDHILKLNQGKEVQLSMDYSSGSGFESKSHYGSGFFQMRIKLPPRDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+ + G G REQ+   WFDP   F
Sbjct  90   GVVTAFYLTSKG-DTHDEVDFEFLGNRQGKPIAIQTNVFSNGQGGREQKFVPWFDPTTSF  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVD +PIRVFKN +  GV YPS   +Q+  SLWN E+WAT GGK K
Sbjct  149  HTYGILWNPYQIVFYVDKVPIRVFKNIKKSGVNYPS-KPMQLVASLWNGENWATSGGKEK  207

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA++QGF+  GC  + +SN+ N C S   YWWN++    L+  E+     VR
Sbjct  208  INWAYAPFKAQYQGFSDHGCHVNGQSNNANVCGST-RYWWNTRTYSQLSANEQKVMENVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M YDYC+D PR+P  P EC+
Sbjct  267  AKYMTYDYCSDRPRYPVPPSECR  289



>gb|KFK29696.1| hypothetical protein AALP_AA7G166900 [Arabis alpina]
Length=288

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 185/264 (70%), Gaps = 8/264 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            + SFD NY V WG  HV   +QG+EIQL MD SSGSGF SK+ YGSG F++++K+P  D+
Sbjct  30   EASFDENYVVTWGQEHVLKLNQGKEIQLSMDHSSGSGFESKNHYGSGFFQMKIKLPEKDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYLTSN  +  DE+DFEFLGNRE KP+T+QTN+  +G GNREQR  LWFDP  D
Sbjct  90   AGIVTAFYLTSNG-NTQDEVDFEFLGNREGKPITIQTNVFTKGQGNREQRFVLWFDPTED  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y ILWN + IVFYVDNIPIRVFKN    G  YPS   +Q+  SLWN E WAT+GGKA
Sbjct  149  FHAYGILWNPYHIVFYVDNIPIRVFKNNTK-GTNYPS-KPMQVVSSLWNGEEWATEGGKA  206

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW+ APFKA FQGF+  GC  D      N C S   YWWN+++   L+  E+  Y   
Sbjct  207  KINWTNAPFKAHFQGFSESGCHGDSP----NVCGSS-KYWWNTERYVGLSVSEQKAYENA  261

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            R  +M+YDYC+D  RF   P EC+
Sbjct  262  RSKYMNYDYCSDFTRFSVRPYECR  285



>ref|XP_009135205.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Brassica rapa]
 emb|CDX73838.1| BnaA03g32090D [Brassica napus]
Length=288

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 185/261 (71%), Gaps = 5/261 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD NY V WGN  V   +QGRE+QL MDKSSG+GF SK  +GSG F++R+K+P  DTAGV
Sbjct  30   FDDNYVVTWGN--VLKLNQGREVQLSMDKSSGAGFQSKHKFGSGFFQMRIKLPPKDTAGV  87

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYLTS   D  DELDFEFLG RE KP+ +QTN+   G GNREQ+  LWFDP+ADFH+
Sbjct  88   VTAFYLTSKG-DTQDELDFEFLGAREGKPIQIQTNVFINGQGNREQKFVLWFDPSADFHT  146

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y ILWN +QI FYVDN+PIR+FKN +  GV YPS   + +  SLWN E+WAT+GGKAKIN
Sbjct  147  YGILWNPYQIAFYVDNVPIRIFKNNKRYGVGYPS-KPMTLVVSLWNGEAWATEGGKAKIN  205

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            WS APFKA F+ F+  GC AD ++ +   C S   YWWN+ +   L+  E   +  VR  
Sbjct  206  WSYAPFKANFERFSDSGCHADGRTINAKVCGST-TYWWNTNQYSRLSANETTAFKNVRAK  264

Query  198  FMHYDYCADLPRFPTLPPECK  136
            +M YDYC+D PR+P  P EC+
Sbjct  265  YMTYDYCSDHPRYPVPPTECR  285



>ref|XP_010440650.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2 [Camelina sativa]
Length=294

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 185/263 (70%), Gaps = 4/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY V WG NHV   +QG+E++L MD+SSGSGF SKS YGSG F++R+K+P  D+A
Sbjct  33   IDFDKNYVVTWGQNHVLKLNQGKEVELSMDQSSGSGFESKSHYGSGFFQMRIKLPPRDSA  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP   F
Sbjct  93   GVVTAFYLTSKG-DTHDEVDFEFLGNRQGKPIGIQTNVFTNGQGNREQKFVLWFDPTTSF  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN + IVFYVD IPIRVFKN    GV YPS   +Q+  SLWN E WAT+GGK K
Sbjct  152  HTYGILWNPYHIVFYVDKIPIRVFKNNR-FGVNYPS-KPMQLVASLWNGEEWATNGGKDK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA+FQGF   GC  D +SN+   C S   YWWN++    L+  E+     VR
Sbjct  210  INWAYAPFKAQFQGFPEHGCRLDGQSNNRKVCGST-RYWWNNRTYNRLSANEQKTMENVR  268

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M YDYC+D PR+P  P EC+
Sbjct  269  AKYMTYDYCSDRPRYPVPPTECR  291



>ref|XP_002863177.1| hypothetical protein ARALYDRAFT_359039 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39436.1| hypothetical protein ARALYDRAFT_359039 [Arabidopsis lyrata subsp. 
lyrata]
Length=292

 Score =   281 bits (718),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 187/261 (72%), Gaps = 3/261 (1%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD +Y V WG +H+   +QG+E+QL MD+SSGSGF SKS YGSG F++R+K+P  D+AGV
Sbjct  32   FDVHYVVTWGQDHILKLNQGKEVQLSMDQSSGSGFESKSHYGSGFFQMRIKLPPRDSAGV  91

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYLTS   + HDE+DFEFLGNR+ KP  +QTN+   G G REQ+  LWFDP   FH+
Sbjct  92   VTAFYLTSKG-NTHDEVDFEFLGNRQGKPTAIQTNVFTNGQGGREQKFVLWFDPTTSFHT  150

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y ILWN + IVFYVD +PIRVFKN +  GV YPS   +Q++ SLWN E+WAT+GGK KIN
Sbjct  151  YGILWNPYHIVFYVDKVPIRVFKNNKRSGVNYPS-KPMQLETSLWNGEAWATNGGKDKIN  209

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            W+ APFKA+FQGF+  GC  + +SN  N C S   YWWN++    L+  E+     VR  
Sbjct  210  WAYAPFKAQFQGFSDHGCHVNGQSNIANVCGST-KYWWNTRTYSRLSANEQKAMENVRAK  268

Query  198  FMHYDYCADLPRFPTLPPECK  136
            +M+YDYC+D PR+P  P EC+
Sbjct  269  YMNYDYCSDRPRYPVPPSECR  289



>ref|XP_002863184.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39443.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   279 bits (714),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 186/264 (70%), Gaps = 7/264 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            + SFD +Y V WG +HV   +Q +E+QL MD SSGSGF SK+ YGSG F++R+K+P  D+
Sbjct  2    ESSFDEHYVVTWGQDHVLKLNQSKEVQLSMDHSSGSGFESKNHYGSGFFQMRIKLPAKDS  61

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYLTS   +  DE+DFEFLGNRE KP+T+QTN+  +G GNREQR  LWFDP  D
Sbjct  62   AGIVTAFYLTSKG-NSQDEVDFEFLGNREGKPITIQTNVFTKGQGNREQRFVLWFDPTED  120

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y ILWN + IVFYVDNIPIRVFKN +  GV YPS   +Q+  SLWN E+WATDGGKA
Sbjct  121  FHAYGILWNPYHIVFYVDNIPIRVFKNNKK-GVSYPS-KPMQVVSSLWNGEAWATDGGKA  178

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW+ APFKA FQGF+  GC  D     +N      AYWWN+ K   ++  E+  +   
Sbjct  179  KINWAYAPFKAHFQGFSESGCHMD----GLNDACESSAYWWNTGKYVGISVSEQKAFKNA  234

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            R  +M+YDYC+D  RF   P EC+
Sbjct  235  RAKYMNYDYCSDHTRFSVPPDECQ  258



>ref|XP_010470043.1| PREDICTED: putative xyloglucan endotransglucosylase/hydrolase 
protein 1 [Camelina sativa]
Length=294

 Score =   280 bits (717),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 186/262 (71%), Gaps = 6/262 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
             FD NY V WG +HV  S+QG+E+QL MD  SGSGF SK+ YGSG F++R+KV G++++G
Sbjct  37   GFDENYVVTWGQDHVLKSNQGKEVQLTMDYFSGSGFESKNHYGSGFFQMRIKVFGNNSSG  96

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS   D HDE+DFEFLGN E KP+TLQTN+  EG GNREQR  LWFDP  D+H
Sbjct  97   VVTAFYLTSKG-DTHDEVDFEFLGNVEGKPITLQTNVYTEGRGNREQRFDLWFDPTIDYH  155

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            +Y ILWN + IVFYVD+IPIRVF N  + GV YPS   +Q+  SLWN E+WA DGGK KI
Sbjct  156  NYGILWNPYHIVFYVDSIPIRVFNNNTSNGVNYPS-KPMQVVSSLWNGENWARDGGKTKI  214

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NW+ APFKA FQG +  GC  D  SN+   C S   YWWN+  L     E++V Y  VR 
Sbjct  215  NWTYAPFKAHFQGLSDSGCHVDDPSNNSKACGSS-IYWWNTMMLSVF--EQKV-YKTVRE  270

Query  201  NFMHYDYCADLPRFPTLPPECK  136
             +M+YDYC+D  RF  LP EC+
Sbjct  271  KYMNYDYCSDQARFSVLPSECR  292



>emb|CDY00754.1| BnaC03g37380D [Brassica napus]
Length=286

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 182/261 (70%), Gaps = 5/261 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD NY V WGN  V   DQGRE+QL MDK+SG+ F SK  +GSG F++R+K+P  DTAGV
Sbjct  28   FDDNYVVTWGN--VLKLDQGREVQLSMDKTSGAAFESKHKFGSGFFQMRIKLPPKDTAGV  85

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYLTS   D  DELDFEFLG+RE KP+ +QTN+   G GNREQ+  LWFDP+ DFH+
Sbjct  86   VTAFYLTSKG-DTQDELDFEFLGDREGKPIQIQTNVFINGQGNREQKFVLWFDPSTDFHT  144

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y ILWN +QI FYVDN+PIR+FKN +  GV YPS   + +  SLWN E WATDGGKAKIN
Sbjct  145  YGILWNPYQIAFYVDNVPIRIFKNNKRYGVGYPS-KPMTLVVSLWNGEGWATDGGKAKIN  203

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            WS APFKA F+ F+  GC AD  + +   C S   YWWN+ +   L+  E   +  VR  
Sbjct  204  WSCAPFKANFERFSDSGCHADGLNINAKVCGST-TYWWNTIQYSRLSANETTAFKNVRAK  262

Query  198  FMHYDYCADLPRFPTLPPECK  136
            +M YDYC+D PR+P  P EC+
Sbjct  263  YMTYDYCSDHPRYPVPPTECR  283



>ref|XP_010685035.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 184/263 (70%), Gaps = 5/263 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
            +FD NY V WG +HV   ++  E+Q+ +D SSG+ F SK  YGSG F +++K+P +D+ G
Sbjct  28   TFDENYHVVWGYDHV--QNEASEVQIYLDNSSGAAFESKLDYGSGFFTMKIKLPSNDSGG  85

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS  +   DELDFEFLGNRE KP TLQTN+ A G G+RE RI LWFDP ADFH
Sbjct  86   VVTAFYLTSLDDGNRDELDFEFLGNREGKPYTLQTNVFAHGQGDREHRIRLWFDPTADFH  145

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            +YKILWNQH IVF+VDNIPIR FKN   +GV YPS   ++I  S+W+  SWATDGG+ KI
Sbjct  146  TYKILWNQHHIVFFVDNIPIRYFKNNTRLGVSYPS-KPMKIDASIWDGSSWATDGGQTKI  204

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
             W  APF+A F+GFNV+GC+       I+ C +   +WWNSK+ W LN  E+  Y  V+ 
Sbjct  205  IWEHAPFRAYFKGFNVNGCSVS-NGGSIDPC-NYDQFWWNSKRYWELNPTEQKAYKIVKH  262

Query  201  NFMHYDYCADLPRFPTLPPECKR  133
            +++ YDYC D  R P  PPEC +
Sbjct  263  HYLTYDYCVDKTRHPVPPPECSQ  285



>ref|XP_010473997.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Camelina sativa]
Length=397

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 185/263 (70%), Gaps = 3/263 (1%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY V WG NHV   +QG+E++L MD+SSGSGF SKS YGSG F++R+K+P  D+A
Sbjct  135  IDFDKNYVVTWGQNHVLKLNQGKEVELSMDQSSGSGFESKSHYGSGFFQMRIKLPPRDSA  194

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   + HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP+  F
Sbjct  195  GVVTAFYLTSKG-NTHDEVDFEFLGNRQGKPIGIQTNVFTNGQGNREQKFVLWFDPSTSF  253

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN + IVFYVD IPIRVFKN +  GV YPS   +Q+  SLWN E WAT GGK K
Sbjct  254  HTYGILWNPYHIVFYVDKIPIRVFKNNKRFGVNYPS-KPMQLVASLWNGEEWATSGGKDK  312

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA+FQGF   GC  D +SN+   C S   YWWN+     L+  E+     VR
Sbjct  313  INWAYAPFKAQFQGFPEHGCRLDGQSNNRKVCGST-RYWWNNMTYNRLSANEQKAMKDVR  371

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M YDYC+D PR+P  P EC+
Sbjct  372  AKYMKYDYCSDRPRYPVPPTECR  394



>emb|CAB45507.1| endoxyloglucan transferase-like protein [Arabidopsis thaliana]
 emb|CAB78350.1| endoxyloglucan transferase-like protein [Arabidopsis thaliana]
Length=295

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 188/263 (71%), Gaps = 7/263 (3%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V FD NY V WG N+V   +QG+E+QL +D SSGSGF SK+ Y SG F+IR+KVP  DT+
Sbjct  37   VGFDDNYVVTWGQNNVLKLNQGKEVQLSLDHSSGSGFESKNHYESGFFQIRIKVPPKDTS  96

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   + HDE+DFEFLGN+E K + +QTN+   G GNREQ++ LWFDP+ DF
Sbjct  97   GVVTAFYLTSKG-NTHDEVDFEFLGNKEGK-LAVQTNVFTNGKGNREQKLALWFDPSKDF  154

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIV YVDNIP+RVFKN  + G+ YPS   +Q+  SLWN E+WATDGGK+K
Sbjct  155  HTYAILWNPYQIVLYVDNIPVRVFKNTTSQGMNYPS-KPMQVVVSLWNGENWATDGGKSK  213

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS APFKA FQGFN  GC  + +    N C S  AYWWN+     L+  E+  Y  VR
Sbjct  214  INWSLAPFKANFQGFNNSGCFTNAEK---NACGSS-AYWWNTGSYSKLSDSEQKAYTNVR  269

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
            + +M+YDYC+D  RF   P ECK
Sbjct  270  QKYMNYDYCSDKVRFHVPPSECK  292



>ref|NP_193044.2| xyloglucan endotransglucosylase/hydrolase 1 [Arabidopsis thaliana]
 sp|Q9SV61.2|XTH1_ARATH RecName: Full=Putative xyloglucan endotransglucosylase/hydrolase 
protein 1; Short=At-XTH1; Short=XTH-1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE83228.1| putative xyloglucan endotransglucosylase/hydrolase protein 1 
[Arabidopsis thaliana]
Length=292

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 188/263 (71%), Gaps = 7/263 (3%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V FD NY V WG N+V   +QG+E+QL +D SSGSGF SK+ Y SG F+IR+KVP  DT+
Sbjct  34   VGFDDNYVVTWGQNNVLKLNQGKEVQLSLDHSSGSGFESKNHYESGFFQIRIKVPPKDTS  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS   + HDE+DFEFLGN+E K + +QTN+   G GNREQ++ LWFDP+ DF
Sbjct  94   GVVTAFYLTSKG-NTHDEVDFEFLGNKEGK-LAVQTNVFTNGKGNREQKLALWFDPSKDF  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIV YVDNIP+RVFKN  + G+ YPS   +Q+  SLWN E+WATDGGK+K
Sbjct  152  HTYAILWNPYQIVLYVDNIPVRVFKNTTSQGMNYPS-KPMQVVVSLWNGENWATDGGKSK  210

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS APFKA FQGFN  GC  + +    N C S  AYWWN+     L+  E+  Y  VR
Sbjct  211  INWSLAPFKANFQGFNNSGCFTNAEK---NACGSS-AYWWNTGSYSKLSDSEQKAYTNVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
            + +M+YDYC+D  RF   P ECK
Sbjct  267  QKYMNYDYCSDKVRFHVPPSECK  289



>ref|XP_008235463.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Prunus mume]
Length=286

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 192/265 (72%), Gaps = 11/265 (4%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHD-  751
            D +FD NY V WGN+HV S +QGREIQL +D  SGSGF S   Y SG F +RMK+PG++ 
Sbjct  26   DSAFDKNYEVTWGNDHVLSLNQGREIQLSLDSHSGSGFGSYLKYSSGFFHMRMKIPGNNS  85

Query  750  TAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAA  571
            TAGV+T+FYLTS T  RHDELDFEFLGN E + +TLQTN+   GVG REQRI LWFDP +
Sbjct  86   TAGVITTFYLTSKTS-RHDELDFEFLGNAEGEAITLQTNVFVNGVGGREQRIDLWFDPTS  144

Query  570  DFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +FH YK+LWN HQIVF++D+ PIRVF N  N+GV YP+   ++I+ +LWN + WA+    
Sbjct  145  NFHDYKLLWNPHQIVFFIDDTPIRVFNNYTNLGVPYPT-QPMRIEATLWNGD-WAS---P  199

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             KINW+ APF+A +QGF++ GC+   +S+++  C+ +  YWWN++  W LN  ++  Y  
Sbjct  200  QKINWAYAPFRARYQGFDISGCST--QSSNVEECY-KSNYWWNNRNYWELNPTQKQAYEN  256

Query  210  VRRNFMHYDYCADLPRFP-TLPPEC  139
            VR+ +M+YDYC D PRFP  LP EC
Sbjct  257  VRKKYMNYDYCNDKPRFPFGLPKEC  281



>ref|XP_010450275.1| PREDICTED: putative xyloglucan endotransglucosylase/hydrolase 
protein 1 [Camelina sativa]
Length=294

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 185/261 (71%), Gaps = 6/261 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD NY V WG +HV  S+QG+E+QL MD  SGSGF SK+ YGSG F++R+KV G++++GV
Sbjct  38   FDENYVVTWGQDHVLKSNQGKEVQLTMDYFSGSGFESKNHYGSGFFQMRIKVFGNNSSGV  97

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYLTS   D HDE+DFEFLGN E K +TLQ N+  EG GNREQR  LWFDP  DFH+
Sbjct  98   VTAFYLTSKG-DTHDEVDFEFLGNVEGKSITLQKNVYTEGRGNREQRFDLWFDPTIDFHT  156

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y ILWN + IVFYVD+IPIRVF N  + GV YPS   +Q+  SLWN E+WATDGGK KIN
Sbjct  157  YGILWNPYHIVFYVDSIPIRVFNNNTSNGVNYPS-KPMQVVSSLWNGENWATDGGKTKIN  215

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            W+ APFKA FQGF+  GC  D   N+   C S   YWWN+  L     E++V Y  VR  
Sbjct  216  WTYAPFKAHFQGFSDSGCHVDDPRNNSKACGSS-IYWWNTMMLSIF--EQKV-YKTVREK  271

Query  198  FMHYDYCADLPRFPTLPPECK  136
            +M+YDYC+D  RF  LP EC+
Sbjct  272  YMNYDYCSDQARFSVLPSECR  292



>gb|KHN10983.1| Xyloglucan endotransglucosylase/hydrolase protein 2 [Glycine 
soja]
Length=231

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = -2

Query  783  FEIRMKVPGHDTAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNRE  604
            F +R+KVP  ++AGVVT++YLTS     HDELDFEFLGNRE KP  LQTN+  +G GNRE
Sbjct  20   FHLRIKVPDRNSAGVVTAYYLTSQGRS-HDELDFEFLGNREGKPYRLQTNVFVDGQGNRE  78

Query  603  QRIYLWFDPAADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLW  424
            QRI LWFDP ADFH+Y+ILWNQHQIVFYVDNIPIRV+KNK +IGV YP+   +QI+ SLW
Sbjct  79   QRILLWFDPTADFHNYRILWNQHQIVFYVDNIPIRVYKNKSDIGVGYPT-KPMQIQASLW  137

Query  423  NAESWATDGGKAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWS  244
            + +SWAT+GGK K +WS APF+A FQGF+V GC   P SN    C S   YWWN++K W 
Sbjct  138  DGDSWATNGGKTKTDWSYAPFRASFQGFDVSGCQV-PTSNISQNC-SSDKYWWNTQKFWR  195

Query  243  LNREERVQYLKVRRNFMHYDYCADLPRFPTLPPEC  139
            L+   + QY +V+  +M YDYCAD  R+P +P EC
Sbjct  196  LDSVRQRQYERVKHKYMTYDYCADRNRYPEIPLEC  230



>ref|XP_006414974.1| hypothetical protein EUTSA_v10026812mg [Eutrema salsugineum]
 gb|ESQ56427.1| hypothetical protein EUTSA_v10026812mg [Eutrema salsugineum]
Length=291

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 180/261 (69%), Gaps = 5/261 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            FD NY V WGN  +   +QGRE+QLLMDK+SGS F SK +YGSG F++R+K+P  D+AGV
Sbjct  33   FDKNYVVTWGN--ILKFNQGREVQLLMDKASGSAFESKHNYGSGFFQMRIKLPLRDSAGV  90

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYLTS   + HDELDFEFLGNR  KP+ +QTN+   G GNREQ+  LWFDP  +FH+
Sbjct  91   VTAFYLTSKG-NAHDELDFEFLGNRGGKPIAIQTNVFTNGQGNREQKFVLWFDPTTNFHT  149

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y ILWN + IVFYVD +PIR+FKNK+  GV YPS   +++  SLWN E WATDGGKAKIN
Sbjct  150  YGILWNPYHIVFYVDKVPIRIFKNKKRFGVGYPS-KPMKVVASLWNGEDWATDGGKAKIN  208

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            WS APFKA FQ F   GC  D +      C S   YWWN +    L   E   +  VR  
Sbjct  209  WSYAPFKANFQRFFDSGCHMDGQKQSGKFCGS-AIYWWNRRIYSRLTENEEKAFKHVRTK  267

Query  198  FMHYDYCADLPRFPTLPPECK  136
            +M+YDYC+D PRFP  P EC+
Sbjct  268  YMNYDYCSDRPRFPVPPIECR  288



>emb|CDY00753.1| BnaC03g37370D [Brassica napus]
Length=291

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 182/262 (69%), Gaps = 5/262 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
             FD NY V WGN  V   +QGRE+QL MDK++G+ F SK  +GSG F++R+K+P  D+AG
Sbjct  32   GFDENYVVTWGN--VLKLNQGREVQLSMDKTAGAAFESKHKFGSGFFQMRIKLPPKDSAG  89

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP+ DFH
Sbjct  90   VVTAFYLTSKG-DTHDEVDFEFLGNRDGKPIQIQTNVFNNGQGNREQKFVLWFDPSTDFH  148

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            +Y ILWN +QIVFYVD IPIR+FKN +  GV YPS   + +  SLWN E WATDGGKAKI
Sbjct  149  TYGILWNPYQIVFYVDKIPIRIFKNNKKYGVGYPS-KPMTVIASLWNGEGWATDGGKAKI  207

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NWS APFKA FQ F+  GC AD  + +   C S   Y+WN+ +   L+  E   +  VR 
Sbjct  208  NWSYAPFKANFQSFSDSGCHADGGNINAEACGST-TYYWNTIQYSRLSANETTAFKNVRA  266

Query  201  NFMHYDYCADLPRFPTLPPECK  136
             ++ YDYC+D  RFP  P EC+
Sbjct  267  KYVTYDYCSDKRRFPVPPTECR  288



>ref|XP_007199163.1| hypothetical protein PRUPE_ppa019741mg, partial [Prunus persica]
 gb|EMJ00362.1| hypothetical protein PRUPE_ppa019741mg, partial [Prunus persica]
Length=267

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 192/265 (72%), Gaps = 11/265 (4%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHD-  751
            D +FD NY + WGN+HV S +QGREIQL +D  SGSGF S   Y SG F +RMK+PG++ 
Sbjct  4    DSAFDKNYEITWGNDHVLSLNQGREIQLSLDSRSGSGFGSYLKYSSGFFHMRMKIPGNNS  63

Query  750  TAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAA  571
            TAGV+T+FYLTS T  RHDELDFEFLGN E + +TLQTN+   GVG REQRI+LWFDP +
Sbjct  64   TAGVITTFYLTSKTS-RHDELDFEFLGNAEGEAITLQTNVFVNGVGGREQRIHLWFDPTS  122

Query  570  DFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGK  391
             FH YK+LWN  QIVF++D+ PIRVF N  N+GV YP+   ++I+ +LWN + WA+    
Sbjct  123  HFHDYKLLWNPRQIVFFIDDTPIRVFNNYTNLGVPYPT-QPMRIEATLWNGD-WAS---P  177

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             KINW+ APF+A++QGF++ GC+   +S+++  C+ +  YWWN++  W LN  ++  Y  
Sbjct  178  QKINWAYAPFRADYQGFDISGCST--QSSNVEECY-KSNYWWNNRNYWELNPTQKQAYEN  234

Query  210  VRRNFMHYDYCADLPRFP-TLPPEC  139
            VR+ +M+YDYC D PRFP  LP EC
Sbjct  235  VRKKYMNYDYCNDKPRFPFGLPKEC  259



>ref|XP_002518076.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF44209.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=289

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 189/263 (72%), Gaps = 4/263 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
            SF  NY + +G +H  S  QGR++Q+ +D+SSG+ F SK +YGSG F + MK+PG ++ G
Sbjct  31   SFYDNYKISYGYDHAWSKSQGRDVQISLDQSSGAAFQSKQTYGSGFFHLNMKLPGSNSGG  90

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYL+S + + HDELDFEFLGN + KP+ LQTN++A G G+REQRI LWFDP + +H
Sbjct  91   VVTAFYLSSVSPNHHDELDFEFLGNNDGKPIYLQTNVIANGKGDREQRIRLWFDPTSKYH  150

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            SY+ILWN+ QIVFY+DN PIRVFKNK  +GV +PS   LQI+ S+WN ++WATDGG  KI
Sbjct  151  SYRILWNRFQIVFYIDNYPIRVFKNKRKLGVGFPS-QPLQIESSIWNGDNWATDGGLTKI  209

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NW+ APF A F+ F ++GC A    +++  C+S   +WWN ++ W LN  ++  Y  ++ 
Sbjct  210  NWTYAPFIAGFRSFGINGCPA--YGSNMKHCYSI-KFWWNRQQYWQLNPSQQRTYQTIKS  266

Query  201  NFMHYDYCADLPRFPTLPPECKR  133
             +  YDYC D  RFPT PPEC +
Sbjct  267  KYTTYDYCTDGKRFPTPPPECPQ  289



>ref|XP_010488614.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
3 [Camelina sativa]
Length=291

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 185/262 (71%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G+E+ L MD+SSG GF SK+SYGSG F+IR+KVPG +T 
Sbjct  34   VTFGQNYVVTWGQSHVSTLHSGQEVDLYMDQSSGGGFESKNSYGSGLFQIRIKVPGGNTG  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  94   GIVTAFYLTSKGGG-HDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFRLWFNPTKHY  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVDNIPIRV+KN+   GV YPS   +Q++ SLWN + WATDGG+ K
Sbjct  153  HTYGILWNPYQIVFYVDNIPIRVYKNEN--GVSYPS-KPMQVEASLWNGDDWATDGGRTK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NW+ +PF A FQ F++ GC  D +SN++  C S   YWWN+     LN  E+  Y   R
Sbjct  210  VNWAYSPFIAHFQDFSLSGCNIDGRSNNVGACASS-NYWWNAGNYQRLNGHEQSMYEHFR  268

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M+YDYC+D  ++ TLP EC
Sbjct  269  NKYMNYDYCSDRSKYQTLPREC  290



>emb|CDX73839.1| BnaA03g32080D [Brassica napus]
Length=290

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 181/262 (69%), Gaps = 6/262 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
             FD NY V WGN  V   +QG E+QL MDKS+GS F SK  +GSG F++R+K+P  DTAG
Sbjct  32   GFDENYVVTWGN--VLKLNQG-EVQLSMDKSAGSAFESKHKFGSGFFQMRIKLPPKDTAG  88

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP+ DFH
Sbjct  89   VVTAFYLTSKG-DTHDEVDFEFLGNRDGKPIQIQTNVFNNGQGNREQKFVLWFDPSTDFH  147

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            +Y ILWN +QIVFYVD IPIR+FKN +  GV YPS   + +  SLWN E WATDGGKAKI
Sbjct  148  TYGILWNPYQIVFYVDKIPIRIFKNNKKYGVGYPS-KPMTVIASLWNGEGWATDGGKAKI  206

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NWS APFKA FQ F+  GC AD  + +   C S   Y+WN+ +   L+  E   +  VR 
Sbjct  207  NWSYAPFKANFQSFSDSGCHADGGNINAEACGST-TYYWNTIQYSRLSANETTAFKNVRA  265

Query  201  NFMHYDYCADLPRFPTLPPECK  136
             +M YDYC+D  RFP  P EC+
Sbjct  266  KYMRYDYCSDKRRFPVPPTECR  287



>ref|XP_009135204.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Brassica rapa]
Length=290

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 181/262 (69%), Gaps = 6/262 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
             FD NY V WGN  V   +QG E+QL MDKS+GS F SK  +GSG F++R+K+P  DTAG
Sbjct  32   GFDENYVVTWGN--VLKLNQG-EVQLSMDKSAGSAFESKHKFGSGFFQMRIKLPPKDTAG  88

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
            VVT+FYLTS   D HDE+DFEFLGNR+ KP+ +QTN+   G GNREQ+  LWFDP+ DFH
Sbjct  89   VVTAFYLTSKG-DTHDEVDFEFLGNRDGKPIQIQTNVFNNGQGNREQKFVLWFDPSTDFH  147

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            +Y ILWN +QIVFYVD IPIR+FKN +  GV YPS   + +  SLWN E WATDGGKAKI
Sbjct  148  TYGILWNPYQIVFYVDKIPIRIFKNNKKYGVGYPS-KPMTVIASLWNGEGWATDGGKAKI  206

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NWS APFKA FQ F+  GC AD  + +   C S   Y+WN+ +   L+  E   +  VR 
Sbjct  207  NWSYAPFKANFQSFSDSGCHADGGNINAEACGST-TYYWNTIQYSRLSANETTAFKNVRA  265

Query  201  NFMHYDYCADLPRFPTLPPECK  136
             +M YDYC+D  RFP  P EC+
Sbjct  266  KYMKYDYCSDKRRFPVPPTECR  287



>ref|XP_010466925.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
3-like [Camelina sativa]
Length=291

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 185/262 (71%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NYFV WG +HV++   G+E+ L MD+SSG GF SK+SYGSG F+IR+KVPG +T 
Sbjct  34   VTFGQNYFVTWGQSHVSTLHSGQEVDLYMDQSSGGGFESKNSYGSGLFQIRIKVPGGNTG  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  94   GIVTAFYLTSKGGG-HDEIDFEFLGNNYGKPVTLQTNLFLNGEGNREERFVLWFNPTKHY  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVDNIPIRV+KN+   GV YP+   +Q++ SLWN + WATDGG+ K
Sbjct  153  HTYGILWNPYQIVFYVDNIPIRVYKNEN--GVSYPT-KPMQVEASLWNGDDWATDGGRTK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NWS +PF A FQ F++ GC  D +SN+++ C S   YWWN+     LN  E+  Y   R
Sbjct  210  VNWSYSPFIAHFQDFSLSGCNIDGRSNNVSACASSN-YWWNAGNYQRLNGHEQSMYEHFR  268

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M+YDYC D  ++ T P EC
Sbjct  269  NKYMNYDYCTDRSKYQTPPREC  290



>ref|XP_010440647.1| PREDICTED: putative xyloglucan endotransglucosylase/hydrolase 
protein 1 [Camelina sativa]
Length=286

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 185/264 (70%), Gaps = 8/264 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            + SFD NY V WG +HV+  +Q +E+QL MD +SGSGF SK+ YGSG F++R+K+P  D+
Sbjct  29   EASFDENYVVTWGQDHVSKLNQNKEVQLSMDHNSGSGFESKNHYGSGFFQMRIKLPQKDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYLTS   +  DE+DFEFLGNRE KP+ +QTN+  +G GNREQR  LWFDP  D
Sbjct  89   AGIVTAFYLTSKG-NIQDEVDFEFLGNREGKPIIVQTNVFTKGQGNREQRFVLWFDPTED  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y ILWN + IVF++DNIPIRVFKN    G+ YPS   +Q+  SLWN E+WATDGGKA
Sbjct  148  FHAYGILWNPYHIVFFIDNIPIRVFKNNPK-GISYPS-KPMQVVSSLWNGEAWATDGGKA  205

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
             INWS APFKA FQGF+  GC  D     +N C S   YWWN+ K   L+  E+  Y   
Sbjct  206  MINWSYAPFKAHFQGFSESGCHVD----GLNVCGSS-TYWWNTGKYVGLSVSEQKDYENA  260

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            +  + +YDYC+D  RF  LP EC+
Sbjct  261  KTKYRNYDYCSDHTRFSVLPNECQ  284



>ref|XP_006418675.1| hypothetical protein EUTSA_v10002629mg [Eutrema salsugineum]
 gb|ESQ37111.1| hypothetical protein EUTSA_v10002629mg [Eutrema salsugineum]
Length=292

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 191/263 (73%), Gaps = 6/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG  HV++   G+E+ L MD+SSG+GF S++ YGSG F++R+KVPG ++A
Sbjct  34   VTFGQNYVVKWGQGHVSTLHSGQEVDLYMDQSSGAGFQSRNLYGSGLFQMRIKVPGGNSA  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTSN  + HDE+DFEFLGN + KP+TLQTN+ A G GNRE+R +LWF+P   +
Sbjct  94   GVVTAFYLTSNGGN-HDEIDFEFLGNNDGKPITLQTNVFANGEGNREERFHLWFNPIKHY  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVDNIPIRV+KN++  GV YPS   +Q++ SLWN + WATDGG+ K
Sbjct  153  HTYGILWNPYQIVFYVDNIPIRVYKNEK--GVSYPS-KPMQVEASLWNGDDWATDGGRTK  209

Query  384  INWSQAPFKAEFQGFN-VDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            +NWS +PF A FQ F+ + GC  D +SND+  C S   YWWN+ K   L+  E+  Y  V
Sbjct  210  VNWSYSPFIAHFQDFSGLSGCYIDGRSNDVAACGSSN-YWWNAGKYQRLSGYEQKIYEHV  268

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R  +M+YDYC D  ++ + P EC
Sbjct  269  RNKYMNYDYCTDRNKYQSPPREC  291



>ref|XP_006300154.1| hypothetical protein CARUB_v10016385mg [Capsella rubella]
 gb|EOA33052.1| hypothetical protein CARUB_v10016385mg [Capsella rubella]
Length=293

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 185/265 (70%), Gaps = 5/265 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G+E+ L MD+SSG GF SK SYGSG F+IR+KVPG +T 
Sbjct  34   VTFGQNYVVTWGQSHVSTLHSGQEVDLYMDQSSGGGFESKDSYGSGLFQIRIKVPGGNTG  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  94   GIVTAFYLTSKGGG-HDEIDFEFLGNNYGKPVTLQTNLFLNGEGNREERFNLWFNPTKHY  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVDNIPIRV+KN+   G+ YPS   +Q++ SLWN ++WATDGG+ K
Sbjct  153  HTYGILWNPYQIVFYVDNIPIRVYKNER--GLSYPS-KPMQVEASLWNGDAWATDGGRTK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NWS +PF A FQ F++ GC  D +SN++  C S   YWWN+ +   LN  E+  Y   R
Sbjct  210  VNWSYSPFIAHFQDFSLSGCNIDGRSNNVGACESS-NYWWNTGEYQRLNGHEQQMYEHFR  268

Query  204  RNFMHYDYCADLPRFPTLPPECKRH  130
              +M+YDYC D  ++ T P EC  H
Sbjct  269  SKYMNYDYCTDRSKYQTPPRECYYH  293



>ref|XP_004510291.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Cicer arietinum]
Length=221

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 162/216 (75%), Gaps = 5/216 (2%)
 Frame = -2

Query  783  FEIRMKVPGHDTAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNRE  604
            F +R+KVPG D+AGVVT++YL +     H+E+DFEFLG+R   P  LQTN+ A GVGNRE
Sbjct  8    FHMRIKVPGSDSAGVVTAYYLKT-LGKLHEEMDFEFLGSRIGMPYVLQTNVFANGVGNRE  66

Query  603  QRIYLWFDPAADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLW  424
            Q+I+LWFDP  DFH YKILWN HQIVFYVDNIPIRV+KN  NIG  YPS +A+QI+ SLW
Sbjct  67   QKIHLWFDPTIDFHDYKILWNAHQIVFYVDNIPIRVYKNNTNIGASYPS-NAMQIQVSLW  125

Query  423  NAESWATDGGKAKINWSQAPFKAEFQGFNVDGCTA-DPKSNDINRCFSRGAYWWNSKKLW  247
            N E WAT+GGKAKINW+ APFKA FQGF+V GC + +P   D  +CF+ G +WWN++  W
Sbjct  126  NGEDWATEGGKAKINWNYAPFKAYFQGFDVSGCPSLNPNLVDP-KCFN-GNFWWNNQNYW  183

Query  246  SLNREERVQYLKVRRNFMHYDYCADLPRFPTLPPEC  139
             LN +E  Q   +++N++ YDYC D  R+PT P EC
Sbjct  184  QLNPQEEKQLENIKKNYVIYDYCTDRKRYPTPPIEC  219



>ref|XP_010513810.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
3-like [Camelina sativa]
Length=291

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 182/262 (69%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G+E+ L MD+SSG GF SK+SYGSG F+IR+KVPG +T 
Sbjct  34   VTFGQNYVVTWGQSHVSTLHSGQEVDLYMDQSSGGGFESKNSYGSGLFQIRIKVPGGNTG  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  94   GIVTAFYLTSKGGG-HDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFTLWFNPTKHY  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVD IPIRV+KN+   GV YP+   +Q++ SLWN + WATDGG+ K
Sbjct  153  HTYGILWNPYQIVFYVDYIPIRVYKNEN--GVSYPT-KPMQVEASLWNGDDWATDGGRTK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NWS +PF A FQ F++ GC  D +SN++  C S   YWWN+     LN  E+  Y   R
Sbjct  210  VNWSYSPFIAHFQDFSLSGCNIDGRSNNVGACASS-NYWWNAGNYQRLNGPEQSMYENFR  268

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M+YDYC D  ++ T P EC
Sbjct  269  NKYMNYDYCTDRSKYQTPPREC  290



>ref|XP_002883570.1| hypothetical protein ARALYDRAFT_899104 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59829.1| hypothetical protein ARALYDRAFT_899104 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 182/262 (69%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G E+ L +D+SSG GF SK SYGSG FE+R+KVPG +T 
Sbjct  33   VTFGQNYVVKWGQSHVSTLHSGEEVDLYIDQSSGGGFESKDSYGSGLFEMRIKVPGGNTG  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  93   GIVTAFYLTSKGGG-HDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPTKHY  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y +LWN +QIVFYVDNIPIRV+KN+   GV YPS   +Q++ SLWN + WATDGG+ K
Sbjct  152  HTYGLLWNPYQIVFYVDNIPIRVYKNEN--GVSYPS-RPMQVEASLWNGDDWATDGGRTK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NWS +PF A F+ F + GC  D +SN++  C S   YWWN+ K   L+  E+  Y  VR
Sbjct  209  VNWSYSPFIAHFRDFALSGCNIDGRSNNVGACESS-NYWWNAGKYQRLSGNEQKLYEHVR  267

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M+YDYC D  ++ T P EC
Sbjct  268  SKYMNYDYCTDRSKYQTPPREC  289



>ref|XP_009372559.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Pyrus x bretschneideri]
Length=295

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 191/266 (72%), Gaps = 10/266 (4%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVP-GHD  751
            D+ FD NY   WGN+H+ S +QGRE+QL +D  SG  FAS  +Y SG F +RMK+P  ++
Sbjct  23   DIVFDKNYEFIWGNDHILSLNQGRELQLTLDNRSGCKFASYLNYSSGFFHMRMKIPENNN  82

Query  750  TAGVVTSFYLTSN-TEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPA  574
            TAGVVTSFYL S  +  +HDELDFEFLGN E + +TLQTN+   GVGNREQRI LWFDPA
Sbjct  83   TAGVVTSFYLMSKASASQHDELDFEFLGNIEGQQITLQTNVFVNGVGNREQRINLWFDPA  142

Query  573  ADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGG  394
             +FH YKILWN HQ+VF++D+ PIRVF N  N GV YP+   ++I+ +LW A+ WAT G 
Sbjct  143  GNFHDYKILWNPHQVVFFIDDTPIRVFNNYTNYGVPYPT-QPMRIEAALWTAD-WATFG-  199

Query  393  KAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYL  214
              KINW+ APF A +QGF++ GC+A  +++D+  C+S   +WWN+ + W+LN  ++  Y 
Sbjct  200  -HKINWTYAPFAAHYQGFDISGCSA--QNSDVEECYSSN-HWWNNMEHWNLNSTQQKAYE  255

Query  213  KVRRNFMHYDYCADLPRFPT-LPPEC  139
             VR+ +M+YDYC D  ++P+ LP EC
Sbjct  256  NVRKKYMNYDYCDDKAKYPSGLPREC  281



>ref|XP_010269486.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein [Nelumbo nucifera]
Length=328

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 178/262 (68%), Gaps = 2/262 (1%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            F  NY   W  +H+   + G ++QL++DK +G+GF S+ S+  G F +RMK+ G D+AGV
Sbjct  65   FQKNYVPTWAPDHIKYINGGSQVQLVLDKYTGTGFQSRGSFLFGHFSMRMKMVGGDSAGV  124

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G REQRIYLWFDPA DFH+
Sbjct  125  VTAFYLSSEKLE-HDEIDFEFLGNRTGQPYILQTNVFSGGKGEREQRIYLWFDPAQDFHT  183

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y +LWN HQIVF+VDN+PIR+FKN  ++GVRYP    ++I  SLWNA+ WAT GG  K +
Sbjct  184  YSVLWNMHQIVFFVDNVPIRIFKNNGDLGVRYPFNQPMKIYSSLWNADDWATRGGLEKTD  243

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            WS+APF A +  F+VDGC A      +  C SRG  WW+      L+ ++  +   VR+ 
Sbjct  244  WSKAPFVASYSSFHVDGCDAS-SPQSLQFCASRGRMWWDQIAFHDLDAQQYRRLQWVRKK  302

Query  198  FMHYDYCADLPRFPTLPPECKR  133
            F  Y+YC D  R+PT+PPEC R
Sbjct  303  FTIYNYCTDRSRYPTIPPECAR  324



>ref|XP_009414407.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Musa acuminata subsp. malaccensis]
Length=300

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 184/265 (69%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H++  + G E+QL +DKS+G+GF S+ SY  G F + +K+   D+
Sbjct  36   DVPFQKNYVPTWAFDHISYFNGGDEVQLCLDKSTGTGFQSRGSYLFGHFSMHIKMVPGDS  95

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  96   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTDQPYILQTNVFSGGKGDREQRIYLWFDPTKD  154

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN HQIVF+VD++PIRVFKN +++GV+YP    ++I  SLWNA+ WAT GG  
Sbjct  155  YHSYSVLWNMHQIVFFVDDVPIRVFKNSKDLGVKYPFNQPMKIYSSLWNADDWATRGGLE  214

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S D   C ++G  WW+ K+   L+  +  +   V
Sbjct  215  KTDWSRAPFVASYRGFHIDGCEA---SADAKFCATQGMQWWDQKEFQDLDGPQYRRLQWV  271

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YCAD  R+PT+PPEC R
Sbjct  272  RQKYTIYNYCADQSRYPTMPPECHR  296



>gb|KDP39357.1| hypothetical protein JCGZ_01114 [Jatropha curcas]
Length=274

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 177/259 (68%), Gaps = 3/259 (1%)
 Frame = -2

Query  909  NYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGVVTS  730
            NY   WG++HV +   G ++Q+ +D+SSG+ F SK++YG G F I +KVPG ++AGVVT+
Sbjct  19   NYEFAWGSDHVRTFGGGTDVQIFLDQSSGARFESKAAYGGGYFSIEIKVPGRNSAGVVTT  78

Query  729  FYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHSYKI  550
            FYLTS +E+ HDELDFEFLGN+E +PV LQTN+ AEG G REQR  LWFDP ADFH Y I
Sbjct  79   FYLTSVSENGHDELDFEFLGNKEGQPVYLQTNVFAEGKGEREQRFKLWFDPTADFHRYTI  138

Query  549  LWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKINWSQ  370
             WNQH IVFYVD+ PIRVFKN  NIGV Y S   ++I  S+WN + WATDGG+ KINW+ 
Sbjct  139  FWNQHMIVFYVDDSPIRVFKNNRNIGVGYLS-KPMKIAASIWNGDGWATDGGRTKINWAY  197

Query  369  APFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRNFMH  190
            APF A ++ F V  C     S++I+ C S    WWN +  W+L   E   Y  V+  +  
Sbjct  198  APFIAGYRDFTVSACPVG-DSDNIDACISPNP-WWNQEGFWTLGPSEDHIYQYVKSTYKI  255

Query  189  YDYCADLPRFPTLPPECKR  133
            YDYC D  + PT PPEC +
Sbjct  256  YDYCTDQTKNPTPPPECGQ  274



>gb|KFK39808.1| hypothetical protein AALP_AA3G291100 [Arabis alpina]
Length=288

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 188/263 (71%), Gaps = 6/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G+E+ L MD+SSG+GF SK +YGSG F++R+KVPG ++ 
Sbjct  30   VTFGQNYVVTWGQSHVSTLHSGKEVDLYMDQSSGAGFESKDTYGSGLFQMRIKVPGGNSG  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS    R DE+DFEFLGN   +P+TLQTN+   GVG+RE+R  LWF+P   +
Sbjct  90   GVVTAFYLTSKGGSR-DEVDFEFLGNNNGRPITLQTNVFVNGVGDREERFRLWFNPIKHY  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN++QIVFYVDNIPIRV+KN++  GV YPS   +Q++ SLWN + WATDGG+ K
Sbjct  149  HTYGILWNRYQIVFYVDNIPIRVYKNEK--GVSYPS-KPMQVEASLWNGDDWATDGGRTK  205

Query  384  INWSQAPFKAEFQGFN-VDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            INWS +PF A FQ F+ + GC  D +S ++  C S   YWWN+ K   L+  E+  Y  V
Sbjct  206  INWSNSPFIAHFQDFSGLSGCNIDVRSINVAACGSSN-YWWNTGKYQRLSGYEQKIYEHV  264

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R+ +M+ DYC D  R+PT P EC
Sbjct  265  RKKYMNSDYCTDRSRYPTPPREC  287



>emb|CDY69237.1| BnaCnng62600D [Brassica napus]
Length=295

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  31   DVPFGRNYVPTWAFDHQKQLNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +PV LQTN+   G GNREQRIYLWFDP+  
Sbjct  91   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPVILQTNVFTGGKGNREQRIYLWFDPSKA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VDNIPIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  150  YHTYSVLWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+  +   L+ E+  +   V
Sbjct  210  KTNWANAPFIASYRGFHIDGCQA---SVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  267  RMKWTIYNYCTDRTRFPVMPAECKR  291



>ref|XP_010532897.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Tarenaya hassleriana]
Length=292

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 191/266 (72%), Gaps = 11/266 (4%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGH-DT  748
            +SFD  Y V WG +HV    QG+EIQL +D+ SG GF SKSSYGSG F+ R+K+P   D+
Sbjct  33   ISFDDKYVVTWGQDHVFKLGQGQEIQLSLDQLSGCGFESKSSYGSGFFQTRIKLPDQKDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            +GV+T+FYLTS  E+ HDE+DFEFLGNR+  P+TLQTN+ A+G G+REQRI LWFDP+ D
Sbjct  93   SGVITAFYLTSKGEN-HDEVDFEFLGNRQGDPITLQTNVFADGKGDREQRILLWFDPSKD  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY I+WN  QI+FYVD IPIRVFKN ++ GV +P+  A+Q+ GSLWN  +WA+  GK 
Sbjct  152  FHSYSIVWNPTQILFYVDEIPIRVFKNNKDKGVGFPT-KAMQVVGSLWNG-TWAS--GKT  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAY--WWNSKK-LWSLNREERVQY  217
            +INW+ APF A FQ F++ GC  D  SND N   + G+   WWN+ K +  L+  E  +Y
Sbjct  208  QINWAYAPFSAHFQSFDIPGCAVD--SNDGNALGTCGSAQDWWNAGKYVVGLSGGEEKEY  265

Query  216  LKVRRNFMHYDYCADLPRFPTLPPEC  139
              VR  +M+YDYC D  R+PT PPEC
Sbjct  266  QNVRAKYMNYDYCVDRSRYPTPPPEC  291



>ref|NP_189141.1| xyloglucan endotransglucosylase/hydrolase 3 [Arabidopsis thaliana]
 sp|Q9LJR7.1|XTH3_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
3; Short=At-XTH3; Short=XTH-3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01890.1| endoxyloglucan transferase-like protein [Arabidopsis thaliana]
 gb|ABE65966.1| xyloglucan:xyloglucosyl transferase/xyloglucan endotransglycosylase/endo-xyloglucan 
transferase [Arabidopsis thaliana]
 gb|AEE76972.1| xyloglucan endotransglucosylase/hydrolase 3 [Arabidopsis thaliana]
Length=290

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 180/262 (69%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G E+ L MD+SSG GF SK +YGSG FE+R+KVP  +T 
Sbjct  33   VTFGQNYIVTWGQSHVSTLHSGEEVDLYMDQSSGGGFESKDAYGSGLFEMRIKVPSGNTG  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  93   GIVTAFYLTSKGGG-HDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPTKHY  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y +LWN +QIVFYVDNIPIRV+KN+   GV YPS   +Q++ SLWN + WATDGG+ K
Sbjct  152  HTYGLLWNPYQIVFYVDNIPIRVYKNEN--GVSYPS-KPMQVEASLWNGDDWATDGGRTK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NWS +PF A F+ F + GC  D +SN++  C S   YWWN+     L+  E+  Y  VR
Sbjct  209  VNWSYSPFIAHFRDFALSGCNIDGRSNNVGACESSN-YWWNAGNYQRLSGNEQKLYEHVR  267

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M+YDYC D  ++ T P EC
Sbjct  268  SKYMNYDYCTDRSKYQTPPREC  289



>ref|NP_178708.1| endoxyloglucan transferase A1 [Arabidopsis thaliana]
 sp|Q39099.1|XTH4_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
4; Short=At-XTH4; Short=XTH-4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD45123.1|AF163819_1 endoxyloglucan transferase [Arabidopsis thaliana]
 dbj|BAA03921.1| endo-xyloglucan transferase [Arabidopsis thaliana]
 gb|AAC98464.1| xyloglucan endotransglycosylase (ext/EXGT-A1) [Arabidopsis thaliana]
 gb|AAK96738.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AAL07050.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AAL24355.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AAL47378.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AAM47963.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AAM62691.1| putative endoxyloglucan glycosyltransferase [Arabidopsis thaliana]
 gb|AEC06021.1| xyloglucan endotransglucosylase/hydrolase protein 4 [Arabidopsis 
thaliana]
Length=296

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  32   DVPFGRNYVPTWAFDHQKQFNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  92   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIR FKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  151  YHTYSILWNMYQIVFFVDNIPIRTFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ E+  +   V
Sbjct  211  KTNWANAPFVASYKGFHIDGCQA---SVEAKYCATQGRMWWDQKEFRDLDAEQWRRLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  268  RMKWTIYNYCTDRTRFPVMPAECKR  292



>gb|ABK28571.1| unknown [Arabidopsis thaliana]
Length=291

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 180/262 (69%), Gaps = 5/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG +HV++   G E+ L MD+SSG GF SK +YGSG FE+R+KVP  +T 
Sbjct  33   VTFGQNYIVTWGQSHVSTLHSGEEVDLYMDQSSGGGFESKDAYGSGLFEMRIKVPSGNTG  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G+VT+FYLTS     HDE+DFEFLGN   KPVTLQTN+   G GNRE+R  LWF+P   +
Sbjct  93   GIVTAFYLTSKGGG-HDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPTKHY  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y +LWN +QIVFYVDNIPIRV+KN+   GV YPS   +Q++ SLWN + WATDGG+ K
Sbjct  152  HTYGLLWNPYQIVFYVDNIPIRVYKNEN--GVSYPS-KPMQVEASLWNGDDWATDGGRTK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NWS +PF A F+ F + GC  D +SN++  C S   YWWN+     L+  E+  Y  VR
Sbjct  209  VNWSYSPFIAHFRDFALSGCNIDGRSNNVGACESSN-YWWNAGNYQRLSGNEQKLYEHVR  267

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
              +M+YDYC D  ++ T P EC
Sbjct  268  SKYMNYDYCTDRSKYQTPPREC  289



>ref|XP_009408365.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Musa acuminata subsp. malaccensis]
Length=296

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DK++G+GF S  SY  G F +++K+   D+
Sbjct  32   DVPFQKNYVPTWAYDHIKYFDGGREVQLSLDKNTGTGFQSGGSYLFGHFSMQIKMVPGDS  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  92   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTNQPYILQTNVFTGGKGDREQRIYLWFDPTKD  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVFYVD++PIRVFKN +++GVRYP    ++I  SLWN + WAT GG  
Sbjct  151  YHSYSVLWNMYQIVFYVDDVPIRVFKNSKDLGVRYPFNQPMKIYSSLWNGDDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  211  KTDWSKAPFVAAYRGFHIDGCEA---SAEAKFCATQGMRWWDQKEFRDLDGLQYRRLQWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P +PPEC+R
Sbjct  268  RQKYTIYNYCTDRKRYPAMPPECRR  292



>ref|XP_009136186.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase [Brassica 
rapa]
Length=295

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  31   DVPFGRNYVPTWAFDHQKQLNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  91   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  150  YHTYSILWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+  +   L+ E+  +   V
Sbjct  210  KTNWANAPFIASYRGFHIDGCQA---SVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  267  RMKWTIYNYCTDRTRFPVMPAECKR  291



>emb|CDX93096.1| BnaA03g38180D [Brassica napus]
Length=295

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  31   DVPFGRNYVPTWAFDHQKQLNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  91   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  150  YHTYSILWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+  +   L+ E+  +   V
Sbjct  210  KTNWANAPFIASYRGFHIDGCQA---SVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  267  RMKWTIYNYCTDRTRFPVMPAECKR  291



>sp|Q6YDN9.1|XTH_BRAOB RecName: Full=Xyloglucan endotransglucosylase/hydrolase; AltName: 
Full=BobXET16A; Flags: Precursor [Brassica oleracea var. 
botrytis]
 gb|AAO00727.1| xyloglucan endotransglycosylase precursor [Brassica oleracea 
var. botrytis]
Length=295

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  31   DVPFGRNYVPTWAFDHQKQLNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +PV LQTN+   G GNREQRIYLWFDP+  
Sbjct  91   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPVILQTNVFTGGKGNREQRIYLWFDPSKA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VDNIPIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  150  YHTYSVLWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+  +   L+ E+  +   V
Sbjct  210  KTNWANAPFIASYRGFHIDGCQA---SVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P EC+R
Sbjct  267  RMKWTIYNYCTDRTRFPVMPAECRR  291



>ref|XP_006285505.1| hypothetical protein CARUB_v10006944mg [Capsella rubella]
 gb|EOA18403.1| hypothetical protein CARUB_v10006944mg [Capsella rubella]
Length=281

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 179/264 (68%), Gaps = 18/264 (7%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV FD NY V WG N+V   +QG+E+QL MD+SSGSGF SKS Y SG F++R+K+P  D+
Sbjct  33   DVGFDENYVVTWGQNNVLKLNQGKEVQLSMDQSSGSGFESKSHYNSGFFQLRIKLPQKDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            +G+VT+FYLTS   D HDE+DFEFLGN++ K VT+QTN+   G GNREQ+I  WFDP  D
Sbjct  93   SGIVTAFYLTSKG-DSHDEIDFEFLGNKQGKLVTIQTNVFTSGKGNREQKITPWFDPTED  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y+ILWN +QIV YVD IPIRVFKN  + G++YPS   +Q+  SLWN ESWATDGGKA
Sbjct  152  FHTYEILWNPYQIVLYVDKIPIRVFKNNTSGGMKYPS-KPMQVVVSLWNGESWATDGGKA  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINWS  PFKA FQGFN   C  +      ++                L+  ++  Y  V
Sbjct  211  KINWSNGPFKANFQGFNNYACVPNSGCESYSK----------------LSDSDQKAYENV  254

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            R+ +M YDYC+D  RF   P ECK
Sbjct  255  RQKYMIYDYCSDRARFHVPPSECK  278



>ref|XP_009102440.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
3 [Brassica rapa]
Length=293

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 187/263 (71%), Gaps = 6/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY V WG  H+++   G+E+ L MD+SSG+GF SK+ YGSG F++R+KVPG ++ 
Sbjct  35   VTFGQNYVVKWGQGHISTLHSGKEVDLYMDQSSGAGFESKNIYGSGLFQMRIKVPGGNSG  94

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+FYLTS     HDE+DFEFLGN + KP+TLQTNI A G GNRE+R  LWF+P   +
Sbjct  95   GVVTAFYLTS-LGSNHDEIDFEFLGNNDGKPITLQTNIFANGEGNREERFLLWFNPIKHY  153

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN +QIVFYVDNIPIRV+KN+   GV YPS   +Q++ SLWN ++WATDGG+ K
Sbjct  154  HTYGILWNPYQIVFYVDNIPIRVYKNQN--GVNYPS-KPMQVEASLWNGDAWATDGGRTK  210

Query  384  INWSQAPFKAEFQGFN-VDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            IN++ +PF A FQ F+ + GC  D +S+++  C S   YWWN  K   L+  E+  Y  +
Sbjct  211  INYAYSPFIAHFQDFSGLSGCYIDGRSDNVATCGSSN-YWWNGGKYQRLSGYEQKIYEHI  269

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R+ +M+YDYC D  ++ + P EC
Sbjct  270  RKKYMNYDYCTDRSKYQSPPREC  292



>ref|XP_007037991.1| Xyloglucan endotransglucosylase/hydrolase 2, putative [Theobroma 
cacao]
 gb|EOY22492.1| Xyloglucan endotransglucosylase/hydrolase 2, putative [Theobroma 
cacao]
Length=283

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 183/263 (70%), Gaps = 8/263 (3%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             SF +NY+V WG +H    +   EIQL +D++SGSGF +K  YGSG F IRMK+P  ++ 
Sbjct  26   ASFYSNYYVTWGFDHALIINNETEIQLTLDQTSGSGFETKWRYGSGFFHIRMKIPDKNST  85

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GV+T+FYLTS + D HDELDFE LGN +  P TLQTN+ A G G REQRI+ WFDP  DF
Sbjct  86   GVLTAFYLTSRSSD-HDELDFELLGN-DTAPYTLQTNVFANGQGGREQRIHFWFDPTKDF  143

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSYKILWN +QIVFYVDN+PIRVFKN   +GV YP+   +QI+GS+WNAE WA+ GGK +
Sbjct  144  HSYKILWNHYQIVFYVDNVPIRVFKNNRKVGVNYPN-QPMQIEGSVWNAEGWAS-GGK-R  200

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +W+QAPFKA  Q FN DGC     +  + +C+S   +WWN ++ W L   ++     VR
Sbjct  201  TDWNQAPFKAYLQEFNADGCVLHDYA--VEKCYS-SHFWWNREEFWKLKPRDQKANDHVR  257

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M+YDYC+D  R+   PPECK
Sbjct  258  TKYMYYDYCSDKTRYSKPPPECK  280



>ref|XP_002883741.1| endo-xyloglucan transferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60000.1| endo-xyloglucan transferase [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  32   DVPFGRNYVPTWAFDHQKQFNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  92   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPPILQTNVFTGGKGNREQRIYLWFDPSKA  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIR FKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  151  YHTYSILWNMYQIVFFVDNIPIRTFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+  +   L+ E+  +   V
Sbjct  211  KTNWANAPFIASYKGFHIDGCQA---SVEAKYCATQGRMWWDQNEFRDLDAEQWRRLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  268  RMKWTIYNYCTDRTRFPVMPAECKR  292



>ref|XP_004510290.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Cicer arietinum]
Length=238

 Score =   260 bits (665),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 158/209 (76%), Gaps = 5/209 (2%)
 Frame = -2

Query  783  FEIRMKVPGHDTAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNRE  604
            F +R+KVPG D+AGVVT++YLT+     H+E+DFEFLGNR  KP  LQTN+ A GVGNRE
Sbjct  20   FHMRIKVPGSDSAGVVTAYYLTT-LGKLHEEMDFEFLGNRIGKPYILQTNVFANGVGNRE  78

Query  603  QRIYLWFDPAADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLW  424
             +I+LWFDP  DFH YKILWN HQIVFYVDNIPIRV+KN  NIG  YPS +A+QI+ SLW
Sbjct  79   HKIHLWFDPTIDFHDYKILWNAHQIVFYVDNIPIRVYKNNTNIGASYPS-NAMQIQISLW  137

Query  423  NAESWATDGGKAKINWSQAPFKAEFQGFNVDGCTA-DPKSNDINRCFSRGAYWWNSKKLW  247
            N E WAT+GGKAKINW+ APFKA FQGF+V GC + +P   D  +CF+ G +WWN++  W
Sbjct  138  NGEDWATEGGKAKINWNYAPFKAYFQGFDVSGCPSLNPNLVDP-KCFN-GNFWWNNQNYW  195

Query  246  SLNREERVQYLKVRRNFMHYDYCADLPRF  160
             LN +E  Q   +++N++ YDYC D  R+
Sbjct  196  QLNPQEEKQLENIKKNYVIYDYCTDRKRY  224



>ref|XP_006298227.1| hypothetical protein CARUB_v10014286mg [Capsella rubella]
 gb|EOA31125.1| hypothetical protein CARUB_v10014286mg [Capsella rubella]
Length=296

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  32   DVPFGRNYVPTWAFDHQKQFNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  92   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIR FKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  151  YHTYSILWNMYQIVFFVDNIPIRTFKNSKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+ K    L+  +  +   V
Sbjct  211  KTNWANAPFIASYKGFHIDGCQA---SVEAKYCATQGRMWWDQKDFRDLDAYQWRRLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  268  RSKWTIYNYCTDRARFPVMPVECKR  292



>ref|XP_006285488.1| hypothetical protein CARUB_v10006916mg [Capsella rubella]
 gb|EOA18386.1| hypothetical protein CARUB_v10006916mg [Capsella rubella]
Length=292

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 184/263 (70%), Gaps = 3/263 (1%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            + FD NY V +G + +    QG+++QL MD++SGSGF SKS YGSG F++++K+P  D+A
Sbjct  30   IDFDKNYVVTYGQDRILKLKQGKKVQLSMDQASGSGFESKSHYGSGLFQMKIKLPPRDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVTSFYLTS   +  DE+DFEFLGNR+ KP+ +QTN+   G G REQ+++LWFDP   F
Sbjct  90   GVVTSFYLTSEG-NSQDEIDFEFLGNRQGKPIEVQTNVFTNGQGGREQKVHLWFDPTTSF  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN + IVFYVD IPIRVFKN +   + YPS   +++  S+WN E+WATDGGK K
Sbjct  149  HTYGILWNPYHIVFYVDKIPIRVFKNNKRYEMNYPS-KPMRVMASVWNGEAWATDGGKEK  207

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+ APFKA++QGF   GC  D +S++   C S   YWWN++    L+  ++ +   VR
Sbjct  208  INWAYAPFKAQYQGFAEHGCRLDGQSDNGKDCGS-ARYWWNTRTYNRLSANQQKELENVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
              +M+YDYC++ PR    P EC+
Sbjct  267  AKYMNYDYCSNQPRHHVFPSECQ  289



>ref|XP_006662970.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase-like 
[Oryza brachyantha]
Length=295

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + MK+ G D+
Sbjct  31   DVPFQKNYVPTWAEDHIHYVDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHMKLVGGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRSGEPYILQTNVFSGGKGDREQRIYLWFDPTKD  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD  PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  150  YHSYSVLWNLYMIAFFVDETPIRVFKNSKDLGVRYPFNQPMKLYSSLWNADDWATRGGRE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+ ++  +   V
Sbjct  210  KTDWSRAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFQDLDADQYRRLAWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R     Y+YC D  R+PT+ PEC R
Sbjct  267  RATHTIYNYCDDRDRYPTMSPECHR  291



>ref|XP_010488800.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
4-like [Camelina sativa]
Length=296

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H      G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  32   DVPFGRNYVPTWAFDHQKQFRGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  92   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIR FKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  151  YHTYSILWNMYQIVFFVDNIPIRTFKNSKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  211  KTNWANAPFIASYKGFHIDGCQA---SVEAKYCATQGRMWWDQKEFRDLDAYQWRRLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  268  RSKWTIYNYCTDRTRFPAMPVECKR  292



>ref|XP_010467128.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
4-like [Camelina sativa]
Length=296

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H      G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  32   DVPFGRNYVPTWAFDHQKQFRGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  92   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIR FKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  151  YHTYSILWNMYQIVFFVDNIPIRTFKNSKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  211  KTNWANAPFIASYKGFHIDGCQA---SVEAKYCATQGRMWWDQKEFRDLDAYQWRRLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  268  RSKWTIYNYCTDRTRFPVMPVECKR  292



>ref|XP_002983278.1| hypothetical protein SELMODRAFT_118035 [Selaginella moellendorffii]
 gb|EFJ15620.1| hypothetical protein SELMODRAFT_118035 [Selaginella moellendorffii]
Length=285

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 177/265 (67%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK+SG+GF S+S Y  G   +++K+  +D+
Sbjct  26   DVSFSENYYVRWANDHTRMLNGGTEMQLVLDKASGAGFGSRSKYLFGHVSMKIKLVPNDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN  A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNAFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY ILWN+ QIVFYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHSYSILWNKQQIVFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S+++E + Q   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPMGKWWEQEAFQSIDQEAKGQLQWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC D  RFPT+  EC +
Sbjct  260  KDNYMIYDYCNDSKRFPTISAECGQ  284



>ref|XP_010412980.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
4 [Camelina sativa]
Length=296

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H      G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  32   DVPFGRNYVPTWAFDHQKQFRGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  92   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIR FKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  151  YHTYSILWNMYQIVFFVDNIPIRTFKNSKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  211  KTNWANAPFIASYKGFHIDGCQA---SVEAKYCATQGRMWWDQKEFRDLDAYQWRRLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP +P ECKR
Sbjct  268  RSKWTIYNYCTDRTRFPVMPVECKR  292



>ref|XP_006396101.1| hypothetical protein EUTSA_v10002626mg [Eutrema salsugineum]
 gb|ESQ36880.1| hypothetical protein EUTSA_v10002626mg [Eutrema salsugineum]
Length=295

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  31   DVPFGRNYVPTWAFDHQKQLNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  91   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF+VDNIPIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  150  YHTYSILWNLYQIVFFVDNIPIRVFKNSKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A  +S     C ++G  WW+ K+   L+  +  +   V
Sbjct  210  KTNWANAPFIASYRGFHIDGCQASVES---KYCATQGRMWWDQKEFRDLDAYQYRRLKWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RF  +P ECKR
Sbjct  267  RMKWTIYNYCTDRTRFSVMPAECKR  291



>ref|XP_010026021.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Eucalyptus grandis]
Length=261

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 181/262 (69%), Gaps = 25/262 (10%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             SFD NY + WG +HV   D G+EIQL MD SSGSGFASK SY SG F + +K+PG ++A
Sbjct  24   TSFDENYQITWGYDHVAPLDGGQEIQLSMDASSGSGFASKKSYRSGFFNMEIKLPGRNSA  83

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            GVVT+F+LTS   DR DELDFEFLGNRE KP+TLQTN+  +GVGNREQR  LW       
Sbjct  84   GVVTTFFLTSQG-DRRDELDFEFLGNREGKPITLQTNVFVDGVGNREQRFLLW-------  135

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
                         FYVD+IPIRVF+NK+ I V YP+   +QI+ SLWN +SW TDGG+ K
Sbjct  136  -------------FYVDDIPIRVFENKKRIRVPYPT-QPMQIEASLWNGDSWVTDGGQTK  181

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS APF+A+++GF+V GC  + +S D   C+S  AYWWNS   WSL+ E+  Q   VR
Sbjct  182  IDWSYAPFQAQYRGFDVSGC--EFQSQDPRHCYS-SAYWWNSWSHWSLDEEQNRQLENVR  238

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
            +NFM+YDYC D  R+P  PPEC
Sbjct  239  KNFMNYDYCTDRSRYPVPPPEC  260



>ref|NP_001068033.1| Os11g0539200 [Oryza sativa Japonica Group]
 gb|ABA94104.1| xyloglucan endotransglucosylase/hydrolase precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28396.1| Os11g0539200 [Oryza sativa Japonica Group]
 gb|EAZ18626.1| hypothetical protein OsJ_34148 [Oryza sativa Japonica Group]
 dbj|BAG92562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F+ NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + +K+   D+
Sbjct  31   DVAFEKNYVPTWAEDHIHYVDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHIKLVAGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGEPYILQTNVFSGGKGDREQRIYLWFDPTKD  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD+ PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  150  YHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFNQPMKLYSSLWNADDWATRGGRE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+ ++  +   V
Sbjct  210  KTDWSRAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFRDLDADQYRRLAWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+    Y+YC D  R+P + PEC R
Sbjct  267  RKTHTIYNYCDDRERYPAMSPECHR  291



>ref|XP_002449625.1| hypothetical protein SORBIDRAFT_05g020400 [Sorghum bicolor]
 gb|EES08613.1| hypothetical protein SORBIDRAFT_05g020400 [Sorghum bicolor]
Length=303

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/266 (49%), Positives = 178/266 (67%), Gaps = 5/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + MK+ G D+
Sbjct  38   DVPFQKNYVPTWAQDHIHYVDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHMKLVGGDS  97

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  98   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  156

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKN-KENIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +HSY +LWN + I F+VD++PIRVFKN   ++GVRYP    +++  SLWNA+ WAT GG+
Sbjct  157  YHSYSVLWNLYMIAFFVDDVPIRVFKNTSSDLGVRYPFSQPMKLYSSLWNADDWATRGGR  216

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   
Sbjct  217  EKTDWSNAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFRDLDAAQYRKLAD  273

Query  210  VRRNFMHYDYCADLPRFPTLPPECKR  133
            VRR +  Y+YC D  R+  +PPEC R
Sbjct  274  VRRRYTIYNYCTDRDRYAAMPPECAR  299



>dbj|BAO57274.1| xyloglucan endotransglucosylase/hydrolase [Ipomoea nil]
Length=295

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 183/266 (69%), Gaps = 2/266 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+   + GR + L++D+++G+GF SK+SY  G F +RMK+ G D+
Sbjct  29   DVPFSTNYVPTWASDHIKYINGGRSVDLVLDRNTGTGFQSKNSYQFGHFSMRMKLVGGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+SN  + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP   
Sbjct  89   AGVVTAFYLSSNNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGQGNREQRIYLWFDPTKG  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN + IVF+VD++PIR+FKN +++G+R+P    +++  SLWNA+ WAT GG  
Sbjct  148  FHSYSVLWNMYCIVFFVDDVPIRIFKNSKDLGLRFPFNQPMKLYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A +  F+VDGC A   S ++  C + G  WW+ K    L+ E+  +   V
Sbjct  208  KTDWSKAPFIASYTSFHVDGCMAS-TSQEVQVCNTVGKRWWDQKAFQDLDAEQYRRLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKRH  130
            R+ +  Y+YC D  R+PT+P EC ++
Sbjct  267  RQKYTVYNYCYDKARYPTVPIECAKY  292



>ref|XP_002984349.1| hypothetical protein SELMODRAFT_120108 [Selaginella moellendorffii]
 gb|EFJ14399.1| hypothetical protein SELMODRAFT_120108 [Selaginella moellendorffii]
Length=285

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 175/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK SG+GF S+S Y  G   +++K+  +D+
Sbjct  26   DVSFSENYYVRWANDHTRVLNGGSEMQLVLDKVSGAGFGSRSKYLFGHISMKIKLVPNDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHSYSVLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S + E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPKGNWWEQEAFQSTDEETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC D  RFPT P +C +
Sbjct  260  KDNYMIYDYCTDSKRFPTTPADCGQ  284



>gb|EAY81204.1| hypothetical protein OsI_36383 [Oryza sativa Indica Group]
Length=295

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F+ NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + +K+   D+
Sbjct  31   DVAFEKNYVPTWAEDHIHYVDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHIKLVAGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGEPYILQTNVFSGGKGDREQRIYLWFDPTKD  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD+ PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  150  YHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFNQPMKLYSSLWNADDWATRGGRE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+ ++  +   V
Sbjct  210  KTDWSRAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFRDLDADQYRRLAWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+    Y+YC D  R+P + PEC R
Sbjct  267  RKTHTIYNYCEDRERYPAMSPECHR  291



>ref|NP_001234369.1| xyloglucan endotransglycosylase precursor [Solanum lycopersicum]
 gb|AAG43444.1|AF186777_1 xyloglucan endotransglycosylase [Solanum lycopersicum]
Length=293

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 178/265 (67%), Gaps = 2/265 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+   + G   +LL+DKSSG+GF SK SY  G F ++MK+ G D+
Sbjct  27   DVPFWNNYEPSWSSHHIKYLNGGTTAELLLDKSSGTGFQSKRSYLFGHFSMKMKLVGGDS  86

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  87   AGVVTAFYLSS-TNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  145

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN +QI  +VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  146  FHSYSVLWNTYQIAIFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  205

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS APF A +  F++DGC A     ++  C + G  WW+ K    L+  E  +  +V
Sbjct  206  KTNWSGAPFIASYTSFHIDGCEA-VTPQEVQVCNTNGMKWWDQKAFQDLDGPEYRKLHRV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+NF  Y+YC D  R+PTLP EC R
Sbjct  265  RQNFXIYNYCTDRKRYPTLPLECTR  289



>sp|Q41542.1|XTH_WHEAT RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase; 
Flags: Precursor [Triticum aestivum]
 dbj|BAA03924.1| endo-xyloglucan transferase [Triticum aestivum]
Length=293

 Score =   260 bits (664),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV FD NY   W  +H+   + GRE+QL +DK++G+GF ++ SY  G F + +K+ G D+
Sbjct  29   DVPFDKNYVPTWAQDHIHYVNGGREVQLSLDKTTGTGFQTRGSYLFGHFSMHIKLVGGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD+ PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  148  YHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFDQPMKLYSSLWNADDWATRGGRE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   V
Sbjct  208  KTDWSKAPFVASYRGFHVDGCEA---SAEAKFCATQGARWWDQPEFQDLDAAQYRRLAWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+    Y+YC D  R+  + PECKR
Sbjct  265  RKEHTIYNYCTDHDRYAAMAPECKR  289



>gb|AGT17174.1| Xyloglucan endotransglucosylase/hydrolase [Saccharum hybrid cultivar 
R570]
Length=299

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 178/266 (67%), Gaps = 5/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DK++G+GF ++ SY  G F + MK+ G D+
Sbjct  34   DVPFQKNYVPTWAQDHIHYIDGGREVQLYLDKTTGTGFQTRGSYLFGHFSMHMKLVGGDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  94   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKE-NIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +HSY +LWN + I F+VD++PIRVFKN   ++GVRYP    +++  SLWNA+ WAT GG+
Sbjct  153  YHSYSVLWNLYMIAFFVDDVPIRVFKNTSADLGVRYPFSQPMKLYSSLWNADDWATRGGR  212

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   
Sbjct  213  EKTDWSNAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFRDLDAAQYRKLAD  269

Query  210  VRRNFMHYDYCADLPRFPTLPPECKR  133
            VRR +  Y+YC D  R+  +PPEC R
Sbjct  270  VRRRYTIYNYCTDRDRYAAVPPECAR  295



>ref|XP_002984470.1| hypothetical protein SELMODRAFT_120330 [Selaginella moellendorffii]
 gb|EFJ14520.1| hypothetical protein SELMODRAFT_120330 [Selaginella moellendorffii]
Length=285

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 175/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK+SG+GF S+S Y  G   +++K+   D+
Sbjct  26   DVSFSENYYVRWANDHTRVLNGGSEMQLVLDKASGAGFGSRSKYLFGHISMKIKLVPKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHSYSVLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S + E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPKGNWWEQEAFQSTDEETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC D  RFPT P +C +
Sbjct  260  KDNYMIYDYCTDSKRFPTTPADCGQ  284



>gb|AGT17238.1| xyloglucan endotransglucosylase/hydrolase precursor [Saccharum 
hybrid cultivar R570]
Length=300

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/266 (49%), Positives = 178/266 (67%), Gaps = 5/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + MK+ G D+
Sbjct  35   DVPFQKNYVPTWAQDHIHYIDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHMKLVGGDS  94

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  95   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  153

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKE-NIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +HSY +LWN + I F+VD++PIRVFKN   ++GVRYP    +++  SLWNA+ WAT GG+
Sbjct  154  YHSYSVLWNLYMIAFFVDDVPIRVFKNTSADLGVRYPFSQPMKLYSSLWNADDWATRGGR  213

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   
Sbjct  214  EKTDWSNAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFRDLDAAQYRKLAD  270

Query  210  VRRNFMHYDYCADLPRFPTLPPECKR  133
            VRR +  Y+YC D  R+  +PPEC R
Sbjct  271  VRRRYTIYNYCTDGDRYAAVPPECAR  296



>emb|CDX70524.1| BnaC03g06080D [Brassica napus]
Length=298

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 182/265 (69%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  34   DVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKHTGTGFQSKGSYLFGHFSMHIKMVPGDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ +
Sbjct  94   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRINLWFDPSKN  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN HQIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  153  YHSYSVLWNMHQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ ++  +   V
Sbjct  213  KTNWAKAPFIASYRGFHIDGCEA---SVNAKYCETQGKRWWDKKEFQDLDAKQYKRLKWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ + +Y+YC D  RFP  PPEC+R
Sbjct  270  RKRYTNYNYCTDRVRFPKPPPECRR  294



>ref|XP_002972773.1| hypothetical protein SELMODRAFT_98543 [Selaginella moellendorffii]
 gb|EFJ25994.1| hypothetical protein SELMODRAFT_98543 [Selaginella moellendorffii]
Length=285

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 175/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK+SG+GF S+S Y  G   +++K+   D+
Sbjct  26   DVSFSENYYVRWANDHTRVLNGGSEMQLVLDKASGAGFGSRSKYLFGHISMKIKLVPKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN+ QI+FYVD++P+RV KN E IG+ +P    + +  SLWN + WAT GG  
Sbjct  145  FHSYSVLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGVYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S + E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPKGNWWEQEAFQSTDEETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC D  RFPT P +C +
Sbjct  260  KDNYMIYDYCTDSKRFPTTPADCGQ  284



>ref|XP_008465167.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Cucumis melo]
Length=296

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G E+ L++DK +G+GF SK SY  G F + MK+ G D+
Sbjct  32   NVPFGRNYVPTWAFDHIKYKNGGAEVDLVLDKYTGTGFQSKGSYLFGHFSMSMKLVGGDS  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP+ D
Sbjct  92   AGVVTAFYLSSQNSE-HDEIDFEFLGNRSGQPPILQTNVFTGGKGDREQRIYLWFDPSKD  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y +LWN H IVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  151  FHTYSVLWNLHMIVFFVDDVPIRVFKNCKDIGVKFPFDQPMKIYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC +   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  211  KTDWSKAPFVASYKGFHVDGCES---SVQAKFCATQGTRWWDQKEFQDLDGYQYRRLRWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P+LPPEC+R
Sbjct  268  REKYTIYNYCTDRKRYPSLPPECRR  292



>ref|XP_010533047.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase [Tarenaya 
hassleriana]
Length=298

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 183/265 (69%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL++DK +G+GF SK SY  G F +++K+P  DT
Sbjct  34   NVPFGRNYMPTWAFDHIKYINGGSEIQLVLDKYTGTGFQSKGSYLFGHFSMKIKLPPGDT  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP+  
Sbjct  94   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPPILQTNVFTGGKGDREQRIYLWFDPSQA  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VD++PIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  153  YHTYSVLWNMYQIVFFVDDVPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A++QGF+VDGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  213  KTNWANAPFIAQYQGFHVDGCQA---SVEAKFCATQGRMWWDQNEFRDLDAYQWRRLSWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R P +PPECKR
Sbjct  270  RQKWTIYNYCTDRSRNPVMPPECKR  294



>ref|XP_008778441.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Phoenix dactylifera]
Length=297

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 182/265 (69%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  33   NVPFQKNYVPTWAGDHIKYYNGGNEIQLYLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  +QTN+ + G G+REQRIYLWFDP  D
Sbjct  93   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYIVQTNVFSGGKGDREQRIYLWFDPTKD  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF+VD+IPIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  152  YHFYSVLWNTYQIVFFVDDIPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  211

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  212  KTDWSKAPFVAAYRGFHIDGCEA---SAEAKFCATQGRRWWDQKEFQDLDGYQYRRLSWV  268

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+PT+PPEC+R
Sbjct  269  RQKYTIYNYCTDRSRYPTMPPECRR  293



>ref|XP_002984011.1| hypothetical protein SELMODRAFT_119243 [Selaginella moellendorffii]
 gb|EFJ15023.1| hypothetical protein SELMODRAFT_119243 [Selaginella moellendorffii]
Length=285

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 175/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK SG+GF S+S Y  G   +++K+  +D+
Sbjct  26   DVSFSENYYVRWANDHTRVINGGSEMQLVLDKVSGAGFGSRSKYLFGHISMKIKLVPNDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y +LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHTYSVLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S + E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPEGNWWEQEAFQSTDEETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC D  RFPT P +C +
Sbjct  260  KDNYMIYDYCTDSKRFPTTPADCGQ  284



>ref|XP_002972769.1| hypothetical protein SELMODRAFT_413363 [Selaginella moellendorffii]
 gb|EFJ25990.1| hypothetical protein SELMODRAFT_413363 [Selaginella moellendorffii]
Length=285

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 174/263 (66%), Gaps = 6/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H  + + G E+QL++DK+SG+GF S+S Y  G   +++K+   D+
Sbjct  26   DVSFSQNYYVRWANDHTRALNGGTEMQLVLDKASGAGFGSRSKYLFGHVSMKIKLVPKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY  LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHSYSFLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  K     ++E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPRGNWWEQKAFQRTDKETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            + N+M YDYC D  RFPT P +C
Sbjct  260  KDNYMIYDYCTDSKRFPTTPADC  282



>ref|XP_010259646.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein [Nelumbo nucifera]
Length=296

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 180/266 (68%), Gaps = 4/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+     G  +QL++DK SG+GF S+SSY  G F +R+K+   D+
Sbjct  30   DVPFQKNYVTTWAADHIRYIHGGSRVQLVLDKHSGTGFQSRSSYLFGHFSMRIKMVAGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG+VT+FYL+S + + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  90   AGIVTAFYLSSQSTE-HDEIDFEFLGNRTGQPHILQTNVFTGGKGDREQRIYLWFDPTKH  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y +LWN + IVF+VDN+PIR+FKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  149  FHTYSVLWNMYHIVFFVDNVPIRIFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTA-DPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
            K +WS+APF A +  F+VDGC A  P+S  +  C +RG  WW+ K    L+ ++  +   
Sbjct  209  KTDWSKAPFVASYSSFHVDGCDASSPRS--LWVCNTRGRSWWDQKAFRDLDGQQYRRLKW  266

Query  210  VRRNFMHYDYCADLPRFPTLPPECKR  133
            VRR +  Y+YC D  R+P +PPEC R
Sbjct  267  VRRKYTIYNYCTDRSRYPNVPPECAR  292



>emb|CAA62847.1| Endoxyloglucan transferase (EXT) [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F+ NY   W  +H+   + GRE+QL +DK++G+GF ++ SY  G F + +K+ G D+
Sbjct  30   DVPFEKNYVPTWAEDHIHYVNGGREVQLSLDKTTGTGFQTRGSYLFGHFSMHIKLVGGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD+ PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  149  YHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFDQPMKLYSSLWNADDWATRGGRE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   V
Sbjct  209  KTDWSKAPFVASYRGFHVDGCEA---SAEAKLCATQGARWWDQPEFQDLDAAQYRRLAWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+    Y+YC D  R+  + PECKR
Sbjct  266  RKEHTIYNYCTDRERYAAMSPECKR  290



>ref|XP_002973000.1| hypothetical protein SELMODRAFT_98674 [Selaginella moellendorffii]
 gb|EFJ26221.1| hypothetical protein SELMODRAFT_98674 [Selaginella moellendorffii]
Length=285

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 174/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK+SG+GF S+S Y  G   +++K+   D+
Sbjct  26   DVSFSENYYVRWANDHTRVLNGGSEMQLVLDKASGAGFGSRSKYLFGHISMKIKLVPKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN  QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHSYSVLWNTQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  K     ++E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPRGNWWEQKAFQRTDKETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC D  RFPT P +C +
Sbjct  260  KDNYMIYDYCTDSKRFPTTPADCGQ  284



>gb|KFK39895.1| hypothetical protein AALP_AA3G302800 [Arabis alpina]
Length=295

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 179/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H    + G E+QL++DK +G+GF SK SY  G F + +K+P  DT
Sbjct  31   DVPFGRNYVPTWAFDHQKQFNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDT  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  91   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSQA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +Q+VF+VDNIPIRVFKN +++G+R+P    +++  SLWNA+ WAT GG  
Sbjct  150  YHTYSILWNLYQVVFFVDNIPIRVFKNAKDLGLRFPFNQPMKLYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF++DGC A   S +   C ++G  WW+  +   L+ ++  +   V
Sbjct  210  KTNWANAPFIASYRGFHIDGCQA---SVEAKYCATQGRMWWDQNEFRDLDADQWRRLKWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECK  136
            R  +  Y+YC D  RFP +P ECK
Sbjct  267  RLKWTIYNYCTDRSRFPVMPAECK  290



>ref|XP_004292364.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Fragaria vesca subsp. vesca]
Length=289

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 174/263 (66%), Gaps = 1/263 (0%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V FD NY V WG +H    + GR++Q+ +D+ +G+GF SK  +GSG F +R+KVP  D 
Sbjct  23   EVGFDENYQVTWGFDHALRENGGRQMQIYLDQYTGAGFESKQWFGSGWFNLRIKVPVRDC  82

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVV +FYL S      DELDFEFLGNRE KP+TLQTN++  G   REQR + WFDP AD
Sbjct  83   AGVVLAFYLRSEGSHNQDELDFEFLGNREGKPITLQTNVITNGQNYREQRTHFWFDPTAD  142

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH YKILWN HQ+VFY+DNIPIRVF+N + I V Y +   + I  S+W+  SWATDGG+ 
Sbjct  143  FHDYKILWNHHQVVFYIDNIPIRVFRNNKKIKVAYLT-RPMVIAVSIWDGSSWATDGGQT  201

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KI++++APF+A FQ F+++ C  D    D+        Y WN +    LN  +   Y +V
Sbjct  202  KIDYNRAPFRAYFQKFDMNACIVDRSKPDVGEFCYATKYLWNHRVHRQLNSTDLEAYNRV  261

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            RR +M+YDYC D  RF T P EC
Sbjct  262  RREYMNYDYCTDTQRFQTFPREC  284



>ref|XP_010453490.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 isoform X1 [Camelina sativa]
 ref|XP_010453491.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 isoform X2 [Camelina sativa]
Length=297

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  33   NVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G+GNREQRI LWFDP+ D
Sbjct  93   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGIGNREQRINLWFDPSKD  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  152  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  211

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  212  KTNWAKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWV  268

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP  PPEC+R
Sbjct  269  RKRYTIYNYCTDRVRFPVPPPECRR  293



>ref|XP_010419998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Camelina sativa]
Length=298

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  34   NVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G+GNREQRI LWFDP+ D
Sbjct  94   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGIGNREQRINLWFDPSKD  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  153  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  213  KTNWAKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP  PPEC+R
Sbjct  270  RKRYTIYNYCTDRVRFPVPPPECRR  294



>emb|CDX69621.1| BnaA10g19700D [Brassica napus]
Length=293

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYFPTWAFDHIKYLNGGSEVHLILDKYTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S + + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ D
Sbjct  89   AGTVTAFYLSSQSSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRINLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+ ++  +   V
Sbjct  208  KTNWAKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDAQQYKRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP  PPEC+R
Sbjct  265  RTRYTIYNYCTDRVRFPVPPPECRR  289



>gb|ABK27149.1| unknown [Picea sitchensis]
Length=294

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  30   DVPFPKNYVPSWAADHIKYINGGNEIQLSLDKWTGTGFQSKGSYLFGHFSMQIKMVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  90   AGTVTAFYLSSQNAE-HDEIDFEFLGNRSGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN HQIVF+VD++PIRVFKN  ++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  149  YHSYAVLWNMHQIVFFVDDVPIRVFKNSRDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S   + C + G  WW+ K    L+  +  +   V
Sbjct  209  KTDWSKAPFVASYRGFHVDGCEA---SVSNSACPTLGRRWWDQKAFDDLDGMQWRKLKGV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YCAD  R+P +PPEC R
Sbjct  266  RDRYTIYNYCADRGRYPAMPPECTR  290



>ref|XP_004141155.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5-like [Cucumis sativus]
 ref|XP_004166290.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5-like [Cucumis sativus]
 emb|CCH26413.1| xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN59782.1| hypothetical protein Csa_3G845490 [Cucumis sativus]
Length=295

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G E+ L++DK +G+GF SK SY  G F + MK+ G D+
Sbjct  31   NVPFGRNYAPTWAFDHIKYKNGGAEVDLVLDKYTGTGFQSKGSYLFGHFSMSMKLVGGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP+ D
Sbjct  91   AGVVTAFYLSSQNSE-HDEIDFEFLGNRSGQPPILQTNVFTGGKGDREQRIYLWFDPSKD  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y +LWN + IVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  150  FHTYSVLWNLYMIVFFVDDVPIRVFKNCKDIGVKFPFDQPMKIYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC +   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  210  KTDWSKAPFVASYKGFHVDGCES---SVQAKFCATQGTRWWDQKEFQDLDGYQYRRLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+PTLPPEC+R
Sbjct  267  REKYTIYNYCTDRKRYPTLPPECRR  291



>ref|XP_007049743.1| Xyloglucan endotransglucosylase/hydrolase protein 2, putative 
[Theobroma cacao]
 gb|EOX93900.1| Xyloglucan endotransglucosylase/hydrolase protein 2, putative 
[Theobroma cacao]
Length=285

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 174/252 (69%), Gaps = 7/252 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSFD NY + WGN+HVTS ++GREI + MD  SG+GF S + Y SG F++++K+P  D+
Sbjct  22   DVSFDQNYHITWGNSHVTSLNEGREIHISMDNVSGAGFQSNARYASGFFQMKLKIPNKDS  81

Query  747  AGVVTSFYLTSNT-EDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAA  571
            AGVVT+FYL  N  E  HDELDFEFLG++  +P TLQTN+ A   G REQR +LWFDP A
Sbjct  82   AGVVTAFYLIDNKGEGDHDELDFEFLGSK-GQPCTLQTNVFANDKGGREQRYHLWFDPTA  140

Query  570  DFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            DFH+Y ILWNQHQIVFYVDN PIRV KN  NIGV YPS   L I+ S+W+ E WA++G  
Sbjct  141  DFHTYGILWNQHQIVFYVDNTPIRVSKNISNIGVNYPS-QTLVIQASIWDGEGWASNG--  197

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K++WSQ PF A FQGFNVDGC +   SN   +C+   + WWN    W L+  ++     
Sbjct  198  RKLDWSQQPFTASFQGFNVDGCQSLENSNK-EQCYDS-SLWWNGNTYWGLDPAKQKALED  255

Query  210  VRRNFMHYDYCA  175
             R  +M  DYC+
Sbjct  256  ARAEYMFEDYCS  267



>ref|XP_009121720.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Brassica rapa]
Length=293

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NYF  W  +H+   + G E+ L +DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYFPTWAFDHIKYLNGGSEVHLFLDKYTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S + + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ D
Sbjct  89   AGTVTAFYLSSQSSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRINLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+ ++  +   V
Sbjct  208  KTNWAKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDAQQYKRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP  PPEC+R
Sbjct  265  RTRYTIYNYCTDRVRFPVPPPECRR  289



>ref|XP_002512792.1| Xyloglucan endotransglucosylase/hydrolase protein A precursor, 
putative [Ricinus communis]
 gb|EEF49295.1| Xyloglucan endotransglucosylase/hydrolase protein A precursor, 
putative [Ricinus communis]
Length=274

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H++  + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  10   DVPFGRNYVPTWAFDHISYFNGGTEIQLKLDKYTGTGFQSKGSYLFGHFSMHIKMVPGDS  69

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP  +
Sbjct  70   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRIYLWFDPTKE  128

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VD++PIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  129  YHTYSVLWNLYQIVFFVDDVPIRVFKNSKDLGVRFPFNQPMKLYSSLWNADDWATRGGLE  188

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  189  KTDWSKAPFIASYKGFHIDGCEA---SVNAKFCDTQGKRWWDQKEFQDLDAAQYRRLAWV  245

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFPT+ PECKR
Sbjct  246  RQKYTIYNYCTDRSRFPTMAPECKR  270



>ref|XP_010910383.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Elaeis guineensis]
Length=297

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  33   NVPFQKNYVPTWAGDHIKYYNGGNEIQLYLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  93   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD+IPIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  152  YHSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  211

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  212  KTDWSKAPFVAAYRGFHIDGCEA---SAEAKFCATQGRRWWDQKEFQDLDGYQYRRLRWV  268

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+PT+ PEC+R
Sbjct  269  RQKYTIYNYCTDRSRYPTMLPECRR  293



>emb|CDY09832.1| BnaC09g43290D [Brassica napus]
Length=293

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYFPTWAFDHIKYLNGGSEVHLILDKYTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S +   HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ D
Sbjct  89   AGTVTAFYLSSQSS-VHDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRINLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+ ++  +   V
Sbjct  208  KTNWAKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDAQQYKRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP  PPEC+R
Sbjct  265  RTRYTIYNYCTDRVRFPVPPPECRR  289



>ref|XP_010492168.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Camelina sativa]
Length=298

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  34   NVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G+GNREQRI LWFDP+ D
Sbjct  94   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGIGNREQRINLWFDPSKD  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  153  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW  APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  213  KTNWVNAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP  PPEC+R
Sbjct  270  RKRYTIYNYCTDRVRFPVPPPECRR  294



>ref|XP_002873632.1| EXGT-A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49891.1| EXGT-A4 [Arabidopsis lyrata subsp. lyrata]
Length=293

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   NVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGTGNREQRINLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW +APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTNWEKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP  PPEC+R
Sbjct  265  RKRYTIYNYCTDRVRFPVPPPECRR  289



>ref|XP_006288357.1| hypothetical protein CARUB_v10001606mg [Capsella rubella]
 ref|XP_006288358.1| hypothetical protein CARUB_v10001606mg [Capsella rubella]
 gb|EOA21255.1| hypothetical protein CARUB_v10001606mg [Capsella rubella]
 gb|EOA21256.1| hypothetical protein CARUB_v10001606mg [Capsella rubella]
Length=293

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   NVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G+GNREQRI LWFDP+ D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGIGNREQRINLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTNWANAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  RFP  PPEC+R
Sbjct  265  RTRYTIYNYCTDRVRFPVPPPECRR  289



>gb|ACK36946.1| xyloglucan endotransglycosylase [Annona cherimola]
Length=293

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G E+ L +DK +G+GF SK SY  G F +R+K+   D+
Sbjct  29   DVPFQRNYMPTWAFDHIKYFNGGNEVHLTLDKYTGTGFQSKGSYLFGHFSMRIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+  
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVFTGGKGNREQRIYLWFDPSKG  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y ILWN +QIVF VD++PIRVFKN +++G+R+P    +++  SLWNA+ WAT GG  
Sbjct  148  YHNYAILWNMYQIVFLVDDVPIRVFKNCKDLGLRFPFNQPMKLYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A +QGF++DGC A   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWSKAPFVAAYQGFHIDGCEA---SVQATYCATQGKRWWDQKEFQDLDGLQYRRLQWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+PT+PPECKR
Sbjct  265  RQKYTIYNYCTDRSRYPTMPPECKR  289



>ref|XP_003577501.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Brachypodium distachyon]
Length=294

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F+ NY   W ++H+   + GRE+QL +DKS+G+GF ++ SY  G F + +K+ G D+
Sbjct  30   DVPFEKNYVPTWASDHIHYLNGGREVQLSLDKSTGTGFQTRGSYLFGHFSMHIKLVGGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD+ PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  149  YHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFDQPMKLYSSLWNADDWATRGGRE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   V
Sbjct  209  KTDWSNAPFVASYRGFHVDGCEA---SAEAKFCATQGARWWDQPEFQDLDAAQYRRLAWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+    Y+YC D  R+  + PECKR
Sbjct  266  RKEHTIYNYCTDRERYAAMSPECKR  290



>ref|XP_010066388.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Eucalyptus grandis]
 gb|KCW64272.1| hypothetical protein EUGRSUZ_G01909 [Eucalyptus grandis]
Length=293

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +D  +G+GF SK SY  G F +++K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLSLDNYTGTGFQSKGSYLFGHFSMQIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP+ D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRIYLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDLGVKFPFDQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +W++APF A ++ F++DGC A   S +   C S+G  WW+ K+   L+ E+  +   V
Sbjct  208  KTDWAKAPFMASYKSFHIDGCEA---SVEAKFCDSQGKRWWDQKEFQDLDAEQFRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  F  Y+YC D  RFP++ PECKR
Sbjct  265  REKFTIYNYCTDTVRFPSVAPECKR  289



>ref|XP_008812130.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Phoenix dactylifera]
Length=297

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  33   NVPFQKNYVPTWAGDHIKYYNGGNEIQLYLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  92

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+D+EFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  93   AGTVTAFYLSSQNSE-HDEIDYEFLGNRTGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  151

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD+IPIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  152  YHSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  211

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  212  KTDWSKAPFVAAYRGFHIDGCEA---STEAKFCATQGRRWWDQKEFQDLDGYQYRRLRWV  268

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R  T+PPEC+R
Sbjct  269  RQKYTIYNYCTDRSRSSTMPPECRR  293



>ref|NP_196891.1| endoxyloglucan transferase A4 [Arabidopsis thaliana]
 sp|Q9XIW1.1|XTH5_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 5; Short=At-XTH5; Short=XTH-5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD45126.1|AF163822_1 endoxyloglucan transferase [Arabidopsis thaliana]
 dbj|BAA81669.1| endoxyloglucan transferase [Arabidopsis thaliana]
 dbj|BAB11115.1| endoxyloglucan transferase [Arabidopsis thaliana]
 dbj|BAD43991.1| endoxyloglucan transferase [Arabidopsis thaliana]
 gb|AED91952.1| endoxyloglucan transferase A4 [Arabidopsis thaliana]
Length=293

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   NVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGAGNREQRINLWFDPSKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNMYQIVFFVDDVPIRVFKNSKDVGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW +APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTNWEKAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP  PPEC+R
Sbjct  265  RKRYTIYNYCTDRVRFPVPPPECRR  289



>ref|XP_002984345.1| hypothetical protein SELMODRAFT_120242 [Selaginella moellendorffii]
 gb|EFJ14395.1| hypothetical protein SELMODRAFT_120242 [Selaginella moellendorffii]
Length=285

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 174/263 (66%), Gaps = 6/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DVSF  NY+V W N+H    + G E+QL++DK+SG+GF S+S Y  G   +++K+   D+
Sbjct  26   DVSFSENYYVRWANDHTRVLNGGTEMQLVLDKASGAGFGSRSKYLFGHVSMKIKLVPKDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDE+DFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  86   AGTVTAFYMSSET-DKHDEIDFEFLGNVSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY  LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  145  FHSYSFLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  K     ++E + +   V
Sbjct  205  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPRGNWWEQKAFQRTDKETKSKLKWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            + N+M Y+YC+D  RFPT P +C
Sbjct  260  KDNYMIYNYCSDSKRFPTTPADC  282



>gb|ABV46535.1| xyloglucan endotransglucosylase hydrolase 3 [Bambusa oldhamii]
Length=294

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G+E+QL +DKS+G+GF ++ SY  G F + +K+   D+
Sbjct  30   DVPFQKNYVPTWAQDHIHYINGGQEVQLYLDKSTGTGFQTRGSYLFGHFSMHIKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+D+EFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDYEFLGNRTGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + I F+VD+ PIRVFKN +++GVRYP    +++  SLWNA+ WAT GG+ 
Sbjct  149  YHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFNQPMKLYSSLWNADDWATRGGRE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+ E+  +   V
Sbjct  209  KTDWSRAPFVASYRGFHVDGCEA---SAEARYCATQGARWWDQPEFRDLDGEQYRRLAWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            RR    Y+YC D  R+P + PEC+R
Sbjct  266  RREHTIYNYCTDRDRYPAMSPECQR  290



>ref|XP_009131365.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Brassica rapa]
 emb|CDX78542.1| BnaA03g04540D [Brassica napus]
Length=298

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+
Sbjct  34   DVPFGRNYFPTWAFDHIKYLNGGSEVHLVLDKHTGTGFQSKGSYLFGHFSMHIKMVPGDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ +
Sbjct  94   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRINLWFDPSKN  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN HQIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  153  YHSYSVLWNMHQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW++APF A ++GF++DGC A   S     C ++G  WW+ ++   L+ ++  +   V
Sbjct  213  KTNWAKAPFVASYRGFHIDGCEA---SVSAKFCETQGKRWWDKEEFQDLDAKQYKRLKWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP  PPEC+R
Sbjct  270  RKRYTIYNYCTDRVRFPKPPPECRR  294



>ref|XP_003524704.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
 gb|KHN47560.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Glycine soja]
Length=291

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   DQGR IQL +D+SSG GFASK  Y  G   +++K+   D+A
Sbjct  30   ATFLQDFHVTWSDSHIKQLDQGRAIQLRLDQSSGCGFASKVKYMFGRVSMKIKLVPGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL S+T    DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  90   GTVTAFYLNSDTNYVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPAADF  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD+ PIRV+KN E  G+ YP   A+ +  +LW A++WAT GG  K
Sbjct  150  HTYSILWNHHHIVFYVDDFPIRVYKNNEARGIPYPKMQAMGVYSTLWEADNWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ FN++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  210  IDWSKAPFYAYYKDFNIEGCAVPGPAN----CASNPSNWWEGAAYQALNSIEARRYRWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RFP  PPEC
Sbjct  266  LNHVIYDYCKDKSRFPVTPPEC  287



>gb|ADE42490.1| xyloglucan endotransglucosylase/hydrolase 1 [Fragaria x ananassa]
Length=294

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 180/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+P  D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFHMQIKLPPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP  ++
Sbjct  91   GTVTAFYLSS-TNAEHDEIDFEFLGNRTGQPFILQTNVFTGGKGDREQRIFLWFDPTKEY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   VR
Sbjct  210  TDWSKAPFVATYRGFHIDGCEA---SVQARFCATQGKRWWDQKEFQDLDAYQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+PTLP ECKR
Sbjct  267  QRFTIYNYCTDRTRYPTLPAECKR  290



>gb|ACF88385.1| unknown [Zea mays]
 gb|AFW64927.1| xyloglucan endotransglucosylase/hydrolase [Zea mays]
Length=297

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 179/267 (67%), Gaps = 6/267 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + MK+ G D+
Sbjct  31   DVPFQKNYVPTWAQDHIHYIDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHMKLVGGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKE-NIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +HSY +LWN + I F+VD++PIRVFKN   ++GVRYP    +++  SLWNA+ WAT GG+
Sbjct  150  YHSYSVLWNLYMIAFFVDDVPIRVFKNTSADLGVRYPFSQPMKLYSSLWNADDWATRGGR  209

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +  +
Sbjct  210  EKTDWSNAPFVASYRGFHVDGCEA---SAEARFCATQGARWWDQPEFRDLDAAQYRRLAE  266

Query  210  VRRNFMHYDYCADLPRF-PTLPPECKR  133
            VRR +  Y+YC D  R+   +PPEC R
Sbjct  267  VRRRYTIYNYCTDRDRYGAAVPPECAR  293



>ref|XP_011033703.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Populus euphratica]
Length=293

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYMPTWAFDHIKYINGGSEIQLKLDKFTGTGFQSKGSYLFGHFSMHIKMVAGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQTNE-HDEIDFEFLGNRTGQPYILQTNVYTGGRGDKEQRIYLWFDPTKG  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN +++G+++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNTYQIVFFVDDVPIRVFKNSKDLGLKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +W++APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWAKAPFIASYKGFHIDGCEA---SVNAKFCETQGKRWWDRKEFRDLDAAQYRKLGWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP LPPECKR
Sbjct  265  RKKYTIYNYCTDRVRFPNLPPECKR  289



>ref|XP_004299202.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B-like [Fragaria vesca subsp. vesca]
Length=294

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 180/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+P  D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFHMQIKLPPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP  ++
Sbjct  91   GTVTAFYLSS-TNAEHDEIDFEFLGNRTGQPFILQTNVFTGGKGDREQRIFLWFDPTKEY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   VR
Sbjct  210  TDWSKAPFIATYRGFHIDGCEA---SVQARFCATQGKRWWDQKEFQDLDAYQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+PTLP ECKR
Sbjct  267  QKFTIYNYCTDRTRYPTLPAECKR  290



>ref|XP_004979406.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase-like 
[Setaria italica]
Length=296

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 178/266 (67%), Gaps = 5/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +D+S+G+GF ++ SY  G F + MK+ G D+
Sbjct  31   DVPFQKNYVPTWAEDHIHYVDGGREVQLYLDRSTGTGFQTRGSYLFGHFSMHMKLVGGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKE-NIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +HSY +LWN + I F+VD++PIRVFKN   ++GVRYP    +++  SLWNA+ WAT GG+
Sbjct  150  YHSYSVLWNLYMIAFFVDDVPIRVFKNSSGDLGVRYPFSQPMKLYSSLWNADDWATRGGR  209

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +  +
Sbjct  210  EKTDWSNAPFVASYRGFHVDGCEA---SAEARFCATQGARWWDQPEFRDLDGAQYRKLRE  266

Query  210  VRRNFMHYDYCADLPRFPTLPPECKR  133
            VR+ +  Y+YC D  R   +PPEC +
Sbjct  267  VRQRYTIYNYCTDRDRNAAMPPECAK  292



>ref|XP_006367741.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein-like [Solanum tuberosum]
Length=295

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 176/265 (66%), Gaps = 2/265 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+   + G   +LL+DKSSG+GF SK SY  G F ++MK+ G D+
Sbjct  29   DVPFWNNYEPSWSSHHIKYLNGGTTAELLLDKSSGTGFQSKRSYLFGHFSMKMKLVGGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  89   AGVVTAFYLSS-TNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN  QIV +VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  FHSYSVLWNTFQIVIFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS APF A +  F++DGC A     ++  C + G  WW+ K    L+  +  +   V
Sbjct  208  KTDWSGAPFTASYTSFHIDGCEA-VTPQEVQVCNTNGMKWWDQKAFQDLDGPQYRKLQWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ F  Y+YC D  R+PTLP EC R
Sbjct  267  RQKFTIYNYCTDRKRYPTLPLECTR  291



>ref|XP_007205666.1| hypothetical protein PRUPE_ppa009472mg [Prunus persica]
 gb|EMJ06865.1| hypothetical protein PRUPE_ppa009472mg [Prunus persica]
Length=291

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  30   ATFLQDFQVTWSDSHIRQIDGGRAIQLILDQNSGCGFASKRKYLFGRVSMKIKLIPGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ SNT+   DE+DFEFLGNR  +P T+QTNI A G GNREQR+ LWFDPAADF
Sbjct  90   GTVTAFYMNSNTDAVRDEVDFEFLGNRTGQPYTVQTNIYAHGKGNREQRVNLWFDPAADF  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD++PIRV+KN E  GV YP    + +  +LW A+ WAT GG  K
Sbjct  150  HTYTILWNHHHIVFYVDDVPIRVYKNNEARGVPYPKLQPMGVFSTLWEADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF + ++ F+++GC+    +N    C S    WW      +LN  E  +Y  VR
Sbjct  210  INWSKAPFFSYYKDFDIEGCSVPGPAN----CASSATNWWEGTAYQALNALEYRRYRWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  266  INHMIYDYCTDKSRYPVAPPEC  287



>gb|ABC55454.2| xyloglucan endotransglucosylase/hydrolase 2 [Rosa x borboniana]
Length=287

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 174/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D++SG GF+SK  Y  G   +++K+   D+A
Sbjct  26   ATFLQDFQVTWSDSHIRQIDGGRAIQLVLDQNSGCGFSSKHKYLFGRVSMKIKLIPGDSA  85

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G GNREQR+ LWFDPAADF
Sbjct  86   GTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYARGQGNREQRVNLWFDPAADF  145

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD++PIR++KN E  G+ YP    + +  +LW A+ WAT GG  K
Sbjct  146  HTYTILWNHHHIVFYVDDVPIRLYKNNEAKGIPYPKLQPMGVFSTLWEADDWATRGGLEK  205

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF A ++ F+++GC+    +N    C S    WW      +LN  E  +Y  VR
Sbjct  206  INWSKAPFYAYYKDFDIEGCSVPGPAN----CASSTNNWWEGTAYQALNALEYRRYKWVR  261

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC+D  RFP  PPEC
Sbjct  262  MNHMIYDYCSDRSRFPKPPPEC  283



>ref|XP_002274520.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Vitis vinifera]
Length=307

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+ S + G EIQL++DK +G+GF SK SY  G F +++K+   D+
Sbjct  43   DVPFGRNYVPTWAFDHIKSYNGGSEIQLVLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  102

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  103  AGTVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVFTGGKGDREQRIYLWFDPTKA  161

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY +LWN   I+F VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  162  FHSYSVLWNTFLIIFLVDDVPIRVFKNSKDLGVKFPFDQPMKIYSSLWNADDWATRGGLE  221

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C ++G  WW+ ++   L+  +  +   V
Sbjct  222  KTDWSKAPFVASYKSFHVDGCEA---SVEAKFCATQGKRWWDQREFQDLDSLQYRRLAWV  278

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+PT+PPECKR
Sbjct  279  RQKYTIYNYCTDRVRYPTMPPECKR  303



>ref|XP_006399889.1| hypothetical protein EUTSA_v10014262mg [Eutrema salsugineum]
 gb|ESQ41342.1| hypothetical protein EUTSA_v10014262mg [Eutrema salsugineum]
Length=291

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 179/263 (68%), Gaps = 4/263 (2%)
 Frame = -2

Query  921  SFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAG  742
            SF  NYF  W  +H+   + G E+ L++DK +G+GF SK SY  G F + +K+   D+AG
Sbjct  29   SFCRNYFPTWAFDHIKYLNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVPGDSAG  88

Query  741  VVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFH  562
             VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRI LWFDP+ D+H
Sbjct  89   TVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGRGNREQRINLWFDPSKDYH  147

Query  561  SYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKI  382
            SY +LWN +QIVF+VD++PIRVFKN ++IGV++P    ++I  SLWNA+ WAT GG  K 
Sbjct  148  SYSVLWNMYQIVFFVDDVPIRVFKNSKDIGVKFPFNQPMKIYSSLWNADDWATRGGLEKT  207

Query  381  NWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRR  202
            NW+ APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+ ++  +   VR+
Sbjct  208  NWANAPFVASYRGFHVDGCEA---SVNAKFCETQGKRWWDQKEFRDLDAKQYKRLKWVRQ  264

Query  201  NFMHYDYCADLPRFPTLPPECKR  133
             F  Y+YC D  RFP  PPEC+R
Sbjct  265  RFTIYNYCTDRVRFPVPPPECRR  287



>ref|NP_001148984.1| LOC100282604 precursor [Zea mays]
 gb|ACG33724.1| xyloglucan endotransglucosylase/hydrolase precursor [Zea mays]
Length=297

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 178/267 (67%), Gaps = 6/267 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D GRE+QL +DKS+G+GF ++ SY  G F + MK+ G D+
Sbjct  31   DVPFQKNYVPTWAQDHIHYIDGGREVQLYLDKSTGTGFQTRGSYLFGHFSMHMKLVGGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKE-NIGVRYPSFHALQIKGSLWNAESWATDGGK  391
            +HSY +LWN + I F+VD++PIRVFKN   ++GVRYP    +++  SLWNA+ WAT GG+
Sbjct  150  YHSYSVLWNLYMIAFFVDDVPIRVFKNTSADLGVRYPFSQPMKLYSSLWNADDWATRGGR  209

Query  390  AKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
             K +WS APF A ++GF+VDGC A   S +   C ++GA WW+  +   L+  +  +   
Sbjct  210  EKTDWSNAPFVASYRGFHVDGCEA---SAEARFCATQGARWWDQPEFRDLDAAQYRRLAD  266

Query  210  VRRNFMHYDYCADLPRF-PTLPPECKR  133
            VRR +  Y+YC D  R+   +PPEC R
Sbjct  267  VRRRYTIYNYCTDRDRYGAAVPPECAR  293



>ref|XP_004509043.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Cicer arietinum]
Length=301

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 173/263 (66%), Gaps = 6/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   DQGR IQL++D+ SG GFASK  Y  G   +++K+   D+A
Sbjct  40   ATFQQDFRVTWSDSHIKQIDQGRTIQLVLDQGSGCGFASKVKYMFGRVSMKIKLVPGDSA  99

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G GNREQR+ LWFDP+ADF
Sbjct  100  GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGNREQRVNLWFDPSADF  159

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD IPIRV+KN E  G+ YP   A+ +  +LW A++WAT GG  K
Sbjct  160  HTYSILWNHHHIVFYVDEIPIRVYKNNEAKGIPYPKLQAMGVFSTLWEADNWATRGGLEK  219

Query  384  INWSQAPFKAEFQGFNVDGCT-ADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            I+WS+APF A ++ F+++GC    P S     C S    WW      +LN  E  +Y  V
Sbjct  220  IDWSKAPFYAYYKDFDIEGCAIPGPVS-----CASNPTNWWEGAAYQALNAIEARRYRWV  274

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R N + YDYC D  RFP  PPEC
Sbjct  275  RINHVIYDYCQDKSRFPVTPPEC  297



>ref|XP_006423881.1| hypothetical protein CICLE_v10028851mg [Citrus clementina]
 ref|XP_006487658.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B-like isoform X2 [Citrus sinensis]
 gb|ESR37121.1| hypothetical protein CICLE_v10028851mg [Citrus clementina]
Length=293

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  29   NVPFGRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGSVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKA  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF+VD+IPIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHFYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWSKAPFIASYKGFHIDGCEA---SVQAKYCATQGKRWWDQKEFQDLDAFQYRRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  F  Y+YC D  RFP LPPEC+R
Sbjct  265  RSKFTIYNYCTDRSRFPVLPPECRR  289



>ref|NP_001289208.1| probable xyloglucan endotransglucosylase/hydrolase protein B 
precursor [Pyrus x bretschneideri]
 gb|AGR44474.1| xyloglucan endotransglycosylase 1 [Pyrus x bretschneideri]
Length=294

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 182/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G+EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP A +
Sbjct  91   GTVTAYYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ ++  +   VR
Sbjct  210  TDWSKAPFIASYRGFHIDGCEA---SVEAKFCATQGKRWWDQKEFQDLDAQQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            R F  Y+YC D  R+P++PPECKR
Sbjct  267  RKFTIYNYCTDRVRYPSMPPECKR  290



>ref|XP_002993371.1| hypothetical protein SELMODRAFT_136972 [Selaginella moellendorffii]
 gb|EFJ05556.1| hypothetical protein SELMODRAFT_136972 [Selaginella moellendorffii]
Length=293

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 173/265 (65%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY+V W ++H    + G E+ L++DK+SG+GF S++ Y  G   +++K+   D+
Sbjct  34   DVPFAQNYYVRWADDHTRMLNGGTEMHLVLDKASGAGFGSRTKYLFGHVSMKIKLVPKDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDELDFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  94   AGTVTAFYMSSET-DKHDELDFEFLGNTSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY  LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  153  FHSYSFLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKSQPMGIYSSLWNGDDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S + E + +   V
Sbjct  213  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPRGNWWEQEAFQSTDEETKSKLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M YDYC+D  RFPT P +C +
Sbjct  268  KDNYMIYDYCSDGKRFPTTPADCGQ  292



>ref|XP_002320401.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE98716.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=293

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYAPTWAFDHIKYINGGSEIQLKLDKFTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQTNE-HDEIDFEFLGNRTGQPYILQTNVYTGGKGDKEQRIYLWFDPTKG  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VD++PIRVFKN +++G+++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHAYSVLWNMYQIVFFVDDVPIRVFKNSKDLGLKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +W++APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWAKAPFIASYKGFHIDGCEA---SVNAKFCETQGKRWWDQKEFRDLDAAQYRKLGWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP+LPPECKR
Sbjct  265  RKKYTIYNYCTDRVRFPSLPPECKR  289



>ref|XP_010557646.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase-like [Tarenaya 
hassleriana]
Length=298

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G E QL++D  +G+GF SK SY  G F +++K+P  DT
Sbjct  34   NVPFGRNYVPTWAFDHIKYINGGSETQLVLDNYTGTGFQSKGSYLFGHFSMKIKLPPGDT  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP+  
Sbjct  94   AGVVTAFYLSS-TNNEHDEIDFEFLGNRTGEPPILQTNVFTGGKGDREQRIYLWFDPSKA  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF +D+IPIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  153  YHSYSVLWNLYQIVFLIDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A +QGF+VDGC     S +   C ++G  WW+ ++   L+  +  +   V
Sbjct  213  KTNWANAPFIASYQGFHVDGCQT---SVEAKFCATQGKMWWDREEFRDLDAYQWRRLRWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P  PPECKR
Sbjct  270  RKKWTIYNYCTDRSRYPVTPPECKR  294



>ref|XP_008779173.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
A-like [Phoenix dactylifera]
Length=296

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G E+QL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  32   DVPFQRNYAPTWAYDHIKYINGGNEVQLSLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDS  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  +QTN+   G G+REQRIYLWFDP  D
Sbjct  92   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTNQPYIVQTNVFTGGEGDREQRIYLWFDPTKD  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN E++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  151  YHSYSVLWNMYQIVFFVDDVPIRVFKNCEDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C ++G  WW+ K+   L+  +      V
Sbjct  211  KTDWSKAPFIASYRSFHVDGCEA---SVEAKFCATQGQRWWDQKEFRDLDSLQYRSLSWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            RR +  Y+YC D  R P +PPEC R
Sbjct  268  RREYTIYNYCTDRSRSPVMPPECSR  292



>gb|KDP32131.1| hypothetical protein JCGZ_12592 [Jatropha curcas]
Length=292

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 173/263 (66%), Gaps = 4/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D++SG GFASK  Y  G   +R+K+   D+A
Sbjct  31   AAFLQDFRVTWSDSHIRQIDGGRAIQLVLDQNSGCGFASKMKYLFGRVSMRIKLVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQRI LWFDP++DF
Sbjct  91   GTVTAFYMNSDTDSVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRINLWFDPSSDF  150

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H Y ILWN H IVFYVD++PIRVFKN E  G+ YP F A+ +  +LW A+ WAT GG  K
Sbjct  151  HLYTILWNHHHIVFYVDDVPIRVFKNNEARGIPYPKFQAMGVYSTLWEADDWATRGGLEK  210

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S    WW      +L+  E  +Y  VR
Sbjct  211  IDWSKAPFYAYYKDFDIEGCPVPGPAN----CVSNPRNWWEGANYQALSAMEARRYRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
             N M YDYC D  R+P  PPEC 
Sbjct  267  MNHMIYDYCTDKSRYPVAPPECS  289



>gb|AHC69919.1| xyloglucan endotransglucosylase/hydrolase 1 [Pinus radiata]
Length=294

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+   + G E QL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  30   DVPFQKNYVPTWASDHIKYINGGNEAQLSLDKWTGTGFQSKGSYLFGHFSMQIKMVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQR+YLWFDP  D
Sbjct  90   AGVVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVFSGGKGDREQRVYLWFDPTKD  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN HQIVF+VD++PIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  149  YHSYTVLWNMHQIVFFVDDVPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S   + C + G  WW+ K    L+ ++  +   V
Sbjct  209  KTDWSKAPFVASYKGFHVDGCEA---SMPHSACPTLGRRWWDQKAFDDLDGQQWRKLKWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P + PEC R
Sbjct  266  RDRYTIYNYCTDRVRYPKMSPECTR  290



>pdb|1UMZ|A Chain A, Xyloglucan Endotransglycosylase In Complex With The 
Xyloglucan Nonasaccharide Xllg.
 pdb|1UMZ|B Chain B, Xyloglucan Endotransglycosylase In Complex With The 
Xyloglucan Nonasaccharide Xllg.
 pdb|1UN1|A Chain A, Xyloglucan Endotransglycosylase Native Structure.
 pdb|1UN1|B Chain B, Xyloglucan Endotransglycosylase Native Structure.
Length=278

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  14   DVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  73

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  74   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  132

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN + IVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  133  FHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  192

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++GA WW+ K+   L+  +  +   V
Sbjct  193  KTDWSKAPFIASYRSFHIDGCEA---SVEAKFCATQGARWWDQKEFQDLDAFQYRRLSWV  249

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  250  RQKYTIYNYCTDRSRYPSMPPECKR  274



>gb|AAN87142.1| xyloglucan endotransglycosylase precursor [Populus tremula x 
Populus tremuloides]
Length=294

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  30   DVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN + IVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  FHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++GA WW+ K+   L+  +  +   V
Sbjct  209  KTDWSKAPFIASYRSFHIDGCEA---SVEAKFCATQGARWWDQKEFQDLDAFQYRRLSWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  266  RQKYTIYNYCTDRSRYPSMPPECKR  290



>ref|XP_006487657.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B-like isoform X1 [Citrus sinensis]
 gb|KDO45137.1| hypothetical protein CISIN_1g020962mg [Citrus sinensis]
Length=319

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  55   NVPFGRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  114

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  115  AGSVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKA  173

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF+VD+IPIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  174  YHFYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  233

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  234  KTDWSKAPFIASYKGFHIDGCEA---SVQAKYCATQGKRWWDQKEFQDLDAFQYRRLKWV  290

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  F  Y+YC D  RFP LPPEC+R
Sbjct  291  RSKFTIYNYCTDRSRFPVLPPECRR  315



>ref|NP_001280965.1| probable xyloglucan endotransglucosylase/hydrolase protein B 
precursor [Malus domestica]
 gb|AAN07897.1| xyloglucan endotransglycosylase [Malus domestica]
Length=294

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 182/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G+EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP A +
Sbjct  91   GTVTAYYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ ++  +   VR
Sbjct  210  TDWSKAPFIASYRGFHIDGCEA---SVEAKYCATQGKRWWDQKEFQDLDAQQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+P++PPECKR
Sbjct  267  KKFTIYNYCTDRVRYPSMPPECKR  290



>ref|XP_006423880.1| hypothetical protein CICLE_v10028851mg [Citrus clementina]
 gb|ESR37120.1| hypothetical protein CICLE_v10028851mg [Citrus clementina]
Length=319

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  55   NVPFGRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  114

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  115  AGSVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKA  173

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF+VD+IPIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  174  YHFYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  233

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  234  KTDWSKAPFIASYKGFHIDGCEA---SVQAKYCATQGKRWWDQKEFQDLDAFQYRRLKWV  290

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  F  Y+YC D  RFP LPPEC+R
Sbjct  291  RSKFTIYNYCTDRSRFPVLPPECRR  315



>ref|XP_009359838.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Pyrus x bretschneideri]
Length=335

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 182/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G+EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  72   VPFGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSA  131

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP A +
Sbjct  132  GTVTAYYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAY  190

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  191  HSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  250

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ ++  +   VR
Sbjct  251  TDWSKAPFIASYRGFHIDGCEA---SVEAKFCATQGKRWWDQKEFQDLDAQQWRRLRWVR  307

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            R F  Y+YC D  R+P++PPECKR
Sbjct  308  RKFTIYNYCTDRVRYPSMPPECKR  331



>gb|EYU23679.1| hypothetical protein MIMGU_mgv1a011061mg [Erythranthe guttata]
Length=293

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G +IQL +DKS+GSGF SK SY  G F + +K+   D+
Sbjct  29   DVAFGRNYMPTWAFDHIKYFNGGSQIQLSLDKSTGSGFQSKGSYLFGHFSMHIKMVAGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP  D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVYTGGKGDKEQRIYLWFDPTQD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y +LWN +QIVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  FHTYSVLWNLYQIVFLVDDVPIRVFKNSKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWSKAPFTASYKGFHIDGCEA---SVEAKFCNTQGRRWWDQKEFQDLDASQWSRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YCAD  R+P +P ECKR
Sbjct  265  RSKYTIYNYCADRVRYPVVPAECKR  289



>gb|ACD03216.1| xyloglucan endotransglucosylase/hydrolase 6 [Actinidia deliciosa]
Length=293

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVFYVD++PIR+FKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHAYSVLWNLYQIVFYVDDVPIRIFKNSKDLGVKFPFDQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+      L+ ++  +   V
Sbjct  208  KTDWSKAPFVAAYKSFHIDGCEA---SVEAKFCATQGKRWWDQNDFRDLDADQYRRLQWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+PT+PPEC R
Sbjct  265  RSKYTIYNYCTDRKRYPTMPPECSR  289



>ref|XP_002304625.1| EXGT1 family protein [Populus trichocarpa]
 gb|EEE79604.1| EXGT1 family protein [Populus trichocarpa]
Length=294

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  30   DVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN + IVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  FHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C ++GA WW+ K+   L+  +  +   V
Sbjct  209  KTDWSKAPFIASYRSFHVDGCEA---SVEAKFCATQGARWWDQKEFQDLDALQYRRLSWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  266  RQKYTIYNYCTDRSRYPSMPPECKR  290



>gb|KHN01716.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6, 
partial [Glycine soja]
Length=293

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   DQGR IQL +D+SSG GFASK  Y  G   +++K+   D+A
Sbjct  32   ATFLQDFHVTWSDSHIRQFDQGRAIQLRLDQSSGCGFASKVKYMFGRVSMKIKLVPGDSA  91

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL S+T    DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  92   GTVTAFYLNSDTNYVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPAADF  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD+ PIRV+KN E  G+ YP   A+ +  +LW A++WAT GG  K
Sbjct  152  HTYSILWNHHHIVFYVDDFPIRVYKNNEARGIPYPKMQAMGVYSTLWEADNWATRGGLEK  211

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  212  IDWSKAPFYAYYKDFDIEGCAMPGPAN----CASNPSNWWEGAAYQALNSIEARRYRWVR  267

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RFP  PPEC
Sbjct  268  VNHVIYDYCKDKSRFPVTPPEC  289



>ref|XP_003549996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
Length=292

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   DQGR IQL +D+SSG GFASK  Y  G   +++K+   D+A
Sbjct  31   ATFLQDFHVTWSDSHIRQFDQGRAIQLRLDQSSGCGFASKVKYMFGRVSMKIKLVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL S+T    DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  91   GTVTAFYLNSDTNYVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPAADF  150

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD+ PIRV+KN E  G+ YP   A+ +  +LW A++WAT GG  K
Sbjct  151  HTYSILWNHHHIVFYVDDFPIRVYKNNEARGIPYPKMQAMGVYSTLWEADNWATRGGLEK  210

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  211  IDWSKAPFYAYYKDFDIEGCAMPGPAN----CASNPSNWWEGAAYQALNSIEARRYRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RFP  PPEC
Sbjct  267  VNHVIYDYCKDKSRFPVTPPEC  288



>ref|XP_006385866.1| hypothetical protein POPTR_0003s15800g [Populus trichocarpa]
 gb|ERP63663.1| hypothetical protein POPTR_0003s15800g [Populus trichocarpa]
Length=298

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  34   DVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  94   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN + IVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  153  FHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C ++GA WW+ K+   L+  +  +   V
Sbjct  213  KTDWSKAPFIASYRSFHVDGCEA---SVEAKFCATQGARWWDQKEFQDLDALQYRRLSWV  269

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  270  RQKYTIYNYCTDRSRYPSMPPECKR  294



>ref|XP_004288290.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 174/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D++SG GF+SK  Y  G   +++K+   D+A
Sbjct  31   ATFLQDFQVTWSDSHIRQIDGGRAIQLVLDQNSGCGFSSKHKYLFGRVSMKIKLIPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G GNRE+R+ LWFDPAADF
Sbjct  91   GTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIYAHGQGNREERVNLWFDPAADF  150

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD++PIR++KN E  G+ YP    + +  +LW A+ WAT GG  K
Sbjct  151  HTYTILWNHHHIVFYVDDVPIRLYKNNEAKGIPYPKLQPMGVFSTLWEADDWATRGGLEK  210

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF A ++ F+++GC+    +N    C S    WW      +LN  E  +Y  VR
Sbjct  211  INWSKAPFYAYYKDFDIEGCSVPGPAN----CASSAQNWWEGTAYQALNALEYRRYKWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC+D  R+P  PPEC
Sbjct  267  MNHMIYDYCSDRSRYPKPPPEC  288



>ref|XP_002972756.1| hypothetical protein SELMODRAFT_97913 [Selaginella moellendorffii]
 gb|EFJ25977.1| hypothetical protein SELMODRAFT_97913 [Selaginella moellendorffii]
Length=293

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 172/265 (65%), Gaps = 6/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY+V W ++H    + G E+ L++DK+SG+GF S++ Y  G   +++K+   D+
Sbjct  34   DVPFAQNYYVRWADDHTRMLNGGTEMHLVLDKASGAGFGSRTKYLFGHVSMKIKLVPKDS  93

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FY++S T D+HDELDFEFLGN   +P  +QTN+ A GVGNREQR YLWFDP  D
Sbjct  94   AGTVTAFYMSSET-DKHDELDFEFLGNTSGQPYIVQTNVFANGVGNREQRHYLWFDPTQD  152

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FHSY  LWN+ QI+FYVD++P+RV KN E IG+ +P    + I  SLWN + WAT GG  
Sbjct  153  FHSYSFLWNKQQIIFYVDDVPLRVHKNNEAIGIPFPKTQPMGIYSSLWNGDDWATRGGLE  212

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KINW  APF A ++GF+VD C     +  +  C +    WW  +   S + E + +   V
Sbjct  213  KINWDHAPFVAAYKGFSVDAC-----AGGVESCSAPRGNWWEQEAFQSTDEETKSKLKWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            + N+M Y+YC D  RFPT P +C +
Sbjct  268  KDNYMIYNYCTDSKRFPTTPADCGQ  292



>ref|XP_003624546.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|ABD33176.1| Glycoside hydrolase, family 16; Xyloglucan endo-transglycosylase, 
C-terminal [Medicago truncatula]
 gb|AES80764.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=293

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 175/265 (66%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   ++G EI+LL+DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNEGSEIELLLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   D HDE+DFEFLGNR  +P  LQTN+   G GNREQRI+LWFDP   
Sbjct  89   AGTVTAFYLSSQNAD-HDEIDFEFLGNRTGQPYILQTNVFTGGQGNREQRIFLWFDPTKA  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF+VDNIPIRVFKN + +GV++P    +++  SLWNA+ WAT GG  
Sbjct  148  YHRYSVLWNMYQIVFFVDNIPIRVFKNSKKLGVKFPFDQPMKVYNSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC     S +   C  +G  WWN  +   L+  +  +   V
Sbjct  208  KTDWSKAPFIAGYKSFHIDGCET---SVNAKYCAKQGRKWWNRPEFRDLDAAQWKRIKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ F  Y+YC D  RFP +PPEC+R
Sbjct  265  RKKFTIYNYCTDRTRFPQIPPECRR  289



>ref|XP_003517365.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
Length=296

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 175/262 (67%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W   H+   DQGR IQL++D++SG GFASKS Y  G   +++K+   D+A
Sbjct  35   ATFLQDFEITWSKTHIRQIDQGRSIQLILDQNSGCGFASKSKYMFGRVSMKIKLIPGDSA  94

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDP+ADF
Sbjct  95   GTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  154

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD+ PIRV+KN E  G+ YP+   + +  +LW A++WAT GG  K
Sbjct  155  HTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQPMGVYSTLWEADNWATRGGLEK  214

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  215  IDWSKAPFYAYYKDFDIEGCPVPGPAN----CASNQSNWWEGAAYQALNAIEARRYRWVR  270

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RFP +PPEC
Sbjct  271  LNHIIYDYCQDKSRFPVIPPEC  292



>ref|XP_008369587.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Malus domestica]
Length=331

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 182/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G+EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  68   VPFGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSA  127

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP A +
Sbjct  128  GTVTAYYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAY  186

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  187  HSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  246

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ ++  +   VR
Sbjct  247  TDWSKAPFIASYRGFHIDGCEA---SVEAKYCATQGKRWWDQKEFQDLDAQQWRRLRWVR  303

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+P++PPECKR
Sbjct  304  KKFTIYNYCTDRVRYPSMPPECKR  327



>ref|XP_007223252.1| hypothetical protein PRUPE_ppa009387mg [Prunus persica]
 gb|EMJ24451.1| hypothetical protein PRUPE_ppa009387mg [Prunus persica]
Length=294

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 181/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  31   VPFGRNYQPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKLVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP A +
Sbjct  91   GTVTAYYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   VR
Sbjct  210  TDWSKAPFIATYKGFHIDGCEA---SVEAKFCATQGQRWWDQKEFQDLDANQWRRLKWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+PTLPPECKR
Sbjct  267  QKFTIYNYCTDRVRYPTLPPECKR  290



>gb|KHN36328.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Glycine soja]
Length=296

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 175/262 (67%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W   H+   DQGR IQL++D++SG GFASKS Y  G   +++K+   D+A
Sbjct  35   ATFLQDFEITWSKTHIRQIDQGRAIQLILDQNSGCGFASKSKYMFGRVSMKIKLIPGDSA  94

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDP+ADF
Sbjct  95   GTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  154

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD+ PIRV+KN E  G+ YP+   + +  +LW A++WAT GG  K
Sbjct  155  HTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQPMGVYSTLWEADNWATRGGLEK  214

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  215  IDWSKAPFYAYYKDFDIEGCPVPGPAN----CASNQSNWWEGAAYQALNAIEARRYRWVR  270

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RFP +PPEC
Sbjct  271  LNHIIYDYCQDKSRFPVIPPEC  292



>ref|XP_002512703.1| Xyloglucan endotransglucosylase/hydrolase protein A precursor, 
putative [Ricinus communis]
 gb|EEF50155.1| Xyloglucan endotransglucosylase/hydrolase protein A precursor, 
putative [Ricinus communis]
Length=319

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  54   DVAFGRNYIPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDS  113

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  114  AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  172

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  173  YHSYSVLWNLYQIVFFVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  232

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  233  KTDWSKAPFIASYKGFHIDGCEA---SVEAKFCATQGKRWWDQKEFQDLDAFQYRRLRWV  289

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P+ PPEC R
Sbjct  290  RTKYTIYNYCTDTSRYPSQPPECSR  314



>gb|ACD03215.1| xyloglucan endotransglucosylase/hydrolase 5 [Actinidia deliciosa]
Length=293

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD+IPIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVKFPFDQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+      L+  +  +   V
Sbjct  208  KTDWSKAPFVAAYKSFHIDGCEA---SVEAKFCATQGKRWWDQNDYRDLDAFQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+PT+PPEC+R
Sbjct  265  RSKYTIYNYCTDRTRYPTMPPECRR  289



>gb|ACA02823.1| XET [Pyrus pyrifolia]
Length=294

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 181/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G+EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQR++LWFDP A +
Sbjct  91   GTVTAYYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRVFLWFDPTAAY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+ ++  +   VR
Sbjct  210  TDWSKAPFIASYRGFHIDGCEA---SVEAKFCATQGKRWWDQKEFQDLDAQQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            R F  Y+YC D  R+P +PPECKR
Sbjct  267  RKFTIYNYCTDRVRYPFMPPECKR  290



>gb|ABK92523.1| unknown [Populus trichocarpa]
Length=294

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  30   DVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN + IVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  FHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C  +GA WW+ K+   L+  +  +   V
Sbjct  209  KTDWSKAPFIASYRSFHVDGCEA---SVEAKFCAPQGARWWDQKEFQDLDALQYRRLSWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  266  RQKYTIYNYCTDRSRYPSMPPECKR  290



>ref|XP_010032777.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Eucalyptus grandis]
 gb|KCW52248.1| hypothetical protein EUGRSUZ_J01663 [Eucalyptus grandis]
Length=293

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 179/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+A
Sbjct  30   VAFGRNYMPTWAFDHIKYFNGGSEIQLSLDKYTGTGFQSKGSYLFGHFSMDIKLVAGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S   + HDE+DFEFLGNR  +P  +QTN+   G G+REQRIYLWFDP A +
Sbjct  90   GTVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYIVQTNVFTGGKGDREQRIYLWFDPTAAY  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD++PIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  149  HSYSVLWNMYQIVFFVDDVPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   VR
Sbjct  209  TDWSKAPFVASYRGFHIDGCEA---SVEAKFCATQGQRWWDQKEFQDLDAFQYRRLRWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
              +  Y+YCAD  R+P + PEC+R
Sbjct  266  SKYTIYNYCADRKRYPAMSPECRR  289



>gb|KHG12145.1| putative xyloglucan endotransglucosylase/hydrolase B [Gossypium 
arboreum]
Length=341

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  77   DVPFSRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDS  136

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  137  AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  195

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD+IPIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  196  YHSYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  255

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC +   S +   C ++G  WW+ K    L+  +  +   V
Sbjct  256  KTDWSKAPFIATYKSFHIDGCES---SVEAKFCATQGKRWWDQKAFQDLDAYQWRRLRWV  312

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ F  Y+YC+D  R+PT+ PECKR
Sbjct  313  RKKFTIYNYCSDRVRYPTMSPECKR  337



>gb|KHG08923.1| putative xyloglucan endotransglucosylase/hydrolase B [Gossypium 
arboreum]
Length=293

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 179/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EI+L +DK +G+GF SK SY  G F +++K+   D+A
Sbjct  30   VPFGRNYVPTWAFDHIKYYNGGSEIELYLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   +
Sbjct  90   GTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTTAY  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD++PIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  K
Sbjct  149  HSYSVLWNSYQIVFFVDDVPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC +   S +   C ++G  WW+ K+   L+  +  +   VR
Sbjct  209  TDWSKAPFIASYKGFHIDGCES---SVEAKFCATQGKRWWDQKEFQDLDSYQWRRLAWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
              F  Y+YC+D  RFPT+ PECKR
Sbjct  266  NKFTIYNYCSDRVRFPTIHPECKR  289



>ref|XP_006844710.1| hypothetical protein AMTR_s00016p00250350 [Amborella trichopoda]
 gb|ERN06385.1| hypothetical protein AMTR_s00016p00250350 [Amborella trichopoda]
Length=293

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +V F  NY   W  +H+   + G E QL++DK +G+GF S+ SY  G F + +K+   D+
Sbjct  29   NVPFQKNYVPTWAFDHIKYINGGTEAQLVLDKYTGTGFQSRGSYLFGHFSMDIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G GNREQRIYLWFDP  D
Sbjct  89   AGTVTAYYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVFTGGAGNREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD +PIR+FKN ++IGVR+P    +++  SLWNA+ WAT GG  
Sbjct  148  YHSYAVLWNMYQIVFFVDEVPIRIFKNNKHIGVRFPFNQPMKMYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC AD K    + C ++G  WW+ K    L+  +  +   V
Sbjct  208  KTDWSKAPFIASYRGFHIDGCEADAKD---SVCATQGKRWWDQKAFQDLDGIQYRRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPEC  139
            R  +  Y+YC D  R PT+P EC
Sbjct  265  REKYTIYNYCTDRARIPTMPTEC  287



>ref|XP_010929528.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
[Elaeis guineensis]
Length=296

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G E+QL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  32   DVPFQRNYVPTWAYDHIKYINGGNEVQLSLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDS  91

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  +QTN+   G G+REQRIYLWFDP  D
Sbjct  92   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTNQPYIVQTNVFTGGKGDREQRIYLWFDPTKD  150

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD++PIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  151  YHSYSVLWNMYQIVFFVDDVPIRVFKNCKDLGVRFPFDQPMKIYSSLWNADDWATRGGLE  210

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  211  KTDWSKAPFIASYRSFHVDGCEA---SVEAKFCATQGRRWWDQKEFQDLDSLQYRRLDWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P +PPEC R
Sbjct  268  RHQYTIYNYCTDRSRYPVMPPECGR  292



>ref|XP_010646543.1| PREDICTED: putative xyloglucan endotransglucosylase/hydrolase 
protein 1 [Vitis vinifera]
Length=294

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 180/268 (67%), Gaps = 14/268 (5%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            VSFD NY+  WG  H +S + G E++L +D+ SGSGF S  +YGSG F +RMK+P  D+ 
Sbjct  33   VSFDQNYYNTWGFYHFSSINNGTEVRLSIDEYSGSGFMSNHTYGSGFFRMRMKIPNKDSL  92

Query  744  GVVTSFYLTSNTEDR----HDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDP  577
            G++T+FYLTS   ++    HDELDFEFLG     P TLQTN+ +   G RE+R+ LWFDP
Sbjct  93   GIITTFYLTSQQNNQPAGNHDELDFEFLGGHG-MPYTLQTNVFSNDNGGREERVALWFDP  151

Query  576  AADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDG  397
             ADFH+YKILWNQHQIVFYVD IPIRVFKN   IGV YPS  A+ + GSLW+  +WA  G
Sbjct  152  TADFHTYKILWNQHQIVFYVDKIPIRVFKNNTGIGVNYPS-QAMSVVGSLWSDTTWAAHG  210

Query  396  GKAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQY  217
               +INW+QAPF A FQGFN++GC  D  S   ++C S   Y WN  +   L++ E V Y
Sbjct  211  --QQINWTQAPFVAYFQGFNINGCLKDIDS--TSQCNST-HYRWNGPRYMGLDQTEIVAY  265

Query  216  LKVRRNFMHYDYCADLPRFPTLPPECKR  133
             KVRR ++ Y YC+D     +L PEC R
Sbjct  266  EKVRRKYLTYSYCSDR---GSLHPECPR  290



>ref|XP_004493114.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B-like [Cicer arietinum]
Length=293

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+ S + G EIQLL+D+ +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKSFNGGSEIQLLLDEYTGTGFQSKGSYLFGHFSMNIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S  E+ HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQNEE-HDEIDFEFLGNRTGQPYILQTNVFTGGQGDREQRIYLWFDPTKA  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF VDNIPIRVFKN +++GV++P   A+++  SLWNA+ WAT GG  
Sbjct  148  YHRYSVLWNTYQIVFLVDNIPIRVFKNNKDLGVKFPFNQAMKVYNSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  208  KTDWSKAPFIAGYKSFHIDGCEA---SVNAKFCGTQGKRWWDQPEFRDLDAAQWRRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            RR +  Y+YC D  R P +PPEC R
Sbjct  265  RRKYTIYNYCTDRKRLPQIPPECTR  289



>emb|CAN73201.1| hypothetical protein VITISV_006604 [Vitis vinifera]
Length=294

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 180/268 (67%), Gaps = 14/268 (5%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            VSFD NY+  WG  H +S + G E++L +D+ SGSGF S  +YGSG F +RMK+P  D+ 
Sbjct  33   VSFDQNYYNTWGFYHFSSINNGTEVRLSIDEYSGSGFMSNHTYGSGFFRMRMKIPNKDSL  92

Query  744  GVVTSFYLTSNTEDR----HDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDP  577
            G++T+FYLTS   ++    HDELDFEFLG     P TLQTN+ +   G RE+R+ LWFDP
Sbjct  93   GIITTFYLTSQQNNQPAGNHDELDFEFLGGHG-MPYTLQTNVFSNDNGGREERVALWFDP  151

Query  576  AADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDG  397
             ADFH+YKILWNQHQIVFYVD IPIRVFKN   IGV YPS  A+ + GSLW+  +WA  G
Sbjct  152  TADFHTYKILWNQHQIVFYVDKIPIRVFKNNTGIGVNYPS-QAMSVVGSLWSDTTWAAHG  210

Query  396  GKAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQY  217
               +INW+QAPF A FQGFN++GC  D  S   ++C S   Y WN  +   L++ E V Y
Sbjct  211  --QQINWTQAPFVAYFQGFNINGCLKDIDS--TSQCNST-HYRWNGPRYMGLDQTEIVAY  265

Query  216  LKVRRNFMHYDYCADLPRFPTLPPECKR  133
             KVRR ++ Y YC+D     +L PEC R
Sbjct  266  EKVRRKYLTYSYCSDR---GSLHPECPR  290



>ref|XP_011004327.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Populus euphratica]
Length=293

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+     G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFRGGSEIQLQLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTIR  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + +VF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNSYLVVFFVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWSKAPFIASYKSFHIDGCEA---SVEAKFCATQGTRWWDQKEFQDLDALQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P+LPPECKR
Sbjct  265  RQKYTIYNYCTDRSRYPSLPPECKR  289



>ref|XP_011021810.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Populus euphratica]
Length=296

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 171/262 (65%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D+ SG GFASK+ Y  G   +R+K+   D+A
Sbjct  35   ATFLQDFRVTWSDSHIRQIDGGRAIQLVLDQYSGCGFASKAKYLFGRVSMRIKLIPGDSA  94

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  95   GTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIFAHGKGDREQRVNLWFDPAADF  154

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H Y I WN   IVFYVD++PIRV+KN E  G+ +P    +++  +LW A+ WAT GG  K
Sbjct  155  HVYTIFWNHQHIVFYVDDMPIRVYKNNEAKGIPFPKLQPMRVYSTLWEADDWATRGGLEK  214

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF A ++ F+++GC     +     C S    WW      +LN  E  +Y  VR
Sbjct  215  INWSKAPFYAYYKDFDIEGCPVPGPAT----CASNRGNWWEGATYQALNAMEARKYRWVR  270

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYCAD  R+PT PPEC
Sbjct  271  MNHMIYDYCADKSRYPTTPPEC  292



>gb|KHG03304.1| putative xyloglucan endotransglucosylase/hydrolase 6 -like protein 
[Gossypium arboreum]
Length=290

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 171/262 (65%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W ++H+   D GR IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  29   TTFLEDFRITWSDSHIKQIDGGRAIQLILDQNSGCGFASKRQYLFGRVSMKIKLIPGDSA  88

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  KP T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  89   GTVTAFYMNSDTDTVRDELDFEFLGNRTGKPYTVQTNIYAHGKGDREQRVNLWFDPAADF  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD +PIRV+KN E   + YP F  + +  +LW A+ WAT GG  K
Sbjct  149  HTYTIMWNHHHIVFYVDEVPIRVYKNNEAKNIPYPKFQPMGVYSTLWEADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S    WW      +LN  E  +Y  VR
Sbjct  209  IDWSKAPFLAYYKDFDIEGCPVPGPAN----CASNPRNWWEGTAYQALNAMEARRYRWVR  264

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  265  MNHMIYDYCTDKSRYPVTPPEC  286



>emb|CDP15486.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 171/265 (65%), Gaps = 2/265 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+     G  + L++DK SG+GF SK+SY  G F +RMK+ G D+
Sbjct  30   DVPFQRNYVPSWSADHIKYIKGGSSVDLVLDKISGTGFQSKNSYLFGHFSMRMKLVGGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLW+DP   
Sbjct  90   AGVVTAFYLSSQTNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWYDPTKG  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y I+WN   + F+VDN PIRVFKN +++GV+YP    +++  SLW A+ WAT GG  
Sbjct  149  FHDYGIIWNMDMLAFFVDNTPIRVFKNSKDLGVKYPFNQPMKLYSSLWEADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NW+ APF A +  F++DGC A     ++  C +RG  WW+      L+ E+  +   V
Sbjct  209  KTNWANAPFIASYTSFHIDGCVAS-TPQEVQVCSTRGLKWWDQPAFKDLDGEQYRRLRWV  267

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            RR F  Y+YC+D  R+PT P EC R
Sbjct  268  RRKFTIYNYCSDKARYPTPPIECSR  292



>ref|XP_011020925.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Populus euphratica]
 ref|XP_011020926.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Populus euphratica]
Length=294

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F ++MK+   D+
Sbjct  30   DVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP  +
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTKE  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN + IVF VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  FHYYSVLWNMYIIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++GA WW+ K+   L+  +  +   V
Sbjct  209  KTDWSKAPFIASYRSFHIDGCEA---SVEARFCATQGARWWDQKEFQDLDAFQYRRLSWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  266  RQKYTIYNYCTDRSRYPSMPPECKR  290



>ref|XP_006446867.1| hypothetical protein CICLE_v10016123mg [Citrus clementina]
 ref|XP_006468946.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5-like [Citrus sinensis]
 gb|ESR60107.1| hypothetical protein CICLE_v10016123mg [Citrus clementina]
 gb|KDO63481.1| hypothetical protein CISIN_1g022696mg [Citrus sinensis]
Length=293

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLVLDKYTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP  +
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVYTGGKGDKEQRIYLWFDPTKE  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y +LWN +QIVF VD++PIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  148  FHTYSVLWNMYQIVFLVDDVPIRVFKNSKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC     S +   C ++G  WW+ K    L+  +  +   V
Sbjct  208  KTDWSKAPFIASYKGFHVDGCEV---SVNAKFCETQGKRWWDQKAFQDLDAYQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFPT  PECKR
Sbjct  265  RQKYTIYNYCNDRARFPTPSPECKR  289



>ref|XP_008372631.1| PREDICTED: uncharacterized protein LOC103435981 [Malus domestica]
Length=989

 Score =   266 bits (681),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 190/266 (71%), Gaps = 10/266 (4%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHD-  751
            D++FD  Y   WGN+H+ S +QGRE+QL +D  SG  FAS  +Y SG F +RMK+PG++ 
Sbjct  23   DIAFDKKYEFIWGNDHILSLNQGRELQLTLDNRSGCKFASYLNYSSGFFHMRMKIPGNNN  82

Query  750  TAGVVTSFYLTSN-TEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPA  574
            TAGVVTSFYL S  +  +HDELDFEFLGN E + +TLQTN+   GVG+REQRI LWFDPA
Sbjct  83   TAGVVTSFYLMSKASASQHDELDFEFLGNIEGQQITLQTNVFVNGVGDREQRINLWFDPA  142

Query  573  ADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGG  394
             +FH YKI+WN HQ+VF++D+ PIRVFKN  N GV YP+   ++I+ +LW A+ WAT G 
Sbjct  143  GNFHDYKIIWNPHQVVFFIDDTPIRVFKNYTNYGVPYPT-QPMRIEAALWTAD-WATFG-  199

Query  393  KAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYL  214
              KINW+ APF A  QGF++ GC+A  ++ D+  C+S    WWN+ + W+LN  ++  Y 
Sbjct  200  -HKINWTYAPFVAHCQGFDISGCSA--QNXDVEECYSSNX-WWNNMEYWNLNSTQQKAYE  255

Query  213  KVRRNFMHYDYCADLPRFPT-LPPEC  139
             VR+ +M+YDYC D  ++P+ LP EC
Sbjct  256  NVRKKYMNYDYCDDKAKYPSGLPREC  281


 Score =   166 bits (421),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 133/251 (53%), Gaps = 55/251 (22%)
 Frame = -2

Query  783  FEIRMKVP-GHDTAGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNR  607
            F +R+++P   +TA       LTS  E   DELDFE LG++      L TN+  +G G R
Sbjct  754  FHMRIRLPEAWNTAD------LTSGDEPHQDELDFELLGSKPGGEKFLLTNVFIDGQGGR  807

Query  606  EQRIYLWFDPAADFHSYKILWNQHQIV---------------------------------  526
            E+ +  WFDP  ++H Y+ILWN HQIV                                 
Sbjct  808  EETMTFWFDPTTEYHDYQILWNHHQIVSSYSSNAVLTQKTSIFAVSNICGFTCSIVYVTP  867

Query  525  -FYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKINWSQAPFKAEF  349
             FYVD  PIR+FKN +  GV Y S   ++I+ SLWNAE WAT    A I+W  APFKA +
Sbjct  868  IFYVDKFPIRIFKNNKKFGVPYIS-KPMKIQASLWNAE-WATR--DADIDWRYAPFKAHY  923

Query  348  QGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRNFMHYDYC-AD  172
            +GF+V+GCT     N I  C+    YWWNS+K W L+  ER +Y  +RR F+ YDYC A 
Sbjct  924  EGFDVNGCTPQ---NSIKDCYGH-RYWWNSRKHWELDSNERQKYEDIRR-FLVYDYCSAG  978

Query  171  LPRFPTLPPEC  139
             PR     PEC
Sbjct  979  FPR----KPEC  985



>gb|ADE42488.1| xyloglucan endotransglucosylase/hydrolase 1 [Fragaria chiloensis]
Length=294

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 179/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+P  D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFHMQIKLPPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP  ++
Sbjct  91   GTVTAFYLSS-TNAEHDEIDFEFLGNRTGQPFILQTNVFTGGKGDREQRIFLWFDPTKEY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   VR
Sbjct  210  TDWSKAPFVATYRGFHIDGCEA---SVQARFCATQGKRWWDQKEFQDLDAYQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+PTLP E +R
Sbjct  267  QRFTIYNYCTDRTRYPTLPAEVQR  290



>ref|XP_008222293.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Prunus mume]
Length=294

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 180/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  31   VPFGRNYQPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKLVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++YL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP   +
Sbjct  91   GTVTAYYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTTAY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYSVLWNLYQIVFFVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   VR
Sbjct  210  TDWSKAPFIATYKGFHIDGCEA---SVEAKFCATQGQRWWDQKEFQDLDAYQWRRLKWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+PTLPPECKR
Sbjct  267  QKFTIYNYCTDRVRYPTLPPECKR  290



>gb|ABM91063.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-26 [Populus 
tremula x Populus tremuloides]
Length=293

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +D  +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYAPTWAFDHIKYINGGSEIQLKLDNFTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP  +
Sbjct  89   AGTVTAFYLSSQTNE-HDEIDFEFLGNRTGQPYILQTNVYTGGKGDKEQRIYLWFDPTKE  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VD++PIRVFKN +++G+++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHAYSVLWNMYQIVFFVDDVPIRVFKNSKDLGLKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +W++APF A ++ F+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWAKAPFIASYKSFHVDGCEA---SVNAKFCDTQGKRWWDQKEFQDLDAAQYRKLGWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFP+LPPECKR
Sbjct  265  RQKYTIYNYCTDRVRFPSLPPECKR  289



>gb|AAW27915.1| xyloglucan endotransglucosylase/hydrolase precursor [Vigna radiata]
Length=286

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 176/266 (66%), Gaps = 4/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  22   DVPFGRNYIPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDS  81

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  82   AGTVTAFYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKA  140

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF VDNIPIRVFKN + +GV++P    +++  SLWNA+ WAT GG  
Sbjct  141  YHRYSVLWNMYQIVFLVDNIPIRVFKNLKELGVKFPFDQPMKVYNSLWNADDWATRGGLE  200

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF AE++GF+VDGC A   S     C ++G  WW+  +   L+  +  +   V
Sbjct  201  KTDWSKAPFVAEYKGFHVDGCEASVNS---RFCATQGKRWWDQTEFRDLDSFQWRRLKWV  257

Query  207  RRNFMHYDYCADLPRFPTLPPECKRH  130
            R+ F  Y+YC D  R+P LPPEC+R+
Sbjct  258  RQKFTIYNYCTDRTRYPQLPPECRRN  283



>gb|ABB72441.1| xyloglucan endotransglucosylase [Betula pendula]
Length=294

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G +IQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  30   DVPFGRNYMPTWAFDHIKYFNGGSDIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTHA  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN +QIVF+VD+IPIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  149  YHSYSVLWNLYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  209  KTDWSKAPFIATYRGFHIDGCEA---SVEAKFCATQGQRWWDQKEFQDLDSYQYRRLQWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P L PECKR
Sbjct  266  RTKYTIYNYCTDRVRYPALSPECKR  290



>ref|XP_007155788.1| hypothetical protein PHAVU_003G231900g [Phaseolus vulgaris]
 gb|ESW27782.1| hypothetical protein PHAVU_003G231900g [Phaseolus vulgaris]
Length=290

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 175/262 (67%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+T  DQGR IQL +D++SG GFASK+ Y  G   +++K+   D+A
Sbjct  29   ATFVQDFRVAWADSHITQIDQGRAIQLKLDQNSGCGFASKAKYMFGRVSMKIKLVPGDSA  88

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL S+T++  DELDFEFLGNR  +P T+QTN+ A G G+REQR+ LWFDP+ADF
Sbjct  89   GTVTAFYLNSDTDNVRDELDFEFLGNRTGQPYTVQTNVFAHGKGDREQRVNLWFDPSADF  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN   IVFYVD+ PIRV+KN E  GV YP   A+ +  +LW A+ WAT GG  K
Sbjct  149  HTYSIMWNHRHIVFYVDDFPIRVYKNNERRGVPYPKMQAMGVYSTLWEADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S    WW   +  +LN  E  +Y  VR
Sbjct  209  IDWSKAPFYAYYKDFDIEGCAVPGPAN----CASNPRNWWEGAEYQALNAIEARRYRWVR  264

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  R+P  PPEC
Sbjct  265  MNHVIYDYCRDKSRYPLTPPEC  286



>ref|XP_001752481.1| predicted protein [Physcomitrella patens]
 gb|EDQ82720.1| predicted protein [Physcomitrella patens]
Length=280

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 171/267 (64%), Gaps = 2/267 (1%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V+F  NY     + H    + G ++QL++D+ + SGF SK  Y  G   +RMK+   ++A
Sbjct  16   VTFLENYESQSDSQHFRILNDGHQVQLVLDEYAASGFGSKYQYLFGKIGMRMKLVPGNSA  75

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT++Y++S T   HDE+DFEFLGN   +P  LQTNI A G G REQRIYLWFDP +DF
Sbjct  76   GTVTAYYMSSQTPGLHDEMDFEFLGNVTGQPYILQTNIYANGEGKREQRIYLWFDPTSDF  135

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN  QIVFYVDN PIRVFKN ++IGV YP    + I  ++WN E+WAT+ G  K
Sbjct  136  HSYSVLWNTQQIVFYVDNTPIRVFKNNKDIGVPYPDSKPVGIYSTIWNGENWATNDGWVK  195

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            +NW+ APF A ++ FNVD C  D  + D   C ++ + WW S +  +L   +  Q   VR
Sbjct  196  LNWTYAPFVATYESFNVDACRVD--NGDTASCMAQTSSWWMSSEYQTLGAYQVNQLEWVR  253

Query  204  RNFMHYDYCADLPRFPTLPPECKRH*L  124
             N++ YDYCAD  R P  PPEC R+ L
Sbjct  254  NNYLLYDYCADRKRSPAPPPECARNPL  280



>ref|XP_011086906.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Sesamum indicum]
Length=294

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL++D  +G+GF SK SY  G F + +K+   D+
Sbjct  30   DVPFGRNYVPTWAFDHIKYYNGGSEIQLVLDNYTGTGFQSKGSYLFGHFSMHIKMVAGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP   
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVYTGGKGDKEQRIYLWFDPTKA  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  YHTYSVLWNLYQIVFFVDDVPIRVFKNNKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S     C ++G  WW+ K+   L+  +  +   V
Sbjct  209  KTDWSKAPFVASYRGFHIDGCEA---SVQAKYCDTQGKRWWDQKEFQDLDSFQWRRLRWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFPT+P ECKR
Sbjct  266  RKKYTIYNYCTDRVRFPTIPAECKR  290



>ref|XP_003539234.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6-like [Glycine max]
Length=297

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 174/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W   H+   DQGR IQL++D++SG GFASKS Y  G   +++K+   D+A
Sbjct  36   ATFLQDFEITWSETHIRQIDQGRAIQLILDQNSGCGFASKSKYMFGRVSMKIKLIPGDSA  95

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDP+ADF
Sbjct  96   GTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  155

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD+ PIRV+KN E  G+ YP+  A+ +  +LW A++WAT GG  K
Sbjct  156  HTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQAMGVYSTLWEADNWATRGGLEK  215

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  216  IDWSKAPFYAYYKDFDIEGCPVPGPAN----CASNQSNWWEGAAYQALNAIEARRYRWVR  271

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RF   PPEC
Sbjct  272  LNHIIYDYCQDKSRFSVTPPEC  293



>ref|XP_007032093.1| Xyloglucan endotransglucosylase/hydrolase 4 [Theobroma cacao]
 gb|EOY03019.1| Xyloglucan endotransglucosylase/hydrolase 4 [Theobroma cacao]
Length=413

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  149  DVPFGRNYVPTWAFDHINYLNGGTEIQLKLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDS  208

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  209  AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVYTGGKGDREQRIYLWFDPTKD  267

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN   IV++VD++PIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  268  YHTYSVLWNTFLIVYFVDDVPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  327

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC    +S +   C ++G  WW+ K+   L+ ++  +   V
Sbjct  328  KTDWSKAPFVASYKGFHIDGCE---ESVNARFCKTQGKRWWDQKEFQDLDAQQYDKLRWV  384

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFPT+ PECKR
Sbjct  385  RQKYTIYNYCTDRARFPTMAPECKR  409



>gb|KDP41894.1| hypothetical protein JCGZ_26912 [Jatropha curcas]
Length=293

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL++DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYMPTWAFDHIKYFNGGSEIQLILDKYTGTGFQSKGSYLFGHFSMHIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  89   AGTVTAFYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTRE  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN +QIVF+VD++PIRVFKN +++GVR+P    +++  SLWNA+ WAT GG  
Sbjct  148  YHTYSVLWNMYQIVFFVDDVPIRVFKNCKDLGVRFPFDQPMKLYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+ ++   L+  +  +   +
Sbjct  208  KTDWSKAPFIASYKGFHIDGCEA---SVNAKFCDTQGKRWWDQREFQDLDAAQYRRLSWI  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  RFPT  PEC R
Sbjct  265  RQKYTIYNYCTDRTRFPTSAPECAR  289



>ref|XP_002297895.1| EXGT1 family protein [Populus trichocarpa]
 gb|EEE82700.1| EXGT1 family protein [Populus trichocarpa]
Length=293

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +D  +G+GF SK SY  G F ++MK+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLQLDNYTGTGFQSKGSYLFGHFSMQMKLVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTIR  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + +VF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNSYLVVFFVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWSKAPFIASYKSFHIDGCEA---SVEAKFCATQGTRWWDQKEFQDLDALQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P+LPPECKR
Sbjct  265  RQKYTIYNYCTDRSRYPSLPPECKR  289



>gb|KHN13026.1| Putative xyloglucan endotransglucosylase/hydrolase protein 6 
[Glycine soja]
Length=295

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 174/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W   H+   DQGR IQL++D++SG GFASKS Y  G   +++K+   D+A
Sbjct  34   ATFLQDFEITWSETHIRQIDQGRAIQLILDQNSGCGFASKSKYMFGRVSMKIKLIPGDSA  93

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDP+ADF
Sbjct  94   GTVTAFYMNSDTDTVRDELDFEFLGNRSGQPYTVQTNIYAHGKGDREQRVNLWFDPSADF  153

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD+ PIRV+KN E  G+ YP+  A+ +  +LW A++WAT GG  K
Sbjct  154  HTYTIMWNHHHIVFYVDDFPIRVYKNSEGKGIPYPTMQAMGVYSTLWEADNWATRGGLEK  213

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW      +LN  E  +Y  VR
Sbjct  214  IDWSKAPFYAYYKDFDIEGCPVPGPAN----CASNQSNWWEGAAYQALNAIEARRYRWVR  269

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N + YDYC D  RF   PPEC
Sbjct  270  LNHIIYDYCQDKSRFSVTPPEC  291



>dbj|BAD93485.1| pollen major allergen No.121 isoform 2 [Cryptomeria japonica]
Length=290

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   D G++  L +DKS+G+GF SK +Y  G F +++K+   D+
Sbjct  26   DVPFQKNYNPTWAADHIKYIDGGKQATLSLDKSTGTGFQSKGTYLFGHFSMQIKMVPGDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP  D
Sbjct  86   AGTVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVFSGGKGDREQRIYLWFDPTKD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN  QIVF+VD++PIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  145  YHSYSVLWNMRQIVFFVDDVPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGIE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S   + C + G  WW+ K+   L+  +  +   V
Sbjct  205  KTDWSKAPFVAAYKGFHIDGCEA---SAPYSLCPTLGRRWWDQKEFDDLDGLQWRKLKWV  261

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC+D  R+P L PEC R
Sbjct  262  RSKYTIYNYCSDRVRYPKLSPECSR  286



>gb|AAB39950.1| xyloglucan endotransglycosylase [Tropaeolum majus]
Length=293

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 180/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G +IQL +DK +G+GF SK SY  G F +++K+   D+A
Sbjct  30   VPFGRNYAPTWAFDHIKYFNGGSDIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S   + HDE+DFEFLGN+  +P  LQTN+   G G+REQRIYLWFDP  D+
Sbjct  90   GTVTAFYLSSQNSE-HDEIDFEFLGNKTGQPYILQTNVFTGGKGDREQRIYLWFDPTKDY  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  K
Sbjct  149  HSYSVLWNLYQIVFFVDDVPIRVFKNSKDLGVKFPFNQPMKIYSSLWNADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  + L VR
Sbjct  209  TDWSKAPFIASYKGFHVDGCEA---SVEAKFCATQGKRWWDQKEFQDLDGYQWRRLLWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
              +  Y+YC D  R+PT+ PECKR
Sbjct  266  NKWTIYNYCNDRVRYPTISPECKR  289



>ref|XP_008237031.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Prunus mume]
Length=291

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 172/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  30   ATFLQDFQVTWSDSHIRQIDGGRAIQLILDQNSGCGFASKRKYLFGRVSMKIKLIPGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G GNREQR+ LWFDP+ADF
Sbjct  90   GTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIYAHGKGNREQRVNLWFDPSADF  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD +PIRV+KN E  GV YP    + +  +LW A+ WAT GG  K
Sbjct  150  HTYTILWNHHHIVFYVDEVPIRVYKNNEARGVPYPKLQPMGVFSTLWEADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF + ++ F+++GC+    +N    C S    WW      +L+  +  +Y  VR
Sbjct  210  INWSRAPFYSYYRDFDIEGCSVPGPAN----CASSATNWWEGTAYQALSALQYRRYRWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  266  INHMIYDYCTDKSRYPVAPPEC  287



>emb|CBI33049.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 176/264 (67%), Gaps = 10/264 (4%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            VSFD NY+  WG  H +S + G E++L +D+ SGSGF S  +YGSG F +RMK+P  D+ 
Sbjct  33   VSFDQNYYNTWGFYHFSSINNGTEVRLSIDEYSGSGFMSNHTYGSGFFRMRMKIPNKDSL  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G++T+FY  +     HDELDFEFLG     P TLQTN+ +   G RE+R+ LWFDP ADF
Sbjct  93   GIITTFYQNNQPAGNHDELDFEFLGGHG-MPYTLQTNVFSNDNGGREERVALWFDPTADF  151

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+YKILWNQHQIVFYVD IPIRVFKN   IGV YPS  A+ + GSLW+  +WA  G   +
Sbjct  152  HTYKILWNQHQIVFYVDKIPIRVFKNNTGIGVNYPS-QAMSVVGSLWSDTTWAAHG--QQ  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INW+QAPF A FQGFN++GC  D  S   ++C S   Y WN  +   L++ E V Y KVR
Sbjct  209  INWTQAPFVAYFQGFNINGCLKDIDS--TSQCNST-HYRWNGPRYMGLDQTEIVAYEKVR  265

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            R ++ Y YC+D     +L PEC R
Sbjct  266  RKYLTYSYCSDR---GSLHPECPR  286



>gb|ADO24300.1| xyloglucan endotransglucosylase/hydrolase [Gossypium hirsutum]
Length=290

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 171/262 (65%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W ++H+   D GR IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  29   TTFLEDFRITWSDSHIKQIDGGRAIQLILDQNSGCGFASKRQYLFGRVSMKIKLIPGDSA  88

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  89   GTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPAADF  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD +PIRV+KN E   + YP F  + +  +LW A+ WAT GG  K
Sbjct  149  HTYTIMWNHHHIVFYVDEVPIRVYKNNEAKNIPYPKFQPMGVYSTLWEADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S    WW      +LN  E  +Y  VR
Sbjct  209  IDWSKAPFLAYYKDFDIEGCPVPGPAN----CASNPRNWWEGTAYQALNAMEARRYRWVR  264

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  265  MNHMIYDYCTDKSRYPVTPPEC  286



>ref|XP_010693035.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 5 [Beta vulgaris subsp. vulgaris]
Length=295

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 176/265 (66%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+     G +IQLL+D  +G+GF SK SY  G F + +K+   D+
Sbjct  30   DVPFGRNYAPTWAFDHIKYFHGGSQIQLLLDNYTGTGFQSKGSYLFGHFSMTIKLVAGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  90   AGTVTAFYLSSQTSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKT  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN +QIVF+VD  PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  FHRYSVLWNLYQIVFFVDETPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K NWS+APF A ++GF++DGC A  K+   + C ++G  WW+ K+   L+  +  +   V
Sbjct  209  KTNWSKAPFVASYKGFHIDGCEASVKA---SYCATQGKRWWDQKEFQDLDAYQYRRLRWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R++   Y+YC D  R+ T+PPEC R
Sbjct  266  RKHSTIYNYCKDKLRYRTIPPECSR  290



>ref|XP_011099425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Sesamum indicum]
Length=288

 Score =   249 bits (637),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 172/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W ++H+   D GR IQL++D+SSG GFASK  Y  G   +++K+   D+A
Sbjct  27   ATFLQDFRITWADSHIRQLDGGRAIQLVLDQSSGCGFASKYQYLFGRVSMKIKLVPGDSA  86

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTN+ A G G+REQRI LWFDPAA+F
Sbjct  87   GTVTAFYMNSDTDTIRDELDFEFLGNRSGQPYTVQTNVYAHGKGDREQRINLWFDPAAEF  146

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN   +VFYVD +PIRV+KN E  G+ +P F  + +  +LW A+ WAT GG  K
Sbjct  147  HTYSILWNHRHVVFYVDEVPIRVYKNNEARGIPFPKFQPMGVYSTLWEADDWATRGGLEK  206

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S  + WW       LN EE  +Y  VR
Sbjct  207  IDWSKAPFYAYYKDFDIEGCPVPGPAN----CASNPSNWWEGAAYQQLNPEEAKRYKWVR  262

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  263  MNHMIYDYCTDKSRYPNTPPEC  284



>ref|XP_004292365.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
2-like [Fragaria vesca subsp. vesca]
Length=263

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 178/258 (69%), Gaps = 12/258 (5%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV FD NY V +GN+H++  DQGRE+QL +D +SGSGF SK  YGSG FE+R+K+P   +
Sbjct  7    DVRFDENYVVRYGNDHISKLDQGREVQLSLDLASGSGFNSKRGYGSGFFEMRIKLPARHS  66

Query  747  AGVVTSFYLTSNTEDR---HDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDP  577
             GVVT+FYL+S+ +++   HDELDFEFLG  E    +LQTNI A   GNREQR++LWFDP
Sbjct  67   PGVVTTFYLSSHPDNKPGNHDELDFEFLGT-EGPVFSLQTNIFANDNGNREQRLHLWFDP  125

Query  576  AADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDG  397
              DFH Y ILWN  QIVF+VDNIPIRVFKN   +G RYPS   + ++GS+WN ESWA+ G
Sbjct  126  TKDFHKYGILWNHRQIVFFVDNIPIRVFKNNTRLGARYPS-QEMSVEGSIWNGESWASSG  184

Query  396  GKAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQY  217
               KI WSQAPF+A +Q F++ GC      +  ++      YWWN+K+ + L  E++  Y
Sbjct  185  --KKIEWSQAPFQAHYQEFDIYGCPFGANCSSESQL-----YWWNTKEFYELTPEQQRIY  237

Query  216  LKVRRNFMHYDYCADLPR  163
             KV + +M YDYC D  R
Sbjct  238  KKVTQKYMFYDYCHDRGR  255



>ref|XP_007047639.1| Xyloglucan endotransglycosylase [Theobroma cacao]
 gb|EOX91796.1| Xyloglucan endotransglycosylase [Theobroma cacao]
Length=289

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W ++H+   D GR IQLL+D++SG GFASK  Y  G   +++K+   D+A
Sbjct  28   ATFLEDFRITWSDSHIRQIDGGRAIQLLLDQNSGCGFASKGQYLFGRVSMKIKLIPGDSA  87

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T++  DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  88   GTVTAFYMNSDTDNVRDELDFEFLGNRSGQPYTVQTNIYAHGKGDREQRVNLWFDPAADF  147

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IV+YVD++PIRV+KN E   + YP F  + +  +LW A+ WAT GG  K
Sbjct  148  HTYTIMWNHHHIVYYVDDVPIRVYKNNEARNIPYPKFQPMGVYSTLWEADDWATRGGLEK  207

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S    WW      +L+  E  +Y  VR
Sbjct  208  IDWSKAPFLAYYKDFDIEGCPVPGPAN----CASSPRNWWEGTAYQALSAMEARRYRWVR  263

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  264  MNHMIYDYCTDKSRYPVTPPEC  285



>gb|ABB86296.1| xyloglucan endotransglucosylase hydrolase [Rosa x borboniana]
 dbj|BAH36873.1| xyloglucan endotransglucosylase/hydrolase [Rosa hybrid cultivar]
 gb|ADB55706.1| xyloglucan endotransglycosylase [Rosa chinensis]
 gb|AHZ10960.1| xyloglucan endotransglycosylase [Rosa chinensis]
Length=294

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 179/264 (68%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+A
Sbjct  31   VPFGRNYQPTWAFDHIKYYNGGNEIQLHLDKYTGTGFQSKGSYLFGHFHMQIKLVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP  ++
Sbjct  91   GTVTAFYLSS-TNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTKEY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD+IPIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYSVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ K+   L+  +  +   VR
Sbjct  210  TDWSKAPFVATYRGFHIDGCEA---SVEAKYCATQGKRWWDQKEFQDLDAYQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + F  Y+YC D  R+P+LP ECKR
Sbjct  267  QRFTIYNYCTDRTRYPSLPAECKR  290



>gb|AAC09388.1| xyloglucan endotransglycosylase precursor [Actinidia deliciosa]
Length=293

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + IVF+VD+IPIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNLYLIVFFVDDIPIRVFKNSKDLGVKFPFDQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+      L+  +  +   V
Sbjct  208  KTDWSKAPFVAAYKSFHIDGCEA---SVEAKFCATQGKRWWDQNDYRDLDAFQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+PT+PPEC+R
Sbjct  265  RSKYTIYNYCTDRTRYPTMPPECRR  289



>ref|XP_009397067.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 7 [Musa acuminata subsp. malaccensis]
Length=295

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 170/260 (65%), Gaps = 1/260 (0%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            F  ++ V W ++HV+ +  G  IQLL+D+SSG GFASK+    G   +++K+   D+AG 
Sbjct  33   FARDFHVTWADSHVSPTGGGAAIQLLLDRSSGCGFASKNKLMFGHVSMKIKLISGDSAGT  92

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT+FYL+S T+   DELDFEFLGNR  +P T+QTN+ A G G+REQR+ LWFDP+ADFH+
Sbjct  93   VTAFYLSSETDAIRDELDFEFLGNRSGQPYTVQTNVYAHGKGDREQRVNLWFDPSADFHT  152

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y ILWN H +VF+VD IPIRV+KN +  GV YP    + I  +LWN + WAT GG  KI+
Sbjct  153  YSILWNHHHVVFFVDAIPIRVYKNNQARGVAYPDAQPMGIYSTLWNGDDWATRGGLEKID  212

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVRRN  199
            W +APF+A ++ F+++   A P +  +  C +  A WW +     LN  +   Y  VR N
Sbjct  213  WGKAPFRAYYKDFDIEAACAAP-AGGLGSCATTAANWWEAPSFQQLNAAQARAYRWVRVN  271

Query  198  FMHYDYCADLPRFPTLPPEC  139
             + YDYC D  R+P  PPEC
Sbjct  272  HLVYDYCTDRTRYPVPPPEC  291



>ref|NP_001240246.1| uncharacterized protein LOC100779122 precursor [Glycine max]
 gb|ACU24262.1| unknown [Glycine max]
 gb|KHN46821.1| Putative xyloglucan endotransglucosylase/hydrolase protein B 
[Glycine soja]
Length=295

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/266 (49%), Positives = 176/266 (66%), Gaps = 4/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  31   DVPFGRNYVPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP   
Sbjct  91   AGTVTAFYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTKA  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF VDNIPIRVFKN + +GV++P    +++  SLWNA+ WAT GG  
Sbjct  150  YHRYSVLWNMYQIVFLVDNIPIRVFKNLKGLGVKFPFDQPMKVYNSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF AE++GF+VDGC A   S +   C ++G  WW+  +   L+  +      V
Sbjct  210  KTDWSKAPFIAEYKGFHVDGCEA---SVNAKFCATQGKRWWDQAQYHDLDASQWRWLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKRH  130
            RR +  Y+YC D  R+P LPPEC+R+
Sbjct  267  RRKYTIYNYCTDRSRYPQLPPECRRN  292



>ref|XP_002310324.1| xyloglucan endotransglycosylase hydrolase 2 family protein [Populus 
trichocarpa]
 gb|EEE90774.1| xyloglucan endotransglycosylase hydrolase 2 family protein [Populus 
trichocarpa]
Length=296

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 170/262 (65%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D+ SG GFASK+ Y  G   +R+K+   D+A
Sbjct  35   ATFLQDFRVTWSDSHIRQIDGGRAIQLVLDQYSGCGFASKAKYLFGRVSMRIKLIPGDSA  94

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  95   GTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIFAHGKGDREQRVNLWFDPAADF  154

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H Y I WN   IVF+VD++PIRV+KN E  G+ +P    + +  +LW A+ WAT GG  K
Sbjct  155  HLYTIFWNHQHIVFFVDDVPIRVYKNNEAKGIPFPKLQPMGVYSTLWEADDWATRGGLEK  214

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF A ++ F+++GC     +     C S    WW      +LN  E  +Y  VR
Sbjct  215  INWSKAPFYAYYKDFDIEGCPVPGPAT----CASNRGNWWEGATYQALNAMEARKYRWVR  270

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYCAD  R+PT PPEC
Sbjct  271  MNHMIYDYCADKSRYPTTPPEC  292



>ref|XP_009799936.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein [Nicotiana sylvestris]
 sp|P93349.1|XTH_TOBAC RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA13163.1| endoxyloglucan transferase related protein [Nicotiana tabacum]
Length=295

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 176/265 (66%), Gaps = 2/265 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+     G  + L++D+SSG+GF SK SY  G F +++K+ G D+
Sbjct  29   DVPFWKNYEPSWASHHIKYLSGGSTVDLVLDRSSGAGFQSKKSYLFGHFSMKLKLVGGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+SN  + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGVVTAFYLSSNNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKG  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN  QIV +VD++PIR FKN +++GV++P    ++I  SLW+A+ WAT GG  
Sbjct  148  YHSYSVLWNTFQIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS APF A +  F+VDGC A     ++  C ++G  WW+ K    L+  +  +   V
Sbjct  208  KTDWSNAPFTASYTSFHVDGCEA-ATPQEVQVCNTKGMRWWDQKAFQDLDALQYRRLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+PTLPPEC +
Sbjct  267  RQKYTIYNYCTDRKRYPTLPPECTK  291



>gb|EPS73414.1| hypothetical protein M569_01341, partial [Genlisea aurea]
Length=264

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 174/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W ++H+   D GR IQL +D++SGSGFASK+ Y  G   +R+K+   D+A
Sbjct  3    TTFLQDFRITWADSHIKQLDGGRVIQLNLDQNSGSGFASKNQYLFGKVSMRIKLIPGDSA  62

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+     DELDFEFLGNR  +P T+QTN+ A G GNREQR+ LWFDP+ADF
Sbjct  63   GTVTAFYMISSNFAVRDELDFEFLGNRSGQPYTVQTNVYANGKGNREQRVNLWFDPSADF  122

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN + +VFYVD++P+RVFKN    GV +P+   + I  +LW A+ WAT GG  K
Sbjct  123  HTYAILWNHYHVVFYVDDVPVRVFKNNLAKGVPFPTSQPMGIYSTLWEADDWATRGGLDK  182

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF   +QGF+++GC     +     C S    WW +     L  +E  +Y  VR
Sbjct  183  IDWSKAPFTTYYQGFDIEGC----PNTGPGSCPSNVGNWWETATYQQLTADELRKYRWVR  238

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N++ YDYC D PRFPT+PPEC
Sbjct  239  DNYLIYDYCTDRPRFPTIPPEC  260



>ref|NP_001291229.1| probable xyloglucan endotransglucosylase/hydrolase protein B 
precursor [Populus euphratica]
 gb|ABV44821.1| xyloglucan endotransglucosidase [Populus euphratica]
Length=293

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+     G EIQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFRGGSEIQLQLDKYTGTGFQSKGSYLFGHFSMQVKLVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTIR  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + +VF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNSYLVVFFVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW  K+   L+  +  +   V
Sbjct  208  KTDWSKAPFIASYKSFHIDGCEA---SVEAKFCATQGTRWWAQKEFQDLDALQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P+LPPECKR
Sbjct  265  RQKYTIYNYCTDRSRYPSLPPECKR  289



>ref|NP_001265913.1| probable xyloglucan endotransglucosylase/hydrolase-like precursor 
[Cicer arietinum]
 emb|CAA06217.1| xyloglucan endotransglucosylase/hydrolase [Cicer arietinum]
Length=295

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY+  W  +H+   + G EIQL +DKS+G+GF SK SY  G F + +K+   D+
Sbjct  31   DVPFGRNYYPTWAFDHIKYFNGGSEIQLHLDKSTGTGFQSKGSYLFGHFSMNIKMVPGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G GN+EQRI+LWFDP  +
Sbjct  91   AGTVTAFYLSS-TNSEHDEIDFEFLGNRTGQPYILQTNVFTGGQGNKEQRIFLWFDPTKE  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y ILWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  150  FHRYSILWNMYQIVFFVDDVPIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  210  KTDWSKAPFVAGYKSFHIDGCEA---SVNAKFCATQGKRWWDQPEFRDLDAAQWRRLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ F  Y+YC D  R P +PPEC R
Sbjct  267  RQKFTIYNYCTDRKRLPQIPPECTR  291



>ref|XP_010028049.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Eucalyptus grandis]
 gb|KCW54710.1| hypothetical protein EUGRSUZ_I00659 [Eucalyptus grandis]
Length=292

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 176/263 (67%), Gaps = 4/263 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   + G  IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  31   ATFLQDFRVTWADSHIRQINGGEAIQLILDQNSGCGFASKRQYLFGRVSMKIKLVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ SNT++  DELDFEFLGNR  +P T+QTN+ A G G+REQR+ LWFDPAADF
Sbjct  91   GTVTAFYMNSNTDNIRDELDFEFLGNRTGQPYTVQTNVYAHGKGDREQRVNLWFDPAADF  150

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H +VFYVD++PIRVFKN E   + YP++  + +  +LW A+ WAT GG  K
Sbjct  151  HTYTILWNHHHVVFYVDDVPIRVFKNNEARRLPYPTYQPMGVYSTLWEADDWATRGGLEK  210

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GCT    ++    C S    WW       L+  E  +Y  VR
Sbjct  211  IDWSKAPFYAYYKDFDIEGCTVPGPAS----CASNPRNWWEGASYQQLSAMEARRYRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECK  136
             N M YDYCAD  R+P +PPEC+
Sbjct  267  MNHMIYDYCADRSRYPMVPPECE  289



>gb|KEH22615.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=284

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 178/265 (67%), Gaps = 12/265 (5%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +VSF  NY V WG NHV   D GRE+QL  DK SG+GF SK  Y SG F +R+K+P  D+
Sbjct  29   EVSFKQNYKVTWGRNHVLFFDNGREVQLSFDKISGAGFRSKLEYSSGFFRMRIKIPTKDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
             GVVT+FY+ + +  +HDE+DFEFLGN+   P TLQTN+ A   G REQR  LWFDP  D
Sbjct  89   LGVVTAFYVRNLSYRKHDEIDFEFLGNKG-GPYTLQTNVFASDEGGREQRHSLWFDPTID  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH+Y ILWNQHQIVFYVD  PIR+FKNK N GV +PS + + +  S+WN E WA++G   
Sbjct  148  FHTYGILWNQHQIVFYVDETPIRIFKNKSNKGVSFPS-NQMHVTVSIWNGEPWASNG--K  204

Query  387  KINWSQAPFKAEFQGFNVDGCTA-DPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLK  211
            KI+W QAPF A+FQ FN+ GC + +P+  D   C+S    WWN  K W LN +++ +Y  
Sbjct  205  KIDWKQAPFLAQFQMFNIHGCQSHNPRKYD---CYS-PHLWWNGMKYWELNPQQQREYED  260

Query  210  VRRNFMHYDYCADLPRFPTLPPECK  136
            VRR  + YDYC+D  +   L  EC+
Sbjct  261  VRRIHLLYDYCSDRGQ---LHKECQ  282



>dbj|BAA34946.1| EXGT1 [Pisum sativum]
Length=293

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY+  W  +H+   + G EIQL +DKS+G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYYPTWAFDHIKYFNGGSEIQLHLDKSTGTGFQSKGSYLFGHFSMNIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GN+EQRI+LWFDP  +
Sbjct  89   AGTVTAFYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGQGNKEQRIFLWFDPTKE  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y ILWN +QIVFYVD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  FHRYSILWNMYQIVFYVDDVPIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  208  KTDWSKAPFIAGYKSFHIDGCEA---SVNAKFCATQGKRWWDQVEFRDLDAAQWRRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  F  Y+YC D  R P +PPECKR
Sbjct  265  REKFTIYNYCNDRKRLPQIPPECKR  289



>gb|ADO24304.1| putative xyloglucan endotransglucosylase/hydrolase [Gossypium 
hirsutum]
Length=290

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 171/262 (65%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ + W ++H+   D GR IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  29   ATFLEDFRITWSDSHIKQIDGGRAIQLILDQNSGCGFASKRRYLFGRVSMKIKLIPGDSA  88

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G++EQR+ LWFDPAADF
Sbjct  89   GTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDKEQRVNLWFDPAADF  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y I+WN H IVFYVD +PIRV+KN E   + YP F  + +  +LW A+ WAT GG  K
Sbjct  149  HTYTIIWNHHHIVFYVDEVPIRVYKNNEAKNIPYPKFQPMGVYSTLWEADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +N    C S    WW      +LN  E  +Y  VR
Sbjct  209  IDWSKAPFLAYYKDFDIEGCPVPGPAN----CASNPRNWWEGTAYQALNAMEARRYRWVR  264

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  265  MNHMIYDYCTDKSRYPVTPPEC  286



>ref|XP_003624548.1| Xyloglucan endotransglucosylase [Medicago truncatula]
 gb|ABD33177.1| Glycoside hydrolase, family 16; Xyloglucan endo-transglycosylase, 
C-terminal [Medicago truncatula]
 gb|ACJ85438.1| unknown [Medicago truncatula]
 gb|AES80766.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AFK47999.1| unknown [Medicago truncatula]
Length=293

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 178/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY+  W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVPFGRNYYPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G GN+EQRI+LWFDP  +
Sbjct  89   AGTVTAFYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGQGNKEQRIFLWFDPTKE  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y ILWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  FHRYSILWNMYQIVFFVDDVPIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC +   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  208  KTDWSKAPFIAGYKGFHIDGCES---SVNAKFCATQGKRWWDQPEFRDLDAAQWRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R P +PPECKR
Sbjct  265  RQKYTIYNYCTDRKRLPQVPPECKR  289



>gb|AGC54941.1| xyloglucan endotransglucosylase [Gossypium hirsutum]
Length=293

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 172/255 (67%), Gaps = 9/255 (4%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            +VSFD NY V WGN+HVTS +QG E+ L MDK+SG+GF S   Y SG F+I++K+P  D 
Sbjct  23   NVSFDKNYHVTWGNSHVTSVNQGTEVHLRMDKASGAGFESNVGYASGFFQIKIKLPNKDF  82

Query  747  AGVVTSFYLTSNTEDR---HDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDP  577
            +GVV +FYLTS+ + +   HDELDFEFLG+    P TLQTN+ A   G REQR +LWFDP
Sbjct  83   SGVVVAFYLTSDPDGKGGNHDELDFEFLGSN-GPPFTLQTNVFANDEGGREQRFHLWFDP  141

Query  576  AADFHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDG  397
             +DFH+Y I+WNQHQ+VFYVD  PIRVFKN   IGV YPS   L I+GS+WN E+WA+  
Sbjct  142  TSDFHTYGIVWNQHQVVFYVDKTPIRVFKNNTKIGVSYPS-QQLVIQGSIWNGETWAS--  198

Query  396  GKAKINWSQAPFKAEFQGFNVDGCTADPKSNDINRCF-SRGAYWWNSKKLWSLNREERVQ  220
            G  KI+WSQAPF A F GF V GC     S+  ++C+ S    WWN  K   L+  ER  
Sbjct  199  GGRKIDWSQAPFVASFVGFGVTGCQFQ-SSDSKDQCYISSPKLWWNGDKYLGLDPAERKA  257

Query  219  YLKVRRNFMHYDYCA  175
                R  +++ DYC+
Sbjct  258  LQDARTKYLYDDYCS  272



>gb|ABK25883.1| unknown [Picea sitchensis]
Length=294

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+ + + G E+QL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  30   DVPFQKNYVPTWASDHIKNINGGNEVQLSLDKWTGTGFQSKGSYLFGHFSMQIKMVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP   
Sbjct  90   AGVVTAFYLSSQNAE-HDEIDFEFLGNRSGQPYILQTNVFSGGKGDREQRIYLWFDPTKA  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN  QI+F+VD++PIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  149  YHSYSVLWNMRQIIFFVDDVPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S   + C + G  WW+ K    L+  +  +   V
Sbjct  209  KTDWSKAPFVASYKGFHVDGCEA---SMPNSACPTLGRRWWDQKAFDDLDGLQWRKLKWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P   PEC R
Sbjct  266  RNRYTIYNYCTDTVRYPARSPECTR  290



>ref|XP_009771873.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein B [Nicotiana sylvestris]
Length=299

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 176/266 (66%), Gaps = 4/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +HV   + G EIQL +D  +G+GF SK SY  G F + +K+   D+
Sbjct  26   DVPFGRNYENTWAPDHVKYFNGGSEIQLFLDNRTGTGFQSKGSYLFGHFAMHIKMVAGDS  85

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGN+  +P  +QTNI   G G++EQRIYLWFDP  D
Sbjct  86   AGTVTAFYLSSQNNE-HDEIDFEFLGNKTGEPYVVQTNIYTGGKGDKEQRIYLWFDPTKD  144

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN HQIVF+VD  PIR FKN +++GV++P    ++I  SLW A+ WAT GG  
Sbjct  145  YHTYSVLWNLHQIVFFVDEYPIRTFKNSKDLGVKFPFDQPMKIYSSLWEADDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KI+WS APF A ++GF++DGC A   S +   C ++G  WW+ K+   L++++     +V
Sbjct  205  KIDWSNAPFVASYKGFHIDGCEA---SVNAKLCANQGKKWWDQKEFQDLDKQQWRLLRRV  261

Query  207  RRNFMHYDYCADLPRFPTLPPECKRH  130
            R  +  Y+YC D  RF TLP EC+R+
Sbjct  262  RDKYTIYNYCTDKKRFATLPKECRRN  287



>ref|XP_007161789.1| hypothetical protein PHAVU_001G098200g [Phaseolus vulgaris]
 gb|ESW33783.1| hypothetical protein PHAVU_001G098200g [Phaseolus vulgaris]
Length=293

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G +IQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  29   DVDFGRNYVPTWAFDHIKYFNGGSDIQLHLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  D
Sbjct  89   AGTVTAFYLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKD  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y ILWN +QIVF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  FHRYSILWNLYQIVFFVDDVPIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  208  KTDWSKAPFIAAYKGFHIDGCEA---SVNAKFCDTQGKRWWDQPEFRDLDAAQWRRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ F  Y+YC D  R+P L PEC+R
Sbjct  265  RQKFTIYNYCTDRKRYPQLSPECRR  289



>ref|XP_003548047.1| PREDICTED: LOW QUALITY PROTEIN: xyloglucan endotransglucosylase/hydrolase 
protein A-like [Glycine max]
Length=292

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 175/265 (66%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  28   DVPFGXNYVPTWAFDHIKYLNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMYIKLVAGDS  87

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  88   AGTVTAFYLSS-TNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTRE  146

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVFYVD+ PIRVFKN  ++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  147  YHRYSVLWNMYQIVFYVDDYPIRVFKNSNDLGVKFPFNQPMKIYNSLWNADDWATRGGLE  206

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  207  KTDWSKAPFIASYKGFHIDGCEA---SVNAKFCDTQGKRWWDQPEFRDLDAAQWQKLSWV  263

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YCAD  R+P + PEC R
Sbjct  264  RQKYTIYNYCADRKRYPQVSPECAR  288



>ref|XP_002975683.1| hypothetical protein SELMODRAFT_267868 [Selaginella moellendorffii]
 gb|EFJ23312.1| hypothetical protein SELMODRAFT_267868 [Selaginella moellendorffii]
Length=286

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 171/262 (65%), Gaps = 5/262 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            F+ ++ V W  +HV +   G  +QL +D SSGSGFASK  +  G   + MK+   D+AG 
Sbjct  26   FNTDFAVTWSPDHVNTLLGGSALQLRLDNSSGSGFASKGQFLFGKISMDMKLVPGDSAGT  85

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT++YLTS      DELDFEFLGN   +P  LQTNI + GVG REQRI+LWFDP   FHS
Sbjct  86   VTAYYLTSGQTPNRDELDFEFLGNVSGEPYILQTNIYSNGVGAREQRIFLWFDPTTSFHS  145

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y +LWNQHQIVF VD IPIRVF+N E  GV +PS  ++    S+WN + WAT GG  KI+
Sbjct  146  YSVLWNQHQIVFLVDEIPIRVFRNNEAKGVAFPSKQSMGAFSSIWNGDQWATRGGVVKID  205

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFS-RGAYWWNSKKLWSLNREERVQYLKVRR  202
            WS+APF A ++ F VD C    +S  +  C +  G+ WWN ++  SLNR +R +   V++
Sbjct  206  WSKAPFVASYRNFAVDAC----ESGKVEACSAMAGSAWWNQERYRSLNRNQRHRLKWVQK  261

Query  201  NFMHYDYCADLPRFPTLPPECK  136
            N+M Y+YC D  R+PT P ECK
Sbjct  262  NYMVYNYCIDTSRYPTPPAECK  283



>sp|Q8LNZ5.1|XTHB_PHAAN RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein B; AltName: Full=VaXTH2; Flags: Precursor [Vigna 
angularis]
 dbj|BAC03238.1| xyloglucan endotransglucosylase/hydrolase [Vigna angularis]
Length=293

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 175/266 (66%), Gaps = 4/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF +K SY  G F + +K+   D+
Sbjct  29   DVPFGRNYIPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQTKGSYLFGHFSMNIKMVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+F L+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGTVTAFCLSSQNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKA  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVF VDNIPIRVFKN + +GV++P    +++  SLWNA+ WAT GG  
Sbjct  148  YHRYSVLWNMYQIVFLVDNIPIRVFKNLKELGVKFPFNQPMKVYNSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF AE++GF+VDGC A   S     C ++G  WW+  +   L+  +  +   V
Sbjct  208  KTDWSKAPFVAEYKGFHVDGCEASVNS---RFCATQGKRWWDQTEFRDLDSFQWRRLKWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKRH  130
            R+ F  Y+YC D  R+P LPPEC+R+
Sbjct  265  RQKFTIYNYCTDRTRYPQLPPECRRN  290



>ref|XP_008360204.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
A-like [Malus domestica]
 gb|ACD03225.1| xyloglucan endotransglucosylase/hydrolase 1 [Malus domestica]
Length=294

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 181/264 (69%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK +Y  G F +++K+   D+A
Sbjct  31   VPFGRNYMPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSA  90

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP A +
Sbjct  91   GTVTAFYLSSQNNE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAY  149

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF VD++PIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  150  HSYAVLWNLYQIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  209

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++GF++DGC A   S +   C ++G  WW+ ++   L+ ++  +   VR
Sbjct  210  TDWSKAPFIATYRGFHIDGCEA---SVNAKFCDTQGKRWWDQREYQDLDAQQWRRLRWVR  266

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + +  Y+YC D  R+PT+PPEC+R
Sbjct  267  QKYTIYNYCTDRARYPTMPPECQR  290



>ref|XP_002993509.1| hypothetical protein SELMODRAFT_431582 [Selaginella moellendorffii]
 gb|EFJ05401.1| hypothetical protein SELMODRAFT_431582 [Selaginella moellendorffii]
Length=286

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 170/262 (65%), Gaps = 5/262 (2%)
 Frame = -2

Query  918  FDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTAGV  739
            F+ ++ V W  +HV +   G  +QL +D SSGSGFASK  +  G   + MK+   D+AG 
Sbjct  26   FNTDFAVTWSPDHVNTLLGGSALQLRLDNSSGSGFASKGQFLFGKISMDMKLVPGDSAGT  85

Query  738  VTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADFHS  559
            VT++YLTS      DELDFEFLGN   +P  LQTNI + GVG REQRI+LWFDP   FHS
Sbjct  86   VTAYYLTSGQTPNRDELDFEFLGNVSGEPYILQTNIYSNGVGAREQRIFLWFDPTTSFHS  145

Query  558  YKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAKIN  379
            Y +LWNQHQIVF VD IPIRVF+N E  GV +PS  ++    S+WN + WAT GG  KI+
Sbjct  146  YSVLWNQHQIVFLVDEIPIRVFRNNEAKGVAFPSKQSMGAFSSIWNGDQWATRGGVVKID  205

Query  378  WSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRG-AYWWNSKKLWSLNREERVQYLKVRR  202
            WS+APF A ++ F VD C    +S  +  C +   + WWN ++  SLNR +R +   V++
Sbjct  206  WSKAPFVASYRNFAVDAC----ESGKVEACSAMASSAWWNEERYRSLNRNQRHRLKWVQK  261

Query  201  NFMHYDYCADLPRFPTLPPECK  136
            N+M YDYC D  R+PT P ECK
Sbjct  262  NYMVYDYCIDTSRYPTPPAECK  283



>gb|ABM91069.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-27 [Populus 
trichocarpa]
Length=293

 Score =   247 bits (631),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +D  +G+GF SK SY  G F ++MK+   D+
Sbjct  29   DVPFGRNYVPTWAFDHIKYFNGGSEIQLQLDNYTGTGFQSKGSYLFGHFSMQMKLVPGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTIR  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN + +VF+VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  148  YHSYSVLWNSYLVVFFVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  208  KTDWSKAPFIASYKSFHIDGCEA---SVEAKFCATQGTRWWDQKEFQDLDALQYRRLRWV  264

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+ +LPPECKR
Sbjct  265  RQKYTIYNYCTDRSRYASLPPECKR  289



>gb|ABM91067.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-36 [Populus 
tremula x Populus tremuloides]
Length=294

 Score =   247 bits (631),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 169/262 (65%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D+ +G GFASK+ Y  G   +R+K+   D+A
Sbjct  33   ATFLQDFRVTWSDSHIKQIDGGRAIQLVLDQYAGCGFASKAKYLFGRVSMRIKLIPGDSA  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  93   GTVTAFYMNSDTDAVRDELDFEFLGNRTGQPYTVQTNIFAHGKGDREQRVNLWFDPAADF  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H Y I WN   IVFYVD++PIRV+KN E  G+ +P    + +  +LW A+ WAT GG  K
Sbjct  153  HLYTIFWNHQHIVFYVDDVPIRVYKNHEAKGIPFPKLQPMGVYSTLWEADDWATRGGLEK  212

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            I+WS+APF A ++ F+++GC     +     C S    WW      +LN  E  +Y  VR
Sbjct  213  IDWSKAPFYAYYKDFDIEGCPVPGPAT----CASNRGNWWEGATYQALNAMEARKYRWVR  268

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+PT PPEC
Sbjct  269  MNHMIYDYCTDKSRYPTTPPEC  290



>gb|KDP23230.1| hypothetical protein JCGZ_23063 [Jatropha curcas]
Length=293

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 178/264 (67%), Gaps = 4/264 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
            V F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F +++K+   D+A
Sbjct  30   VPFGRNYVPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSA  89

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  ++
Sbjct  90   GTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEY  148

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            HSY +LWN +QIVF+VDN+PIRVFKN +++GV++P    +++  SLWNA+ WAT GG  K
Sbjct  149  HSYSVLWNLYQIVFFVDNVPIRVFKNCKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEK  208

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
             +WS+APF A ++ F++DGC A   S +   C ++G  WW+ K+   L+  +  +   VR
Sbjct  209  TDWSKAPFIASYREFHIDGCEA---SVEAKFCATQGKRWWDQKEFQDLDGFQYRRLRWVR  265

Query  204  RNFMHYDYCADLPRFPTLPPECKR  133
            + +  Y+YC D  R+P LP ECKR
Sbjct  266  QKYTIYNYCTDRSRYPVLPAECKR  289



>gb|AIS86132.1| xyloglucan endo-transglycosylase [Populus tomentosa]
Length=290

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 179/265 (68%), Gaps = 8/265 (3%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV+F  NY   W  +H+   + G EIQLL+DK +G+GF SK SY  G F ++MK+   D+
Sbjct  30   DVAFGRNYVPTWAFDHIKYFNGGNEIQLLLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  90   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKE  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            FH Y +LWN    +F VD++PIRVFKN +++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  149  FHHYSVLWN----MFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLE  204

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F++DGC A   S +   C ++GA WW+ K+   L+  +  +   V
Sbjct  205  KTDWSKAPFIASYRSFHIDGCEA---SVEAKFCATQGARWWDQKEFQDLDAFQYRRLSWV  261

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+P++PPECKR
Sbjct  262  RQKYTIYNYCTDRSRYPSMPPECKR  286



>ref|XP_004250701.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
A-like [Solanum lycopersicum]
Length=300

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 176/266 (66%), Gaps = 4/266 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +D  +G+GF SK SY  G F + +K+   D+
Sbjct  28   DVPFGRNYEPSWAFDHIKYLNGGSEIQLSLDNRTGTGFQSKGSYLFGHFSMHIKMVAGDS  87

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGN+  +P  LQTN+   G G++EQRIYLWFDP  D
Sbjct  88   AGTVTAFYLSSQNSE-HDEIDFEFLGNKTGEPYILQTNVYTGGKGDKEQRIYLWFDPTKD  146

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H+Y +LWN HQIVF+VD  PIRVFKN +N+GV++P   +++I  SLW A+ WAT GG  
Sbjct  147  YHTYSVLWNLHQIVFFVDEYPIRVFKNNKNLGVKFPFDQSMKIYSSLWEADDWATRGGLE  206

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            KI+WS APF A ++GF++DGC +   S +   C ++G  WW+ K+   L++ +     +V
Sbjct  207  KIDWSNAPFVASYKGFHIDGCES---SVNAKFCANQGKSWWDQKEFQDLDKTQWRLLRRV  263

Query  207  RRNFMHYDYCADLPRFPTLPPECKRH  130
            R  +  Y+YC D  RF T P ECKR+
Sbjct  264  RDKYTIYNYCTDKKRFSTTPIECKRN  289



>gb|KHN13413.1| Xyloglucan endotransglucosylase/hydrolase protein A [Glycine 
soja]
Length=292

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 175/265 (66%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DK +G+GF SK SY  G F + +K+   D+
Sbjct  28   DVPFGRNYVPTWAFDHIKYLNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMYIKLVAGDS  87

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S T   HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP  +
Sbjct  88   AGTVTAFYLSS-TNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTRE  146

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +H Y +LWN +QIVFYVD+ PIRVFKN  ++GV++P    ++I  SLWNA+ WAT GG  
Sbjct  147  YHRYSVLWNMYQIVFYVDDYPIRVFKNSNDLGVKFPFNQPMKIYNSLWNADDWATRGGLE  206

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF++DGC A   S +   C ++G  WW+  +   L+  +  +   V
Sbjct  207  KTDWSKAPFIASYKGFHIDGCEA---SVNAKFCDTQGKRWWDQPEFRDLDAAQWQKLSWV  263

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YCAD  R+P + PEC R
Sbjct  264  RQKYTIYNYCADRKRYPQVSPECAR  288



>ref|XP_009611317.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein [Nicotiana tomentosiformis]
 dbj|BAA32518.1| endo-xyloglucan transferase (EXGT) [Nicotiana tabacum]
Length=295

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 176/265 (66%), Gaps = 2/265 (1%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W ++H+   + G    L++D+SSG+GF SK SY  G F +++++ G D+
Sbjct  29   DVPFWKNYEPSWASHHIKYLNGGSTADLVLDRSSGAGFQSKKSYLFGHFSMKLRLVGGDS  88

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+SN  + HDE+DFEFLGNR  +P  LQTN+   G G+REQRIYLWFDP   
Sbjct  89   AGVVTAFYLSSNNAE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKG  147

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN  QIV +VD++PIR FKN +++GV++P    ++I  SLW+A+ WAT GG  
Sbjct  148  YHSYSVLWNTFQIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLE  207

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS APF A +  F+VDGC A     ++  C ++G  WW+ K    L+  +  +   V
Sbjct  208  KTDWSNAPFTASYTSFHVDGCEA-ATPQEVQVCNTKGMRWWDQKAFQDLDALQYRRLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R+ +  Y+YC D  R+PTLPPEC +
Sbjct  267  RQKYTIYNYCTDRKRYPTLPPECTK  291



>gb|AEQ37176.1| xyloglucan endotransglucosylase/hydrolase [Diospyros kaki]
Length=295

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G +IQL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  31   DVPFGRNYVPTWAFDHIKYFNGGSQIQLSLDKYTGTGFQSKGSYLFGHFSMQIKMVPGDS  90

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G+REQRI+LWFDP  +
Sbjct  91   AGTVTAFYLSSQNSE-HDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTKE  149

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN   I+F+VD++PIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  150  YHSYSVLWNLFLIIFFVDDVPIRVFKNSKDLGVRFPFDQPMKIYSSLWNADDWATRGGLE  209

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++ F+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  210  KTDWSKAPFVASYRSFHVDGCEA---SVNAKFCDTQGKRWWDQKEFQDLDSFQYRRLRWV  266

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P +PPECKR
Sbjct  267  RSKYTIYNYCTDRKRYPVMPPECKR  291



>gb|ABK22907.1| unknown [Picea sitchensis]
Length=294

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 176/265 (66%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+ + + G E+QL +DK +G+GF SK SY  G F +++K+   D+
Sbjct  30   DVPFQKNYVPTWAFDHIKNINGGNEVQLSLDKWTGTGFQSKGSYLFGHFSMQIKMVPGDS  89

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AGVVT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+ + G G+REQRIYLWFDP   
Sbjct  90   AGVVTAFYLSSQNAE-HDEIDFEFLGNRSGQPYILQTNVFSGGKGDREQRIYLWFDPTKA  148

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
            +HSY +LWN  QI+F+VD++PIRVFKN +++GVRYP    ++I  SLWNA+ WAT GG  
Sbjct  149  YHSYSVLWNMRQIIFFVDDVPIRVFKNSKDLGVRYPFNQPMKIYSSLWNADDWATRGGLE  208

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S   + C + G  WW+ K    L+  +  +   V
Sbjct  209  KTDWSKAPFVASYKGFHVDGCEA---SMPNSACPTLGRRWWDQKAFDDLDGLQWRKLKWV  265

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P   PEC R
Sbjct  266  RNRYTIYNYCTDTVRYPARSPECTR  290



>ref|XP_009338970.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 6 [Pyrus x bretschneideri]
Length=294

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -2

Query  924  VSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDTA  745
             +F  ++ V W ++H+   D GR IQL++D++SG GFASK  Y  G   +++K+   D+A
Sbjct  33   ATFLQDFRVTWSDSHIRQIDGGRAIQLVLDQNSGCGFASKQKYLFGRVSMKIKLIPGDSA  92

Query  744  GVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAADF  565
            G VT+FY+ S+T+   DELDFEFLGNR  +P T+QTNI A G G+REQR+ LWFDPAADF
Sbjct  93   GTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNIYAHGKGDREQRVNLWFDPAADF  152

Query  564  HSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKAK  385
            H+Y ILWN H IVFYVD++PIRV+KN E  GV YP    + +  +LW A+ WAT GG  K
Sbjct  153  HTYTILWNHHHIVFYVDDMPIRVYKNNEARGVPYPKLQPMGVFSTLWEADDWATRGGLEK  212

Query  384  INWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKVR  205
            INWS+APF + ++ F+++GC+    ++    C S    WW      +L+  +  +Y  VR
Sbjct  213  INWSKAPFYSYYKDFDIEGCSVPGPAS----CASSTNNWWEGASYQALSALDYRRYRWVR  268

Query  204  RNFMHYDYCADLPRFPTLPPEC  139
             N M YDYC D  R+P  PPEC
Sbjct  269  INHMIYDYCTDRSRYPVAPPEC  290



>gb|EPS65701.1| xyloglucan endotransglycosylase, partial [Genlisea aurea]
Length=288

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 177/265 (67%), Gaps = 4/265 (2%)
 Frame = -2

Query  927  DVSFDANYFVDWGNNHVTSSDQGREIQLLMDKssgsgfaskssygsGCFEIRMKVPGHDT  748
            DV F  NY   W  +H+   + G EIQL +DKS+G+GF SK SY  G F + +K+   D+
Sbjct  24   DVPFGRNYIPTWAFDHIKYLNGGDEIQLSLDKSTGTGFQSKGSYLFGHFSMHIKLVPGDS  83

Query  747  AGVVTSFYLTSNTEDRHDELDFEFLGNRERKPVTLQTNIMAEGVGNREQRIYLWFDPAAD  568
            AG VT+FYL+S   + HDE+DFEFLGNR  +P  LQTN+   G G++EQRIYLWFDP  +
Sbjct  84   AGTVTAFYLSSQNSE-HDEIDFEFLGNRSGQPYILQTNVYTGGKGDKEQRIYLWFDPTRE  142

Query  567  FHSYKILWNQHQIVFYVDNIPIRVFKNKENIGVRYPSFHALQIKGSLWNAESWATDGGKA  388
             H+Y +LWN +QI+F+VD +PIRVFKN +++GVR+P    ++I  SLWNA+ WAT GG  
Sbjct  143  HHTYSVLWNLYQIIFFVDEVPIRVFKNSKDLGVRFPFNQPMKIYSSLWNADDWATRGGLE  202

Query  387  KINWSQAPFKAEFQGFNVDGCTADPKSNDINRCFSRGAYWWNSKKLWSLNREERVQYLKV  208
            K +WS+APF A ++GF+VDGC A   S +   C ++G  WW+ K+   L+  +  +   V
Sbjct  203  KTDWSKAPFMASYRGFHVDGCEA---SVEARFCNTQGKRWWDQKEFQDLDSYQWRRLQWV  259

Query  207  RRNFMHYDYCADLPRFPTLPPECKR  133
            R  +  Y+YC D  R+P +P ECKR
Sbjct  260  RSKYTIYNYCTDRARYPVVPVECKR  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2424532346784