BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31252_g1_i1 len=820 path=[798:0-819]

Length=820
                                                                      Score     E

ref|XP_009788195.1|  PREDICTED: basic form of pathogenesis-relate...    223   5e-69   
ref|XP_009605695.1|  PREDICTED: basic form of pathogenesis-relate...    223   5e-69   
sp|P11670.1|PRB1_TOBAC  RecName: Full=Basic form of pathogenesis-...    220   7e-68   Nicotiana tabacum [American tobacco]
gb|AGS80328.1|  pathogenesis-related protein 1                          219   8e-68   
ref|XP_006367091.1|  PREDICTED: basic form of pathogenesis-relate...    216   3e-66   
ref|NP_001234358.1|  PR1 protein precursor                              213   3e-65   
emb|CAA47374.1|  prb-1b                                                 212   7e-65   Nicotiana tabacum [American tobacco]
ref|XP_009605696.1|  PREDICTED: basic form of pathogenesis-relate...    212   8e-65   
ref|XP_009787159.1|  PREDICTED: basic form of pathogenesis-relate...    211   3e-64   
gb|AAK30143.1|AF348141_1  pathogenesis-related protein PR-1 precu...    210   4e-64   Capsicum annuum
ref|XP_002273788.2|  PREDICTED: pathogenesis-related protein 1          209   2e-63   Vitis vinifera
emb|CAN77102.1|  hypothetical protein VITISV_021166                     207   5e-63   Vitis vinifera
ref|XP_006367093.1|  PREDICTED: basic form of pathogenesis-relate...    207   5e-63   
dbj|BAF95881.1|  putative pathogenesis-related protein 1                206   8e-63   Vitis hybrid cultivar
ref|XP_006367092.1|  PREDICTED: basic form of pathogenesis-relate...    206   1e-62   
gb|AEM36335.1|  pathogenesis-related protein                            204   4e-62   
gb|ADN43416.1|  pathogenesis-related protein 1                          204   5e-62   
ref|XP_006367104.1|  PREDICTED: basic form of pathogenesis-relate...    204   8e-62   
gb|ADN43419.1|  pathogenesis-related protein 1                          204   8e-62   
gb|ADN43439.1|  pathogenesis-related protein 1                          203   1e-61   
gb|ADN43436.1|  pathogenesis-related protein 1                          203   1e-61   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...    203   1e-61   Vitis vinifera
gb|ADN43415.1|  pathogenesis-related protein 1                          203   2e-61   
ref|XP_002274307.1|  PREDICTED: pathogenesis-related leaf protein 6     203   2e-61   Vitis vinifera
gb|ADN43435.1|  pathogenesis-related protein 1                          202   2e-61   
gb|ADN43418.1|  pathogenesis-related protein 1                          202   2e-61   
ref|XP_006367095.1|  PREDICTED: basic form of pathogenesis-relate...    203   2e-61   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...    202   3e-61   
ref|XP_002273416.1|  PREDICTED: basic form of pathogenesis-relate...    202   4e-61   Vitis vinifera
gb|ADN43427.1|  pathogenesis-related protein 1                          201   5e-61   
gb|ADN43434.1|  pathogenesis-related protein 1                          201   6e-61   
gb|ADN43438.1|  pathogenesis-related protein 1                          201   9e-61   
gb|ADN43428.1|  pathogenesis-related protein 1                          201   1e-60   
gb|ADN43417.1|  pathogenesis-related protein 1                          201   1e-60   
gb|ADN43437.1|  pathogenesis-related protein 1                          200   3e-60   
ref|XP_006367102.1|  PREDICTED: basic form of pathogenesis-relate...    200   3e-60   
gb|ADN43432.1|  pathogenesis-related protein 1                          199   8e-60   
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6     199   9e-60   Vitis vinifera
gb|ADB54823.1|  pathogenesis-related protein 1                          198   1e-59   Vitis pseudoreticulata
gb|ADN43433.1|  pathogenesis-related protein 1                          198   1e-59   
gb|ADN43431.1|  pathogenesis-related protein 1                          197   2e-59   
dbj|BAB78476.1|  PR-1                                                   197   2e-59   Solanum torvum [berenjena cimarrona]
ref|XP_002273546.1|  PREDICTED: basic form of pathogenesis-relate...    197   3e-59   Vitis vinifera
ref|XP_010042397.1|  PREDICTED: basic form of pathogenesis-relate...    197   4e-59   
emb|CAD60273.1|  putative pathogenesis related protein 1 precursor      196   6e-59   Vitis vinifera
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...    196   7e-59   
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...    196   1e-58   
ref|XP_002274275.1|  PREDICTED: basic form of pathogenesis-relate...    195   2e-58   Vitis vinifera
ref|XP_006369711.1|  Pathogenesis-related family protein                195   2e-58   
ref|XP_006367089.1|  PREDICTED: pathogenesis-related protein 1A1-...    196   2e-58   
gb|ADN43429.1|  pathogenesis-related protein 1                          194   3e-58   
ref|XP_011030266.1|  PREDICTED: basic form of pathogenesis-relate...    194   4e-58   
gb|ADN43443.1|  pathogenesis-related protein 1                          194   4e-58   
ref|XP_010068342.1|  PREDICTED: basic form of pathogenesis-relate...    194   5e-58   
gb|ADP69172.1|  pathogenesis related protein-1                          194   5e-58   
ref|XP_003545770.1|  PREDICTED: basic form of pathogenesis-relate...    194   8e-58   
ref|XP_010052998.1|  PREDICTED: basic form of pathogenesis-relate...    193   1e-57   
gb|ADN43441.1|  pathogenesis-related protein 1                          193   2e-57   
emb|CAD38276.1|  pathogenesis related protein isoform b1                192   2e-57   Solanum phureja [chaucha]
ref|XP_002522070.1|  STS14 protein precursor, putative                  192   2e-57   Ricinus communis
gb|AES63607.2|  CAP, cysteine-rich secretory protein, antigen 5         192   4e-57   
ref|XP_011016555.1|  PREDICTED: basic form of pathogenesis-relate...    192   4e-57   
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like    192   4e-57   
ref|XP_011002613.1|  PREDICTED: basic form of pathogenesis-relate...    191   5e-57   
ref|XP_003593356.1|  Pathogenesis-related protein                       191   5e-57   
gb|ADB54822.1|  pathogenesis-related protein 1                          192   6e-57   Vitis pseudoreticulata
ref|NP_001275095.1|  pathogenesis-related protein 1b precursor          191   6e-57   
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg             191   7e-57   
gb|ADN43430.1|  pathogenesis-related protein 1                          191   8e-57   
ref|XP_011030276.1|  PREDICTED: basic form of pathogenesis-relate...    191   8e-57   
emb|CAB58263.1|  pathogenesis related protein PR-1                      191   9e-57   Solanum tuberosum [potatoes]
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...    191   1e-56   Vitis vinifera
gb|AAQ19681.1|  cytoplasmic small heat shock protein class I            191   1e-56   Capsicum frutescens [bird pepper]
ref|XP_007201285.1|  hypothetical protein PRUPE_ppa012617mg             190   1e-56   
gb|ADN43442.1|  pathogenesis-related protein 1                          190   2e-56   
ref|XP_010065853.1|  PREDICTED: basic form of pathogenesis-relate...    190   2e-56   
ref|XP_010054707.1|  PREDICTED: basic form of pathogenesis-relate...    190   2e-56   
gb|ADN43440.1|  pathogenesis-related protein 1                          190   2e-56   
gb|AAX20041.1|  cytoplasmic small heat shock protein class I            189   3e-56   Capsicum annuum
ref|XP_011092471.1|  PREDICTED: basic form of pathogenesis-relate...    189   4e-56   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g             189   4e-56   
ref|NP_001234523.1|  pathogenesis-related leaf protein 4 precursor      189   6e-56   
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...    188   7e-56   
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg             188   8e-56   
gb|KDP35893.1|  hypothetical protein JCGZ_09865                         188   9e-56   
ref|XP_010095625.1|  hypothetical protein L484_003726                   188   1e-55   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...    188   1e-55   
emb|CAN68901.1|  hypothetical protein VITISV_019988                     187   1e-55   Vitis vinifera
gb|AFK38989.1|  unknown                                                 187   1e-55   
ref|XP_010053002.1|  PREDICTED: basic form of pathogenesis-relate...    187   1e-55   
ref|XP_003545772.1|  PREDICTED: basic form of pathogenesis-relate...    187   2e-55   
ref|XP_006369712.1|  hypothetical protein POPTR_0001s29540g             189   2e-55   
ref|XP_011030277.1|  PREDICTED: pathogenesis-related protein 1-like     187   2e-55   
dbj|BAD11072.1|  pathogenesis-related protein 1                         187   2e-55   Capsicum chinense [bonnet pepper]
ref|NP_001234314.1|  pathogenesis-related leaf protein 6 precursor      187   2e-55   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...    187   2e-55   
gb|KCW56841.1|  hypothetical protein EUGRSUZ_I02509                     187   2e-55   
ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...    187   3e-55   
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...    187   3e-55   
ref|XP_007148301.1|  hypothetical protein PHAVU_006G196900g             187   3e-55   
ref|XP_010065847.1|  PREDICTED: basic form of pathogenesis-relate...    186   5e-55   
ref|XP_010029887.1|  PREDICTED: pathogenesis-related protein PR-1...    187   5e-55   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...    186   6e-55   
gb|AAB06458.1|  pathogenesis-related protein PR1                        186   7e-55   Brassica napus [oilseed rape]
emb|CDO97323.1|  unnamed protein product                                186   7e-55   
ref|XP_002522062.1|  Protein PRY2 precursor, putative                   186   7e-55   Ricinus communis
ref|XP_007041425.1|  Pathogenesis-related protein 1                     186   8e-55   
ref|XP_002313932.2|  pathogenesis-related family protein                186   8e-55   Populus trichocarpa [western balsam poplar]
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like     185   9e-55   
ref|XP_011091978.1|  PREDICTED: basic form of pathogenesis-relate...    186   1e-54   
ref|XP_010052994.1|  PREDICTED: basic form of pathogenesis-relate...    186   1e-54   
gb|AGK89727.1|  pathogenesis-related 1 protein                          186   1e-54   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1                186   1e-54   
emb|CAD38277.1|  pathogenesis related protein isoform b2                185   1e-54   Solanum phureja [chaucha]
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...    185   1e-54   
ref|XP_003631695.1|  PREDICTED: basic form of pathogenesis-relate...    186   1e-54   
gb|AHA56682.1|  pathogenesis related protein                            185   2e-54   
ref|XP_010943437.1|  PREDICTED: pathogenesis-related protein 1B-like    186   2e-54   
ref|XP_003608310.1|  F-box/FBD/LRR-repeat protein                       199   2e-54   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...    184   2e-54   
emb|CDO97325.1|  unnamed protein product                                184   3e-54   
ref|XP_010054710.1|  PREDICTED: pathogenesis-related leaf protein...    186   3e-54   
emb|CBI25093.3|  unnamed protein product                                184   3e-54   
ref|XP_010252392.1|  PREDICTED: basic form of pathogenesis-relate...    184   4e-54   
ref|XP_010068331.1|  PREDICTED: protein PRY2-like                       192   5e-54   
ref|XP_010041202.1|  PREDICTED: basic form of pathogenesis-relate...    184   5e-54   
ref|XP_010065837.1|  PREDICTED: pathogenesis-related protein 1A-like    184   5e-54   
ref|XP_004246723.1|  PREDICTED: pathogenesis-related leaf protein...    183   6e-54   
ref|XP_009136247.1|  PREDICTED: pathogenesis-related protein 1-like     183   8e-54   
ref|XP_002300292.2|  Pathogenesis-related family protein                183   9e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006422718.1|  hypothetical protein CICLE_v10029873mg             183   1e-53   
ref|XP_007148304.1|  hypothetical protein PHAVU_006G197200g             182   1e-53   
gb|KDP35900.1|  hypothetical protein JCGZ_09872                         182   1e-53   
ref|XP_010052995.1|  PREDICTED: basic form of pathogenesis-relate...    182   1e-53   
ref|XP_006298709.1|  hypothetical protein CARUB_v10014803mg             182   2e-53   
ref|XP_004246724.1|  PREDICTED: pathogenesis-related leaf protein 4     182   2e-53   
ref|XP_010095627.1|  hypothetical protein L484_003728                   182   2e-53   
ref|XP_006486832.1|  PREDICTED: pathogenesis-related protein PR-1...    182   2e-53   
ref|XP_007148307.1|  hypothetical protein PHAVU_006G197500g             182   2e-53   
ref|XP_007041422.1|  Pathogenesis-related protein 1                     182   2e-53   
ref|XP_008236237.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    182   3e-53   
ref|XP_010467244.1|  PREDICTED: pathogenesis-related protein 1-like     181   4e-53   
ref|XP_010488898.1|  PREDICTED: pathogenesis-related protein 1-like     181   4e-53   
ref|XP_002270128.1|  PREDICTED: pathogenesis-related leaf protein 4     181   5e-53   Vitis vinifera
ref|XP_010052992.1|  PREDICTED: basic form of pathogenesis-relate...    181   5e-53   
gb|KCW63528.1|  hypothetical protein EUGRSUZ_G01163                     181   5e-53   
ref|XP_003545771.1|  PREDICTED: pathogenesis-related protein PR-1...    181   5e-53   
gb|AAN37409.1|  pathogenesis-related protein 1                          181   7e-53   Brassica juncea [brown mustard]
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...    180   9e-53   
ref|XP_006345692.1|  PREDICTED: pathogenesis-related leaf protein...    180   1e-52   
gb|KCW63526.1|  hypothetical protein EUGRSUZ_G01161                     180   1e-52   
ref|XP_007201612.1|  hypothetical protein PRUPE_ppa019807mg             180   1e-52   
ref|NP_179064.1|  pathogenesis-related protein 1                        180   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006486821.1|  PREDICTED: basic form of pathogenesis-relate...    180   1e-52   
gb|KCW77213.1|  hypothetical protein EUGRSUZ_D01567                     179   1e-52   
gb|KCW77204.1|  hypothetical protein EUGRSUZ_D01555                     179   1e-52   
gb|KCW63548.1|  hypothetical protein EUGRSUZ_G01181                     179   1e-52   
ref|XP_010065841.1|  PREDICTED: basic form of pathogenesis-relate...    180   2e-52   
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...    180   2e-52   
ref|XP_011002583.1|  PREDICTED: pathogenesis-related leaf protein...    180   2e-52   
gb|ACU15426.1|  unknown                                                 180   2e-52   Glycine max [soybeans]
ref|NP_001234128.1|  pathogenesis-related protein 1A1 precursor         180   2e-52   
ref|XP_004485656.1|  PREDICTED: pathogenesis-related protein 1B-like    179   2e-52   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B         180   2e-52   
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...    179   2e-52   
emb|CAA29022.1|  PR-1b protein                                          179   3e-52   Nicotiana tabacum [American tobacco]
gb|KCW63507.1|  hypothetical protein EUGRSUZ_G01138                     179   3e-52   
ref|XP_004487816.1|  PREDICTED: pathogenesis-related protein 1-like     181   3e-52   
emb|CDO97326.1|  unnamed protein product                                179   3e-52   
ref|XP_006422713.1|  hypothetical protein CICLE_v10029459mg             179   3e-52   
gb|KDP36353.1|  hypothetical protein JCGZ_09850                         180   3e-52   
gb|KGN48339.1|  hypothetical protein Csa_6G483242                       179   4e-52   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                         178   4e-52   
gb|KCW63511.1|  hypothetical protein EUGRSUZ_G01142                     178   4e-52   
ref|XP_010478439.1|  PREDICTED: pathogenesis-related leaf protein...    179   4e-52   
gb|AFJ93090.1|  pathogenesis-related protein 1                          179   5e-52   
ref|XP_010461858.1|  PREDICTED: pathogenesis-related leaf protein...    178   6e-52   
ref|XP_006379156.1|  pathogenesis-related family protein                178   6e-52   
ref|XP_003593357.1|  Pathogenesis-related protein 1a                    184   6e-52   
gb|KCW44547.1|  hypothetical protein EUGRSUZ_L01945                     179   6e-52   
ref|XP_010517582.1|  PREDICTED: pathogenesis-related protein 1-like     178   7e-52   
ref|XP_010500562.1|  PREDICTED: pathogenesis-related leaf protein...    178   7e-52   
ref|XP_003543105.1|  PREDICTED: basic form of pathogenesis-relate...    179   8e-52   
ref|XP_010065845.1|  PREDICTED: basic form of pathogenesis-relate...    178   8e-52   
ref|XP_002273355.1|  PREDICTED: basic form of pathogenesis-relate...    178   8e-52   Vitis vinifera
gb|AAT46023.1|  pathogenesis-related protein 1                          178   1e-51   Brassica rapa
gb|AFR90191.1|  pathogenesis-related protein 1a                         178   1e-51   
gb|ABK94784.1|  unknown                                                 177   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010088981.1|  hypothetical protein L484_013561                   177   2e-51   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like    178   2e-51   
ref|XP_004486257.1|  PREDICTED: basic form of pathogenesis-relate...    177   2e-51   
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...    177   2e-51   
ref|XP_006409652.1|  hypothetical protein EUTSA_v10022888mg             177   2e-51   
ref|XP_010488897.1|  PREDICTED: pathogenesis-related protein 1-like     177   2e-51   
emb|CDX89632.1|  BnaC03g45460D                                          177   2e-51   
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4                177   2e-51   
gb|AHW81904.1|  pathogenesis-related protein                            177   3e-51   
ref|XP_002522071.1|  STS14 protein precursor, putative                  177   3e-51   Ricinus communis
gb|KDP37611.1|  hypothetical protein JCGZ_06954                         177   3e-51   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg             177   3e-51   
ref|XP_009335379.1|  PREDICTED: LOW QUALITY PROTEIN: basic form o...    176   3e-51   
ref|XP_008455065.1|  PREDICTED: pathogenesis-related leaf protein...    177   3e-51   
ref|XP_009335372.1|  PREDICTED: pathogenesis-related leaf protein...    177   3e-51   
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like     177   3e-51   
ref|NP_001237253.1|  uncharacterized protein LOC100527778 precursor     176   3e-51   
ref|XP_010088980.1|  hypothetical protein L484_013560                   177   3e-51   
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310          176   4e-51   
gb|KHN33603.1|  Basic form of pathogenesis-related protein 1            176   4e-51   
emb|CAA36790.1|  unnamed protein product                                177   5e-51   Nicotiana tabacum [American tobacco]
ref|XP_010040969.1|  PREDICTED: pathogenesis-related protein 1-like     176   5e-51   
gb|KDP37604.1|  hypothetical protein JCGZ_06947                         176   5e-51   
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like     176   5e-51   
emb|CDX93140.1|  BnaA03g38620D                                          176   5e-51   
gb|ABA41593.1|  pathogenesis-related protein                            175   6e-51   Solanum lycopersicum
gb|KDP37606.1|  hypothetical protein JCGZ_06949                         176   7e-51   
gb|KHN19054.1|  Basic form of pathogenesis-related protein 1            176   9e-51   
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like     175   9e-51   
gb|KFK39965.1|  hypothetical protein AALP_AA3G312200                    175   9e-51   
ref|XP_010467241.1|  PREDICTED: pathogenesis-related protein 1-like     175   1e-50   
ref|XP_009136246.1|  PREDICTED: pathogenesis-related protein 1-like     175   2e-50   
ref|XP_003545775.1|  PREDICTED: basic form of pathogenesis-relate...    175   2e-50   
ref|XP_010052997.1|  PREDICTED: pathogenesis-related protein 1-like     175   2e-50   
ref|XP_010525646.1|  PREDICTED: pathogenesis-related leaf protein...    175   2e-50   
gb|KCW63515.1|  hypothetical protein EUGRSUZ_G01148                     174   2e-50   
ref|XP_010065842.1|  PREDICTED: pathogenesis-related protein 1-like     175   2e-50   
ref|XP_009605825.1|  PREDICTED: pathogenesis-related protein 1B-like    175   2e-50   
ref|XP_011030278.1|  PREDICTED: pathogenesis-related protein 1-like     175   2e-50   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like    175   2e-50   
ref|XP_004168740.1|  PREDICTED: basic form of pathogenesis-relate...    174   2e-50   
ref|XP_002891554.1|  hypothetical protein ARALYDRAFT_474142             174   2e-50   
gb|ADD97801.1|  pathogenesis-related protein 1                          174   2e-50   
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...    174   2e-50   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6     174   3e-50   
gb|KHN19052.1|  Basic form of pathogenesis-related protein 1            174   3e-50   
ref|XP_010065834.1|  PREDICTED: pathogenesis-related protein 1-like     174   3e-50   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like     174   3e-50   
ref|XP_006393183.1|  hypothetical protein EUTSA_v10011955mg             174   3e-50   
ref|XP_010065833.1|  PREDICTED: pathogenesis-related protein 1-like     174   4e-50   
gb|KGN43830.1|  hypothetical protein Csa_7G070252                       174   4e-50   
ref|XP_004289701.1|  PREDICTED: pathogenesis-related protein 1B-like    174   4e-50   
emb|CAA31009.1|  PR1b preprotein                                        173   4e-50   Nicotiana tabacum [American tobacco]
ref|XP_002522065.1|  STS14 protein precursor, putative                  174   4e-50   Ricinus communis
pdb|1CFE|A  Chain A, P14a, Nmr, 20 Structures                           173   4e-50   
ref|XP_004136923.1|  PREDICTED: pathogenesis-related leaf protein...    174   4e-50   
ref|XP_004289700.1|  PREDICTED: basic form of pathogenesis-relate...    174   4e-50   
ref|XP_010065836.1|  PREDICTED: pathogenesis-related protein 1-like     174   4e-50   
dbj|BAO09561.1|  pathogenesis-related protein 1                         174   5e-50   
gb|AFM77011.1|  pathogenesis related protein 1a                         173   5e-50   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...    173   5e-50   
ref|XP_010270442.1|  PREDICTED: basic form of pathogenesis-relate...    173   6e-50   
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4                174   6e-50   
ref|XP_010065835.1|  PREDICTED: pathogenesis-related protein PR-1...    173   6e-50   
ref|NP_001238109.1|  uncharacterized protein LOC100499927 precursor     173   8e-50   
gb|KCW44084.1|  hypothetical protein EUGRSUZ_L02505                     173   8e-50   
ref|XP_009605694.1|  PREDICTED: pathogenesis-related leaf protein...    173   9e-50   
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...    172   9e-50   
ref|NP_001238168.1|  PR1a precursor                                     173   9e-50   
ref|XP_002272115.1|  PREDICTED: basic form of pathogenesis-relate...    172   1e-49   Vitis vinifera
ref|XP_003593358.1|  Pathogenesis-related protein 1a                    172   1e-49   
ref|XP_010691520.1|  PREDICTED: pathogenesis-related protein 1C-like    172   1e-49   
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like     172   1e-49   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...    172   1e-49   
ref|XP_006299028.1|  hypothetical protein CARUB_v10015165mg             172   1e-49   
dbj|BAF03626.1|  pathogenesis related protein 1                         172   2e-49   Eutrema japonicum [wasabe]
ref|XP_006306376.1|  hypothetical protein CARUB_v10012281mg             172   2e-49   
ref|XP_010065838.1|  PREDICTED: pathogenesis-related protein 1-like     172   2e-49   
ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C         172   2e-49   
gb|KCW63509.1|  hypothetical protein EUGRSUZ_G01140                     172   2e-49   
emb|CAA31010.1|  PR1c preprotein                                        172   2e-49   Nicotiana tabacum [American tobacco]
ref|XP_002313935.2|  hypothetical protein POPTR_0009s08660g             172   2e-49   Populus trichocarpa [western balsam poplar]
gb|KDP37597.1|  hypothetical protein JCGZ_06940                         179   2e-49   
gb|KCW77219.1|  hypothetical protein EUGRSUZ_D01572                     171   2e-49   
ref|XP_009398311.1|  PREDICTED: pathogenesis-related protein PRB1...    172   3e-49   
gb|AFK37568.1|  unknown                                                 172   3e-49   
gb|AEZ52390.1|  pathogenesis-related protein 1                          171   3e-49   
gb|AFK36478.1|  unknown                                                 171   3e-49   
emb|CAA29023.1|  PR-1c protein                                          171   3e-49   Nicotiana tabacum [American tobacco]
ref|XP_008455068.1|  PREDICTED: basic form of pathogenesis-relate...    171   4e-49   
ref|XP_002273199.1|  PREDICTED: basic form of pathogenesis-relate...    171   4e-49   Vitis vinifera
emb|CAA70070.1|  PR protein                                             171   4e-49   
gb|KDP37607.1|  hypothetical protein JCGZ_06950                         171   4e-49   
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like     171   4e-49   
gb|KFK39973.1|  hypothetical protein AALP_AA3G313300                    171   4e-49   
ref|XP_008455071.1|  PREDICTED: basic form of pathogenesis-relate...    171   4e-49   
ref|XP_008236150.1|  PREDICTED: basic form of pathogenesis-relate...    171   4e-49   
ref|XP_010065846.1|  PREDICTED: pathogenesis-related protein 1-like     171   5e-49   
ref|XP_008236236.1|  PREDICTED: basic form of pathogenesis-relate...    171   6e-49   
ref|XP_006412319.1|  hypothetical protein EUTSA_v10026438mg             171   6e-49   
ref|XP_009342367.1|  PREDICTED: pathogenesis-related protein PR-1...    171   6e-49   
ref|NP_179068.1|  pathogenesis-related protein 1                        171   6e-49   
gb|ABK28181.1|  unknown                                                 171   6e-49   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...    171   7e-49   
gb|AFK46675.1|  unknown                                                 171   7e-49   
ref|XP_010065843.1|  PREDICTED: pathogenesis-related protein 1-like     171   7e-49   
gb|AAB05225.1|  pathogenesis-related protein-1                          171   7e-49   
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...    171   7e-49   
ref|XP_002270281.2|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    171   8e-49   
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like     170   8e-49   
gb|KCW63519.1|  hypothetical protein EUGRSUZ_G01152                     170   8e-49   
ref|XP_004289697.1|  PREDICTED: pathogenesis-related protein 1C-like    170   9e-49   
gb|KDP37613.1|  hypothetical protein JCGZ_06956                         170   1e-48   
ref|XP_010052996.1|  PREDICTED: pathogenesis-related protein 1-like     170   1e-48   
ref|XP_009378592.1|  PREDICTED: pathogenesis-related protein PR-1...    170   1e-48   
ref|XP_010530686.1|  PREDICTED: pathogenesis-related protein 1-like     170   1e-48   
ref|XP_010941968.1|  PREDICTED: pathogenesis-related protein PRB1...    170   1e-48   
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like     169   1e-48   
ref|XP_007199955.1|  hypothetical protein PRUPE_ppa1027191mg            170   1e-48   
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...    170   1e-48   
ref|XP_009788194.1|  PREDICTED: pathogenesis-related leaf protein...    170   1e-48   
emb|CDY69373.1|  BnaCnng63210D                                          170   1e-48   
ref|XP_003608313.1|  Pathogenesis-related protein 1A                    169   1e-48   
ref|XP_008236225.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    169   2e-48   
ref|XP_008455062.1|  PREDICTED: pathogenesis-related protein 1-like     169   2e-48   
ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...    169   2e-48   
ref|XP_008245926.1|  PREDICTED: basic form of pathogenesis-relate...    169   2e-48   
ref|XP_003593363.1|  Pathogenesis-related protein 1B                    169   2e-48   
ref|XP_004136922.1|  PREDICTED: basic form of pathogenesis-relate...    169   2e-48   
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...    169   2e-48   
ref|XP_002885924.1|  predicted protein                                  169   2e-48   
ref|XP_010691519.1|  PREDICTED: pathogenesis-related protein 1A-like    169   2e-48   
gb|AFM76999.1|  pathogenesis related protein 1a                         169   2e-48   
gb|KCW77194.1|  hypothetical protein EUGRSUZ_D01543                     168   2e-48   
ref|XP_010467245.1|  PREDICTED: pathogenesis-related protein 1-like     169   2e-48   
gb|ACQ41879.1|  pathogenisis-related protein 1.1                        169   2e-48   
gb|AFK64734.1|  pathogenesis related protein 1a                         169   2e-48   
gb|KFK35951.1|  hypothetical protein AALP_AA4G059500                    169   3e-48   
ref|XP_004170276.1|  PREDICTED: basic form of pathogenesis-relate...    169   3e-48   
ref|XP_010065832.1|  PREDICTED: pathogenesis-related protein 1-like     169   3e-48   
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...    169   3e-48   
ref|XP_002522066.1|  STS14 protein precursor, putative                  169   3e-48   
gb|KFK39972.1|  hypothetical protein AALP_AA3G313200                    168   3e-48   
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like    169   3e-48   
emb|CAA31008.1|  PR1a preprotein                                        169   3e-48   
ref|XP_010488899.1|  PREDICTED: pathogenesis-related protein 1          169   4e-48   
ref|XP_008236223.1|  PREDICTED: pathogenesis-related protein 1-like     169   4e-48   
emb|CAE51954.1|  putative basic PR1                                     169   4e-48   
ref|XP_010266519.1|  PREDICTED: pathogenesis-related protein 1A-like    169   4e-48   
ref|XP_002522064.1|  STS14 protein precursor, putative                  168   5e-48   
dbj|BAA14220.1|  PR1a protein precursor                                 169   5e-48   
emb|CDP12737.1|  unnamed protein product                                168   5e-48   
gb|KCW63502.1|  hypothetical protein EUGRSUZ_G01132                     168   5e-48   
gb|AEL99925.1|  pathogenesis-related protein 1                          168   5e-48   
gb|KDP37608.1|  hypothetical protein JCGZ_06951                         168   6e-48   
ref|XP_009398310.1|  PREDICTED: pathogenesis-related protein 1-like     168   7e-48   
ref|XP_004230668.1|  PREDICTED: pathogenesis-related leaf protein...    168   7e-48   
gb|KGN43833.1|  hypothetical protein Csa_7G070255                       168   7e-48   
gb|ACT99721.1|  pathogen-related protein 1                              168   8e-48   
ref|XP_004136929.1|  PREDICTED: pathogenesis-related protein 1-like     167   1e-47   
ref|XP_007159202.1|  hypothetical protein PHAVU_002G217800g             167   2e-47   
ref|XP_006367090.1|  PREDICTED: pathogenesis-related protein 1-like     167   2e-47   
gb|AFK39516.1|  unknown                                                 167   2e-47   
emb|CDY68267.1|  BnaA06g37750D                                          167   2e-47   
gb|AEQ33601.1|  pathogenesis-related protein 1a                         166   2e-47   
gb|AFM77000.1|  pathogenesis related protein 1a                         167   2e-47   
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...    167   2e-47   
ref|XP_010531558.1|  PREDICTED: pathogenesis-related protein 1          167   2e-47   
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A         167   2e-47   
emb|CDY69090.1|  BnaAnng29270D                                          166   3e-47   
ref|XP_009138211.1|  PREDICTED: pathogenesis-related protein 1-like     166   3e-47   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like     166   3e-47   
gb|AFD29286.1|  pathogenesis-related protein 1                          166   3e-47   
emb|CAA30017.1|  unnamed protein product                                166   3e-47   
ref|XP_010437725.1|  PREDICTED: pathogenesis-related protein 1-like     166   3e-47   
ref|XP_008360375.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    167   3e-47   
gb|KDP37603.1|  hypothetical protein JCGZ_06946                         166   4e-47   
gb|KGN62936.1|  hypothetical protein Csa_2G381380                       166   4e-47   
ref|XP_004136921.1|  PREDICTED: basic form of pathogenesis-relate...    166   4e-47   
gb|ACQ41880.1|  pathogenisis-related protein 1.1                        166   5e-47   
ref|XP_010691522.1|  PREDICTED: pathogenesis-related protein PR-1...    166   5e-47   
ref|NP_175428.1|  putative pathogenesis-related protein                 166   5e-47   
ref|XP_007199090.1|  hypothetical protein PRUPE_ppa020367mg             164   5e-47   
ref|XP_009147855.1|  PREDICTED: pathogenesis-related leaf protein 6     165   7e-47   
ref|XP_010517589.1|  PREDICTED: pathogenesis-related protein 1-like     165   7e-47   
ref|NP_001043091.1|  Os01g0382400                                       166   7e-47   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                       165   8e-47   
gb|KCW77203.1|  hypothetical protein EUGRSUZ_D01554                     165   9e-47   
gb|ABK41053.2|  pathogenesis-related protein 1                          165   9e-47   
ref|XP_010053000.1|  PREDICTED: pathogenesis-related protein 1-like     165   1e-46   
gb|KCW77208.1|  hypothetical protein EUGRSUZ_D01560                     165   1e-46   
ref|XP_004138861.1|  PREDICTED: basic form of pathogenesis-relate...    164   1e-46   
ref|XP_006285149.1|  hypothetical protein CARUB_v10006493mg             165   1e-46   
ref|XP_010547940.1|  PREDICTED: pathogenesis-related protein 1-like     164   2e-46   
ref|XP_010943469.1|  PREDICTED: pathogenesis-related protein PRB1...    164   2e-46   
ref|XP_007148306.1|  hypothetical protein PHAVU_006G197400g             164   2e-46   
emb|CAA52893.1|  PR-1a pathogenesis related protein (Hv-1a)             164   2e-46   
gb|AFF57760.1|  pathogenesis-related protein1                           162   2e-46   
ref|XP_010548693.1|  PREDICTED: basic form of pathogenesis-relate...    164   2e-46   
ref|XP_010691525.1|  PREDICTED: pathogenesis-related protein 1A-like    164   2e-46   
ref|XP_008455064.1|  PREDICTED: pathogenesis-related protein PRB1...    164   2e-46   
ref|XP_006412318.1|  hypothetical protein EUTSA_v10027251mg             164   2e-46   
emb|CDY49367.1|  BnaA03g50560D                                          164   3e-46   
ref|XP_010530685.1|  PREDICTED: pathogenesis-related protein 1-like     163   3e-46   
ref|XP_010447202.1|  PREDICTED: pathogenesis-related protein 1-like     164   3e-46   
ref|XP_011092472.1|  PREDICTED: basic form of pathogenesis-relate...    163   3e-46   
ref|XP_006368156.1|  PREDICTED: basic form of pathogenesis-relate...    162   3e-46   
ref|XP_009388944.1|  PREDICTED: pathogenesis-related protein 1C-like    163   4e-46   
gb|AEX55228.1|  pathogenesis-related protein 1                          164   4e-46   
gb|AFK35640.1|  unknown                                                 164   4e-46   
ref|XP_009138206.1|  PREDICTED: pathogenesis-related protein 1-like     163   5e-46   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...    163   6e-46   
ref|XP_003593453.1|  Pathogenesis-related protein 1a                    164   6e-46   
ref|XP_009147856.1|  PREDICTED: pathogenesis-related leaf protein...    163   6e-46   
ref|XP_003529280.2|  PREDICTED: pathogenesis-related protein 1A-like    162   7e-46   
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...    163   7e-46   
gb|KFK30004.1|  hypothetical protein AALP_AA7G205200                    162   7e-46   
ref|XP_004136928.1|  PREDICTED: pathogenesis-related protein 1C-like    163   8e-46   
ref|XP_009138205.1|  PREDICTED: pathogenesis-related protein 1-like     162   8e-46   
ref|XP_003606006.1|  Maturase K                                         174   9e-46   
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...    162   1e-45   
ref|XP_006298656.1|  hypothetical protein CARUB_v10014746mg             163   1e-45   
ref|XP_004485657.1|  PREDICTED: pathogenesis-related protein PR-1...    162   1e-45   
ref|XP_008370577.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    162   1e-45   
gb|KHN33609.1|  Basic form of pathogenesis-related protein 1            165   1e-45   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...    162   1e-45   
ref|XP_002869193.1|  hypothetical protein ARALYDRAFT_913036             162   1e-45   
emb|CAA65420.1|  pathogenesis-related protein 1                         162   1e-45   
gb|KDP35903.1|  hypothetical protein JCGZ_09875                         166   1e-45   
ref|XP_010432521.1|  PREDICTED: pathogenesis-related protein 1-like     162   1e-45   
ref|XP_007041421.1|  CAP (Cysteine-rich secretory proteins, Antig...    162   1e-45   
gb|KDP36354.1|  hypothetical protein JCGZ_09851                         169   2e-45   
ref|XP_010095626.1|  hypothetical protein L484_003727                   160   2e-45   
ref|NP_195099.1|  putative pathogenesis-related protein                 161   3e-45   
ref|XP_008382391.1|  PREDICTED: pathogenesis-related protein 1A-like    161   3e-45   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...    161   3e-45   
emb|CDY46098.1|  BnaA03g52700D                                          161   4e-45   
ref|XP_009138212.1|  PREDICTED: pathogenesis-related protein 1-like     160   4e-45   
gb|KDP36356.1|  hypothetical protein JCGZ_09853                         161   5e-45   
gb|EYU18353.1|  hypothetical protein MIMGU_mgv1a023502mg                160   5e-45   
ref|NP_188603.1|  putative pathogenesis-related protein                 160   6e-45   
ref|NP_195098.1|  putative pathogenesis-related protein                 160   6e-45   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3                160   6e-45   
ref|XP_002313936.2|  pathogenesis-related family protein                160   6e-45   
gb|EMS61770.1|  Pathogenesis-related protein 1                          160   6e-45   
ref|XP_006466261.1|  PREDICTED: basic form of pathogenesis-relate...    160   9e-45   
prf||1202235B  protein p14,pathogenesis related                         159   1e-44
ref|XP_002885925.1|  predicted protein                                  159   1e-44   
ref|XP_006583787.1|  PREDICTED: basic form of pathogenesis-relate...    159   1e-44   
ref|XP_010904546.1|  PREDICTED: pathogenesis-related protein PRB1...    159   1e-44   
ref|XP_008372933.1|  PREDICTED: basic form of pathogenesis-relate...    159   1e-44   
ref|XP_009342363.1|  PREDICTED: pathogenesis-related leaf protein...    159   1e-44   
ref|XP_010447203.1|  PREDICTED: pathogenesis-related protein 1-like     159   2e-44   
ref|XP_003593361.1|  Pathogenesis-related protein 1a                    159   2e-44   
ref|XP_008798895.1|  PREDICTED: pathogenesis-related protein 1-like     159   2e-44   
ref|XP_009135645.1|  PREDICTED: pathogenesis-related protein 1          159   2e-44   
sp|P35792.1|PR12_HORVU  RecName: Full=Pathogenesis-related protei...    159   2e-44   
sp|Q05968.1|PR1_HORVU  RecName: Full=Pathogenesis-related protein...    159   2e-44   
ref|XP_010530682.1|  PREDICTED: pathogenesis-related protein 1A-like    159   2e-44   
emb|CDY22960.1|  BnaC03g41090D                                          159   2e-44   
ref|XP_009346545.1|  PREDICTED: pathogenesis-related protein 1A-like    159   2e-44   
ref|XP_010437726.1|  PREDICTED: pathogenesis-related protein 1-like     159   2e-44   
ref|XP_006409651.1|  hypothetical protein EUTSA_v10022890mg             159   2e-44   
ref|XP_006368158.1|  PREDICTED: pathogenesis-related protein 1A-like    158   2e-44   
gb|KDP37598.1|  hypothetical protein JCGZ_06941                         158   3e-44   
ref|XP_006426334.1|  hypothetical protein CICLE_v10026661mg             158   3e-44   
gb|EEE54618.1|  hypothetical protein OsJ_01863                          158   3e-44   
ref|XP_006408913.1|  hypothetical protein EUTSA_v10002159mg             159   4e-44   
ref|XP_010687897.1|  PREDICTED: pathogenesis-related protein PR-1...    158   4e-44   
gb|KDP37612.1|  hypothetical protein JCGZ_06955                         157   5e-44   
ref|XP_009378590.1|  PREDICTED: pathogenesis-related leaf protein...    158   5e-44   
gb|AEH25617.1|  pathogenesis-related protein 1-2                        158   5e-44   
ref|XP_004137081.1|  PREDICTED: basic form of pathogenesis-relate...    157   6e-44   
emb|CDX82282.1|  BnaA03g35390D                                          157   7e-44   
ref|XP_010911073.1|  PREDICTED: pathogenesis-related protein PRB1...    157   8e-44   
ref|XP_002869194.1|  hypothetical protein ARALYDRAFT_491308             157   9e-44   
emb|CAA07473.1|  pathogenisis-related protein 1.1                       157   9e-44   
ref|XP_008455067.1|  PREDICTED: pathogenesis-related protein 1A-like    158   1e-43   
gb|ACB45874.1|  pathogen-related protein 1                              157   1e-43   
ref|XP_010942046.1|  PREDICTED: uncharacterized protein LOC105060136    161   2e-43   
gb|AAL84768.1|AF475286_1  pathogenesis-related protein 1-1a             155   2e-43   
emb|CDO97324.1|  unnamed protein product                                156   2e-43   
gb|AHE81248.1|  pathogenesis-related protein 1-5                        156   2e-43   
sp|P35793.1|PR13_HORVU  RecName: Full=Pathogenesis-related protei...    156   3e-43   
ref|XP_010489949.1|  PREDICTED: pathogenesis-related protein 1A-like    156   3e-43   
ref|XP_007148305.1|  hypothetical protein PHAVU_006G197300g             155   3e-43   
gb|ABR18381.1|  unknown                                                 156   3e-43   
dbj|BAD34031.1|  putative pathogenesis related protein                  156   3e-43   
gb|AGO62049.1|  pathogenesis-related protein 1                          155   3e-43   
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940          156   4e-43   
sp|Q41359.1|PR1_SAMNI  RecName: Full=Pathogenesis-related protein...    155   4e-43   
gb|EAZ36936.1|  hypothetical protein OsJ_21273                          156   5e-43   
ref|XP_010507919.1|  PREDICTED: pathogenesis-related protein 1A-like    155   5e-43   
gb|KFK40371.1|  hypothetical protein AALP_AA3G364900                    155   5e-43   
ref|XP_007008873.1|  Concanavalin A-like lectin protein kinase fa...    164   5e-43   
ref|XP_010904557.1|  PREDICTED: pathogenesis-related protein 1-like     155   6e-43   
ref|XP_010943450.1|  PREDICTED: pathogenesis-related protein PR-1...    155   6e-43   
gb|ABK23936.1|  unknown                                                 155   7e-43   
emb|CDY59219.1|  BnaCnng34480D                                          155   7e-43   
ref|XP_010691813.1|  PREDICTED: pathogenesis-related protein 1C         155   8e-43   
ref|XP_004292153.1|  PREDICTED: basic form of pathogenesis-relate...    157   8e-43   
gb|AEH25620.1|  pathogenesis-related protein 1-5                        155   8e-43   
ref|XP_002885324.1|  hypothetical protein ARALYDRAFT_898358             155   9e-43   
gb|ABK55610.1|  pathogenesis-related protein PR1c                       155   1e-42   
ref|XP_008455069.1|  PREDICTED: basic form of pathogenesis-relate...    154   1e-42   
ref|XP_007041423.1|  Basic pathogenesis-related protein 1               156   1e-42   
gb|AID60096.1|  hypothetical protein                                    155   1e-42   
ref|XP_006406470.1|  hypothetical protein EUTSA_v10022205mg             154   1e-42   
emb|CDX69002.1|  BnaC01g04510D                                          155   1e-42   
emb|CDX69000.1|  BnaC01g04530D                                          154   2e-42   
ref|XP_006282972.1|  hypothetical protein CARUB_v10007846mg             154   2e-42   
ref|XP_002883954.1|  hypothetical protein ARALYDRAFT_480471             154   2e-42   



>ref|XP_009788195.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
sylvestris]
Length=177

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            MG L+   +VA      I +   S AQN+P DYLNPHN AR +VGV  MTWDN+LA+YAQ
Sbjct  1    MGFLTT--IVACFITFAI-LIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQ  57

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            N+A+   GDC + HS GPYGENLA A+P LNAA AVK+WVDEK  YDYNSNSCVGG CGH
Sbjct  58   NYANQRIGDCGMIHSHGPYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSCVGGVCGH  117

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC R RCNNGW+ I+C+YDP GN  GQRP+
Sbjct  118  YTQVVWRNSVRLGCARVRCNNGWFFITCNYDPPGNFIGQRPF  159



>ref|XP_009605695.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
tomentosiformis]
Length=177

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            MG L+   +VA      I +F  S AQN+P DYLNPHN AR +VGV  M WDN+LA+YAQ
Sbjct  1    MGSLTT--LVACFITFAI-LFHSSQAQNSPQDYLNPHNTARRQVGVGPMIWDNRLAAYAQ  57

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            N+A+   GDC + HS GPYGENLA A+P LNAA AVK+WVDEK  YDYNSNSCVGG CGH
Sbjct  58   NYANQRIGDCGMIHSHGPYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSCVGGVCGH  117

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC R RCNNGW+ I+C+YDP GN  GQRP+
Sbjct  118  YTQVVWRNSVRLGCARVRCNNGWFFITCNYDPPGNYRGQRPF  159



>sp|P11670.1|PRB1_TOBAC RecName: Full=Basic form of pathogenesis-related protein 1; Short=PRP 
1; Flags: Precursor [Nicotiana tabacum]
 emb|CAA32228.1| PRP 1 precursor (AA -23 to 154) [Nicotiana tabacum]
 prf||1807333A pathogenesis-related protein 1
Length=177

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            MG L+   +VA      I +   S AQN+P DYLNPHN AR +VGV  MTWDN+LA+YAQ
Sbjct  1    MGFLTT--IVACFITFAI-LIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQ  57

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            N+A+   GDC + HS GPYGENLA A+P LNAA AVK+WVDEK  YDYNSNSCVGG CGH
Sbjct  58   NYANQRIGDCGMIHSHGPYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSCVGGVCGH  117

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC R R NNGW+ I+C+YDP GN  GQRP+
Sbjct  118  YTQVVWRNSVRLGCARVRSNNGWFFITCNYDPPGNFIGQRPF  159



>gb|AGS80328.1| pathogenesis-related protein 1 [Actinidia eriantha]
Length=173

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            MG L +   +AL S+M++AM   S AQN+P DYLN HN AR  VGV  + WDN LA+YA+
Sbjct  1    MGWLCRMSSLALASLMVLAMVHSSLAQNSPQDYLNAHNAARAAVGVGPIRWDNNLANYAR  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++A+S   DC L HS GPYGENLAK +P L   D+VK+WVDEK  YDYNSNSC+GG CGH
Sbjct  61   DYANSRIKDCNLVHSKGPYGENLAKGFPGLTGRDSVKMWVDEKKYYDYNSNSCIGGVCGH  120

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY*LRV  166
            YTQVVW  SVR+GC R +C NGWW I CSYDP GNVSGQRPY L++
Sbjct  121  YTQVVWSRSVRVGCARVKCTNGWWFIICSYDPPGNVSGQRPYVLKL  166



>ref|XP_006367091.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=179

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++  ++ A+F  S AQN+P DYLNPHN AR +VGV  MTWDN+LA++AQN+A+   G
Sbjct  6    IALIICFLIFAIFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAG  65

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA A+P LNAA AVK+W DEK  Y+YNSN+C  G  CGHYTQVVWR
Sbjct  66   DCRMQHSGGPYGENLAAAFPQLNAAGAVKMWFDEKQWYNYNSNTCQAGKVCGHYTQVVWR  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW+ I+C+YDP GN  GQRPY
Sbjct  126  NSVRLGCARVRCNNGWYFITCNYDPPGNWRGQRPY  160



>ref|NP_001234358.1| PR1 protein precursor [Solanum lycopersicum]
 gb|ACB88202.1| PR1 protein [Solanum lycopersicum]
Length=179

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++  +  A+F  S AQN+P DYLN HN AR +VGV  MTWDN+LA++AQN+A+   G
Sbjct  6    IALIICFLTFAIFHSSQAQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRAG  65

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA A+P LNAA AVK+WVDEK  Y+YNSN+C  G  CGHYTQVVWR
Sbjct  66   DCRMQHSGGPYGENLAAAFPQLNAAGAVKMWVDEKQWYNYNSNTCQAGKVCGHYTQVVWR  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW+ I+C+YDP GN  GQRPY
Sbjct  126  NSVRLGCARVRCNNGWYFITCNYDPPGNWRGQRPY  160



>emb|CAA47374.1| prb-1b [Nicotiana tabacum]
Length=179

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +VA      I +F  S AQN+P DYLNPHN AR +VGV  MTWDN+LA++AQN+A+   G
Sbjct  7    LVACFITFAI-LFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAG  65

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA AYP L+AA AVK+WVDEK  Y+YNSN+C  G+ CGHYTQVVWR
Sbjct  66   DCRMQHSGGPYGENLAAAYPQLHAAGAVKMWVDEKQFYNYNSNTCAAGNVCGHYTQVVWR  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW+ I+C+YDP GN  GQRPY
Sbjct  126  NSVRLGCARVRCNNGWYFITCNYDPPGNWRGQRPY  160



>ref|XP_009605696.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana tomentosiformis]
Length=179

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +VA      I +F  S AQN+P DYLNPHN AR +VGV  MTWDN+LA++AQN+A+   G
Sbjct  7    LVACFITFAI-LFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAG  65

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA AYP L+AA AVK+WVDEK  Y+YNSN+C  G  CGHYTQVVWR
Sbjct  66   DCRMQHSGGPYGENLAAAYPQLHAAGAVKMWVDEKQFYNYNSNTCAAGKVCGHYTQVVWR  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW+ I+C+YDP GN  GQRPY
Sbjct  126  NSVRLGCARVRCNNGWYFITCNYDPPGNWRGQRPY  160



>ref|XP_009787159.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana sylvestris]
Length=179

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +VA      I +F  S AQN+P DYLN HN AR  VGV  MTWDN++A++AQN+A+   G
Sbjct  7    LVACFITFAI-LFPSSQAQNSPQDYLNAHNAARRRVGVGPMTWDNRVAAFAQNYANQRAG  65

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA A+P LNAA AVK+WVDEK  YDYNSNSC  G  CGHYTQVVWR
Sbjct  66   DCRMQHSGGPYGENLAAAFPQLNAAGAVKMWVDEKQFYDYNSNSCAAGKVCGHYTQVVWR  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW+ I+C+YDP GN  GQRPY
Sbjct  126  NSVRLGCARVRCNNGWYFITCNYDPPGNWRGQRPY  160



>gb|AAK30143.1|AF348141_1 pathogenesis-related protein PR-1 precursor [Capsicum annuum]
 gb|AAC06244.2| basic PR-1 protein precursor [Capsicum annuum]
 gb|AAU20808.1| basic PR-1 protein precursor [Capsicum annuum]
Length=179

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++  +  A+F  + AQN+P DYLN HN AR +VGV  MTWDN+LA++AQN+A+   G
Sbjct  6    IALIVCFITFAIFHSTQAQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRIG  65

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA A+P LNAA AVK+WV+EK  Y+YNSNSC  G  CGHYTQVVWR
Sbjct  66   DCRMQHSGGPYGENLAAAFPQLNAAGAVKMWVNEKQWYNYNSNSCAPGKVCGHYTQVVWR  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW+ I+C+YDP GN  GQRPY
Sbjct  126  NSVRLGCARVRCNNGWYFITCNYDPPGNWRGQRPY  160



>ref|XP_002273788.2| PREDICTED: pathogenesis-related protein 1 [Vitis vinifera]
Length=197

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = -2

Query  666  KMGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYA  487
            KMG L + P+ ALL  M +A+  +  AQN+P DYLN HN AR +VGV  M+WDN +A+YA
Sbjct  37   KMG-LCRSPL-ALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYA  94

Query  486  QNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCG  307
            QN+A+   GDC L HS GPYGENLA   P L   DAV LWV EK NYDYNSNSCVGG CG
Sbjct  95   QNYANQRIGDCNLVHSGGPYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSCVGGQCG  154

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVW  SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  155  HYTQVVWSKSVRLGCARVQCNNGGWFVTCNYDPRGNYIGQRPY  197



>emb|CAN77102.1| hypothetical protein VITISV_021166 [Vitis vinifera]
 emb|CBI25100.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L + P+ ALL  M +A+  +  AQN+P DYLN HN AR +VGV  M+WDN +A+YAQN+A
Sbjct  3    LCRSPL-ALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGENLA   P L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSGGPYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSCVGGQCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVW  SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  122  VVWSKSVRLGCARVQCNNGGWFVTCNYDPRGNYIGQRPY  160



>ref|XP_006367093.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=188

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 125/170 (74%), Gaps = 10/170 (6%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            MG  +   ++  LS  +I  F  S AQN+P DYLNPHN+AR +VGV  MTWDN+LA++AQ
Sbjct  1    MGYSNIALIICFLSFAII--FHSSQAQNSPQDYLNPHNEARRQVGVSPMTWDNRLAAFAQ  58

Query  483  NHADSLTGDCALN-------HSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSC  325
            N+A+   GDC ++       HS GPYGENLA  +P LNAA AVK+WVDEK  Y+YNSN+C
Sbjct  59   NYANQRAGDCRMHYNILLMQHSGGPYGENLAAGFPQLNAAGAVKMWVDEKQWYNYNSNTC  118

Query  324  VGGD-CGHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
              G  CGHYTQVVWR+SVRLGC R RCNNGW+ I+C+YDP GN +GQRPY
Sbjct  119  QAGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCNYDPPGNWNGQRPY  168



>dbj|BAF95881.1| putative pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L + P+ ALL  M +A+  +  AQN+P DYLN HN AR +VGV  M+WDN +A+YAQN+A
Sbjct  3    LCRSPL-ALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGENLA   P L   DAV +WV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSGGPYGENLAWGSPSLTGTDAVNMWVGEKSNYDYNSNSCVGGQCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CN G W ++C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARIQCNKGGWFVTCNYDPRGNYIGQRPY  160



>ref|XP_006367092.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=178

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++  L+  +  +F  S AQN+P DYLNPHN+AR +VGV  M WDN+LA++AQN+A+   G
Sbjct  5    IICFLTFAL--LFHSSKAQNSPQDYLNPHNEARRQVGVGPMAWDNRLAAFAQNYANQRIG  62

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC + HS GPYGENLA  +P LNAA AVK+WVDEK  YDYNSNSC  G  CGHYTQVVWR
Sbjct  63   DCRMQHSGGPYGENLAAGFPQLNAAGAVKMWVDEKQWYDYNSNSCQPGKVCGHYTQVVWR  122

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R RCNNGW  I+C+YDP GN  GQRP+
Sbjct  123  NSVRLGCARVRCNNGWDFITCNYDPPGNWIGQRPF  157



>gb|AEM36335.1| pathogenesis-related protein [Vitis quinquangularis]
Length=160

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L + P+ ALL  M +A+  +  AQN+P DYLN HN AR +VGV  M+WDN +A+YAQN+A
Sbjct  3    LCRSPL-ALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
                GDC L HS GPYGENLA+  P L   DAV LWV EK NYD+NSNSCVGG CGHYTQ
Sbjct  62   KQRIGDCNLVHSGGPYGENLARGSPSLTGTDAVNLWVGEKSNYDHNSNSCVGGQCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVW  SV LGC R +CNNG W ++C+YDP GN+ GQ PY
Sbjct  122  VVWSKSVHLGCARVQCNNGGWFVTCNYDPRGNIVGQSPY  160



>gb|ADN43416.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + V+ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W I+C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  160



>ref|XP_006367104.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = -2

Query  630  LLSVMMIAMFD-LSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDC  454
            ++  +  A+F  +  AQN P DYLN HN+AR +VGV  MTWDN+LA++AQN+A+   GDC
Sbjct  9    VVCFITFAIFPFICEAQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDC  68

Query  453  ALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSS  277
             + HS GPYGENLA A+P LNAA AV+ WV+E+  Y+YNSN+C  G  CGHYTQVVWR+S
Sbjct  69   RMQHSGGPYGENLASAFPQLNAAGAVQQWVNERQWYNYNSNTCQAGRVCGHYTQVVWRNS  128

Query  276  VRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VRLGC R RCNNGW+ I+C+YDP GN+SGQRP+
Sbjct  129  VRLGCARVRCNNGWYFITCNYDPRGNMSGQRPF  161



>gb|ADN43419.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + V+ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>gb|ADN43439.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M +A+     AQN+  DY++ HN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGLALAHTCCAQNSAQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    DC L HS G YGENLAK  P L   DAV LWV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRISDCNLVHSGGRYGENLAKGSPSLTGTDAVNLWVGEKPNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNGWW ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCNNGWWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43436.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M  A+     AQN+P DY++PHN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  161



>ref|XP_002274371.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN80994.1| hypothetical protein VITISV_042545 [Vitis vinifera]
Length=161

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M +A+     AQN+P DY++ HN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LCKISMALLVGLMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    DC L HS GPYGENLAK    L   DAV LWV EK  YDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRISDCNLVHSGGPYGENLAKGSGSLTGTDAVNLWVGEKPYYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNGWW ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCNNGWWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43415.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + V+ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVDLWVGEKPNYDYNSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_002274307.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=161

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M +A+  +  AQN+P DY+N HN AR +VGV  MTW++ +A+YAQN+A
Sbjct  3    LCKISLPLLVGLMGLALAHVCCAQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    DC L HS GPYGENLAK    L   DAV LWV EK NYDYNSNSCVGG+C HYTQ
Sbjct  63   NKRISDCNLVHSGGPYGENLAKGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVW +SVRLGC R +CNNGWW ++C+YDP GN  GQRPY
Sbjct  123  VVWSNSVRLGCARVQCNNGWWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43435.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+  M +A+     AQN+P DY++ HN AR +VGV  MTW+N +A+YAQN+A
Sbjct  3    LFKISLALLVGPMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGPMTWNNTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV +WV EK NYDYNSNSCVGG CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCVGGKCGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W I+C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  161



>gb|ADN43418.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43426.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + ++ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W I+C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  160



>ref|XP_006367095.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = -2

Query  630  LLSVMMIAMFD-LSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDC  454
            ++  +  A+F  +  AQN P DYLN HN+AR +VGV  MTWDN+LA++AQN+A+   GDC
Sbjct  9    VVCFITFAIFPFICEAQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDC  68

Query  453  ALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSS  277
             + HS GPYGENLA A+P LNAA AV+ WV+E+  Y+YNSN+C  G  CGHYTQVVWR++
Sbjct  69   RMQHSGGPYGENLASAFPQLNAAGAVQQWVNERQWYNYNSNTCQAGRVCGHYTQVVWRNA  128

Query  276  VRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VRLGC R RCNNGW+ I+C+YDP GN+SGQRP+
Sbjct  129  VRLGCARVRCNNGWYFITCNYDPRGNMSGQRPF  161



>ref|XP_010252393.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=167

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
             L + + A   +S AQ++P DY+N HN AR EVGV  MTWD+K+A+YAQ +A+   GDCA
Sbjct  17   FLIIGLAAGLHVSLAQDSPQDYINAHNAARAEVGVGSMTWDDKVAAYAQQYANQRIGDCA  76

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVR  271
            L HS GPYGENLA A P L+  DAVK+WVDEK  YDYNSNSC GG+C HYTQVVWR SVR
Sbjct  77   LVHSGGPYGENLAAAMPSLSGTDAVKMWVDEKQYYDYNSNSCSGGECLHYTQVVWRDSVR  136

Query  270  LGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            LGC +  CNNGW  ++C+YDP GN  GQRPY
Sbjct  137  LGCAKVHCNNGWDFVTCNYDPPGNYVGQRPY  167



>ref|XP_002273416.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 gb|ADN43420.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43421.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43422.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43423.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43424.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43425.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=160

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + ++ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>gb|ADN43427.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=159

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +  + ++ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A+   GD
Sbjct  7    LVFICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGD  66

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQVVWR+S
Sbjct  67   CNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQVVWRNS  126

Query  276  VRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  127  VRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  159



>gb|ADN43434.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M  A+     AQN+P DY++PHN A+ +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAAQAQVGVGPITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV +WV EK NYDYNSNSCVGG CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCVGGKCGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W I+C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  161



>gb|ADN43438.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M +A+     AQN+  DY++ HN AR  VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGLALAHTCRAQNSAQDYVDAHNAARARVGVGSITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    DC L HS G YGEN AK  P L   DAV LWV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRISDCNLVHSGGRYGENPAKGSPSLTGTDAVNLWVGEKPNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC RA+CNNGWW ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARAQCNNGWWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43428.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=160

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + ++ +++   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICLVGLSLVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>gb|ADN43417.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +V  + ++ +A+   S AQN+  DYLN HN AR +VGV  MTW+N +ASYAQN+A
Sbjct  3    LFKISLV-FICLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGEN+A     L   DAV LWV EK NYDY+SNSCVGG CGHYTQ
Sbjct  62   NQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYSSNSCVGGKCGHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CNNG W I+C+YDP GN  GQRPY
Sbjct  122  VVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  160



>gb|ADN43437.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=161

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M  A+     AQN+P DY++PHN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV +WV EK NYDYNSNSC GG+CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCFGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +C+NG W ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCDNGGWFVTCNYDPPGNYVGQRPY  161



>ref|XP_006367102.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=167

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            + +  ++  ++F  S  QN P +YL PHN+AR +VGV  MTW+N LA YAQN+A+   GD
Sbjct  5    IWVACLITFSIFHSSQGQNCPQNYLIPHNEARRQVGVGPMTWNNSLADYAQNYANQRIGD  64

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRS  280
            C + HS GPYGENLA A+PDLNAADAVK+WVDEK  YD +SN+C  G+ CGHYTQVVWR+
Sbjct  65   CGMIHSQGPYGENLAAAFPDLNAADAVKMWVDEKQWYDSDSNTCALGEVCGHYTQVVWRN  124

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            S+R+GC + +CNNGW+ I+C+YDP GN  GQRPY
Sbjct  125  SIRVGCAKVQCNNGWYFITCNYDPPGNYIGQRPY  158



>gb|ADN43432.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M  A+     AQN+P DY++ HN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGFALAHTCCAQNSPQDYVDSHNAARAQVGVGPITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV +WV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +C+NG W ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCDNGGWFVTCNYDPPGNYVGQRPY  161



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K     ++  M + +  +S AQN+P D+L+ HN AR EVGV  M+WDN +A+YAQN+ 
Sbjct  3    LCKISSSLVVGFMGLVLAHISYAQNSPQDFLDAHNVARAEVGVGPMSWDNTVAAYAQNYT  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGENLA   P L   DAV LWV EK NYDYNSNSCVGG+C HYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENLAWGSPSLTGIDAVNLWVGEKTNYDYNSNSCVGGECRHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            V+WR+S+RLGC RA+CN+G W ++C+YDP GN  GQRP+
Sbjct  123  VIWRNSLRLGCARAQCNSGGWFVTCNYDPPGNYVGQRPF  161



>gb|ADB54823.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=161

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K     ++  M + +  +S AQN+  D+L+ HN  R EVGV  M+WDN +A+YAQN+ 
Sbjct  3    LCKISSSLVVGFMGLVLAHISYAQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQNYT  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGENLA   P L   DAV LWV EK NYDYNSNSCVGG CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENLAWGSPSLTGTDAVNLWVGEKSNYDYNSNSCVGGQCGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +CN G WL++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCNKGGWLVACNYDPRGNYIGQRPY  161



>gb|ADN43433.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +   + +M +A+     AQN+  DY++ HN AR +VGV  MTW+N +A+YAQN+A
Sbjct  3    LFKISLALXVGLMGLALAHTCCAQNSLQDYVDAHNAARAQVGVGPMTWNNTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC+L HS GPYGEN+A   P L + DAV +WV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRIGDCSLVHSGGPYGENIAWGSPSLTSTDAVNMWVGEKPNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGC R +C+NG W ++C+YDP GN  GQRPY
Sbjct  123  VVWRNSVRLGCARVQCDNGGWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43431.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M  A+     AQN+P DY++PHN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV +WV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VV R+SVRLGC R +C+NG W ++C+YDP GN  GQRPY
Sbjct  123  VVRRNSVRLGCARVQCDNGGWFVTCNYDPLGNYVGQRPY  161



>dbj|BAB78476.1| PR-1 [Solanum torvum]
Length=168

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  621  VMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNH  442
             +  A+F  S AQ    ++LN HN AR  VGV  MTWDN LA+YAQN+A+   GDC + H
Sbjct  4    FITFAIFHSSQAQTPQENFLNAHNAARRRVGVGPMTWDNTLAAYAQNYANQRIGDCMMQH  63

Query  441  SDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSVRLG  265
            SDGPYGENLA A+P LNAA AVK+W DEK  YDYNSN+C  G  CGHYTQVVWR+SVRLG
Sbjct  64   SDGPYGENLAAAFPQLNAAGAVKMWEDEKQWYDYNSNTCAPGKVCGHYTQVVWRNSVRLG  123

Query  264  CGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            C R RC++GW  I+C+YDP GN  GQRPY
Sbjct  124  CARVRCSSGWVFITCNYDPPGNYIGQRPY  152



>ref|XP_002273546.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN74267.1| hypothetical protein VITISV_000653 [Vitis vinifera]
 emb|CBI25096.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  +  + ++A+   S AQN+  DYL+ HN AR +VGV  MTWD+ +A+YA+++A
Sbjct  3    LCKRELALICFIGILALVHPSHAQNSQQDYLDVHNAARADVGVEPMTWDDNVAAYARDYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
               +GDC + HS+GPYGENLA    D  A DA  LWV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   SQRSGDCNMVHSNGPYGENLAMGSGDFTATDAANLWVGEKSNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SV LGC R +CNNGWW +SC+Y P GN+ GQ PY
Sbjct  123  VVWRNSVSLGCARVQCNNGWWFVSCNYSPQGNIIGQHPY  161



>ref|XP_010042397.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F LS AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  4    LTIIISLVFISLFQLSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTSTFTGTYAVSLWVAEKQNYNYNTNTCSSGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R +CNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCARVQCNNGWWYVVCNYDPLGNYEGELPY  158



>emb|CAD60273.1| putative pathogenesis related protein 1 precursor [Vitis vinifera]
Length=161

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L + P+ ALL  M +A+  +  AQN+P DY+N HN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LCRSPL-ALLCFMWLALAHICCAQNSPQDYVNAHNAARAQVGVGSITWNDTVAAYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    DC L HS GPYGENLAK    L   DAV LWV EK NYDYNSNSCVGG+C HYTQ
Sbjct  62   NKRISDCNLVHSGGPYGENLAKGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPA-GNVSGQRPY  178
            VVW +SVRLGC R +CNNGWW ++C+YDP  GN  GQRPY
Sbjct  122  VVWSNSVRLGCARVQCNNGWWFVTCNYDPPRGNYIGQRPY  161



>ref|XP_004504945.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cicer arietinum]
Length=163

 Score =   196 bits (499),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 116/161 (72%), Gaps = 6/161 (4%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
             S+F +V +LS+     F L+ AQN+P DYLN HN AR +VGV ++TWDN +A+YA N+A
Sbjct  7    FSRFSLVIILSLG----FSLTNAQNSPQDYLNAHNIARAQVGVANITWDNTVATYALNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYP-DLNAADAVKLWVDEKDNYDYNSNSCV-GGDCGHY  301
            +S  GDC L HS G YGENLAK          AV LWV+EK  YDYN+NSC+ GG C HY
Sbjct  63   NSRIGDCNLVHSSGSYGENLAKGSSGSFTGITAVNLWVNEKQYYDYNTNSCINGGQCLHY  122

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGC R +CNNGWW ++C+YDP GN  GQ+PY
Sbjct  123  TQVVWRNSVRLGCARVQCNNGWWFVTCNYDPPGNCIGQKPY  163



>ref|XP_010252394.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
 ref|XP_010252398.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -2

Query  627  LSVMMI--AMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDC  454
            L ++M+  A+  +S AQ++P DY+N HN+AR  VGV  MTWDN LA YAQ +A+   GDC
Sbjct  10   LFILMVGLALLHVSEAQDSPQDYINAHNEARRAVGVGPMTWDNTLAGYAQRYANQRIGDC  69

Query  453  ALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSS  277
            A+ HS+GPYGENLA A P L+  +AVK+WV+EK  Y+YNSNSC  G  CGHYTQVVWRSS
Sbjct  70   AMKHSNGPYGENLAAAMPSLSGTNAVKMWVNEKQFYBYNSNSCAAGKVCGHYTQVVWRSS  129

Query  276  VRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VRLGC +  CNNGW  + C+Y P GN  GQRPY
Sbjct  130  VRLGCAKVHCNNGWDFVICNYAPRGNYVGQRPY  162



>ref|XP_002274275.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=161

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +  L+ +M +A+     AQN+P DY+N HN AR +VGV  MTWD+ +A+YAQN+A
Sbjct  3    LCKISLPLLVGLMGLALAHTCYAQNSPQDYVNAHNTARAQVGVGSMTWDDTVATYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGENLA   P L   DAV +WV EK  YDYNSNSCVGG+C HYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENLAWGSPSLTGTDAVNMWVAEKPYYDYNSNSCVGGECRHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVW +SVRLGC R +CN+G W ++C+YDP GN  GQ PY
Sbjct  123  VVWSNSVRLGCARVQCNSGGWFVTCNYDPPGNYQGQHPY  161



>ref|XP_006369711.1| Pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP66280.1| Pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
             +SK  +     + +  +  LS AQ++P DY+N HN+AR +VGV ++ WD  +A+YA ++
Sbjct  2    EISKNSLAIAFLIALAIIIPLSLAQDSPQDYVNAHNNARAQVGVGNIVWDTNVAAYASDY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
               LTGDC L HS GPYGENLA    DL  + AVKLWVDEK  YDYNSNSCVGG+C HYT
Sbjct  62   VKRLTGDCRLVHSGGPYGENLAGGSGDLTGSAAVKLWVDEKPKYDYNSNSCVGGECRHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVRLGC +ARC+NG  +ISC+Y P GN  GQRPY
Sbjct  122  QVVWRNSVRLGCAKARCSNGGTVISCNYSPPGNYVGQRPY  161



>ref|XP_006367089.1| PREDICTED: pathogenesis-related protein 1A1-like [Solanum tuberosum]
Length=179

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = -2

Query  648  KFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADS  469
            K+ ++ +  +    +F  S AQ    ++LN HN AR +VGV  MTWD  LA+YAQN+A+ 
Sbjct  2    KYSILVVCFITFAIIFHSSQAQTPQENFLNAHNAARRQVGVGPMTWDYGLAAYAQNYANQ  61

Query  468  LTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQV  292
              GDC + HSDGPYGENLA A+P LNAA AVK+W DEK  YDYNSN+C  G  CGHYTQV
Sbjct  62   RIGDCGMIHSDGPYGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCAPGKVCGHYTQV  121

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SVRLGC R RCN+GW  I+C+YDP GN  G+RPY
Sbjct  122  VWRDSVRLGCARVRCNSGWVFITCNYDPPGNYIGRRPY  159



>gb|ADN43429.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DY++ HN AR +VGV  +TW++ +A+YAQN+A+    DC L HS GPYGENLAK
Sbjct  25   AQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGGPYGENLAK  84

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                L   DAV LWV EK  YDYNSNSCVGG+CGHYTQVVWR+SVRLGC R +CNNGWW 
Sbjct  85   GSGSLTGTDAVNLWVGEKSYYDYNSNSCVGGECGHYTQVVWRNSVRLGCARVQCNNGWWF  144

Query  228  ISCSYDPAGNVSGQRPY  178
            ++C+YDP GN  GQRPY
Sbjct  145  VTCNYDPPGNYVGQRPY  161



>ref|XP_011030266.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=161

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
             +SK  +     + +  +  LS AQN+P DYLN HN+AR +V V ++ WDN +A+YA N+
Sbjct  2    EISKNSLAIAFLISLAIIIPLSLAQNSPQDYLNAHNNARAQVRVGNIVWDNNVAAYASNY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
               LTGDC L HS GPYGENLA +  DL  + AVKLWV+EK  YDYNSNSCVGG+C HYT
Sbjct  62   IKRLTGDCRLVHSGGPYGENLAGSSGDLTGSAAVKLWVNEKPKYDYNSNSCVGGECRHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVRLGC +ARC+NG  +ISC+Y P GN   QRPY
Sbjct  122  QVVWRNSVRLGCAKARCSNGGTVISCNYAPPGNYVNQRPY  161



>gb|ADN43443.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43444.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DY+N HN AR +VGV  MTW++ +A+YAQN+A+    DC L HS GPYGENLAK
Sbjct  25   AQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQNYANKRISDCNLVHSGGPYGENLAK  84

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                L   DAV LWV EK NYDYNSNSCVGG+C HYTQVVW +SVRLGC R +CNNGWW 
Sbjct  85   GSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQVVWSNSVRLGCARVQCNNGWWF  144

Query  228  ISCSYDPAGNVSGQRPY  178
            ++C+YDP GN  GQRPY
Sbjct  145  VTCNYDPPGNYVGQRPY  161



>ref|XP_010068342.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  4    LTIIISLVFISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK      +  AV LWV EK NY YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTSTFTSTYAVSLWVAEKQNYKYNTNTCSSGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R +CNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCARVQCNNGWWYVVCNYDPLGNYEGELPY  158



>gb|ADP69172.1| pathogenesis related protein-1 [Populus tomentosa]
Length=161

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
             +SK  +     +       LS AQ++P DY+N HN+AR +VGV ++ WD  +A+YA N+
Sbjct  2    EISKNSLAIAFLIAFAITIPLSLAQDSPQDYVNAHNNARAQVGVGNIVWDTNVAAYASNY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
               LTGDC L HS GPYGENLA    DL  + AVKLWVDEK  YDYNSNSCVGG+C HYT
Sbjct  62   IKRLTGDCRLVHSGGPYGENLAGGSGDLTGSAAVKLWVDEKPKYDYNSNSCVGGECRHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVRLGC +A+C+NG  +ISC+Y P GN  GQRPY
Sbjct  122  QVVWRNSVRLGCAKAKCSNGGTVISCNYSPPGNYVGQRPY  161



>ref|XP_003545770.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|KHN33604.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score =   194 bits (492),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
            FPV+ +L ++MI +  ++ AQ++PADY+N HN AR EVGV ++ WD+ +A++AQN+A+  
Sbjct  8    FPVLCVLGLVMI-VSHVANAQDSPADYVNAHNAARSEVGVQNLAWDDTVAAFAQNYANQR  66

Query  465  TGDCALNHSDG--PYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
             GDC L HS G   YGENLA +  DL+  DAVKLWVDEK NYDYNSNSCVGG+C HYTQV
Sbjct  67   KGDCQLIHSGGGGQYGENLAMSTGDLSGTDAVKLWVDEKSNYDYNSNSCVGGECLHYTQV  126

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SVRLGC +  C+NG   I+C+Y P GN  GQRPY
Sbjct  127  VWRDSVRLGCAKVACDNGGTFITCNYAPPGNYVGQRPY  164



>ref|XP_010052998.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 ref|XP_010068340.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  4    LTIIISLVFISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTSTFTGTYAVSLWVAEKQNYNYNTNTCSSGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R +CNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCARVQCNNGWWYVVCNYDPPGNYEGELPY  158



>gb|ADN43441.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DY N HN AR +VGV  MTW++ +A+YAQN+A+    DC L HS GPYGENLAK
Sbjct  25   AQNSPQDYANAHNAARAQVGVGSMTWNDTVAAYAQNYANKRISDCNLVHSGGPYGENLAK  84

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                L   DAV LWV EK NYDYNSNSCVGG+C HYTQ+VW +SVRLGC R +CNNGWW 
Sbjct  85   GSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQIVWSNSVRLGCARVQCNNGWWF  144

Query  228  ISCSYDPAGNVSGQRPY  178
            ++C+YDP GN  GQRPY
Sbjct  145  VTCNYDPPGNYVGQRPY  161



>emb|CAD38276.1| pathogenesis related protein isoform b1 [Solanum phureja]
Length=159

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMI-AMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +  F +  LL+ +MI A+F    AQN+P DYL  HNDAR +VGV  M+WD  LAS AQN+
Sbjct  1    MGLFNISLLLTCLMILAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNY  60

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+S TGDC L HS    GENLAK   D     AV+LWV EK NY+Y +N C  G  CGHY
Sbjct  61   ANSRTGDCNLIHSGA--GENLAKGSGDFTGRAAVQLWVGEKPNYNYGTNQCASGQVCGHY  118

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  119  TQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNYVGQRPY  159



>ref|XP_002522070.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40270.1| STS14 protein precursor, putative [Ricinus communis]
Length=162

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -2

Query  642  PVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLT  463
            P +AL+ ++ IA+   S AQ+   DYLN HN AR +VG+  +TWD+K+ASYAQ+HA+   
Sbjct  6    PSLALVCIISIALIFSSHAQDTQQDYLNAHNSARGDVGLGPLTWDDKVASYAQHHANQHK  65

Query  462  GDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVW  286
             DC+L HS+GPYGENLA +  DL+  DAVK+W+DEK  YDYNSNSC  G  CGHYTQVVW
Sbjct  66   SDCSLVHSEGPYGENLAWSSGDLSGTDAVKMWIDEKPYYDYNSNSCASGQICGHYTQVVW  125

Query  285  RSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            RSSVRLGC +  CNNG   I C+YDP GN  GQRPY
Sbjct  126  RSSVRLGCAKVSCNNGGTFIGCNYDPPGNYIGQRPY  161



>gb|AES63607.2| CAP, cysteine-rich secretory protein, antigen 5, partial [Medicago 
truncatula]
Length=164

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L+ F + + LS M I++     AQN+P D+L  HN ARDEVGV  + W+  L +YAQN+A
Sbjct  11   LAIFFICSTLSCMNISL-----AQNSPQDFLEVHNQARDEVGVGPLYWEQTLEAYAQNYA  65

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    +C L HS GPYGENLA+ Y ++N  D+VK W+ EK NYDYNSNSCV  +CGHYTQ
Sbjct  66   NKRIKNCELEHSMGPYGENLAEGYGEVNGTDSVKFWLSEKPNYDYNSNSCVNDECGHYTQ  125

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            ++WR SV LGC +++C NGW  + CSY P GNV G+RPY
Sbjct  126  IIWRDSVHLGCAKSKCKNGWVFVICSYSPPGNVEGERPY  164



>ref|XP_011016555.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=159

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
             SKF + A L  M     +++ AQN+P DY++ HN  R EVGV  +TW+N +A+YAQ +A
Sbjct  3    FSKFLLAAYL--MASVSVNITLAQNSPQDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYA  60

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +S    C L HS GPYGEN+A+ Y +LN  DAVK+W  EK  Y +++NSCVG +C HYTQ
Sbjct  61   NSRVEKCELEHSGGPYGENIAEGYGNLNGVDAVKMWASEKPFYSHDTNSCVGDECLHYTQ  120

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR SV LGCGRA+C NGWW ++C+YDP GN+ GQ PY
Sbjct  121  VVWRKSVHLGCGRAKCKNGWWFVTCNYDPVGNIEGQSPY  159



>ref|XP_004289699.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=162

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
             LSK  +++L+S++ +A+   + AQN+P DYLN HN AR  VGV  +TWD  LA+YAQ +
Sbjct  2    ELSKISILSLISLVALALLHSTHAQNSPQDYLNAHNSARAAVGVGGLTWDPNLAAYAQRY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+S  GDC L HS+GPYGENLAK+  DL+   AV LWV EK  Y+YNSN+C  G  CGHY
Sbjct  62   ANSHYGDCNLVHSNGPYGENLAKSSGDLSGTSAVNLWVGEKAYYNYNSNTCASGRVCGHY  121

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR SVR+GC R +C NG   I C+YDP GN  GQ+PY
Sbjct  122  TQVVWRKSVRVGCARVKCMNGGTFIGCNYDPRGNYVGQKPY  162



>ref|XP_011002613.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=159

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
             SKF + A L  M     +++ AQN+P DY++ HN  R EVGV  +TW+N +A+YAQ +A
Sbjct  3    FSKFLLAAYL--MASVSVNITLAQNSPQDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYA  60

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +S    C L HS GPYGEN+A+ Y +LN  DAVK+W  EK  Y + +NSCVG +C HYTQ
Sbjct  61   NSRVEKCELEHSGGPYGENIAEGYGNLNGVDAVKMWASEKPFYSHGTNSCVGDECLHYTQ  120

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR SV LGCGRA+C NGWW ++C+YDP GN+ GQ PY
Sbjct  121  VVWRKSVHLGCGRAKCKNGWWFVTCNYDPVGNIEGQSPY  159



>ref|XP_003593356.1| Pathogenesis-related protein [Medicago truncatula]
Length=158

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L+ F + + LS M I++     AQN+P D+L  HN ARDEVGV  + W+  L +YAQN+A
Sbjct  5    LAIFFICSTLSCMNISL-----AQNSPQDFLEVHNQARDEVGVGPLYWEQTLEAYAQNYA  59

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    +C L HS GPYGENLA+ Y ++N  D+VK W+ EK NYDYNSNSCV  +CGHYTQ
Sbjct  60   NKRIKNCELEHSMGPYGENLAEGYGEVNGTDSVKFWLSEKPNYDYNSNSCVNDECGHYTQ  119

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            ++WR SV LGC +++C NGW  + CSY P GNV G+RPY
Sbjct  120  IIWRDSVHLGCAKSKCKNGWVFVICSYSPPGNVEGERPY  158



>gb|ADB54822.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=176

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K     ++  M + +  +S AQN+  D+L+ HN  R EVGV  M+WDN +A+YAQN+ 
Sbjct  3    LCKISSSLVVGFMGLVLAHISYAQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQNYT  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGENLA   P L   DAV LWV EK NYDYNSNSCVGG+C HYTQ
Sbjct  63   NQRIGDCNLVHSGGPYGENLAWGSPSLTGIDAVNLWVGEKINYDYNSNSCVGGECLHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            V+WR+S+RLGC R +C+NG W I+C+YDP GN  GQRP+
Sbjct  123  VIWRNSLRLGCARVQCDNGGWFITCNYDPPGNYMGQRPF  161



>ref|NP_001275095.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
 ref|XP_006345693.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 ref|XP_006345695.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 gb|AAL01594.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
Length=159

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMI-AMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +  F +  LL+ +M+ A+F    AQN+P DYL  HNDAR +VGV  M+WD  LAS AQN+
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNY  60

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+S TGDC L HS    GENLAK   D     AV+LWV EK NY+Y +N C  G  CGHY
Sbjct  61   ANSRTGDCNLIHSGA--GENLAKGTGDFTGRAAVQLWVGEKPNYNYGTNQCASGQVCGHY  118

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  119  TQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGQRPY  159



>ref|XP_006422719.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
 gb|ESR35959.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
Length=159

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 3/155 (2%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+L ++ +A   LS AQN+  DYL  HN+AR  V V  M WDNK+A+YAQN+A+   GD
Sbjct  6    LAILCLVALATTQLSSAQNSQQDYLRAHNEARASVRVGPMRWDNKVAAYAQNYANQRKGD  65

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS GPYGENLA +  DL    AVKLWVDE+  Y+YNSN+CVGG+C HYTQVVWR+S
Sbjct  66   CRLVHSGGPYGENLAWSSGDLTGTAAVKLWVDERPKYNYNSNTCVGGECRHYTQVVWRNS  125

Query  276  VRLGCGRARCNN--GWWLISCSYDPAGNVSGQRPY  178
            VRLGC R +CNN  G ++I CSYDP GNV+G+RPY
Sbjct  126  VRLGCARVKCNNNRGTFVI-CSYDPPGNVAGKRPY  159



>gb|ADN43430.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  +   + +M  A+     AQN+P DY++PHN AR +VGV  +TW++ +A+YAQN+A
Sbjct  3    LFKISLALXVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GD  L HS GPYGEN+A   P L   DAV +WV EK NYDYNSNSCVGG+CGHYTQ
Sbjct  63   NQRIGDRNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCVGGECGHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VV R+SVRLGC R +C+NG W ++C+YDP GN  GQRPY
Sbjct  123  VVRRNSVRLGCARVQCDNGGWFVTCNYDPLGNYVGQRPY  161



>ref|XP_011030276.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=161

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
              +  L+S+ +I    LS AQN+P DYLN HN+AR +V V ++ WDN +A+YA N+   L
Sbjct  8    LAIAFLISLAII--IPLSLAQNSPQDYLNAHNNARAQVRVGNIVWDNNVAAYASNYIKRL  65

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVW  286
             GDC L HS GPYGENLA +  DL  + AVKLWV+EK  YDYNSNSCVGG+C HYTQVVW
Sbjct  66   AGDCRLVHSGGPYGENLAGSSGDLTGSAAVKLWVNEKPKYDYNSNSCVGGECRHYTQVVW  125

Query  285  RSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R+SVRLGC +ARC+NG  +ISC+Y P GN   QRPY
Sbjct  126  RNSVRLGCAKARCSNGGTVISCNYAPPGNYVNQRPY  161



>emb|CAB58263.1| pathogenesis related protein PR-1 [Solanum tuberosum]
Length=159

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMI-AMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +  F +  LL+ +M+ A+F    AQN+P DYL  HNDAR +VGV  M+WD  LAS AQN+
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNY  60

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+S TGDC L HS    GENLAK   D     AV+LWV EK NY+Y +N C  G  CGHY
Sbjct  61   ANSRTGDCNLIHSGA--GENLAKGSGDFTGRAAVQLWVGEKPNYNYGTNQCASGQVCGHY  118

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  119  TQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGQRPY  159



>ref|XP_002265050.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI35453.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K  V     +    +   S AQN+  DYLN HN AR +V V  MTW+N +A+YAQ++A
Sbjct  3    LCKISVALACLIGSALLVHTSYAQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS+GPYGENLAK         AV LWV EK NYDYNSNSCVGG+C HYTQ
Sbjct  63   NKQIGDCNLVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKPNYDYNSNSCVGGECRHYTQ  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SV LGC RA+CNNGWW I C+Y P GN  GQRPY
Sbjct  123  VVWRNSVSLGCARAQCNNGWWYIICNYYPPGNYIGQRPY  161



>gb|AAQ19681.1| cytoplasmic small heat shock protein class I [Capsicum frutescens]
Length=158

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 117/159 (74%), Gaps = 3/159 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L   P++ L+ ++++A+F    AQN+P DYL  HN+AR +VGV  M+WD  LAS AQN+A
Sbjct  3    LFNIPLL-LVCLIVLAIFHSCHAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +S TGDC+L HS    GENLAK   D     AV+LWV EK NY++ +N C GG+C HYTQ
Sbjct  62   NSRTGDCSLIHSGA--GENLAKGGGDYTGRRAVELWVSEKPNYNHATNQCAGGECRHYTQ  119

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  120  VVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGQRPY  158



>ref|XP_007201285.1| hypothetical protein PRUPE_ppa012617mg [Prunus persica]
 gb|AEV57468.1| pathogensis-related protein 1a, partial [Prunus persica]
 gb|EMJ02484.1| hypothetical protein PRUPE_ppa012617mg [Prunus persica]
Length=161

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            LSK    A + ++ +A+   +GAQ++P DYLN HN AR +VGV  +TWD  L +YAQ +A
Sbjct  3    LSKISF-AFVCLIGLALLQSTGAQDSPQDYLNAHNAARAQVGVAPLTWDPNLVAYAQRYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +S  GDC L HS+GPYGEN+AK+  DL+   AV L+V EK +YDYNSN+C  G  CGHYT
Sbjct  62   NSRAGDCNLVHSNGPYGENIAKSTGDLSGTAAVNLFVGEKPDYDYNSNTCAAGKMCGHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVRLGC +ARC NG   I C+YDP GN+ GQRPY
Sbjct  122  QVVWRNSVRLGCAKARCTNGGTFIGCNYDPRGNIRGQRPY  161



>gb|ADN43442.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DY++ HN AR +VGV  +TW++ +A+YAQN+A+    DC L HS GPYGENLAK
Sbjct  25   AQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGGPYGENLAK  84

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                L   DAV LWV EK  YDYNSNSCVGG+CG YTQVVWR+SVRLGC R +CNNGWW 
Sbjct  85   GSGSLTGTDAVNLWVGEKPYYDYNSNSCVGGECGLYTQVVWRNSVRLGCARVQCNNGWWF  144

Query  228  ISCSYDPAGNVSGQRPY  178
            ++C+YDP GN  GQRPY
Sbjct  145  VTCNYDPPGNYVGQRPY  161



>ref|XP_010065853.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ +++F  + AQN+P DYL+ HN AR +VGV +MTWDN LA+YAQ++A+    
Sbjct  4    LTIIISLVSVSLFQPTHAQNSPQDYLDSHNAARKQVGVVNMTWDNTLATYAQSYANQRVS  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTGTFTGTYAVGLWVAEKQNYNYNTNTCASGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC + RCNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCAKVRCNNGWWYVVCNYDPPGNYEGELPY  158



>ref|XP_010054707.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  4    LTIIISLVFISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV  K NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTSTFTGTYAVSLWVAGKQNYNYNTNTCSSGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R +CNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCARVQCNNGWWYVVCNYDPPGNYEGELPY  158



>gb|ADN43440.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DY+N HN AR +VGV  MT ++ +A+YAQN+A+    DC L HS GPYGENLAK
Sbjct  25   AQNSPQDYVNAHNAARAQVGVGSMTRNDTVAAYAQNYANKRISDCNLVHSGGPYGENLAK  84

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                L   DAV LWV EK NYDYNSNSCVGG+C HYTQVVW +SVRLGC R +CNNGWW 
Sbjct  85   GSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQVVWSNSVRLGCARVQCNNGWWF  144

Query  228  ISCSYDPAGNVSGQRPY  178
            ++C+YDP GN  GQRPY
Sbjct  145  VTCNYDPPGNYVGQRPY  161



>gb|AAX20041.1| cytoplasmic small heat shock protein class I [Capsicum annuum]
 gb|AHZ65519.1| cytoplasmic small heat shock protein class I [Capsicum annuum 
Conoides Group]
Length=158

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L   P++ L+ ++++A+F    AQN+P DYL  HN+AR +VGV  M+WD  LAS AQN+A
Sbjct  3    LFNIPLL-LVCLIVLAIFHSCHAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +S TGDC L HS    GENLAK   D     AV+LWV EK NY++ +N C GG+C HYTQ
Sbjct  62   NSRTGDCNLIHSGA--GENLAKGGGDYTGRRAVELWVSEKPNYNHATNQCAGGECRHYTQ  119

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+SVRLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  120  VVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGQRPY  158



>ref|XP_011092471.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
             P +++LS+ ++    L+ AQN+P D+L  HN  R +VGVP + W+  L +YAQ++A   
Sbjct  3    IPKLSILSICLMVALQLACAQNSPGDFLKAHNAGRAQVGVPPLAWNETLVAYAQDYAKKR  62

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVV  289
            +GDCA+ HSDGPYGENLA    D+NA +AV++W+DEK  YD  SNSC+GG+ C HYTQVV
Sbjct  63   SGDCAMKHSDGPYGENLAAGSWDVNAKEAVQMWLDEKKFYDVGSNSCIGGEPCLHYTQVV  122

Query  288  WRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            WR S  +GC RA+C+NGW  ++C+YDP GN  G+RPY
Sbjct  123  WRGSTHVGCARAKCSNGWTFVTCNYDPPGNYVGERPY  159



>ref|XP_007148303.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
 gb|ESW20297.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
Length=166

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = -2

Query  666  KMGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYA  487
            KMG L K    AL  + ++ + D+  AQ++ ADY+N HN AR +VGVP++ WDN +AS+A
Sbjct  2    KMG-LCKLSFFALSVLGLVIVGDVVYAQDSIADYVNEHNAARSQVGVPNIVWDNTVASFA  60

Query  486  QNHADSLTGDCALNHSDG--PYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD  313
            QN+A+   GDC L HS G   YGENLAK+  DL+  DAVKLWVDEK  YDYNSNSC  G 
Sbjct  61   QNYANQRQGDCNLIHSGGGGKYGENLAKSSGDLSGKDAVKLWVDEKQYYDYNSNSCAAGQ  120

Query  312  -CGHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             CGHYTQVVWR+SVR+GC + RC+NG   I+C+Y P GN  GQ+PY
Sbjct  121  QCGHYTQVVWRNSVRVGCAKVRCSNGGTFITCNYSPPGNYVGQKPY  166



>ref|NP_001234523.1| pathogenesis-related leaf protein 4 precursor [Solanum lycopersicum]
 sp|Q04108.1|PR04_SOLLC RecName: Full=Pathogenesis-related leaf protein 4; Short=P4; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA03615.1| pathogenesis-related protein P4 [Solanum lycopersicum]
 emb|CAA09671.1| pathogenesis-related protein PR1a (P4) [Solanum lycopersicum]
Length=159

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 115/161 (71%), Gaps = 4/161 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMI-AMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +  F +  LL+ +M+ A+F    AQN+P DYL  HNDAR +VGV  M+WD  LAS AQN+
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNY  60

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+S  GDC L HS    GENLAK   D     AV+LWV E+ +Y+Y +N CVGG  CGHY
Sbjct  61   ANSRAGDCNLIHSGA--GENLAKGGGDFTGRAAVQLWVSERPDYNYATNQCVGGKMCGHY  118

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGCGRARCNNGWW ISC+YDP GN  G+RPY
Sbjct  119  TQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGERPY  159



>ref|XP_011092473.1| PREDICTED: pathogenesis-related leaf protein 6-like [Sesamum 
indicum]
Length=162

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALL--SVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
            + K  +VAL   ++  I  +    AQN+P DY++ HN AR +VGV  + WD K+A++A+N
Sbjct  1    MHKTILVALFFFAIATILQYSSCHAQNSPQDYVSAHNAARAQVGVGPIAWDEKVAAFARN  60

Query  480  HADSLTGDCALNHS-DGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            + +   GDC L HS + PYGENLAK   +     AV+LWV EK  YDY+SNSCVGG+C H
Sbjct  61   YVNQRIGDCNLVHSTNRPYGENLAKGSGEFTGRAAVELWVREKPFYDYSSNSCVGGECLH  120

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVR+GC RARCNNGWW ISC+YDP GN  GQRPY
Sbjct  121  YTQVVWRNSVRVGCARARCNNGWWFISCNYDPPGNYIGQRPY  162



>ref|XP_006422707.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
 gb|ESR35947.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
Length=159

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+L ++ +    LS AQN+  DYL  HN+AR  V V  M WDNK+A+YA+N+A+   GD
Sbjct  6    LAILCLVALVTTQLSSAQNSQQDYLRAHNEARASVRVGPMRWDNKVAAYAKNYANQRKGD  65

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS GPYGENLA +  DL    AVKLWVDE+  Y+YNSN+CVGG+C HYTQVVWR+S
Sbjct  66   CRLVHSGGPYGENLAWSSGDLTGTAAVKLWVDERPKYNYNSNTCVGGECRHYTQVVWRNS  125

Query  276  VRLGCGRARCNN--GWWLISCSYDPAGNVSGQRPY  178
            VRLGC R +CNN  G ++I CSYDP GNV+G+RPY
Sbjct  126  VRLGCARVKCNNNRGTFVI-CSYDPPGNVAGKRPY  159



>gb|KDP35893.1| hypothetical protein JCGZ_09865 [Jatropha curcas]
Length=160

 Score =   188 bits (478),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            LSK  ++  + V    + +LS AQN+P DY++ HN  R  VGVP +T +  +A+YAQ +A
Sbjct  2    LSKLLLLGTVLVGFTVLVELSLAQNSPQDYVDAHNSVRARVGVPPITCNRTVAAYAQEYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +S   +C   HS GPYGEN+A+ Y +LN  DAV +WV EK NYD+ SNSCVG +C HYTQ
Sbjct  62   NSRVENCEFEHSYGPYGENIAEGYGNLNGVDAVAMWVTEKANYDHKSNSCVGDECLHYTQ  121

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWRSSV LGC  A+C NGWW ++C+YDP GN+ GQRPY
Sbjct  122  VVWRSSVHLGCRWAKCKNGWWFVTCNYDPVGNIEGQRPY  160



>ref|XP_010095625.1| hypothetical protein L484_003726 [Morus notabilis]
 gb|EXB61532.1| hypothetical protein L484_003726 [Morus notabilis]
Length=167

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 120/165 (73%), Gaps = 7/165 (4%)
 Frame = -2

Query  651  SKFPVVALLS-----VMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYA  487
            S  P V+L++     ++ +AM   S AQ++P D+LN HN AR EVGV  MTWD+K+ASYA
Sbjct  3    SGRPTVSLVTLFPCVIIGLAMLQASNAQDSPQDFLNAHNSARAEVGVGQMTWDDKVASYA  62

Query  486  QNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-C  310
            Q +A+S  GDC++ HS GPYGENLA +  DL+  DAV++WV+EK +YDY SN+C  G  C
Sbjct  63   QQYANSHIGDCSMVHSGGPYGENLAWSSGDLSGTDAVRMWVNEKADYDYGSNTCASGKVC  122

Query  309  GHYTQVVWRSSVRLGCGRARCNNG-WWLISCSYDPAGNVSGQRPY  178
            GHYTQVVWR+SVRLGC + RCNN    LI C+YDP GN  GQ+PY
Sbjct  123  GHYTQVVWRNSVRLGCAKVRCNNNKGTLIGCNYDPRGNYVGQKPY  167



>ref|XP_010270273.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nelumbo 
nucifera]
Length=167

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +AL+ ++   ++ +S AQN+P DYLN HN AR +VGV  M WDN +A+YA+N+A+    D
Sbjct  8    LALVLLISFGLWHVSQAQNSPQDYLNAHNAARAQVGVGPMRWDNNVAAYARNYANQRIRD  67

Query  456  CALNHSDGP-YGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            C L HS G  YGENLAK        DAV LWV EK  YDYNSNSC+GG C HYTQVVWR 
Sbjct  68   CNLVHSGGGLYGENLAKGSGAFTGVDAVNLWVKEKPFYDYNSNSCIGGQCLHYTQVVWRD  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVRLGC R RCNNGW+ ++C+YDP GN  G+RPY
Sbjct  128  SVRLGCARVRCNNGWFFVTCNYDPPGNFIGERPY  161



>emb|CAN68901.1| hypothetical protein VITISV_019988 [Vitis vinifera]
Length=150

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            + L S +++     S AQN+  DYLN HN AR +V V  MTW+N +A+YAQ++A+   GD
Sbjct  1    MGLCSALLV---HTSFAQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYANKQIGD  57

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS+GPYGENLAK         AV LWV EK NYDY+SNSCVGG+C HYTQVVWR+S
Sbjct  58   CNLVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKPNYDYSSNSCVGGECRHYTQVVWRNS  117

Query  276  VRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            V LGC RA+CNNGWW I C+Y P GN  GQRPY
Sbjct  118  VSLGCARAQCNNGWWFIICNYYPPGNYIGQRPY  150



>gb|AFK38989.1| unknown [Medicago truncatula]
 gb|AES63608.2| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=159

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            +S F ++ +L + +I +  ++ AQN+ ADY+N HN+AR +VGV ++ WDN LA+ AQN+A
Sbjct  1    MSSFSLICVLGLFII-IGHVAHAQNSQADYVNSHNEARRQVGVANVVWDNNLATVAQNYA  59

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +S  GDC L HS G YGENLA +  DL+  DAV+LWV+EK++Y+YNSN+C  G  CGHYT
Sbjct  60   NSRRGDCRLTHSGGRYGENLAGSTGDLSGTDAVRLWVNEKNDYNYNSNTCASGKVCGHYT  119

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR++ R+GC + RCNNG   I C+YDP GN  GQ+PY
Sbjct  120  QVVWRNTKRIGCAKVRCNNGGTFIICNYDPPGNYVGQKPY  159



>ref|XP_010053002.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW77216.1| hypothetical protein EUGRSUZ_D01570 [Eucalyptus grandis]
Length=158

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  + AQN+P DYLN HN AR +VGV +MTWDN LA+YAQ++A+    
Sbjct  4    LTIIISLVSISLFQPTHAQNSPQDYLNSHNAARKQVGVANMTWDNTLAAYAQSYANQRVS  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC L HS+GPYGENLAK         AV LWV EK NY+Y++N+C  G +C HYTQ+VWR
Sbjct  64   DCGLVHSNGPYGENLAKGTGTFTGTYAVSLWVAEKQNYNYDTNTCASGCNCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC + +CNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCAKVQCNNGWWYVMCNYDPPGNYEGELPY  158



>ref|XP_003545772.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|KHN33606.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=165

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
            F V+ LL ++++     + AQ++P D++N HN AR +VGVP++ WD+ +A++AQN+A+  
Sbjct  9    FSVLCLLGLVIVGDH-AAYAQDSPTDFVNAHNAARSQVGVPNIVWDDTVAAFAQNYANQR  67

Query  465  TGDCALNHS--DGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
             GDC L HS  DG YGENLA +  +L+  +AVKLWVDEK  YDYNSN+CVGG+C HYTQV
Sbjct  68   KGDCKLVHSGGDGKYGENLAGSTGNLSGTNAVKLWVDEKSKYDYNSNTCVGGECRHYTQV  127

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VW++SVRLGCG+ RC+NG   I+C+Y P GN  GQRPY
Sbjct  128  VWKNSVRLGCGKVRCDNGGTFITCNYAPPGNYVGQRPY  165



>ref|XP_006369712.1| hypothetical protein POPTR_0001s29540g [Populus trichocarpa]
 gb|ERP66281.1| hypothetical protein POPTR_0001s29540g [Populus trichocarpa]
Length=215

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 4/156 (3%)
 Frame = -2

Query  633  ALLSVMMIAM----FDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
            ALLS   IA+      LS AQ++P DYLN H +AR +VGV +  WDN +A+YA ++   L
Sbjct  60   ALLSDCRIALSPIIIPLSLAQDSPQDYLNAHANARAQVGVGNNVWDNNVAAYASDYVKRL  119

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVW  286
            TGDC L HS GPYGENLA +  DL  +DAVKLWVDEK NYDYNS+SCVGG+C HYTQV+W
Sbjct  120  TGDCRLVHSGGPYGENLAWSSGDLTGSDAVKLWVDEKSNYDYNSDSCVGGECRHYTQVIW  179

Query  285  RSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R+S RLGC +ARC+NG  LISC+Y P+GN   +RPY
Sbjct  180  RNSFRLGCAKARCSNGGTLISCNYAPSGNFVNERPY  215



>ref|XP_011030277.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=161

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
             +SK  V     + +  +   S AQ++P DYLN H +AR +VGV ++ WDN +A+YA N+
Sbjct  2    EISKNSVAIAFLISLAIIIPPSLAQDSPQDYLNAHTNARAQVGVGNIVWDNNVAAYASNY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
               L GDC L HS GPYGENLA +  DL  + AVKLWVDEK  YDYNS+SCVGG+C HYT
Sbjct  62   IKRLAGDCRLVHSGGPYGENLAGSSGDLTGSAAVKLWVDEKPKYDYNSDSCVGGECRHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+S RLGC +ARCN+G  +ISC+Y P+GN   +RPY
Sbjct  122  QVVWRNSFRLGCAKARCNSGGTVISCNYAPSGNFVNERPY  161



>dbj|BAD11072.1| pathogenesis-related protein 1 [Capsicum chinense]
Length=161

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            + L+S+M++A+F    AQN+P DYL  HN+AR +VGV  MTWD  LAS AQN+A+S TGD
Sbjct  8    LLLVSLMILAIFHSCDAQNSPQDYLEVHNNARAQVGVGPMTWDAGLASRAQNYANSRTGD  67

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRS  280
            C L HS GP GENLAK   D     AV+LWV EK NY++ +N C  G  CGHYTQVVWR+
Sbjct  68   CNLIHS-GP-GENLAKGGGDFTGRAAVELWVFEKPNYNHGTNQCASGKVCGHYTQVVWRN  125

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRP  181
            SVRLGCGRARCNNGWW ISC+YDP GN +GQ P
Sbjct  126  SVRLGCGRARCNNGWWFISCNYDPVGNWAGQSP  158



>ref|NP_001234314.1| pathogenesis-related leaf protein 6 precursor [Solanum lycopersicum]
 sp|P04284.2|PR06_SOLLC RecName: Full=Pathogenesis-related leaf protein 6; Short=P6; 
AltName: Full=Ethylene-induced protein P1; AltName: Full=P14; 
AltName: Full=P14A; AltName: Full=PR protein; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA48672.1| P1(p14) protein [Solanum lycopersicum]
 gb|AAA03616.1| pathogenesis-related protein P6 [Solanum lycopersicum]
 emb|CAA70042.1| PR protein [Solanum lycopersicum]
Length=159

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMI-AMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +  F +  LL+ +M+ A+F    AQN+P DYL  HNDAR +VGV  M+WD  LAS AQN+
Sbjct  1    MGLFNISLLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNY  60

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+S  GDC L HS    GENLAK   D     AV+LWV E+ +Y+Y +N CVGG  C HY
Sbjct  61   ANSRAGDCNLIHSGA--GENLAKGGGDFTGRAAVQLWVSERPSYNYATNQCVGGKKCRHY  118

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  119  TQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWIGQRPY  159



>ref|XP_009605697.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
tomentosiformis]
Length=163

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
            L+  +++A    S AQN+  DYL  HN AR +VGV  +TWD  LA+YAQN+A+   GDC 
Sbjct  12   LICFIILAFAFPSHAQNSQTDYLAAHNSARSQVGVSAITWDTTLANYAQNYANQRIGDCN  71

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSV  274
            L HS+GPYGENLAK         AV LWV EK  YDY +N C GG+ C HYTQVVWR+SV
Sbjct  72   LVHSNGPYGENLAKGTGSFTGTAAVNLWVAEKPYYDYTNNYCTGGNQCLHYTQVVWRNSV  131

Query  273  RLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R+GC RA+CNNGWW + CSYDP GN  GQRPY
Sbjct  132  RVGCARAQCNNGWWFVICSYDPPGNYVGQRPY  163



>gb|KCW56841.1| hypothetical protein EUGRSUZ_I02509 [Eucalyptus grandis]
Length=164

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 113/158 (72%), Gaps = 0/158 (0%)
 Frame = -2

Query  651  SKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            S   +   +  ++ A+  +S AQN+  D+++ HN AR EVGV  +TW+  +A+YA+ +A+
Sbjct  7    SSLAIFVYIIGLICALAGISVAQNSHQDFVDEHNAARAEVGVGPITWNRTVAAYARKYAE  66

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
               GDC L HS GPYGENLAK Y  L+  D+VK+WV E+D+YDY+SNSCV G+C HYTQV
Sbjct  67   ERRGDCNLEHSGGPYGENLAKGYGVLSGRDSVKMWVGEEDDYDYSSNSCVVGECRHYTQV  126

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SV LGC R +C++GWW + CSYDP GN  G+RPY
Sbjct  127  VWRDSVHLGCARVKCDDGWWFVICSYDPPGNYEGERPY  164



>ref|XP_011092436.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
             P ++LLSV ++    L+ AQN+P DYL  HN  R +VGVP + W+  L +YA+++A   
Sbjct  3    IPKLSLLSVCLMVALQLACAQNSPDDYLKAHNAGRAQVGVPPLAWNETLVAYAEDYAKKR  62

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVV  289
             GDCA+ HSDGPYGENLAK   D+NA +AV++W+DEK  YD  +N+C+GG+ C HYTQVV
Sbjct  63   AGDCAMKHSDGPYGENLAKGSWDVNAKEAVQMWLDEKKFYDEATNTCIGGEPCLHYTQVV  122

Query  288  WRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            WR S  +GC R +C+NGW  ++C+YDP GN  G+RPY
Sbjct  123  WRGSTHVGCARVKCSNGWTFVTCNYDPPGNYVGERPY  159



>ref|XP_010245650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=163

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            +G + K     L  +++     L  AQ++P DYL+ HN  R EVGV  +TWD+K+A+YA 
Sbjct  2    VGVVYKLEFAHLFLLVLTLFHVLCHAQDSPEDYLHAHNIVRSEVGVGPLTWDSKVAAYAH  61

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            N+A    GDC L HSDGPYGEN+A         DAVK+W  EK  YDY SNSC+GG+CGH
Sbjct  62   NYASQRIGDCKLEHSDGPYGENIAGGGDPFPGVDAVKMWASEKQYYDYASNSCIGGECGH  121

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC +  CNNG   I C+YDP GN  G+RPY
Sbjct  122  YTQVVWRNSVRLGCAKVHCNNGGIFIICNYDPPGNYIGERPY  163



>ref|XP_007148301.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
 gb|ESW20295.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
Length=183

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIA--MFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
            L   P++ L+++++    +  +  AQN+P D+LN HN AR +VGV  M WD  +AS+AQN
Sbjct  3    LPMIPMLPLVAILLATSTLSQICDAQNSPQDFLNAHNTARSQVGVGPMRWDATVASFAQN  62

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHY  301
            + + L G+C + HS GPYGENLA +  DL A  AVKLWV EK  YDYNSN+CVGG+C HY
Sbjct  63   YVNKLKGNCKMVHSGGPYGENLAWSSGDLTATAAVKLWVGEKPYYDYNSNTCVGGECRHY  122

Query  300  TQVVWRSSVRLGCGRARCNNGW-WLISCSYDPAGNVSGQRPY  178
            TQVVWR+SVRLGC + RCN+G   +ISC+YDP GN  GQRP+
Sbjct  123  TQVVWRNSVRLGCAKVRCNDGRATIISCNYDPPGNYIGQRPF  164



>ref|XP_010065847.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW63537.1| hypothetical protein EUGRSUZ_G01173 [Eucalyptus grandis]
Length=158

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  + AQN+P DYLN HN AR +VGV +MTWDN LA+YAQ++A+    
Sbjct  4    LTIIISLVSISLFQPTHAQNSPQDYLNSHNAARKQVGVANMTWDNTLAAYAQSYANQRVS  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC L HS+GPYGENLAK         AV LWV EK NY+YN+N+C  G DC HYT++VW 
Sbjct  64   DCGLVHSNGPYGENLAKGTGTFTGTYAVSLWVTEKQNYNYNTNTCASGCDCLHYTKMVWC  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC + +CNNGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCAKVQCNNGWWYVVCNYDPPGNYEGELPY  158



>ref|XP_010029887.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Eucalyptus 
grandis]
Length=173

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 113/158 (72%), Gaps = 0/158 (0%)
 Frame = -2

Query  651  SKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            S   +   +  ++ A+  +S AQN+  D+++ HN AR EVGV  +TW+  +A+YA+ +A+
Sbjct  16   SSLAIFVYIIGLICALAGISVAQNSHQDFVDEHNAARAEVGVGPITWNRTVAAYARKYAE  75

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
               GDC L HS GPYGENLAK Y  L+  D+VK+WV E+D+YDY+SNSCV G+C HYTQV
Sbjct  76   ERRGDCNLEHSGGPYGENLAKGYGVLSGRDSVKMWVGEEDDYDYSSNSCVVGECRHYTQV  135

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SV LGC R +C++GWW + CSYDP GN  G+RPY
Sbjct  136  VWRDSVHLGCARVKCDDGWWFVICSYDPPGNYEGERPY  173



>ref|XP_006486833.1| PREDICTED: pathogenesis-related leaf protein 6-like [Citrus sinensis]
Length=159

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 114/155 (74%), Gaps = 3/155 (2%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+L ++ +A   LS AQN+  DYL  HN+ R  V V  M WDNK+A+YAQN+A+   GD
Sbjct  6    LAILCLVALATTQLSSAQNSQQDYLRAHNETRASVRVGPMRWDNKVAAYAQNYANQRKGD  65

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS GPY ENLA +  DL    AVKLWVDE+  Y+YNSN+CVGG+C HYTQVVWR+S
Sbjct  66   CRLVHSGGPYSENLAWSNGDLTGMAAVKLWVDERPKYNYNSNTCVGGECRHYTQVVWRNS  125

Query  276  VRLGCGRARCNN--GWWLISCSYDPAGNVSGQRPY  178
            VRLGC R +CNN  G ++I C+YDP GNV+GQRPY
Sbjct  126  VRLGCTRVKCNNNRGTFVI-CNYDPPGNVAGQRPY  159



>gb|AAB06458.1| pathogenesis-related protein PR1 [Brassica napus]
 gb|ABS11041.1| pathogenesis-related protein [Brassica oleracea var. gemmifera]
 emb|CDX89633.1| BnaC03g45470D [Brassica napus]
Length=162

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+ ++ A+   S AQN+P DY+N HN AR  VGV  + WD  LA++AQ++AD L G
Sbjct  9    LLLILAALVGALVHPSRAQNSPQDYVNAHNQARQAVGVGPVQWDGTLAAFAQSYADRLRG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS GPYGENLA +  D +   AV LWV+EK NY+Y SN+C+ G+C HYTQVVWR 
Sbjct  69   DCRLVHSGGPYGENLAWSSADFSGVSAVNLWVNEKANYNYASNTCINGECRHYTQVVWRK  128

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GCG+ARCNNG  +ISC+YDP GN   ++PY
Sbjct  129  SVRIGCGKARCNNGGTIISCNYDPRGNYVNEKPY  162



>emb|CDO97323.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = -2

Query  615  MIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSD  436
             +A    + AQN+P DYLN HN AR +VGV  MTWD  +A+YAQN+A+    DC L HS 
Sbjct  18   FLARVLPTHAQNSPQDYLNVHNSARSQVGVGPMTWDTTVAAYAQNYANQRISDCNLVHSQ  77

Query  435  GPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGR  256
            GPYGENLAK         A  LWV EK  Y+Y SNSCVGG+C HYTQVVWR SVRLGC R
Sbjct  78   GPYGENLAKGTGTFTGTAAANLWVAEKPYYNYTSNSCVGGECLHYTQVVWRDSVRLGCAR  137

Query  255  ARCNNGWWLISCSYDPAGNVSGQRPY  178
             +C N WW + CSYDP GN  GQRPY
Sbjct  138  VQCTNSWWFVICSYDPPGNYIGQRPY  163



>ref|XP_002522062.1| Protein PRY2 precursor, putative [Ricinus communis]
 gb|EEF40262.1| Protein PRY2 precursor, putative [Ricinus communis]
Length=161

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -2

Query  624  SVMM-IAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCAL  448
            +VM+   +  +S AQN+P DY+N HN  R E+GV  +TW+  +A+YAQ +A+S    C  
Sbjct  10   TVMVGTVLVHISLAQNSPQDYVNAHNTVRAEIGVGPITWNKTVAAYAQTYANSRIESCEF  69

Query  447  NHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG--DCGHYTQVVWRSSV  274
             HS GPYGEN+A+ Y +LN  DAV +WV EK NYDY SNSC GG  +C HYTQVVWR+SV
Sbjct  70   EHSYGPYGENIAEGYGNLNGVDAVNMWVSEKPNYDYGSNSCKGGEDECLHYTQVVWRNSV  129

Query  273  RLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             LGCGRA+C  GWW ++C+Y P GN+ GQRP+
Sbjct  130  HLGCGRAKCKTGWWFVTCNYHPVGNIEGQRPF  161



>ref|XP_007041425.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97256.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=159

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L+KF +   + ++   +  +S AQN+P DYL+ H+ AR +VGV  MTWD ++A+YAQ++A
Sbjct  3    LTKFSLA--ICLLASTLVHVSLAQNSPQDYLSVHDAARAQVGVGPMTWDPEVAAYAQDYA  60

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +    DC L HS GPYGEN+A+A   L  A+AV++WVDEK  Y+Y++N CVGG+C HYTQ
Sbjct  61   NIRVADCGLVHSYGPYGENIAEASYALTGAEAVQMWVDEKPYYNYDANICVGGECLHYTQ  120

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+S RLGC R  CN+GWW ++C+YDP GN  G+RPY
Sbjct  121  VVWRNSTRLGCARVECNSGWWFVTCNYDPPGNYVGERPY  159



>ref|XP_002313932.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE87887.2| pathogenesis-related family protein [Populus trichocarpa]
Length=160

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
            L+ ++ +A+   S AQN+  DYLN HN AR +V V ++ WDN +A+YA N+A+S   DC 
Sbjct  10   LVYLVSLALAHPSHAQNSQQDYLNAHNAARSQVTVANIIWDNTVAAYALNYANSRISDCN  69

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVR  271
            L HS+GPYGENLAK         AV LWV EK  YDY SNSCVGG C HYTQVVWR+SVR
Sbjct  70   LVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKPYYDYASNSCVGGQCLHYTQVVWRNSVR  129

Query  270  LGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +GC R +C NGWW +SC+YDP GN  G+RPY
Sbjct  130  VGCARVKCTNGWWFVSCNYDPPGNYIGERPY  160



>ref|XP_006486819.1| PREDICTED: pathogenesis-related protein 1-like, partial [Citrus 
sinensis]
Length=154

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 114/155 (74%), Gaps = 3/155 (2%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+L ++ +A   LS AQN+  DYL  HN+AR  V +  M WDNK+A+YAQN+A+    D
Sbjct  1    LAILCLVALATTQLSSAQNSQQDYLRAHNEARASVRIGPMRWDNKVAAYAQNYANQRKAD  60

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS GPYGENLA +  DL    AVKLWVDE+  Y+YNSN+CVGG+C HYTQVVW +S
Sbjct  61   CRLVHSGGPYGENLAWSSGDLTGTAAVKLWVDERPKYNYNSNTCVGGECRHYTQVVWHNS  120

Query  276  VRLGCGRARCNN--GWWLISCSYDPAGNVSGQRPY  178
            VRLGC R +CNN  G ++I CSYDP GNV+G+RPY
Sbjct  121  VRLGCARVKCNNNRGTFVI-CSYDPPGNVAGKRPY  154



>ref|XP_011091978.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 1/157 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
             P +++L + ++    L+ AQN+P D+L  HN  R +VGVP + W+  L +YAQ++A   
Sbjct  3    IPKLSILLICLMVALQLACAQNSPGDFLKAHNAGRAQVGVPPLAWNETLVAYAQDYAKKR  62

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVV  289
            +GDCA+ HSDGPYGENLA    D+NA + V++W+DEK  YD  SNSC+GG+ C HYTQVV
Sbjct  63   SGDCAMKHSDGPYGENLAAGSWDVNAKEVVQMWLDEKKFYDVGSNSCIGGEPCLHYTQVV  122

Query  288  WRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            WR S  +GC RA+C+NGW  ++C+YDP GN  G+RPY
Sbjct  123  WRGSTHVGCARAKCSNGWTFVTCNYDPPGNYVGERPY  159



>ref|XP_010052994.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW77195.1| hypothetical protein EUGRSUZ_D01544 [Eucalyptus grandis]
Length=158

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  + AQN+P DYLN HN AR +VGV +MTWDN LA+YAQ++A+    
Sbjct  4    LTIIISLVSISLFQPTHAQNSPQDYLNSHNAARKQVGVANMTWDNMLAAYAQSYANQRVN  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            D  L HS+GPYGENLAK         AV LWV EK NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DYGLVHSNGPYGENLAKGTGTFTGTSAVSLWVAEKQNYNYNTNTCASGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC + +C+NGWW + C+YDP GN  G+ PY
Sbjct  124  DSVRVGCAKVQCDNGWWYVVCNYDPPGNYEGELPY  158



>gb|AGK89727.1| pathogenesis-related 1 protein [Coffea canephora]
Length=162

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +AL S +++A+F  S  QN+  DY++ HN AR +VGV  + WD+ +A+YAQN+A+    D
Sbjct  8    LALFSFILLAIFWPSRTQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQNYANQRIND  67

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCV-GGDCGHYTQVVWRS  280
            C L HSDG YGENLA+   D    DAV LWV EK  YDYNSN+C  G  CGHYTQVVWR+
Sbjct  68   CNLEHSDGRYGENLAEGGGDFTGRDAVNLWVSEKQYYDYNSNTCAQGQQCGHYTQVVWRN  127

Query  279  SVRLGCGRARC-NNGWWLISCSYDPAGNVSGQRPY  178
            SVRLGC R +C NNGWW + CSYDP GN  GQRPY
Sbjct  128  SVRLGCARVQCTNNGWWFVICSYDPPGNYDGQRPY  162



>gb|AFK93500.1| pathogenesis related protein 1 isoform 1 [Ficus pumila var. awkeotsang]
Length=165

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = -2

Query  648  KFPVVALLSVMM-IAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            +  +VA   +++ +A    S AQ++P D++N H+ AR EVGV  +TWD+ +ASYAQ +A+
Sbjct  7    RVSLVAFTCLIIGLATLQASNAQDSPQDFVNAHSSARGEVGVGAITWDDTVASYAQQYAN  66

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQ  295
            S  GDC + HS GPYGENLA +  DL+  DAV++WV+EK NY+YNSNSC  G  CGHYTQ
Sbjct  67   SHIGDCNMVHSGGPYGENLAWSSGDLSGTDAVRMWVNEKANYNYNSNSCASGKVCGHYTQ  126

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR SVRLGC + RCNNG   I C+YDP GN  GQ+PY
Sbjct  127  VVWRKSVRLGCAKVRCNNGGTFIGCNYDPPGNYVGQKPY  165



>emb|CAD38277.1| pathogenesis related protein isoform b2 [Solanum phureja]
Length=159

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
             + +M++++F    AQN+P DYL  HNDAR +VGV  M+WD  LA+ AQN+A+S  GDC 
Sbjct  10   FICLMVLSIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLAARAQNYANSRIGDCN  69

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSV  274
            L HS    GENLAK   D     AV+LWV EK NY+Y++N C  G  CGHYTQVVWR+SV
Sbjct  70   LIHSGA--GENLAKGGGDYTGRRAVQLWVSEKPNYNYDTNQCASGKMCGHYTQVVWRNSV  127

Query  273  RLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            RLGCGRARCNNGWW ISC+YDP GN  GQRPY
Sbjct  128  RLGCGRARCNNGWWFISCNYDPVGNYVGQRPY  159



>ref|XP_011092435.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 111/157 (71%), Gaps = 1/157 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
             P ++LLSV ++    L+ AQN+P DYL  HN  R +VGVP + W   L +YA+++A   
Sbjct  3    IPKLSLLSVCLMVALQLACAQNSPDDYLKAHNAGRAQVGVPPLAWSETLVAYAEDYAKKR  62

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVV  289
             GDCA+ HSDGPYGENLAK   D+NA +AV++W+DEK  YD  +N+C+GG+ C HYTQVV
Sbjct  63   AGDCAMKHSDGPYGENLAKGSWDVNAKEAVQMWLDEKKFYDEATNTCIGGEPCLHYTQVV  122

Query  288  WRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            WR S  +GC + +C NGW  +SC+YDP GN  G+RPY
Sbjct  123  WRGSTHVGCAKVKCANGWAFVSCNYDPPGNYVGERPY  159



>ref|XP_003631695.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN83925.1| hypothetical protein VITISV_002104 [Vitis vinifera]
 emb|CBI25102.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K     ++  M + +  +S AQN+P D+L+ HN AR EVGV  MTW++ +A+YAQN+A
Sbjct  3    LCKISSSLVVGFMGLVLAHISYAQNSPQDFLDAHNAARAEVGVESMTWNDTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQ  295
            +   GDC L HS GPYGEN+A   P L   DAV +WV EK  YDYNSNSCVGG+C  Y +
Sbjct  63   NQRIGDCNLVHSSGPYGENIAWGTPSLTGTDAVNMWVGEKPYYDYNSNSCVGGECLQYIK  122

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            V+WR+S+ LGC R +CN G W ++C+YDP GN  GQRP+
Sbjct  123  VIWRNSLHLGCARVQCNTGGWFVTCNYDPPGNYVGQRPF  161



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +AL+ +M + +   S AQN+  DYLN HN AR +VGV  MTWDN +A+YAQ +A S  GD
Sbjct  8    LALVCLMSLVLVHPSYAQNSQQDYLNAHNAARAQVGVGPMTWDNNVAAYAQRYASSRMGD  67

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVG-GDCGHYTQVVWRS  280
            C L HS GPYGENLA+          V LWV EK  YDYNSNSCVG  +C HYTQVVWR+
Sbjct  68   CNLVHSGGPYGENLAEGNGSFTGTAGVNLWVGEKPYYDYNSNSCVGRKECRHYTQVVWRN  127

Query  279  SVRLGCGRARC-NNGWWLISCSYDPAGNVSGQRPY  178
            SVRLGC R +C NNGWW + CSYDP GN  GQRPY
Sbjct  128  SVRLGCARVQCTNNGWWFVICSYDPPGNYIGQRPY  162



>ref|XP_010943437.1| PREDICTED: pathogenesis-related protein 1B-like [Elaeis guineensis]
Length=191

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A +  + +++ + S AQN+P DYL PHN AR  VGV  MTWDN LA YA N+A++ TGD
Sbjct  11   LATIIAICLSITNPSVAQNSPQDYLQPHNAARRAVGVGPMTWDNTLARYALNYANTRTGD  70

Query  456  CALNHSDGPYGENLAKAYPDL-NAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            C L HS GPYGENL  + P +  AA AV  WVDE+  YDY +N+C  G  CGHYTQVVWR
Sbjct  71   CRLVHSRGPYGENLYMSSPSIATAARAVGAWVDERRFYDYRTNTCARGKVCGHYTQVVWR  130

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R RCNNG + I CSY+P GN+SG+RPY
Sbjct  131  DSVRVGCARVRCNNGNYFIICSYNPPGNISGRRPY  165



>ref|XP_003608310.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=908

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
            F + +L   ++   F  S AQN P D+++ HN AR +VGV ++TWDN +A+YA N+A+S 
Sbjct  7    FSLFSLFLTILSLWFSFSNAQNLPQDFVDAHNTARAQVGVANITWDNTVATYALNYANSR  66

Query  465  TGDCALNHSDGPYGENLAKAYP-DLNAADAVKLWVDEKDNYDYNSNSCV-GGDCGHYTQV  292
              DC L HS+GPYGENLAK          AV +WV+EK  YDYN+NSC+ GG C HYTQV
Sbjct  67   KSDCNLVHSNGPYGENLAKGSSGTFTGVTAVNMWVNEKQYYDYNTNSCINGGQCLHYTQV  126

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR+SVRLGC R +C NGWW ++C+YDP GN  GQ+PY
Sbjct  127  VWRNSVRLGCARVQCTNGWWFVTCNYDPPGNYVGQKPY  164



>ref|XP_009787160.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
sylvestris]
Length=163

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
            L+  +++A    S AQN+  DYLN HN AR +VGV  +TWD  LA+YAQN+A+   GDC 
Sbjct  12   LICFIILAFAFPSHAQNSQTDYLNAHNSARTQVGVSAITWDITLANYAQNYANQRIGDCN  71

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSV  274
            L HS+GPYGENLAK       A AV +WV EK  YDY +N C  G+ C HYTQVVW +SV
Sbjct  72   LVHSNGPYGENLAKGSGSFTGAAAVNMWVAEKPYYDYTNNCCTTGNQCLHYTQVVWSNSV  131

Query  273  RLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R+GC RA+C+NGWW + CSYDP GNV GQRPY
Sbjct  132  RVGCARAQCSNGWWFVICSYDPPGNVVGQRPY  163



>emb|CDO97325.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +AL+S +++A+F  S AQN+  DY++ HN AR +VGV  + WD+ +A+YAQN+A+    D
Sbjct  8    LALVSFILLAIFWPSRAQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQNYANQRIND  67

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCV-GGDCGHYTQVVWRS  280
            C L HS G YGENLA+   DL   DAV LWV EK  YDYNSN+C  G  CGHYTQVVWR 
Sbjct  68   CNLVHSGGRYGENLAEGSGDLTGRDAVNLWVSEKQYYDYNSNTCAQGQQCGHYTQVVWRD  127

Query  279  SVRLGCGRARC-NNGWWLISCSYDPAGNVSGQRPY  178
            SVRLGC R +C NNGWW + CSYDP GN  GQRPY
Sbjct  128  SVRLGCARVQCTNNGWWFVICSYDPPGNYVGQRPY  162



>ref|XP_010054710.1| PREDICTED: pathogenesis-related leaf protein 6-like [Eucalyptus 
grandis]
Length=211

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -2

Query  645  FPVVALLSVMM-IAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADS  469
            FP   +  V++ I++F  + AQN+P DYL+ HN AR +VGV +MTWDN LA+YAQ++A+ 
Sbjct  54   FPDKFIAHVLVSISLFQPTHAQNSPQDYLDSHNAARKQVGVANMTWDNMLAAYAQSYANQ  113

Query  468  LTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQV  292
               DC L HS+GPYGENLAK         AV LWV EK NY+YN+N+CV G DC HYTQ+
Sbjct  114  RVSDCGLVHSNGPYGENLAKGTGTFTGTYAVSLWVAEKQNYNYNTNTCVSGCDCLHYTQM  173

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SVR+GC + +CNNGWW + C+YDP GN  G+ PY
Sbjct  174  VWRDSVRVGCAKVQCNNGWWYVVCNYDPPGNYEGELPY  211



>emb|CBI25093.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 6/163 (4%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
              KF +   +    +A F L  AQ++P DY++ HN AR +VGV  +TW+  +A+YA+ +A
Sbjct  3    FHKFLLAIYIFGSALAHFSL--AQSSPQDYVDAHNAARAQVGVQPITWNETVAAYARRYA  60

Query  474  DSLTGD-CALNHSDGPYGENLAKAYPD---LNAADAVKLWVDEKDNYDYNSNSCVGGDCG  307
             S   + C++ HS GPYGENLA+ Y     L   DAV LWV EK NYDYNSNSCVGG CG
Sbjct  61   SSRVAEQCSMEHSGGPYGENLAEGYGSIGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCG  120

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWR+SVRLGC R +CNNG W ++C+YDP GN  GQRPY
Sbjct  121  HYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  163



>ref|XP_010252392.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
             +S+  +A   +  AQ+APADYLN HN AR +VGV  +TWD+ +A+YAQ +A+   GDCA
Sbjct  12   FVSIGALAWLHVCLAQDAPADYLNAHNAARADVGVGPLTWDDNVAAYAQAYANERAGDCA  71

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVR  271
            + HS GPYGENLA   P L+   AV+ WV EK  YDY+SNSCVGG+C HYTQVVW  SVR
Sbjct  72   MVHSGGPYGENLATGTPSLSGTAAVEGWVGEKQYYDYSSNSCVGGECLHYTQVVWSDSVR  131

Query  270  LGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            LGC +  CN+GW  + CSYDP GN  GQRPY
Sbjct  132  LGCAKVHCNSGWDFVICSYDPPGNYVGQRPY  162



>ref|XP_010068331.1| PREDICTED: protein PRY2-like [Eucalyptus grandis]
Length=433

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  279  LTIIISLVFISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  338

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY YN+N+C  G DC HYTQ+VWR
Sbjct  339  DCSLVHSNGPYGENLAKGTSTFTGTYAVSLWVAEKQNYKYNTNTCSSGCDCLHYTQMVWR  398

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R +CNNGW  + C+YDP GN  G+ PY
Sbjct  399  DSVRVGCARVQCNNGWQYVVCNYDPPGNYEGELPY  433



>ref|XP_010041202.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=163

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M   SK  +       ++A  + S AQ+   D+++ HN AR +VGV  + W++ +A+YAQ
Sbjct  1    MASFSKSSLAITCLTFLLAFAETSFAQSTHQDFVDAHNAARAQVGVAPLAWNDTVAAYAQ  60

Query  483  NHADSLTGD-CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCG  307
             +A+      CAL HS GPYGENLA+ Y +L+  DAVK+WV E+ NYD++SN+CVGG+C 
Sbjct  61   TYANKRAATGCALEHSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGGECL  120

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWRSS+ LGC R +C+NGWW ++C+YDP GN  G+ PY
Sbjct  121  HYTQVVWRSSIHLGCARVKCSNGWWFVTCNYDPPGNYEGESPY  163



>ref|XP_010065837.1| PREDICTED: pathogenesis-related protein 1A-like [Eucalyptus grandis]
Length=163

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M   +K  +       ++A+ + S AQ+   D+++ HN AR +VGV  +TW++ +A+YAQ
Sbjct  1    MASFNKSSLAITCLTFLLAIAETSLAQSTHQDFVDAHNGARAQVGVAPLTWNDTVAAYAQ  60

Query  483  NHADSLTGD-CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCG  307
             +A       CAL HS GPYGENLA+ Y +L+  DAVK+WV E+ NYD++SN+CVGG+C 
Sbjct  61   TYASKRAATGCALEHSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGGECL  120

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWRSS+ LGC R +C+NGWW ++C+YDP GN  G+ PY
Sbjct  121  HYTQVVWRSSIHLGCARVKCSNGWWFVTCNYDPPGNYEGESPY  163



>ref|XP_004246723.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
lycopersicum]
Length=159

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
             + L   M++A+F    AQN+P DYL  HN+AR +VGV  M+WD+ LA+ AQ +ADS  G
Sbjct  7    TLFLFCFMILAIFHSCDAQNSPQDYLVVHNNARGQVGVGPMSWDDALATKAQRYADSRRG  66

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC L HS GP GENLAK   D     A +LWV EK NY+Y +N C  G  CGHYTQVVWR
Sbjct  67   DCNLIHS-GP-GENLAKGSGDFTGRRASELWVAEKPNYNYGTNQCASGKVCGHYTQVVWR  124

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +S+RLGCGRARCNNGWW I C+Y P GN+ GQRPY
Sbjct  125  TSIRLGCGRARCNNGWWFICCNYAPFGNIIGQRPY  159



>ref|XP_009136247.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
 gb|AAB01666.1| PR-1a [Brassica napus]
 gb|AAB09587.1| pathogenesis-related protein PR1 [Brassica napus]
 gb|ABC94641.1| PR1 [Brassica juncea]
 gb|AFP86472.1| pathogenesis-related protein 1 [Brassica rapa subsp. chinensis]
 emb|CDX93141.1| BnaA03g38630D [Brassica napus]
Length=161

 Score =   183 bits (465),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+ ++ A+   S AQ++P DY+N HN AR  VGV  + WD  LA+YAQN+AD L G
Sbjct  9    LLLILAALVGALVHPSKAQDSPQDYVNAHNQARQAVGVGPVQWDGTLAAYAQNYADRLRG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HSDGPYGENLA +  D +   AV LWV+EK NY+++SN+C  G+C HYTQVVWR 
Sbjct  69   DCRLIHSDGPYGENLAGSSADFSGVSAVNLWVNEKANYNHDSNTC-NGECLHYTQVVWRK  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GCG+ARCNNG  +ISC+YDP GN   ++PY
Sbjct  128  SVRIGCGKARCNNGGTIISCNYDPRGNYVNEKPY  161



>ref|XP_002300292.2| Pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE85097.2| Pathogenesis-related family protein [Populus trichocarpa]
Length=167

 Score =   183 bits (465),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            ++SK   +A++S++ +A    + AQ++P D+LN HN AR  VGV  M WD+K+A++A+++
Sbjct  2    KMSKI-ALAIISLVSLATVHHAHAQDSPQDFLNAHNAARASVGVGPMRWDDKVAAFARSY  60

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
             + L   C + HS GPYGENLA   PDL    AVK+WVDE+ NYDYNSNSCVGG C HYT
Sbjct  61   INGLRDGCRMVHSGGPYGENLAWGSPDLAGTGAVKMWVDERANYDYNSNSCVGGQCLHYT  120

Query  297  QVVWRSSVRLGCGRARCNNG-WWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVRLGC + RCNNG   LISC+YDP GN + QRP+
Sbjct  121  QVVWRNSVRLGCAKVRCNNGAGTLISCNYDPPGNYNDQRPF  161



>ref|XP_006422718.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|ESR35958.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|KDO37560.1| hypothetical protein CISIN_1g048073mg [Citrus sinensis]
Length=164

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 2/164 (1%)
 Frame = -2

Query  666  KMGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYA  487
            KM  +S    +  +  + + +   S AQN+P DYL+ HN AR  V VP++ W++ +A+YA
Sbjct  2    KMSSISLALAICFMGSLAL-LIQTSHAQNSPQDYLDAHNSARAAVYVPNIIWNDTVAAYA  60

Query  486  QNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-C  310
            QN+++S   DC L HS GPYGENLAK         AV LWV EK NY+Y++N+C  G  C
Sbjct  61   QNYSNSRIADCNLVHSGGPYGENLAKGSGTFTGTAAVSLWVAEKANYNYSTNTCAAGKVC  120

Query  309  GHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            GHYTQVVWR+S+R+GC R +C+NGWW ++CSYDP GN  GQ+PY
Sbjct  121  GHYTQVVWRNSIRVGCARVQCSNGWWFVTCSYDPPGNYIGQKPY  164



>ref|XP_007148304.1| hypothetical protein PHAVU_006G197200g [Phaseolus vulgaris]
 gb|ESW20298.1| hypothetical protein PHAVU_006G197200g [Phaseolus vulgaris]
Length=159

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 115/161 (71%), Gaps = 6/161 (4%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L K     L  + ++++     AQ++P DY+N HN AR EVGVP++ WDN +A++AQ++A
Sbjct  3    LFKISFCTLFVLGLVSVH----AQDSPDDYVNEHNAARSEVGVPNIVWDNTVAAFAQDYA  58

Query  474  DSLTGDCALNHSDG--PYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHY  301
            +   GDC L HS G   YGENLA +  DL+  DAVK+WV EK NYDYNSNSCVGG+C HY
Sbjct  59   NQRQGDCNLIHSGGGGKYGENLAGSSGDLSGEDAVKMWVGEKSNYDYNSNSCVGGECLHY  118

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVW++SVR+GC + RCNNG   I C+YDP GN  G++PY
Sbjct  119  TQVVWKNSVRVGCAKVRCNNGGTFIGCNYDPPGNYVGEKPY  159



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 115/162 (71%), Gaps = 6/162 (4%)
 Frame = -2

Query  654  LSK--FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
            LSK   P++ L+SV +I       AQ++P DY+N HN AR  VGV  +TWDN +A+YA+N
Sbjct  2    LSKILLPLICLMSVTLIIPLH---AQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARN  58

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGH  304
            +A+   GDC L HS GPYGENLA +   L+   AVKLWVDEK  Y+YNSN+C  G  CGH
Sbjct  59   YANRHIGDCRLVHSGGPYGENLAGSSGYLSGTAAVKLWVDEKAFYNYNSNTCAAGKVCGH  118

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVR+GC + +CNNG   I+C+YDP GN  GQRPY
Sbjct  119  YTQVVWRNSVRIGCAKVKCNNGGTFITCNYDPPGNYVGQRPY  160



>ref|XP_010052995.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW77197.1| hypothetical protein EUGRSUZ_D01546 [Eucalyptus grandis]
Length=158

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  + AQN+P DYL+ HN AR +VGV +MTWDN LA+YAQ++ +    
Sbjct  4    LTIIISLVSISLFQPTHAQNSPQDYLDSHNAARKQVGVANMTWDNTLAAYAQSYVNQRVS  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC L HS+G YGENLAK         AV LWV EK NY+YN+N+C  G DC HYTQ++WR
Sbjct  64   DCGLVHSNGAYGENLAKGTGTFTGTYAVNLWVVEKQNYNYNTNTCASGCDCLHYTQMIWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC + +CNNGWW + C+Y+P GN  G+ PY
Sbjct  124  DSVRVGCAKVQCNNGWWYVVCNYNPPGNYEGELPY  158



>ref|XP_006298709.1| hypothetical protein CARUB_v10014803mg [Capsella rubella]
 gb|EOA31607.1| hypothetical protein CARUB_v10014803mg [Capsella rubella]
Length=161

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+ ++  +   S AQ++  DY+N HN AR +VGV  M W+ KL +YA+NH D+L G
Sbjct  9    ILIILAALVGVLLVPSKAQDSLQDYVNAHNQARSQVGVGPMQWNEKLVTYARNHIDTLKG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS+G YGENLAK+Y DL+   AV LWV+EK NY+Y++N+C  G CGHYTQVVWR+
Sbjct  69   DCRLVHSNGRYGENLAKSYGDLSGVTAVNLWVNEKANYNYDTNTC-NGVCGHYTQVVWRN  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVRLGC +  CNNG  +ISC+YDP GN   Q+PY
Sbjct  128  SVRLGCAKVMCNNGGTIISCNYDPPGNYVNQKPY  161



>ref|XP_004246724.1| PREDICTED: pathogenesis-related leaf protein 4 [Solanum lycopersicum]
 emb|CAA04881.1| pathogenesis-related protein [Solanum lycopersicum]
Length=160

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L    ++ +  +M++A+F    AQN+P DYL  HNDAR +VGV  M+WD  L S AQ++A
Sbjct  3    LFNMSLLLMTCLMVLAIFHSCDAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQSYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +S  GDC L HS    GENLAK   D     AV+LWV EK NY+Y++N CV G  CGHYT
Sbjct  63   NSRAGDCNLIHSGS--GENLAKGGGDFTGRAAVELWVSEKPNYNYDTNECVSGKMCGHYT  120

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR SVRLGCGRA CN+GWW ISC+YDP GN  GQRPY
Sbjct  121  QVVWRDSVRLGCGRALCNDGWWFISCNYDPVGNWVGQRPY  160



>ref|XP_010095627.1| hypothetical protein L484_003728 [Morus notabilis]
 gb|EXB61534.1| hypothetical protein L484_003728 [Morus notabilis]
Length=162

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++ V  +A+F+ S AQN   DYLN  N AR +V V ++TWD  +A+YA N+A+S  G
Sbjct  9    LFLMICVFGLALFEPSHAQNTQQDYLNGRNVARKQVDVTNITWDTTVATYALNYANSRKG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS+G YGENLAK     +   AV LWV EK  Y+Y SNSCVGG+C HYTQVVWR 
Sbjct  69   DCNLVHSNGAYGENLAKGTGSFSGKAAVDLWVAEKSKYNYTSNSCVGGECRHYTQVVWRY  128

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GC R +C+NGWW ++C+YDP GN   + PY
Sbjct  129  SVRVGCARVKCDNGWWFVTCNYDPPGNYVNETPY  162



>ref|XP_006486832.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Citrus 
sinensis]
Length=164

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 112/164 (68%), Gaps = 2/164 (1%)
 Frame = -2

Query  666  KMGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYA  487
            KM  +S    +  +  + + +   S AQN+P DYL+ HN AR  V VP++ W++ +A+YA
Sbjct  2    KMSSISLALAICFMGSLAL-LIQTSHAQNSPQDYLDAHNSARAAVYVPNIIWNDTVAAYA  60

Query  486  QNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-C  310
            QN+++S   DC L HS GPYGEN+AK         AV LWV EK NY+Y++N+C  G  C
Sbjct  61   QNYSNSRIADCNLVHSGGPYGENIAKGSGTFTGTAAVSLWVAEKANYNYSTNTCAAGKVC  120

Query  309  GHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            GHYTQVVWR+S+R+GC R +C+NGWW ++CSYDP GN  GQ+PY
Sbjct  121  GHYTQVVWRNSIRVGCARVQCSNGWWFVTCSYDPPGNYIGQKPY  164



>ref|XP_007148307.1| hypothetical protein PHAVU_006G197500g [Phaseolus vulgaris]
 gb|ESW20301.1| hypothetical protein PHAVU_006G197500g [Phaseolus vulgaris]
Length=157

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -2

Query  627  LSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCAL  448
            L + ++    +S AQN+P DY+  HN AR EVGV  ++W++ L +YAQ +A+    DC L
Sbjct  8    LPLFLMVTVTVSLAQNSPQDYVEVHNQARAEVGVGPISWNHTLEAYAQRYANKRIPDCNL  67

Query  447  NHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRL  268
             HS GPYGENLA+ Y ++  +DAVK W+ EK  YDY SN CV  +CGHYTQ+VWR SV L
Sbjct  68   EHSMGPYGENLAEGYGEMKGSDAVKFWLTEKPYYDYKSNKCVHDECGHYTQIVWRDSVNL  127

Query  267  GCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            GC RA+C NGW  + CSY P GNV G+RPY
Sbjct  128  GCARAKCKNGWMFVICSYSPPGNVEGERPY  157



>ref|XP_007041422.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97253.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=156

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -2

Query  612  IAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDG  433
              +  L+ AQN+P DYLN HN AR  V V  M WD+++A+YA N+A+   GDC L HS G
Sbjct  12   FCLLGLAIAQNSPQDYLNAHNSARARVNVGPMRWDDRVAAYATNYANQRKGDCRLVHSGG  71

Query  432  PYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRA  253
            PYGENLA +  DL+   AV LWV E+ NYDYNSNSCVGG+C HYTQVVWR+SVRLGC + 
Sbjct  72   PYGENLAWSSADLSGTAAVNLWVAERPNYDYNSNSCVGGECRHYTQVVWRNSVRLGCAKV  131

Query  252  RCNNGWWLISCSYDPAGNVSGQRPY  178
            RCN+G   I+C+YDP GN   QRPY
Sbjct  132  RCNSGGTFITCNYDPPGNYVNQRPY  156



>ref|XP_008236237.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related leaf protein 
6-like [Prunus mume]
Length=157

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 110/155 (71%), Gaps = 5/155 (3%)
 Frame = -2

Query  627  LSVMMIAMFDL----SGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            L ++++ +  L    S AQN+  DYLN HN AR +VGVP++TWD+ + +YAQN+A+S   
Sbjct  3    LCIVLLCLPSLVLHPSXAQNSQQDYLNAHNVARKQVGVPNITWDSTVEAYAQNYANSSAA  62

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC L HS+G YGENLAK         AV LWV EK NY+Y SNSCVGG  C HYTQVVW+
Sbjct  63   DCNLVHSNGTYGENLAKGSGSFTGTAAVNLWVAEKPNYNYTSNSCVGGQQCLHYTQVVWK  122

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC R +C+NGWW  +C+YDP GN  GQRPY
Sbjct  123  NSVRLGCARVQCSNGWWFATCNYDPPGNYVGQRPY  157



>ref|XP_010467244.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+V++ A+  LS AQ+   DY+N HN AR +VGV  M WD ++A+YA+ +A+ L G
Sbjct  9    ILIILAVLVGALVVLSKAQDGNQDYVNAHNQARSQVGVGPMQWDEEVAAYARRYAEQLKG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS+G YGENLAK+  D++   AV LWV+EK NY+Y+SN+C  G CGHYTQVVWR+
Sbjct  69   DCKLVHSNGRYGENLAKSSGDMSGVAAVNLWVNEKANYNYDSNTC-NGVCGHYTQVVWRN  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GC + RCNNG  +ISC+YDP GN   Q+PY
Sbjct  128  SVRVGCAKVRCNNGGTIISCNYDPPGNYPNQKPY  161



>ref|XP_010488898.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+V++ A+  LS AQ+   DY+N HN AR +VGV  M WD ++A+YA+ +A+ L G
Sbjct  9    ILIILAVLVGALVVLSKAQDGNQDYVNAHNQARSQVGVGPMQWDEEIAAYARRYAEQLKG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS+G YGENLAK+  D +   AV LWV+EK NY+Y+SN+C  G CGHYTQVVWR+
Sbjct  69   DCKLVHSNGRYGENLAKSSGDFSGVAAVNLWVNEKANYNYDSNTC-NGVCGHYTQVVWRN  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GC + RCNNG  +ISC+YDP GN   Q+PY
Sbjct  128  SVRVGCAKVRCNNGGTIISCNYDPPGNYPNQKPY  161



>ref|XP_002270128.1| PREDICTED: pathogenesis-related leaf protein 4 [Vitis vinifera]
 emb|CAN61902.1| hypothetical protein VITISV_012766 [Vitis vinifera]
Length=167

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 105/142 (74%), Gaps = 3/142 (2%)
 Frame = -2

Query  594  SGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH-ADSLTGDCALNHSDGPYGEN  418
            S AQN P DYL  HN AR EVGV  MTWD KLA+YA  + ++ L GDC L HS GPYGEN
Sbjct  20   SHAQNTPQDYLTAHNAARAEVGVQPMTWDKKLANYASQYVSEKLIGDCNLEHSGGPYGEN  79

Query  417  LA-KAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNN  241
            LA +   D + ADAVK+WV EK  Y+Y+SNSCVGG+CGHYTQVVW +SV +GC R  C N
Sbjct  80   LAARGATDFDGADAVKMWVSEKPYYNYDSNSCVGGECGHYTQVVWNTSVNVGCARVLCKN  139

Query  240  G-WWLISCSYDPAGNVSGQRPY  178
            G WW++SC+YDP GN  G+RPY
Sbjct  140  GEWWIVSCNYDPPGNYFGERPY  161



>ref|XP_010052992.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=154

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 113/155 (73%), Gaps = 5/155 (3%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++ +   G
Sbjct  4    LTIIISLVSISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNTLATYAQSYTNQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY+YN+N+   G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKG----TGTYAVSLWVAEKQNYNYNTNTRSSGCDCLHYTQMVWR  119

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +S+R+GC R +CNNGWW + C+YDP GN  G+ PY
Sbjct  120  NSIRVGCTRVQCNNGWWYVVCNYDPPGNYEGELPY  154



>gb|KCW63528.1| hypothetical protein EUGRSUZ_G01163, partial [Eucalyptus grandis]
Length=139

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   GDC+L HS+GPYGENLAK
Sbjct  2    AQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHSNGPYGENLAK  61

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSVRLGCGRARCNNGWW  232
                  +  AV LWV EK NY YN+N+C  G DC HYTQ+VWR SVR+GC R +CNNGWW
Sbjct  62   GTSTFTSTYAVSLWVAEKQNYKYNTNTCSSGCDCLHYTQMVWRDSVRVGCARVQCNNGWW  121

Query  231  LISCSYDPAGNVSGQRPY  178
             + C+YDP GN  G+ PY
Sbjct  122  YVVCNYDPLGNYEGELPY  139



>ref|XP_003545771.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Glycine 
max]
 gb|KHN33605.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHS--DGPYGENL  415
            AQ++P DY+N HN AR +VGVP++ WDN +A++AQN+A+   GDC L HS  DG YGENL
Sbjct  26   AQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENL  85

Query  414  AKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGW  235
            A +  +L+  DAV+LWV+EK  Y+YNSNSCVGG+C HYTQVVWR+S+RLGC + RCNNG 
Sbjct  86   AGSTGNLSGKDAVQLWVNEKSKYNYNSNSCVGGECLHYTQVVWRNSLRLGCAKVRCNNGG  145

Query  234  WLISCSYDPAGNVSGQRPY  178
              I C+Y P GN  GQRPY
Sbjct  146  TFIGCNYAPPGNYIGQRPY  164



>gb|AAN37409.1| pathogenesis-related protein 1 [Brassica juncea]
Length=160

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+ ++ A+   S AQ++P  Y+N HN AR  VGV  + WD  LA+YAQN+AD L G
Sbjct  8    LLLILAALVGALVHPSKAQDSPQGYVNAHNQARQAVGVGPVQWDGTLAAYAQNYADRLRG  67

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HSDGPYGENLA +  D +   AV LWV+EK NY+++SN+C  G+C HYTQVVWR 
Sbjct  68   DCRLIHSDGPYGENLAGSSADFSGVSAVNLWVNEKANYNHDSNTC-NGECLHYTQVVWRK  126

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GCG+ARCNNG  +ISC+YDP GN   ++PY
Sbjct  127  SVRIGCGKARCNNGGTIISCNYDPRGNYVNEKPY  160



>ref|XP_004138862.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004173439.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+     + +F L+ AQN+P DY++ HN AR  VGV  MTW+N +A+YAQ++A+    D
Sbjct  1    MAIFIPTFMFLFFLAHAQNSPQDYISLHNKARSAVGVGPMTWNNTVAAYAQSYANKRIND  60

Query  456  CALNHSDGPYGENLAKAY-PDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            CAL HS GPYGEN+A  Y P+   AD VK+WV EK  YDY SNSC GGDCGHYTQVVWR+
Sbjct  61   CALVHSTGPYGENIAVGYYPEFTGADGVKMWVGEKHLYDYASNSCKGGDCGHYTQVVWRT  120

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SV LGC R  C      + C+YDP GN  G RPY
Sbjct  121  SVHLGCARVACKGKSQFVVCNYDPPGNYIGLRPY  154



>ref|XP_006345692.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
Length=159

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
             + L+  M++A+F    AQN+P DYL  HN+AR +V V  M+WD  LA+ AQ +ADS  G
Sbjct  7    TLFLICFMILAIFHSCDAQNSPQDYLAVHNNARAQVRVGPMSWDGALATKAQKYADSRRG  66

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            DC L HS    GENLAK   D     A +LWV EK NY+Y++N C  G  CGHYTQVVWR
Sbjct  67   DCNLIHSGS--GENLAKGSGDFTGRSASELWVAEKPNYNYDTNKCASGKVCGHYTQVVWR  124

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGCGRARCNNGWW I C+Y P+GN+ G+RPY
Sbjct  125  TSVRLGCGRARCNNGWWFICCNYAPSGNIVGRRPY  159



>gb|KCW63526.1| hypothetical protein EUGRSUZ_G01161, partial [Eucalyptus grandis]
Length=141

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  594  SGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENL  415
            S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   GDC+L HS+GPYGENL
Sbjct  2    SHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHSNGPYGENL  61

Query  414  AKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSVRLGCGRARCNNG  238
            AK         AV LWV EK NY+YN+N+C  G DC HYTQ+VWR SVR+GC R +CNNG
Sbjct  62   AKGTSTFTGTYAVSLWVAEKQNYNYNTNTCSSGCDCLHYTQMVWRDSVRVGCARVQCNNG  121

Query  237  WWLISCSYDPAGNVSGQRPY  178
            WW + C+YDP GN  G+ PY
Sbjct  122  WWYVVCNYDPPGNYEGELPY  141



>ref|XP_007201612.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
 gb|EMJ02811.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
Length=157

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 112/157 (71%), Gaps = 5/157 (3%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
            F ++ L S+++      S AQN+  DYLN HN AR++VGVP++TWD+ + +YAQN+A+S 
Sbjct  5    FVLLCLTSLVL----HPSHAQNSQQDYLNAHNVAREQVGVPNITWDSTVEAYAQNYANSR  60

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVV  289
              DC L HS+G YGENLA+         AV LWV EK NY+Y SNSCVGG  C HYTQVV
Sbjct  61   AADCNLVHSNGTYGENLAEGSGSFTGTSAVNLWVAEKPNYNYTSNSCVGGQQCLHYTQVV  120

Query  288  WRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            W++SVRLGC R +C+NG W ++C+YDP GN  GQRPY
Sbjct  121  WKNSVRLGCARVKCSNGLWFVTCNYDPPGNYVGQRPY  157



>ref|NP_179064.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
 gb|AAC69384.1| putative pathogenesis related-1 (PR1) protein [Arabidopsis thaliana]
 gb|AAM15107.1| putative pathogenesis related-1 (PR1) protein [Arabidopsis thaliana]
 gb|AEC06313.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
Length=161

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M   S   ++ +L+ ++ A+     AQ++  DY+N HN AR ++GV  M WD  LA+YA+
Sbjct  1    MKVTSYSRILIILAALVGALVVPLKAQDSQQDYVNAHNQARSQIGVGPMQWDEGLAAYAR  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            N+A+ L GDC L HS GPYGENLAK+  DL+   AV LWV+EK NY+Y++N+C  G CGH
Sbjct  61   NYANQLKGDCRLVHSRGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDTNTC-NGVCGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC + RCNNG  +ISC+YDP GN + Q+PY
Sbjct  120  YTQVVWRNSVRLGCAKVRCNNGGTIISCNYDPPGNYANQKPY  161



>ref|XP_006486821.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Citrus sinensis]
 ref|XP_006486823.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Citrus sinensis]
Length=159

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = -2

Query  630  LLSVMMIAMFDLS-------GAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            LL+  ++A+F +S        AQ++  D +N HN AR EVGV  MTW++ +A+YAQ++A+
Sbjct  2    LLNKFILAIFFISLTLPHIIHAQSSHQDIVNAHNAARAEVGVDPMTWNDTVAAYAQDYAN  61

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
               GDC L HS GPYGENLA+ Y  L+  DAVK W+ EK NYD+ SNSCVG +C HYTQ+
Sbjct  62   QRMGDCNLEHSMGPYGENLAEGYGKLDGVDAVKFWLTEKPNYDHASNSCVGDECLHYTQI  121

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SV +GCGR +C N WW + C+Y P GN+ G+RPY
Sbjct  122  VWRKSVSVGCGRVKCKNDWWFVICNYYPPGNIEGERPY  159



>gb|KCW77213.1| hypothetical protein EUGRSUZ_D01567, partial [Eucalyptus grandis]
Length=149

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 1/145 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  4    LTIIISLVFISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV  K NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTSTFTGTYAVSLWVAGKQNYNYNTNTCSSGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDP  208
             SVR+GC R +CNNGWW + C+YDP
Sbjct  124  DSVRVGCARVQCNNGWWYVVCNYDP  148



>gb|KCW77204.1| hypothetical protein EUGRSUZ_D01555, partial [Eucalyptus grandis]
Length=139

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   GDC+L HS+GPYGENLAK
Sbjct  2    AQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHSNGPYGENLAK  61

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSVRLGCGRARCNNGWW  232
                     AV LWV EK NY+YN+N+C  G DC HYTQ+VWR SVR+GC R +CNNGWW
Sbjct  62   GTSTFTGTYAVSLWVAEKQNYNYNTNTCSSGCDCLHYTQMVWRDSVRVGCARVQCNNGWW  121

Query  231  LISCSYDPAGNVSGQRPY  178
             + C+YDP GN  G+ PY
Sbjct  122  YVVCNYDPPGNYEGELPY  139



>gb|KCW63548.1| hypothetical protein EUGRSUZ_G01181, partial [Eucalyptus grandis]
Length=149

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (74%), Gaps = 1/145 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ +++F  + AQN+P DYL+ HN AR +VGV +MTWDN LA+YAQ++A+    
Sbjct  4    LTIIISLVSVSLFQPTHAQNSPQDYLDSHNAARKQVGVVNMTWDNTLATYAQSYANQRVS  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY+YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTGTFTGTYAVGLWVAEKQNYNYNTNTCASGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDP  208
             SVR+GC + RCNNGWW + C+YDP
Sbjct  124  DSVRVGCAKVRCNNGWWYVVCNYDP  148



>ref|XP_010065841.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
            ++S++ I++F  + AQN+P DYL+ HN AR +VG+ +MTWDN LA+YAQ++A+    +C 
Sbjct  7    IISLVSISLFQPTHAQNSPQDYLDSHNAARKQVGMGNMTWDNTLAAYAQSYANQRVSNCG  66

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSV  274
            L HS+GPY ENLAK      A   V LWV EK NY+YN+N+C  G DC HYTQ+VWR  V
Sbjct  67   LVHSNGPYSENLAKGTGTFTAIYVVSLWVAEKQNYNYNTNACASGCDCLHYTQMVWRDLV  126

Query  273  RLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R+GC + +CNNGWW + C+YDP GN  G+ PY
Sbjct  127  RVGCAKVQCNNGWWYVVCNYDPPGNYEGELPY  158



>ref|XP_004168739.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+     + +F L+ AQN+P DY++ HN AR  VGV  MTW+N +A+YAQ++A+    D
Sbjct  1    MAIFIPTFMFLFFLAHAQNSPQDYISLHNKARAAVGVGPMTWNNTVAAYAQSYANKRIND  60

Query  456  CALNHSDGPYGENLAKAY-PDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            CAL HS GPYGEN+A  Y P+   AD VK+WV EK  YDY SNSC GGDCGHYTQVVWR+
Sbjct  61   CALVHSTGPYGENIAVGYYPEFTGADGVKMWVGEKHLYDYASNSCKGGDCGHYTQVVWRT  120

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SV LGC R  C      + C+YDP GN  G RPY
Sbjct  121  SVHLGCARVACKGKSQFVVCNYDPPGNYIGLRPY  154



>ref|XP_011002583.1| PREDICTED: pathogenesis-related leaf protein 6-like [Populus 
euphratica]
Length=160

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 0/151 (0%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
            L  ++ +A+   S AQN+P DYLN HN AR +V V ++ WDN +A+YA N+++S   +C 
Sbjct  10   LFCLVGLALVHPSHAQNSPQDYLNAHNAARSQVTVANIIWDNTVAAYALNYSNSRISNCN  69

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVR  271
            L HS+GPYGENLAK         AV LWV EK  YD  SNSCVGG C HYTQVVWR+SVR
Sbjct  70   LVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKPYYDNASNSCVGGQCLHYTQVVWRNSVR  129

Query  270  LGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +GC R +C NGWW +SC+YDP GN   +RPY
Sbjct  130  VGCARVQCTNGWWFVSCNYDPPGNYIEERPY  160



>gb|ACU15426.1| unknown [Glycine max]
 gb|ACU17403.1| unknown [Glycine max]
Length=164

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHS--DGPYGENL  415
            AQ++P DY+N HN AR +VGVP++ WDN +A++AQN+A+   GDC L HS  DG YGENL
Sbjct  26   AQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENL  85

Query  414  AKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGW  235
            A +  +L+  DAV+LWV+EK  Y+YNSNSCVGG+C HYTQVVWR+S+RLGC + RCNNG 
Sbjct  86   AGSTGNLSGKDAVQLWVNEKSKYNYNSNSCVGGECLHYTQVVWRNSLRLGCAKVRCNNGG  145

Query  234  WLISCSYDPAGNVSGQRPY  178
              I C+Y P GN  GQRPY
Sbjct  146  TSIGCNYAPPGNYIGQRPY  164



>ref|NP_001234128.1| pathogenesis-related protein 1A1 precursor [Solanum lycopersicum]
 sp|Q08697.1|PR1A_SOLLC RecName: Full=Pathogenesis-related protein 1A1; Short=PR-1A1; 
Flags: Precursor [Solanum lycopersicum]
 emb|CAA50596.1| PR-1a1 [Solanum lycopersicum]
Length=175

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            + +   +   +F  S AQ    ++LN HN AR  VGV  MTWD+ LA+YAQN+A+    D
Sbjct  5    IFVACFITFIIFHSSQAQTPRENFLNAHNAARRRVGVGPMTWDDGLAAYAQNYANQRADD  64

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRS  280
            C + HSDGPYGENLA A+P LNAA AVK+W DEK  YDYNSN+C  G  CGHYTQVVWR 
Sbjct  65   CGMIHSDGPYGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCAPGKVCGHYTQVVWRK  124

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGN  199
            SVRLGC R RCN+GW  I+C+YDP GN
Sbjct  125  SVRLGCARVRCNSGWVFITCNYDPPGN  151



>ref|XP_004485656.1| PREDICTED: pathogenesis-related protein 1B-like [Cicer arietinum]
Length=160

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 5/162 (3%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            +S F ++ +L ++ I M   + AQ++P DY+N HN AR EVGVP++ WDN +AS+AQ++A
Sbjct  1    MSSFSLMCVLGLIFI-MGHTAHAQDSPTDYVNAHNAARSEVGVPNIVWDNTVASFAQSYA  59

Query  474  DSLTGDCALNHSDG---PYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            +    DC L HSDG    YGEN+A +  D++  +AV LWVDEK NYDYNSNSCVGG+C H
Sbjct  60   NQRK-DCQLMHSDGNHGGYGENIALSSGDMSGTEAVSLWVDEKANYDYNSNSCVGGECLH  118

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR S R+GC + +C+NG   I+C+Y P GN  GQ+PY
Sbjct  119  YTQVVWRDSHRVGCAKVKCDNGGTFITCNYSPPGNYIGQKPY  160



>ref|XP_009610821.1| PREDICTED: pathogenesis-related protein 1B [Nicotiana tomentosiformis]
 sp|P07053.1|PR1B_TOBAC RecName: Full=Pathogenesis-related protein 1B; Short=PR-1B; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35665.1| unnamed protein product [Nicotiana tabacum]
 dbj|BAA14221.1| PR1b protein precursor [Nicotiana tabacum]
 emb|CAA27183.1| PR-1b precursor; (aa -30-138) [Nicotiana tabacum]
 prf||1203245A protein 1b,pathogenesis related
Length=168

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 4/163 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMF--DLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
             S+ P   L+S +++ +     S AQN+  DYL+ HN AR +VGV  +TWDN +A+YAQN
Sbjct  6    FSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQN  65

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGGD-CG  307
            +   L  DC L HS G YGENLA+   D + AA AV++WVDEK  YD++SN+C  G  CG
Sbjct  66   YVSQLAADCNLVHSHGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCG  125

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWR+SVR+GC R +CNNG +++SC+YDP GNV GQ PY
Sbjct  126  HYTQVVWRNSVRVGCARVKCNNGGYVVSCNYDPPGNVIGQSPY  168



>ref|XP_009378591.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=161

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
             AL+ ++ + +   S AQN+P DYLN HN AR +VGV  ++WD  L +YAQ +A+S  GD
Sbjct  8    FALVCLISLTLLPSSHAQNSPQDYLNAHNAARAQVGVAPLSWDTNLVNYAQRYANSRIGD  67

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRS  280
            C L HS GPYGEN+A +  DL+   AV L+V EK NY+Y SN+C  G  CGHYTQVVWRS
Sbjct  68   CNLVHSGGPYGENIASSGGDLSGTAAVNLFVSEKANYNYYSNTCAAGKMCGHYTQVVWRS  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            S RLGC + RCNNG   I C+YDP GN +GQ+PY
Sbjct  128  STRLGCAKVRCNNGGTFIGCNYDPPGNYAGQKPY  161



>emb|CAA29022.1| PR-1b protein [Nicotiana tabacum]
Length=164

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 4/163 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMF--DLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
             S+ P   L+S +++ +     S AQN+  DYL+ HN AR +VGV  +TWDN +A+YAQN
Sbjct  2    FSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQN  61

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGGD-CG  307
            +   L  DC L HS G YGENLA+   D + AA AV++WVDEK  YD++SN+C  G  CG
Sbjct  62   YVSQLAADCNLVHSHGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCG  121

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWR+SVR+GC R +CNNG +++SC+YDP GNV GQ PY
Sbjct  122  HYTQVVWRNSVRVGCARVKCNNGGYVVSCNYDPPGNVIGQSPY  164



>gb|KCW63507.1| hypothetical protein EUGRSUZ_G01138 [Eucalyptus grandis]
Length=149

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  621  VMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD-CALN  445
            +++ A+ + S AQ+   D+++ HN AR +VGV  +TW++ +A+YAQ +A       CAL 
Sbjct  1    MVLKAIAETSLAQSTHQDFVDAHNGARAQVGVAPLTWNDTVAAYAQTYASKRAATGCALE  60

Query  444  HSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLG  265
            HS GPYGENLA+ Y +L+  DAVK+WV E+ NYD++SN+CVGG+C HYTQVVWRSS+ LG
Sbjct  61   HSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGGECLHYTQVVWRSSIHLG  120

Query  264  CGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            C R +C+NGWW ++C+YDP GN  G+ PY
Sbjct  121  CARVKCSNGWWFVTCNYDPPGNYEGESPY  149



>ref|XP_004487816.1| PREDICTED: pathogenesis-related protein 1-like [Cicer arietinum]
Length=199

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSL  466
            F ++ L+S+++     +S AQN+P DYL  HN AR EVGV  + W + +ASYAQN+A+ L
Sbjct  23   FVLLPLISILISTSTQISHAQNSPQDYLKIHNKARSEVGVGPIYWASTVASYAQNYANQL  82

Query  465  TGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVV  289
             G+C + HS GPYGENLA +  DL A  AV +WV EK  YDYN+N+C  G  CGHYTQVV
Sbjct  83   KGNCKMVHSKGPYGENLAWSSGDLTATSAVTMWVGEKQYYDYNTNTCSNGYKCGHYTQVV  142

Query  288  WRSSVRLGCGRARCNNGW-WLISCSYDPAGNVSGQRPY  178
            WR S+RLGC + +CN+G   +ISC+YDP GN  GQRP+
Sbjct  143  WRDSIRLGCAKVKCNDGRSTIISCNYDPPGNYIGQRPF  180



>emb|CDO97326.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            L KF +V L+++     F    AQN   DY++ HN AR +VGV  M WD ++A+YA+N+A
Sbjct  3    LFKFSLVLLITLASSPSFL---AQNTQKDYVDAHNAARAQVGVGPMHWDEQVAAYARNYA  59

Query  474  DSLTGDCALN---HSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
              +      N   HS G YGENLA    D     AV LWV EK  Y+Y +NSCVGG CGH
Sbjct  60   AKIQMANTCNNLVHSGGRYGENLAAGTGDFTGLRAVNLWVGEKSKYNYQTNSCVGGVCGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWRSSVRLGC R RCNNGWW + CSYDP GN+ GQRPY
Sbjct  120  YTQVVWRSSVRLGCARVRCNNGWWYVICSYDPRGNIGGQRPY  161



>ref|XP_006422713.1| hypothetical protein CICLE_v10029459mg [Citrus clementina]
 gb|ESR35953.1| hypothetical protein CICLE_v10029459mg [Citrus clementina]
Length=159

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = -2

Query  630  LLSVMMIAMFDLS-------GAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            LL+  ++A+F +S        AQ++  D +N HN AR EVGV  MTW++ +A+YAQ++A+
Sbjct  2    LLNKFILAIFFISLTLPHIIHAQSSHQDIVNAHNAARAEVGVDPMTWNDTVAAYAQDYAN  61

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
               GDC + HS GPYGENLA+ Y  L+  DAVK W+ EK NYD+ SNSCVG +C HYTQ+
Sbjct  62   QRMGDCNMEHSMGPYGENLAEGYGKLDGVDAVKFWLTEKPNYDHASNSCVGDECLHYTQI  121

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SV +GCGR +C N WW + C+Y P GN+ G+RPY
Sbjct  122  VWRKSVSVGCGRVKCKNDWWFVICNYYPPGNIEGERPY  159



>gb|KDP36353.1| hypothetical protein JCGZ_09850 [Jatropha curcas]
Length=182

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -2

Query  618  MMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHS  439
            M +A+   S AQ++P DY+N HN AR  VGV  +TWDN +A+YA+N+A+   GDC L HS
Sbjct  1    MSVALIIPSHAQDSPQDYVNVHNTARAAVGVDPVTWDNTVAAYARNYANQRIGDCRLVHS  60

Query  438  DGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSVRLGC  262
             GPYGENLA +  DL+   AV+LWVDEK  YDYNS+SC  G  CGHYTQVVW  SVR+GC
Sbjct  61   GGPYGENLAGSSGDLSGTTAVELWVDEKAFYDYNSSSCAAGMVCGHYTQVVWSYSVRIGC  120

Query  261  GRARCNNGWWLISCSYDPAGNVSGQRP  181
             + +CNNG   ISC+YDP GN+ GQRP
Sbjct  121  AKVKCNNGGAFISCNYDPPGNIIGQRP  147



>gb|KGN48339.1| hypothetical protein Csa_6G483242 [Cucumis sativus]
Length=150

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = -2

Query  612  IAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDG  433
            + +F L+ AQN+P DY++ HN AR  VGV  MTWDN +A+YAQ++A+    DCAL HS G
Sbjct  1    MFLFVLTHAQNSPQDYISLHNKARAAVGVGPMTWDNTVAAYAQSYANKRKNDCALVHSTG  60

Query  432  PYGENLAKA-YPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGR  256
            PYGEN+A   YP+   AD VKLWV EK  YDY SNSC GGDCGHYTQVVWR+SV LGC R
Sbjct  61   PYGENIAIGFYPEFTGADGVKLWVGEKHLYDYASNSCKGGDCGHYTQVVWRTSVHLGCAR  120

Query  255  ARCNNGWWLISCSYDPAGNVSGQRPY  178
              C      + C+YDP GN  G RPY
Sbjct  121  VPCKGKSQFVVCNYDPPGNYIGLRPY  146



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  618  MMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHS  439
            M + +     AQ++P DY+N HN AR  VGV  +TWDN +A+YA+N+A+   GDC L HS
Sbjct  1    MSVTLIIPLHAQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANQHIGDCRLVHS  60

Query  438  DGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSVRLGC  262
             GPYGENLA +  DL+   AVKLWVDEK  YDYNSN+C  G  CGHYTQVVWR+SVR+GC
Sbjct  61   GGPYGENLAGSSGDLSDPAAVKLWVDEKAFYDYNSNTCAAGKVCGHYTQVVWRNSVRIGC  120

Query  261  GRARCNNGWWLISCSYDPAGNVSGQRPY  178
             + +CNNG   I+C+YDP GN  GQRPY
Sbjct  121  AKVKCNNGGTFITCNYDPPGNYVGQRPY  148



>gb|KCW63511.1| hypothetical protein EUGRSUZ_G01142, partial [Eucalyptus grandis]
Length=149

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  ++S++ I++F  S AQN+P DYL+ HN AR +VGV ++TWDN LA+YAQ++A+   G
Sbjct  4    LTIIISLVFISLFQPSHAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVG  63

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWR  283
            DC+L HS+GPYGENLAK         AV LWV EK NY YN+N+C  G DC HYTQ+VWR
Sbjct  64   DCSLVHSNGPYGENLAKGTSTFTGTYAVSLWVAEKQNYKYNTNTCSSGCDCLHYTQMVWR  123

Query  282  SSVRLGCGRARCNNGWWLISCSYDP  208
             SVR+GC R +CNNGW  + C+YDP
Sbjct  124  DSVRVGCARVQCNNGWQYVVCNYDP  148



>ref|XP_010478439.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            ++ F   +LL V +  +   + AQN+  DYL  HN+AR +VGV ++ WD  +A+YA N+A
Sbjct  1    MNTFKTPSLLIVAISFLVIATNAQNSQQDYLTAHNNARTQVGVANLVWDTTVATYALNYA  60

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYT  298
            ++   +C+L HS+GPYGENLAK   +  A  AVKLWVDEK  Y Y +N+C GG  C HYT
Sbjct  61   NTRKANCSLIHSNGPYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACTGGQQCLHYT  120

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR SV++GC R +C NGWW +SC+YD  GN  G+ PY
Sbjct  121  QVVWRESVKIGCARVQCTNGWWFVSCNYDAPGNWIGEYPY  160



>gb|AFJ93090.1| pathogenesis-related protein 1 [Bacopa monnieri]
Length=176

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  585  QNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAKA  406
            QN+P D+LN HN AR +VGV  + W++ +ASYA ++A    GDC L HSDGPYGENLA+ 
Sbjct  41   QNSPQDFLNAHNHARAQVGVKPLVWNDTIASYALDYARKRYGDCELEHSDGPYGENLAEG  100

Query  405  YPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWLI  226
            +  L+A DAV +WV EK  YDYNSNSCVGG+C HYTQVVWR S  LGC R +C+NGW  +
Sbjct  101  WGRLSAVDAVGMWVSEKSCYDYNSNSCVGGECLHYTQVVWRDSTHLGCARLQCHNGWLFV  160

Query  225  SCSYDPAGNVSGQRPY  178
            +C+YDP GN  G+RPY
Sbjct  161  TCNYDPPGNYVGERPY  176



>ref|XP_010461858.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            ++ F   +LL V +  +   + AQN+  DYL  HN+AR +VGV ++ WD  +A+YA N+A
Sbjct  1    MNTFKTPSLLIVAISFLVIATTAQNSQQDYLTAHNNARAQVGVANLVWDTTVATYALNYA  60

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYT  298
            ++   +C+L HS+GPYGENLAK   +  A  AVKLWVDEK  Y Y +N+C GG  C HYT
Sbjct  61   NTRKANCSLIHSNGPYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACTGGQQCLHYT  120

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR SV++GC R +C NGWW +SC+YD  GN  G+ PY
Sbjct  121  QVVWRESVKIGCARVQCTNGWWFVSCNYDAPGNWIGEYPY  160



>ref|XP_006379156.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP56953.1| pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            +S    +A  +++ +++   S AQ+ P DYL+ HN AR  VGV  +TWD  + +YAQN+A
Sbjct  2    MSSKISLAFFTLITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYT  298
            +   GDC L HS GPYGENLA +  DL+  DAVK+WVDEK  YDYNSNSC  G  CGHYT
Sbjct  62   NQRAGDCNLIHSGGPYGENLAWSSADLSGTDAVKMWVDEKAYYDYNSNSCAAGQQCGHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+S RLGC + +C+ G   I C+YDP GN  GQ+PY
Sbjct  122  QVVWRNSARLGCAKVKCSTGGTFIGCNYDPPGNYVGQKPY  161



>ref|XP_003593357.1| Pathogenesis-related protein 1a [Medicago truncatula]
Length=338

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            +S F ++ +L + +I +  ++ AQN+ ADY+N HN+AR +VGV ++ WDN LA+ AQN+A
Sbjct  1    MSSFSLICVLGLFII-IGHVAHAQNSQADYVNSHNEARRQVGVANVVWDNNLATVAQNYA  59

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +S  GDC L HS G YGENLA +  DL+  DAV+LWV+EK++Y+YNSN+C  G  CGHYT
Sbjct  60   NSRRGDCRLTHSGGRYGENLAGSTGDLSGTDAVRLWVNEKNDYNYNSNTCASGKVCGHYT  119

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQR  184
            QVVWR++ R+GC + RCNNG   I C+YDP GN  GQ+
Sbjct  120  QVVWRNTKRIGCAKVRCNNGGTFIICNYDPPGNYVGQK  157



>gb|KCW44547.1| hypothetical protein EUGRSUZ_L01945 [Eucalyptus grandis]
Length=179

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 110/151 (73%), Gaps = 1/151 (1%)
 Frame = -2

Query  627  LSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD-CA  451
            LS +  A  + S AQ+   D+++ HN AR +VGV  + W++ +A+YAQ +A+      CA
Sbjct  29   LSFLQPAFAETSFAQSTHQDFVDAHNAARAQVGVAPLAWNDTVAAYAQTYANKRAATGCA  88

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVR  271
            L HS GPYGENLA+ Y +L+  DAVK+WV E+ NYD++SN+CVGG+C HYTQVVWRSS+ 
Sbjct  89   LEHSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGGECLHYTQVVWRSSIH  148

Query  270  LGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            LGC R +C+NGWW ++C+YDP GN  G+ PY
Sbjct  149  LGCARVKCSNGWWFVTCNYDPPGNYEGESPY  179



>ref|XP_010517582.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 117/162 (72%), Gaps = 1/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +S   ++ +L+ ++  +   S AQ++P DY+N HN AR +VGV  + WD ++A YA+
Sbjct  1    MNFISYSCILIILAFLVGVLVVPSKAQDSPQDYVNAHNQARSQVGVGPIQWDEEVAGYAR  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD L GDC L HS G YGENLA +  D +  DAV LWV+EK +Y+Y+SN+C  G CGH
Sbjct  61   SYADQLKGDCNLVHSGGRYGENLAMSTGDFSGVDAVNLWVNEKADYNYDSNTC-NGVCGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC + RCNNG  ++SC+YDP GN +G++PY
Sbjct  120  YTQVVWRNSVRLGCAKVRCNNGGTVVSCNYDPPGNFNGEKPY  161



>ref|XP_010500562.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            ++ F   +LL V +  +   + AQN+  DYL  HN+AR +VGV ++ WD  +A+YA N+A
Sbjct  1    MNTFKTPSLLIVAISFLVIATNAQNSQQDYLTAHNNARAQVGVANLVWDTTVATYALNYA  60

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYT  298
            ++   +C+L HS+GPYGENLAK   +  A  AVKLWVDEK  Y Y +N+C GG  C HYT
Sbjct  61   NTRKANCSLIHSNGPYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACTGGQQCLHYT  120

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR SV++GC R +C NGWW +SC+YD  GN  G+ PY
Sbjct  121  QVVWRESVKIGCARVQCTNGWWFVSCNYDAPGNWIGEYPY  160



>ref|XP_003543105.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 ref|XP_003543107.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
isoform 1 [Glycine max]
 ref|XP_003543109.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
isoform 1 [Glycine max]
 ref|XP_003543111.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|ACU15480.1| unknown [Glycine max]
Length=174

 Score =   179 bits (453),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 118/167 (71%), Gaps = 11/167 (7%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVG---------VPHMTWDNKLAS  493
            F V+ +L ++++   D++ AQ++  DY+N HN AR EVG         VP + WD+ +A+
Sbjct  10   FCVMCVLGLVIVG--DVAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAA  67

Query  492  YAQNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD  313
            YA+++A+   GDC L HS G YGEN+A +  +L+  DAVK+WVDEK NYDY+SNSCVGG+
Sbjct  68   YAESYANQRKGDCQLIHSGGEYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGE  127

Query  312  CGHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY*L  172
            C HYTQVVW +SVRLGC +  C+NG   I+C+YDP GN  G+RPY L
Sbjct  128  CLHYTQVVWANSVRLGCAKVTCDNGGTFITCNYDPPGNFVGERPYKL  174



>ref|XP_010065845.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=162

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = -2

Query  624  SVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALN  445
            S++ I++F  + AQN+P DYLN HN A+ +VGV +MTWDN LA+YAQ++A+    DC+L 
Sbjct  13   SLVSISLFQPTHAQNSPQDYLNSHNAAQKQVGVANMTWDNTLAAYAQSYANQRVSDCSLV  72

Query  444  HSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSVRL  268
            HS+GPYGENLAK         AV LWV EK NY+YN+N+     DC HYTQ+VWR+SVR+
Sbjct  73   HSNGPYGENLAKGTGMFTGIYAVGLWVAEKQNYNYNTNTYASRCDCLHYTQMVWRNSVRV  132

Query  267  GCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            GC + +CNNGWW + C+Y+P GN  G+ PY
Sbjct  133  GCAKVQCNNGWWYVVCNYNPPGNYEGELPY  162



>ref|XP_002273355.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=160

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
              KF +   +    +A F L  AQ++P DY++ HN AR +VGV  +TW+  +A+YA+ +A
Sbjct  3    FHKFLLAIYIFGSALAHFSL--AQSSPQDYVDAHNAARAQVGVQPITWNETVAAYARRYA  60

Query  474  DSLTGD-CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
             S   + C++ HS GPYGENLA+ Y  ++ +DAV+ W+ EK NYD+NSNSCVGG+C HYT
Sbjct  61   SSRVAEQCSMEHSGGPYGENLAEGYGSMSGSDAVEFWLTEKPNYDHNSNSCVGGECLHYT  120

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            Q+VW  S+ LGC R +C NGWW I+C+Y P GN+ G+RPY
Sbjct  121  QIVWGGSLHLGCARVQCKNGWWFITCNYYPPGNIEGERPY  160



>gb|AAT46023.1| pathogenesis-related protein 1 [Brassica rapa subsp. oleifera]
Length=161

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++ +L+ ++ A+   S AQ++P DY N HN AR  VGV  + WD  LA+YAQN+AD L G
Sbjct  9    LLLILAALVGALVHPSKAQDSPQDYANAHNQARQAVGVGPVQWDGTLAAYAQNYADRLRG  68

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS  PYGENLA +  DL+   AV LWV EK +Y+Y SN+C  G CGHYTQVVWR 
Sbjct  69   DCRLVHSGRPYGENLAGSSGDLSGVRAVNLWVSEKASYNYPSNTC-NGVCGHYTQVVWRK  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SVR+GCG+ARCNNG  +ISC+YDP GN   ++PY
Sbjct  128  SVRIGCGKARCNNGGTIISCNYDPRGNYVNEKPY  161



>gb|AFR90191.1| pathogenesis-related protein 1a [Salsola ferganica]
Length=166

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVM-MIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYA  487
            M    KF  +AL  ++  + +  +  AQN+P DY+N HN AR  VGV  + WD KLA+YA
Sbjct  1    MALSKKFATIALCFILATVTLAQMCHAQNSPQDYVNAHNAARAAVGVGKIQWDGKLAAYA  60

Query  486  QNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-C  310
            Q +A+   GDCAL HS GPYGEN+A         DAVK+WV EK NY+YNSN+C     C
Sbjct  61   QQYANQRKGDCALKHSGGPYGENIAVGGGPFTGRDAVKMWVAEKANYNYNSNTCAANKVC  120

Query  309  GHYTQVVWRSSVRLGCGRARCNNG--WWLISCSYDPAGNVSGQRPY  178
            GHYTQVVWR SVR+GC R  CN+G   + + CSYDP GN  GQ+PY
Sbjct  121  GHYTQVVWRKSVRVGCARVPCNSGPYSYFVICSYDPRGNYVGQKPY  166



>gb|ABK94784.1| unknown [Populus trichocarpa]
 gb|ABK96093.1| unknown [Populus trichocarpa]
Length=161

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            +S    +A  +++ +++   S AQ+ P DYL+ HN AR  VGV  +TWD  + +YAQN+A
Sbjct  2    MSSKISLAFFTLITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYA  61

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYT  298
            +   GDC L HS GPYGEN+A +  DL+  DAVK+WVDEK  YDYNSNSC  G  CGHYT
Sbjct  62   NQRAGDCNLVHSGGPYGENIAWSSADLSGTDAVKMWVDEKAYYDYNSNSCAAGQQCGHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+S RLGC + +C+ G   I C+YDP GN  GQ+PY
Sbjct  122  QVVWRNSARLGCAKVKCSTGGTFIGCNYDPPGNYVGQKPY  161



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            LS+  +  ++ ++ + + +L  AQ  P D+L PHN AR EVGV  MTWD+ +A+YA+N+A
Sbjct  3    LSRISLALVICILGLGVIELCYAQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD---CGH  304
            +   GDC L HS GPYGEN+A +  DL+AA AV +WV EK  YDY SN CVG +   C H
Sbjct  63   NQRQGDCKLVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNKCVGQNPMGCLH  122

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR S RLGC + RCN+G   + C+Y+P GN  GQRPY
Sbjct  123  YTQVVWRKSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  164



>ref|XP_008798893.1| PREDICTED: pathogenesis-related protein 1B-like [Phoenix dactylifera]
Length=190

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 106/155 (68%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A +S + ++  + S AQN+P DYL PHNDAR  VGVP M WD  L  YA N+A+    D
Sbjct  10   LAAISAICLSFTNPSVAQNSPEDYLRPHNDARRAVGVPPMRWDTTLERYALNYANQRARD  69

Query  456  CALNHSDGPYGENLAKAYPDL-NAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            C L HS G YGENL  + P +  AA AV  WVDE+  Y+Y SN+C  G  CGHYTQVVWR
Sbjct  70   CRLIHSGGRYGENLYMSSPSIATAARAVGAWVDERRFYNYRSNTCARGKVCGHYTQVVWR  129

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             SVR+GC R RCNNG + I CSY+P GN+SG+RPY
Sbjct  130  ESVRVGCARVRCNNGNYFIICSYNPPGNISGRRPY  164



>ref|XP_004486257.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cicer arietinum]
Length=158

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 7/158 (4%)
 Frame = -2

Query  630  LLSVMMIAMFDLSG-------AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            + S M++A+F L         AQN+P D+++ HN+AR+ VGV  + W++ L +YAQN+A+
Sbjct  1    MRSHMILAIFFLFMCSNLCCIAQNSPQDFVDVHNEAREVVGVGPLYWNHTLEAYAQNYAN  60

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
                DC L HS GP+GENLA+ Y ++N +DAVK W+ EK  YDYNSNSCV  +C HYTQ+
Sbjct  61   KRIKDCELEHSMGPFGENLAEGYGEMNGSDAVKFWLTEKPYYDYNSNSCVHDECLHYTQI  120

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +W  SV LGC +++C NGW  + CSY P GNV GQRPY
Sbjct  121  IWSDSVHLGCAKSKCQNGWVFVICSYSPPGNVEGQRPY  158



>ref|XP_004152970.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004168650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 104/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +A+     + +F L+ AQN+  DY++ HN AR  VGV  MTW+N +A+YAQ++A+    D
Sbjct  1    MAIFIPTFMFLFFLAHAQNSAQDYISLHNKARATVGVGPMTWNNTVAAYAQSYANKRIND  60

Query  456  CALNHSDGPYGENLAKAY-PDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            CAL HS GPYGEN+A  Y P+   AD VK+WV EK  YDY SNSC GGDCGHYTQVVWR+
Sbjct  61   CALVHSTGPYGENIAVGYYPEFTGADGVKMWVGEKHLYDYASNSCKGGDCGHYTQVVWRT  120

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SV LGC R  C      + C+YDP GN  G RPY
Sbjct  121  SVHLGCARVACKGKSQFVVCNYDPPGNYIGLRPY  154



>ref|XP_006409652.1| hypothetical protein EUTSA_v10022888mg [Eutrema salsugineum]
 gb|ESQ51105.1| hypothetical protein EUTSA_v10022888mg [Eutrema salsugineum]
Length=161

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +  F  + LL+ ++ A+   S AQ++  DY+  HN+AR  VG+  + WD +++++AQ
Sbjct  1    MKLILYFRFLILLAALVGALVLPSKAQDSQQDYVRVHNEARAAVGLGPVQWDERVSAFAQ  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD   GDC L HS GPYGENLAK+  DL+   AV LWVDEK +YDY SN+C  G+CGH
Sbjct  61   SYADQRRGDCNLVHSSGPYGENLAKSSGDLSGIRAVNLWVDEKASYDYPSNTC-NGECGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SV+LGCG+ARCNNG  +I C+YDP GN   ++PY
Sbjct  120  YTQVVWRNSVKLGCGKARCNNGGTIIVCNYDPPGNYVNEKPY  161



>ref|XP_010488897.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 116/162 (72%), Gaps = 1/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +S   ++ +L+ ++  +   S AQ++P DY+N HN AR +VGV  + WD ++A YA+
Sbjct  1    MNFISYTRILIILAALIGVLLVPSKAQDSPQDYVNAHNQARSQVGVGPIQWDEEVAGYAR  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD L GDC L HS G YGENLA +  D +  DAV LWV+EK +Y+Y+SN+C  G CGH
Sbjct  61   SYADQLKGDCNLVHSGGRYGENLAMSTGDFSGVDAVNLWVNEKADYNYDSNTC-NGVCGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC + RCNNG  ++SC+YDP GN + ++PY
Sbjct  120  YTQVVWRNSVRLGCAKVRCNNGGTVVSCNYDPPGNFNDEKPY  161



>emb|CDX89632.1| BnaC03g45460D [Brassica napus]
Length=160

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +S F  + LL+  + A+   S AQ++P +Y+  HN+AR  VGV  M W+  LA+ AQ
Sbjct  1    MEVISNFSFLILLAASVGALLP-SKAQDSPQEYVRVHNEARAGVGVGPMQWNETLAAVAQ  59

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD    DC L HS GPYGENLAK+  DL+   AV LWV+EK NYDY SN+C  G+CGH
Sbjct  60   SYADQRRSDCNLIHSTGPYGENLAKSSGDLSGVRAVNLWVEEKANYDYPSNTC-NGECGH  118

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQ+VWRSSV+LGCG+A+CNNG   + C+YDP GN   Q+PY
Sbjct  119  YTQIVWRSSVKLGCGKAKCNNGGTFVVCNYDPPGNYVNQKPY  160



>gb|AHA43767.1| pathogenesis related protein 1 isoform 4 [Morus alba var. multicaulis]
 gb|AHW81905.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            LS+  +  ++ ++ + + +L  AQ  P D+L+PHN AR +VGV  MTWD+ +A+YA+N+A
Sbjct  3    LSRISLALVICILGLGVIELCYAQTTPQDFLDPHNRARAKVGVGPMTWDDSVAAYARNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD---CGH  304
            +   GDC L HS GPYGEN+A +  DL+AA AV +WV EK  YDY SN+CVG +   C H
Sbjct  63   NQRQGDCKLVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLH  122

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR S RLGC + RCN+G   + C+Y+P GN  GQRPY
Sbjct  123  YTQVVWRKSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  164



>gb|AHW81904.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            LS+  +  ++ ++ + + +L  AQ  P D+L+PHN AR +VGV  MTWD+ +A+YA+N+A
Sbjct  3    LSRISLALVICILGLGVIELCYAQTTPQDFLDPHNRARAKVGVGPMTWDDSVAAYARNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD---CGH  304
            +   GDC L HS GPYGEN+A +  DL+AA AV +WV EK  YDY SN+CVG +   C H
Sbjct  63   NQRQGDCKLVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGRNPMGCLH  122

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR S RLGC + RCN+G   + C+Y+P GN  GQRPY
Sbjct  123  YTQVVWRKSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  164



>ref|XP_002522071.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40271.1| STS14 protein precursor, putative [Ricinus communis]
Length=164

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 2/164 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            MG L    V+  L + +  +     AQN+  DYL+ HN AR +VGV ++ WDN +A+YAQ
Sbjct  1    MGSLKISQVLVSLLMGLALVVHPCHAQNSQQDYLDAHNAARAQVGVANIVWDNTVATYAQ  60

Query  483  NHADSLTGDCALNHSDGPYGENLAK-AYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DC  310
            N+A+S  GDC L HS G YGENLAK +   L    AV LWV EK  Y+Y SNSC GG  C
Sbjct  61   NYANSRIGDCNLVHSSGSYGENLAKGSSSSLTGTAAVNLWVAEKPYYNYTSNSCTGGQQC  120

Query  309  GHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             HYTQVVW  SVRLGC R +C NGWW ++C+YDP GN  GQ+PY
Sbjct  121  LHYTQVVWSKSVRLGCARVQCTNGWWFVTCNYDPPGNYIGQKPY  164



>gb|KDP37611.1| hypothetical protein JCGZ_06954 [Jatropha curcas]
Length=163

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 4/159 (3%)
 Frame = -2

Query  651  SKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            S FP+ AL+++ +I       +Q+   DYL+ HN AR  VGV  ++WD+ +A+YAQN+A+
Sbjct  8    SLFPLFALINLALILPIQ---SQDQQQDYLDAHNQARTAVGVGPLSWDDTVAAYAQNYAN  64

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQ  295
               GDC L HS GPYGENLA +  +L+  DAVK+WVDEK  YDY+SNSC  G  CGHYTQ
Sbjct  65   QRAGDCNLVHSGGPYGENLAWSSAELSGTDAVKMWVDEKAYYDYDSNSCSPGQMCGHYTQ  124

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVW SSVR+GC + RC+NG   I+C+YDP GN  GQ+PY
Sbjct  125  VVWSSSVRVGCAKVRCSNGGTFITCNYDPPGNYVGQKPY  163



>ref|XP_006422714.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
 gb|ESR35954.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
Length=163

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
             SK   + L  ++ +A+   S AQ+ P DY+N HN AR +VGV  +TWD+++ASYAQN+A
Sbjct  3    FSKNSSLPLFCILGLALILSSHAQDLPQDYVNAHNAARAQVGVGPVTWDDRVASYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +   GDC L HS GPYGENLA +   L+  DAVKLWV+EK +YDYNSN+C  G  CGHYT
Sbjct  63   NKRKGDCNLVHSGGPYGENLAWSSAGLSGTDAVKLWVNEKADYDYNSNTCAAGKVCGHYT  122

Query  297  QVVWRSSVRLGCGRARCNNG-WWLISCSYDPAGNVSGQRPY  178
            QVVWR SVR+GC +  CNN     I C+YDP GN  G++PY
Sbjct  123  QVVWRKSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>ref|XP_009335379.1| PREDICTED: LOW QUALITY PROTEIN: basic form of pathogenesis-related 
protein 1 [Pyrus x bretschneideri]
Length=157

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            V  + VM +     S  QN+  D+LN HN  R +V VP + WDN +A+YAQN+A+S  GD
Sbjct  3    VLCIVVMALGQVHPSHTQNSQQDFLNAHNAVRAQVYVPDIVWDNAVAAYAQNYANSRIGD  62

Query  456  CALNHSD--GPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWR  283
            C L HS+  G YGE LAK         AV LWV EK NYDYNSNSC G  C HYTQVVW+
Sbjct  63   CNLVHSNSNGTYGEKLAKGSGSFTGVAAVNLWVAEKPNYDYNSNSCXGQQCLHYTQVVWK  122

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SV+LGC R +C NGWW ++C+Y P GN  GQRPY
Sbjct  123  NSVKLGCARVQCTNGWWFVTCNYSPPGNYVGQRPY  157



>ref|XP_008455065.1| PREDICTED: pathogenesis-related leaf protein 6-like [Cucumis 
melo]
Length=163

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +L+    + LL+V+++ +     AQN+  DY+N HN AR  V V ++ W+  LA+YAQ +
Sbjct  5    KLTSVFQLFLLAVVVLTL-RCCEAQNSAQDYINGHNSARSTVKVGNIVWNATLAAYAQTY  63

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
            A+S  GDC L HS+GPYGENLAK     + A AVKLWVDEK  Y Y++N+C GG+C HYT
Sbjct  64   ANSRKGDCQLIHSNGPYGENLAKGNNGFSGAAAVKLWVDEKPYYSYSNNACNGGECLHYT  123

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVW++S R+GC R +CN+GWW ISC+YDP GN  G+ PY
Sbjct  124  QVVWKTSYRVGCARVQCNDGWWFISCNYDPPGNWDGEWPY  163



>ref|XP_009335372.1| PREDICTED: pathogenesis-related leaf protein 6-like [Pyrus x 
bretschneideri]
 ref|XP_009346539.1| PREDICTED: pathogenesis-related leaf protein 6-like [Pyrus x 
bretschneideri]
Length=162

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = -2

Query  636  VALLSVMMIAMFDL--SGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLT  463
            VA+L ++++A+  +  S  QN+  D+LN HN  R +V VP + WDN +A+YAQN+A+S  
Sbjct  5    VAVLCIVVMALGQVHPSHTQNSQQDFLNAHNAVRAQVYVPDIVWDNAVAAYAQNYANSRI  64

Query  462  GDCALNHSD--GPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQV  292
             DC L HS+  G YGENLAK         AV LWV EK NYDYNSNSCVGG  C HYTQV
Sbjct  65   RDCNLVHSNSNGTYGENLAKGSGSFTGVAAVNLWVAEKPNYDYNSNSCVGGQQCLHYTQV  124

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VW+ SV+LGC R +C NGWW ++C+Y P GN  GQRPY
Sbjct  125  VWKKSVKLGCARVQCTNGWWFVTCNYSPPGNYVGQRPY  162



>ref|XP_011002601.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=162

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -2

Query  651  SKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            SK  +     ++ +++   S AQ+ P DYL+ HN AR  VGV  +TWD  + +YAQN+A+
Sbjct  4    SKISLAFFTLIITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYAN  63

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQ  295
               GDC L HS GPYGENLA +  DL+  DAVK+WVDEK  YDY+SNSC  G  CGHYTQ
Sbjct  64   QRAGDCNLVHSGGPYGENLAWSSADLSGTDAVKMWVDEKAYYDYSSNSCAAGQQCGHYTQ  123

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR+S RLGC + +C+ G   I C+YDP GN  GQ+PY
Sbjct  124  VVWRNSARLGCAKVKCSTGGTFIGCNYDPPGNYVGQKPY  162



>ref|NP_001237253.1| uncharacterized protein LOC100527778 precursor [Glycine max]
 gb|ACU16951.1| unknown [Glycine max]
Length=161

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++++  ++      LS AQN P D+L+ HN AR EVGV  ++W++ L +YAQ +A+    
Sbjct  8    ILSIFFLVCTTTPPLSLAQNTPQDFLDVHNQARAEVGVGPLSWNHTLQAYAQRYANERIP  67

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS GP+GENLA+ Y ++  +DAVK W+ EK  YD+ SN+CV  +C HYTQ+VWR 
Sbjct  68   DCNLEHSMGPFGENLAEGYGEMKGSDAVKFWLTEKPYYDHYSNACVHDECLHYTQIVWRG  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SV LGC RA+CNNGW  + CSY P GN+ G+RPY
Sbjct  128  SVHLGCARAKCNNGWVFVICSYSPPGNIEGERPY  161



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            LS+  +  ++ ++ + + +   AQN P D+L PHN AR EVGV  MTWD+ +A+YAQ +A
Sbjct  3    LSRISLALIMCILGLGVTESCCAQNTPQDFLTPHNRARAEVGVGPMTWDDSVAAYAQRYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD---CGH  304
            +   GDC L HS GPYGENLA +  DL+AA AVK+WV EK  YD+NSN CVG +   C H
Sbjct  63   NQRRGDCKLIHSSGPYGENLAWSSGDLSAAGAVKMWVAEKSLYDHNSNKCVGKNPMGCLH  122

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR S RLGC + RCN+G   + C+Y+P GN  GQ PY
Sbjct  123  YTQVVWRDSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQWPY  164



>ref|XP_006848057.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
 gb|ERN09638.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
Length=165

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            +  L+ +  + M  L  AQN+P DYLNPHN AR  + V  +TWD+ +A++AQN+A+    
Sbjct  10   LTLLVVLCTMGMVHLCHAQNSPQDYLNPHNAARTRLNVGPLTWDDNVAAFAQNYANQRAR  69

Query  459  DCALNHSDGPYGENL-AKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVW  286
            DC L HS GPYGENL   +  D +AADAV  WV+EK +YDYNSN+C  G  CGHYTQVVW
Sbjct  70   DCNLIHSGGPYGENLFGGSGADFSAADAVNAWVNEKADYDYNSNTCAAGKQCGHYTQVVW  129

Query  285  RSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R+SVRLGC + RCNNG   I+C+Y+P GN  GQ+PY
Sbjct  130  RNSVRLGCAKVRCNNGGIFITCNYNPPGNFIGQKPY  165



>gb|KHN33603.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=161

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++++  ++      LS AQN P D+L+ HN AR EVGV  ++W++ L +YAQ +A+    
Sbjct  8    ILSIFFLVCTTTPPLSLAQNTPQDFLDVHNQARAEVGVGPLSWNHTLQAYAQRYANERIP  67

Query  459  DCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRS  280
            DC L HS GP+GENLA+ Y ++  +DAVK W+ EK  YD+ SN+CV  +C HYTQ+VWR 
Sbjct  68   DCNLEHSMGPFGENLAEGYGEMKGSDAVKFWLTEKPYYDHYSNACVHDECLHYTQIVWRD  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            SV LGC RA+CNNGW  + CSY P GN+ G+RPY
Sbjct  128  SVHLGCARAKCNNGWVFVICSYSPPGNIEGERPY  161



>emb|CAA36790.1| unnamed protein product [Nicotiana tabacum]
Length=184

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLS--GAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
             S+ P   L+S +++ +      GAQN+P DYL+ HN AR +VGV  +TWD+++A+YAQN
Sbjct  6    FSQMPSFFLVSTLLLFLIISLSCGAQNSPQDYLDAHNTARADVGVEPLTWDDQVAAYAQN  65

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGGD-CG  307
            +A  L  DC L HS G YGENLA    D + AA AV++WV+EK  YD++SN+C  G  CG
Sbjct  66   YASQLAADCMLVHSHGQYGENLAWGSGDFMTAAKAVEMWVNEKQYYDHDSNTCAQGQVCG  125

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY*L-RVSFNYIY  148
            HYTQVVWR+SVR+GC RA+CN+G +++SC+YDP GN  GQ PY L R  F+ IY
Sbjct  126  HYTQVVWRNSVRVGCARAQCNSGGYVVSCNYDPPGNFVGQSPYELKRRPFHVIY  179



>ref|XP_010040969.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW44744.1| hypothetical protein EUGRSUZ_L01705 [Eucalyptus grandis]
Length=170

 Score =   176 bits (447),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            V  L  + +A+  LS AQ++P DY+  HN AR +VGV  +TWD ++ASYA+++A     D
Sbjct  16   VIFLVALTLALISLSVAQDSPQDYVAAHNAARSQVGVGPITWDERVASYARDYAQKHARD  75

Query  456  CA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            C  L HS GPYGENLA A PDL    AV LWV EK +YDYNSNSC  G  CGHYTQVVWR
Sbjct  76   CTRLVHSGGPYGENLAWASPDLTGTRAVNLWVGEKPDYDYNSNSCAPGKVCGHYTQVVWR  135

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVR+GC +A+C  G  L++C+YDP GN  GQ+PY
Sbjct  136  NSVRVGCAKAQCATGGTLVTCNYDPPGNYRGQKPY  170



>gb|KDP37604.1| hypothetical protein JCGZ_06947 [Jatropha curcas]
Length=162

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 107/161 (66%), Gaps = 4/161 (2%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            +L   P+     +++   F+   AQ  P DYLN HN AR  VG+  M+WD K+A+YAQN+
Sbjct  5    KLLALPLFIATVLLLPVPFN---AQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            A+    +C L HS+GPYGENLA    DL+  +AVK+WVDEK  YDYNSNSC  G  CGHY
Sbjct  62   ANQHVSECNLVHSEGPYGENLAWGSGDLSVEEAVKMWVDEKTYYDYNSNSCAPGQVCGHY  121

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR SVRLGC +  C NG   I C+YDP GN  G+RPY
Sbjct  122  TQVVWRESVRLGCAKVTCTNGGTFIGCNYDPPGNYIGKRPY  162



>ref|XP_006486822.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
             SK   + L  ++ +A+   S AQ++P DY+N HN AR +VGV  +TWD+++ASYAQN+A
Sbjct  3    FSKNSSLPLFCILGLALILSSHAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +   GDC L HS GPYGENLA +   L+  DAVK+WV+EK +YDYNSN+C  G  CGHYT
Sbjct  63   NQRKGDCNLVHSGGPYGENLAWSSAGLSGTDAVKMWVNEKADYDYNSNTCAEGKVCGHYT  122

Query  297  QVVWRSSVRLGCGRARCNNG-WWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVR+GC +  CNN     I C+YDP GN  G++PY
Sbjct  123  QVVWRNSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>emb|CDX93140.1| BnaA03g38620D [Brassica napus]
Length=160

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +S F  + LL+  + A+   S AQ++P DY+  HN+AR  VGV  M W+  +A+ AQ
Sbjct  1    MEVISNFRFLILLAAFVGALLH-SKAQDSPQDYVRVHNEARAGVGVGPMQWNESIAAVAQ  59

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD    DC L HS GPYGENLAK+  DL+   AV LWV+EK NYDY SN+C  G+CGH
Sbjct  60   SYADQRRSDCNLIHSTGPYGENLAKSSGDLSGVRAVNLWVEEKANYDYPSNTC-NGECGH  118

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQ+VWRSSV+LGCG+A+CN+G   + C+YDP GN   Q+PY
Sbjct  119  YTQIVWRSSVKLGCGKAKCNSGGTFVVCNYDPPGNYVNQKPY  160



>gb|ABA41593.1| pathogenesis-related protein [Solanum lycopersicum]
Length=136

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  585  QNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAKA  406
            QN+P DYL  HNDAR +VGV  M+WD  LAS AQN+A+S  GDC L HS    GENLAK 
Sbjct  2    QNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA--GENLAKG  59

Query  405  YPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSVRLGCGRARCNNGWWL  229
              D     AV+LWV E+ +Y+Y +N CVGG  C HYTQVVWR+SVRLGCGRARCNNGWW 
Sbjct  60   GGDFTGRAAVQLWVSERPSYNYATNQCVGGKKCRHYTQVVWRNSVRLGCGRARCNNGWWF  119

Query  228  ISCSYDPAGNVSGQRPY  178
            ISC+YDP GN  GQRPY
Sbjct  120  ISCNYDPVGNWIGQRPY  136



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score =   176 bits (445),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 4/159 (3%)
 Frame = -2

Query  651  SKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            S FP+ AL+++ +I       +Q+   DYL+ HN AR  VGV  ++WD+ +A+YAQN+A 
Sbjct  8    SLFPLFALINLALILPIQ---SQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYAS  64

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQ  295
               GDC L HS GPYGENLA +  +L+  DAVK+WVDEK  YDY+SNSC  G  CGHYTQ
Sbjct  65   QRAGDCNLVHSGGPYGENLAWSSAELSGTDAVKMWVDEKAYYDYDSNSCSPGQMCGHYTQ  124

Query  294  VVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VVWR SVR+GC + RC+NG   ++C+YDP GN  GQ+PY
Sbjct  125  VVWRDSVRVGCAKVRCSNGGTFVTCNYDPPGNYVGQKPY  163



>gb|KHN19054.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
 gb|KHN19058.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=162

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 112/157 (71%), Gaps = 9/157 (6%)
 Frame = -2

Query  615  MIAMFDLSGAQNAPADYLNPHNDARDEVG---------VPHMTWDNKLASYAQNHADSLT  463
            ++ + D++ AQ++  DY+N HN AR EVG         VP + WD+ +A+YA+++A+   
Sbjct  6    LVIVGDVAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRK  65

Query  462  GDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWR  283
            GDC L HS G YGEN+A +  +L+  DAVK+WVDEK NYDY+SNSCVGG+C HYTQVVW 
Sbjct  66   GDCQLIHSGGEYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGECLHYTQVVWA  125

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY*L  172
            +SVRLGC +  C+NG   I+C+YDP GN  G+RPY L
Sbjct  126  NSVRLGCAKVTCDNGGTFITCNYDPPGNFVGERPYKL  162



>ref|XP_006486820.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
             SK   + L  ++ +A+   S AQ++P DY+N HN AR +VGV  +TWD+++ASYAQN+A
Sbjct  3    FSKNSSLPLFCILGLALILSSHAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYT  298
            +   GDC L HS GPYGENLA +   L+  DAVKLWV+EK +Y YNSN+C  G  CGHYT
Sbjct  63   NQRKGDCNLVHSGGPYGENLAWSSAGLSGTDAVKLWVNEKADYHYNSNTCAAGKVCGHYT  122

Query  297  QVVWRSSVRLGCGRARCNNG-WWLISCSYDPAGNVSGQRPY  178
            QVVWR SVR+GC +  CNN     I C+YDP GN  G++PY
Sbjct  123  QVVWRKSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>gb|KFK39965.1| hypothetical protein AALP_AA3G312200 [Arabis alpina]
Length=161

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 111/162 (69%), Gaps = 1/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  L  F +V +L  ++ A+   S AQ+   DY+N HN AR  VGV  M WD  +A+ A+
Sbjct  1    MKVLGYFQLVLILVAIVEALVLPSNAQDRDQDYINGHNQARSAVGVGPMQWDAGVAAVAR  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
             +A+   GDC L HS+GPYGENLAK+  DL+   AV LWV+EK NYDY +N+C  G CGH
Sbjct  61   KYANQRKGDCRLIHSNGPYGENLAKSTGDLSGISAVNLWVNEKANYDYPTNTC-NGVCGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQ+VWR+SVRLGC +ARCNNG  +I C+YDP GN   Q+PY
Sbjct  120  YTQIVWRNSVRLGCAKARCNNGGTIIVCNYDPPGNYVNQKPY  161



>ref|XP_010467241.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +S   ++ +L+ ++  +   S AQ++P DY+N HN AR +VGV  + WD ++A YA+
Sbjct  1    MNFISSSRILIILAALIGVLLVPSKAQDSPQDYVNAHNQARSQVGVGPIQWDEEVAGYAR  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD L GDC L HS G YGENLA +  D +  DAV LWV+EK +Y+Y+SN+C  G CGH
Sbjct  61   SYADQLKGDCNLAHSGGRYGENLAMSTGDFSGVDAVNLWVNEKADYNYDSNTC-NGVCGH  119

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC +  CNNG  ++SC+YDP GN + ++PY
Sbjct  120  YTQVVWRNSVRLGCAKVTCNNGGTVVSCNYDPRGNFNHEKPY  161



>ref|XP_009136246.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=160

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  +S F  + LL+  +  +   S AQ++P DY+  HN+AR  VGV  M W+  +A+ AQ
Sbjct  1    MEVISNFRFLILLAAFVGTLLH-SKAQDSPQDYVRVHNEARAGVGVGPMQWNESIAAVAQ  59

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGH  304
            ++AD    DC L HS GPYGENLAK+  DL+   AV LWV+EK NYDY SN+C  G+CGH
Sbjct  60   SYADQRRSDCNLIHSTGPYGENLAKSSGDLSGVRAVNLWVEEKANYDYPSNTC-NGECGH  118

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQ+VWRSSV+LGCG+A+CN+G   + C+YDP GN   Q+PY
Sbjct  119  YTQIVWRSSVKLGCGKAKCNSGGTFVVCNYDPPGNYVNQKPY  160



>ref|XP_003545775.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
Length=174

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 117/167 (70%), Gaps = 11/167 (7%)
 Frame = -2

Query  645  FPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVG---------VPHMTWDNKLAS  493
            F V+ +L ++++   D++ AQ++  DY+N HN AR EV          VP + WD+ +A+
Sbjct  10   FCVMCVLGLVIVG--DVAYAQDSAQDYVNAHNAARAEVSSQSPRANVIVPSLAWDDTVAA  67

Query  492  YAQNHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD  313
            YA+++A+   GDCAL HS G YGEN+A +  +L+  DAVK+WVDEK NYDYNSNSCVGG+
Sbjct  68   YAESYANQRKGDCALIHSGGKYGENIAMSTGELSGTDAVKMWVDEKANYDYNSNSCVGGE  127

Query  312  CGHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY*L  172
            C HYTQVVW  S+RLGC +  C+NG   I+C+YDP GN+ G+ PY L
Sbjct  128  CLHYTQVVWAHSLRLGCAKVTCDNGGTFITCNYDPPGNLVGESPYEL  174



>ref|XP_010052997.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
Length=165

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +  L  + +A+  LS AQ++P DY+  HN AR +V V  M WD  +A YA+++A+    D
Sbjct  11   LIFLVALTLALIPLSIAQDSPQDYVAAHNAARSQVNVGPMAWDETVAGYARDYANKHASD  70

Query  456  CA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCV-GGDCGHYTQVVWR  283
            C  L HS GPYGENLA A PDL    AV +WV EK +YDYNSNSC  G DCGHYTQVVWR
Sbjct  71   CTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKDCGHYTQVVWR  130

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC +A+C  G  L++C+YDP GNV GQ+PY
Sbjct  131  NSVRLGCAKAQCTTGGTLVTCNYDPPGNVVGQKPY  165



>ref|XP_010525646.1| PREDICTED: pathogenesis-related leaf protein 6-like [Tarenaya 
hassleriana]
Length=163

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = -2

Query  663  MGRLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            M  L     VA+ ++ +     +S  QN    YLN HN AR +VGV ++ WD+ +A+YAQ
Sbjct  1    MNTLGPLFRVAVFAIAIGLQVVVSSGQNTAQGYLNAHNSARTQVGVANIAWDDTVAAYAQ  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCG  307
            ++A+S   DC+L HS+GPYGENLAK         AV LWV EK  Y+Y +NSC GG  C 
Sbjct  61   SYANSRASDCSLVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKLYYNYTTNSCTGGKQCL  120

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWR SVRLGC R +C +G+W ++C+YDP GN  G+RPY
Sbjct  121  HYTQVVWRDSVRLGCARVQCIDGYWFVTCNYDPPGNYVGERPY  163



>gb|KCW63515.1| hypothetical protein EUGRSUZ_G01148 [Eucalyptus grandis]
Length=161

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +  L  + +A+  LS AQ++P DY+  HN AR +VGV  M WD  +A YA+++A+    D
Sbjct  7    LIFLVALTLALIPLSIAQDSPQDYVAAHNAARSQVGVGPMAWDETVAGYARDYANKHASD  66

Query  456  CA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            C  L HS GPYGENLA A PDL    AV +WV EK +YDYNSNSC  G  CGHYTQVVWR
Sbjct  67   CTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKVCGHYTQVVWR  126

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC +A+C  G  L++C+YDP GNV GQ+PY
Sbjct  127  NSVRLGCAKAQCATGGTLVTCNYDPPGNVVGQKPY  161



>ref|XP_010065842.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
Length=165

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +  L  + +A+  LS AQ++P DY+  HN AR +VGV  M WD  +A YA+++A+    D
Sbjct  11   LIFLVALTLALIPLSIAQDSPQDYVAAHNAARSQVGVGPMAWDETVAGYARDYANKHASD  70

Query  456  CA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            C  L HS GPYGENLA A PDL    AV +WV EK +YDYNSNSC  G  CGHYTQVVWR
Sbjct  71   CTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKVCGHYTQVVWR  130

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVRLGC +A+C  G  L++C+YDP GNV GQ+PY
Sbjct  131  NSVRLGCAKAQCATGGTLVTCNYDPPGNVVGQKPY  165



>ref|XP_009605825.1| PREDICTED: pathogenesis-related protein 1B-like [Nicotiana tomentosiformis]
Length=177

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 114/163 (70%), Gaps = 4/163 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMF--DLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
             S+ P   L+S +++ +     S AQN+  DYL+ HN AR +V V  +TWD+ +A+YAQN
Sbjct  6    FSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVAVEPLTWDDDVAAYAQN  65

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGGD-CG  307
            +   L  DC L HS G YGENLA+   D + AA AV++WVDEK  YDY+SN+C  G  CG
Sbjct  66   YVSQLAADCNLVHSHGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDYDSNTCAEGQVCG  125

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            HYTQVVWR+SVR+GC R +C+NG +++SC+YDP GNV GQ P+
Sbjct  126  HYTQVVWRNSVRVGCARVQCDNGGYVVSCNYDPPGNVIGQSPF  168



>ref|XP_011030278.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=167

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
             +SK  +  +  V++ +    + AQ++P D+LN HN AR  VGV  M W N +A++A+++
Sbjct  2    EMSKIALAIISLVILASTVHDAHAQDSPRDFLNAHNAARASVGVGPMRWSNTVAAFARSY  61

Query  477  ADSLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYT  298
             + L   C + HS GP GENLA    DL    AVK+WVDE+ NYDYNSNSCVGG C HYT
Sbjct  62   INGLRDGCRMVHSSGPCGENLAWGSADLAGTAAVKMWVDERANYDYNSNSCVGGQCLHYT  121

Query  297  QVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            QVVWR+SVRLGC + RC+NG  +ISC+YDP GN + QRP+
Sbjct  122  QVVWRNSVRLGCAKVRCDNGGTIISCNYDPPGNYNDQRPF  161



>ref|XP_009803803.1| PREDICTED: pathogenesis-related protein 1C-like [Nicotiana sylvestris]
Length=184

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 122/174 (70%), Gaps = 5/174 (3%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLS--GAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQN  481
             S+ P   L+S +++ +      GAQN+P DYL+ HN AR +VGV  +TWD+++A+YAQN
Sbjct  6    FSQMPSFFLVSTLLLFLIISLSCGAQNSPQDYLDAHNTARADVGVEPLTWDDQVAAYAQN  65

Query  480  HADSLTGDCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGGD-CG  307
            +A  L  DC L HS G YGENLA    D + AA AV++WV+EK  YD++SN+C  G  CG
Sbjct  66   YASQLAADCMLVHSHGQYGENLAWGSGDFMTAAKAVEMWVNEKQYYDHDSNTCAQGQVCG  125

Query  306  HYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY*L-RVSFNYIY  148
            HYTQVVWR+SVR+GC R +CN+G +++SC+YDP GN  GQ PY L R  F+ IY
Sbjct  126  HYTQVVWRNSVRVGCARVQCNDGGYVVSCNYDPPGNFVGQSPYELKRRPFHVIY  179



>ref|XP_004168740.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  597  LSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGEN  418
            L+ AQNAP DY++ HN AR  VGV  MTW+N +A+YAQ++A+    DCAL HS GPYGEN
Sbjct  14   LTHAQNAPQDYISLHNKARAAVGVGPMTWNNTVAAYAQSYANKRKNDCALIHSTGPYGEN  73

Query  417  LAKAY-PDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNN  241
            +A  Y P+   AD VK+WV EK  YDY SNSC GGDCGHYTQVVWR+SV LGC R  C  
Sbjct  74   IAVGYYPEFTGADGVKMWVGEKHLYDYASNSCKGGDCGHYTQVVWRTSVHLGCARVACKG  133

Query  240  GWWLISCSYDPAGNVSGQRPY  178
                + C+YDP GN  G RPY
Sbjct  134  KSQFVVCNYDPPGNYIGLRPY  154



>ref|XP_002891554.1| hypothetical protein ARALYDRAFT_474142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67813.1| hypothetical protein ARALYDRAFT_474142 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 108/161 (67%), Gaps = 2/161 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            ++ F   ++L V +  +   + AQN P DYLN HN AR +VGVP++ WD  LA+YA N+A
Sbjct  1    MNTFKTPSVLIVAISFLVIATNAQNTPQDYLNSHNTARAQVGVPNVVWDTTLATYALNYA  60

Query  474  DSLTGDCALNHSDGPYGENLAK-AYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHY  301
            +S   +C+L HS+GPYGENLAK +    +   AVKLWVDEK  Y Y  N+C GG  C HY
Sbjct  61   NSRKANCSLVHSNGPYGENLAKGSSSTFSGISAVKLWVDEKPYYSYAYNNCTGGKQCLHY  120

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR SV++GC R +C N WW +SC+YD  GN  G+ PY
Sbjct  121  TQVVWRDSVKIGCARVQCTNTWWFVSCNYDSPGNWVGEYPY  161



>gb|ADD97801.1| pathogenesis-related protein 1 [Musa ABB Group]
Length=163

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = -2

Query  651  SKFPVVALLSVMMIAMFDLSG-AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            S  P +A+L  + +AM   S  AQN+P D+++PHN AR  VGV  ++WD+ +A+YAQN+A
Sbjct  3    SSNPALAMLCTVALAMACTSTLAQNSPQDFVSPHNAARAAVGVGPVSWDSTVAAYAQNYA  62

Query  474  DSLTGDCALNHSDGPYGENL-AKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHY  301
            +    DC L HS GPYGEN+ + +  D  AADAV  WV EK +YDYNSN C     CGHY
Sbjct  63   NQRKADCQLVHSGGPYGENIFSGSGRDYTAADAVNAWVSEKQDYDYNSNKCAPNKVCGHY  122

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWRSS  +GCGR RCNNG   I+C+Y P GN +GQRPY
Sbjct  123  TQVVWRSSTAIGCGRVRCNNGGIFITCNYKPPGNYAGQRPY  163



>ref|XP_010527028.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Tarenaya 
hassleriana]
Length=164

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
              KF    +++++ + M     AQ++P DY+N HN AR EVGV  ++WDN +A++AQN+A
Sbjct  3    FPKFSGTLIMALLALVMAQTLQAQDSPQDYVNAHNRARAEVGVGPVSWDNTVAAFAQNYA  62

Query  474  DSLTGDCALNHSDG--PYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGH  304
                GDC L HS G   YGENLA +   L   DAV LWV+EK +YDYNSN+C  G  CGH
Sbjct  63   RQRAGDCRLIHSGGGGRYGENLAMSTGGLTGVDAVALWVNEKVDYDYNSNTCRPGKVCGH  122

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR++VR+GC + RCN+G   I+C+YDP GN  GQ+PY
Sbjct  123  YTQVVWRNTVRIGCAKVRCNSGGTFITCNYDPPGNYVGQKPY  164



>ref|XP_004230669.1| PREDICTED: pathogenesis-related leaf protein 6 [Solanum lycopersicum]
Length=164

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDL---SGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQ  484
            ++ F    +L   +I  F L     AQN+  DYLN HN AR +VGV  +TW+  L +YAQ
Sbjct  1    MALFKSSNVLICFIILAFVLPYYCDAQNSQTDYLNTHNSARSQVGVGAITWNTTLENYAQ  60

Query  483  NHADSLTGDCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGG-DC  310
            N+A+    DC L HS+GPYGEN+AK     +    AV LWV EK  YDYNSNSC GG +C
Sbjct  61   NYANQRISDCNLVHSNGPYGENIAKGSGSFMTGTAAVNLWVGEKPYYDYNSNSCTGGKEC  120

Query  309  GHYTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             HYTQVVW++S++LGC R +C NGWW ++C+Y+P GN  GQRPY
Sbjct  121  RHYTQVVWKNSIQLGCARVQCTNGWWFVTCNYNPPGNYIGQRPY  164



>gb|KHN19052.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=160

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -2

Query  642  PVVALLSVMMIAMFD---LSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHAD  472
            P   +LS+  +       LS AQN P D+L+ HN AR EVGV  ++W++ L +YAQ++A+
Sbjct  3    PCNVILSIFFLVCTRTPLLSLAQNTPQDFLDVHNQARAEVGVGPLSWNHTLQAYAQSYAN  62

Query  471  SLTGDCALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQV  292
                DC L HS GP+GEN+A+ Y ++  +DAVK W+ EK  YD++SN+CV  +C HYTQ+
Sbjct  63   KRIPDCNLEHSMGPFGENIAEGYAEMKGSDAVKFWLTEKPYYDHHSNACVHDECLHYTQI  122

Query  291  VWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            VWR SV LGC RA+CNN W  + CSY P GN+ G+RPY
Sbjct  123  VWRDSVHLGCARAKCNNDWVFVICSYSPPGNIEGERPY  160



>ref|XP_010065834.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW63504.1| hypothetical protein EUGRSUZ_G01134 [Eucalyptus grandis]
Length=165

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 2/162 (1%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            R+S    +  L  + +A+  LS AQ++P DY+  HN AR +VGV  +TWD ++A YA+++
Sbjct  4    RMSVPLHIIFLVALALALIPLSIAQDSPQDYVAAHNAARSQVGVGQITWDERVAGYARDY  63

Query  477  ADSLTGDCA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGH  304
            A     DC  L HS GPYGENLA A PDL    AV +WV EK  Y+YNSNSC  G  CGH
Sbjct  64   AQKHARDCTRLVHSAGPYGENLAWASPDLTGTRAVNMWVGEKPYYNYNSNSCASGKVCGH  123

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC +A+C  G  L++C+YDP GN  GQ+PY
Sbjct  124  YTQVVWRNSVRLGCAKAKCATGGTLVTCNYDPPGNYVGQKPY  165



>ref|XP_008372945.1| PREDICTED: pathogenesis-related protein 1-like [Malus domestica]
 gb|ABC47922.1| pathogenesis-related protein 1a [Malus domestica]
Length=161

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 106/154 (69%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            +ALL ++   +   S AQ+ P DYL  HNDAR  VGV  +TWD+K+A YAQN+A+   GD
Sbjct  8    LALLFILGSVLIQSSHAQDTPQDYLKSHNDARAAVGVGPLTWDDKVAGYAQNYANQHVGD  67

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRS  280
            C L HS GPYGENLA +  D++   AV +WV EK +Y Y SNSC  G  CGHYTQVVWR+
Sbjct  68   CNLVHSGGPYGENLAMSTGDMSGTAAVDMWVAEKADYSYESNSCADGKVCGHYTQVVWRN  127

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            S R+GC + RC++G   I C+YDP GN  GQ+PY
Sbjct  128  SARVGCAKVRCSSGGTFIGCNYDPPGNYVGQKPY  161



>ref|XP_006393183.1| hypothetical protein EUTSA_v10011955mg [Eutrema salsugineum]
 gb|ESQ30469.1| hypothetical protein EUTSA_v10011955mg [Eutrema salsugineum]
Length=161

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 2/161 (1%)
 Frame = -2

Query  654  LSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHA  475
            ++ F  + LL +    +   S AQN   DYLN HN AR +VGV ++ WD  +A+YAQN+A
Sbjct  1    MNTFKTLVLLIIAASFLVIASNAQNTAQDYLNTHNTARSQVGVANVVWDATVATYAQNYA  60

Query  474  DSLTGDCALNHSDGPYGENLAK-AYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHY  301
            ++   DC L HS GPYGENLAK +    +   AV LW++EK  Y+Y +NSC GG  C HY
Sbjct  61   NARKSDCNLVHSSGPYGENLAKGSSSTFSGISAVNLWINEKPYYNYTTNSCTGGKQCLHY  120

Query  300  TQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            TQVVWR SV++GC R +C NGWW ++C+YD  GN  G+ PY
Sbjct  121  TQVVWRDSVKIGCARVQCTNGWWFVTCNYDAPGNYIGEYPY  161



>ref|XP_010065833.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW63503.1| hypothetical protein EUGRSUZ_G01133 [Eucalyptus grandis]
Length=170

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            V  L  + +A+  LS AQ++P DY+  HN AR +VGV  +TWD ++ASYA+++A     D
Sbjct  16   VIFLVALTLALISLSVAQDSPQDYVAAHNAARSQVGVGPITWDERVASYARDYAQKHARD  75

Query  456  CA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWR  283
            C  L HS GPYGENLA A PDL    AV LWV EK +Y+YNSNSC  G  CGHYTQVVWR
Sbjct  76   CTRLVHSGGPYGENLAWASPDLTGTRAVNLWVGEKPDYNYNSNSCAPGKVCGHYTQVVWR  135

Query  282  SSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            +SVR+GC +A+C  G  L++C+YDP GN  GQ+PY
Sbjct  136  NSVRVGCAKAQCATGGTLVTCNYDPPGNYIGQKPY  170



>gb|KGN43830.1| hypothetical protein Csa_7G070252 [Cucumis sativus]
Length=163

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+  DY+N HN AR  VGV ++ W+  LA+YAQ +A+S   DC L HS+GPYGEN+AK
Sbjct  27   AQNSAQDYINGHNSARSTVGVGNIVWNTTLAAYAQTYANSRKSDCQLIHSNGPYGENIAK  86

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                 + A AVKLWVDEK  Y Y+ N+C GG+C HYTQVVW +S R+GC R +CNNGWW 
Sbjct  87   GNNGFSGAAAVKLWVDEKPYYSYSKNACDGGECLHYTQVVWETSYRVGCARVQCNNGWWF  146

Query  228  ISCSYDPAGNVSGQRPY  178
            ISC+YDP GN   +RPY
Sbjct  147  ISCNYDPPGNWDEERPY  163



>ref|XP_004289701.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 104/156 (67%), Gaps = 2/156 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
             VA L ++ +A    S AQN+  DYLN HN AR  VGV ++ WD+ +A+YAQN+A+S   
Sbjct  4    FVAFLCLIGLAAVHPSHAQNSQQDYLNAHNTARAHVGVANIIWDSTVAAYAQNYANSRIA  63

Query  459  DCALNHSDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVW  286
            DC L HS GPYGENLAK     L    AV LWV EK  Y+Y SNSC GG  C HYTQVVW
Sbjct  64   DCNLVHSGGPYGENLAKGSSSALTGTAAVNLWVAEKPYYNYTSNSCTGGQQCLHYTQVVW  123

Query  285  RSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
             +S+RLGC R +C N WW ++C+YDP GN  GQ PY
Sbjct  124  ANSIRLGCARVQCTNTWWFVTCNYDPPGNYVGQLPY  159



>emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum]
Length=153

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -2

Query  621  VMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNH  442
            ++ + +   S AQN+  DYL+ HN AR +VGV  +TWDN +A+YAQN+   L  DC L H
Sbjct  4    LLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVH  63

Query  441  SDGPYGENLAKAYPD-LNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSVRL  268
            S G YGENLA+   D + AA AV++WVDEK  YD++SN+C  G  CGHYTQVVWR+SVR+
Sbjct  64   SHGQYGENLAQGSGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRV  123

Query  267  GCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            GC R +CNNG +++SC+YDP GNV GQ PY
Sbjct  124  GCARVKCNNGGYVVSCNYDPPGNVIGQSPY  153



>ref|XP_002522065.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40265.1| STS14 protein precursor, putative [Ricinus communis]
Length=161

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN P DY+N HN AR  VGV  MTWDN +A+YAQN+A+    DC L HS G YGEN+A 
Sbjct  24   AQNLPQDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGGRYGENIAW  83

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVWRSSVRLGCGRARCNNGWW  232
            +  DL+   AVKLWVDEK  Y+YNSN+C  G  CGHYTQVVWR+SVRLGC + RC NG  
Sbjct  84   SSGDLSGTAAVKLWVDEKAFYNYNSNTCAAGQQCGHYTQVVWRNSVRLGCAKVRCRNGGT  143

Query  231  LISCSYDPAGNVSGQRPY  178
             I+C+YDP GN   QRPY
Sbjct  144  FITCNYDPPGNFVNQRPY  161



>pdb|1CFE|A Chain A, P14a, Nmr, 20 Structures
Length=135

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = -2

Query  585  QNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAKA  406
            QN+P DYL  HNDAR +VGV  M+WD  LAS AQN+A+S  GDC L HS    GENLAK 
Sbjct  1    QNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA--GENLAKG  58

Query  405  YPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRSSVRLGCGRARCNNGWWL  229
              D     AV+LWV E+ +Y+Y +N CVGG  C HYTQVVWR+SVRLGCGRARCNNGWW 
Sbjct  59   GGDFTGRAAVQLWVSERPSYNYATNQCVGGKKCRHYTQVVWRNSVRLGCGRARCNNGWWF  118

Query  228  ISCSYDPAGNVSGQRP  181
            ISC+YDP GN  GQRP
Sbjct  119  ISCNYDPVGNWIGQRP  134



>ref|XP_004136923.1| PREDICTED: pathogenesis-related leaf protein 4-like [Cucumis 
sativus]
 ref|XP_004169190.1| PREDICTED: pathogenesis-related leaf protein 4-like [Cucumis 
sativus]
Length=157

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -2

Query  588  AQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCALNHSDGPYGENLAK  409
            AQN+  DY+N HN AR  VGV ++ W+  LA+YAQ +A+S   DC L HS+GPYGEN+AK
Sbjct  21   AQNSAQDYINGHNSARSTVGVGNIVWNTTLAAYAQTYANSRKSDCQLIHSNGPYGENIAK  80

Query  408  AYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSSVRLGCGRARCNNGWWL  229
                 + A AVKLWVDEK  Y Y+ N+C GG+C HYTQVVW +S R+GC R +CNNGWW 
Sbjct  81   GNNGFSGAAAVKLWVDEKPYYSYSKNACDGGECLHYTQVVWETSYRVGCARVQCNNGWWF  140

Query  228  ISCSYDPAGNVSGQRPY  178
            ISC+YDP GN   +RPY
Sbjct  141  ISCNYDPPGNWDEERPY  157



>ref|XP_004289700.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Fragaria vesca subsp. vesca]
Length=164

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 114/157 (73%), Gaps = 3/157 (2%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
            ++  + + ++ +   S AQN+P DY++ HN AR  VGVP++TWD+ +A+YAQ++A+  +G
Sbjct  8    LLCFIVLTVVLLVQPSHAQNSPQDYVDAHNAARLRVGVPNITWDDTVAAYAQHYANLRSG  67

Query  459  DCALNHSDGPYGENLAKAYPD--LNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVW  286
            DC+L HS GPYGENLA  Y    +   +AV LW++EK  Y++NSN CVGG+C HYTQV+W
Sbjct  68   DCSLVHSHGPYGENLAYGYGSGAITGVNAVNLWLEEKPYYNHNSNCCVGGECLHYTQVIW  127

Query  285  RSSVRLGCGRARCNN-GWWLISCSYDPAGNVSGQRPY  178
              S+RLGC R +C+N G W ++C+YDP GN  G+RPY
Sbjct  128  HYSIRLGCARVQCSNPGCWFVTCNYDPPGNYYGKRPY  164



>ref|XP_010065836.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 ref|XP_010040970.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 ref|XP_010041778.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW44745.1| hypothetical protein EUGRSUZ_L01707 [Eucalyptus grandis]
 gb|KCW63506.1| hypothetical protein EUGRSUZ_G01137 [Eucalyptus grandis]
Length=165

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 2/162 (1%)
 Frame = -2

Query  657  RLSKFPVVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNH  478
            R+S    +  L  + +A+  LS AQ++P DY+  HN AR +VGV  +TWD ++A YA+++
Sbjct  4    RMSVPLHIIFLVALALALIPLSIAQDSPQDYVAAHNAARSQVGVGRITWDERVAGYARDY  63

Query  477  ADSLTGDCA-LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGH  304
            A     DC  L HS GPYGENLA A PDL    AV +WV EK  Y+YNSNSC  G  CGH
Sbjct  64   AKKHARDCTRLVHSGGPYGENLAWASPDLTGTRAVNMWVGEKPYYNYNSNSCASGKVCGH  123

Query  303  YTQVVWRSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            YTQVVWR+SVRLGC +A+C  G  L++C+YDP GN  GQ+PY
Sbjct  124  YTQVVWRNSVRLGCAKAKCATGGTLVTCNYDPPGNYVGQKPY  165



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = -2

Query  630  LLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGDCA  451
            ++ ++ + + +L  AQ  P D+L PHN AR EVGV  MTWD+ +A+YA+N+A+   GDC 
Sbjct  4    VICILGLGVIELCYAQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARNYANQRQGDCK  63

Query  450  LNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD---CGHYTQVVWRS  280
            L HS GPYGEN+A +  DL+AA AV +WV EK  YDY SN+CVG +   C HYTQVVWR 
Sbjct  64   LVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLHYTQVVWRK  123

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            S RLGC + RCN+G   + C+Y+P GN  GQRPY
Sbjct  124  STRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  157



>gb|AFM77011.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=154

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 106/154 (69%), Gaps = 1/154 (1%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            + L+ V+   +   S AQ+ P DYLN HN AR  VGV  +TWD+K+A YAQN+A+   GD
Sbjct  1    LGLVVVLCSVLIQSSHAQDTPQDYLNSHNAARAAVGVGPLTWDDKVAGYAQNYANQHVGD  60

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGD-CGHYTQVVWRS  280
            C L HS GPYGENLA +  D++   AV +WV EK +YDY SNSC  G  CGHYTQVVWR+
Sbjct  61   CNLVHSGGPYGENLAMSTGDMSGTAAVDMWVAEKADYDYESNSCADGKVCGHYTQVVWRN  120

Query  279  SVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            S R+GC + RC++G   I C+YDP GN  GQ+PY
Sbjct  121  SARVGCAKVRCSSGGTFIGCNYDPPGNYVGQKPY  154



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  639  VVALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTG  460
             +AL   + +AM   + AQN+P D+++ HN AR  VGV  ++WD+ +A+YAQN+A+   G
Sbjct  7    TLALACAVFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNYANQRIG  66

Query  459  DCALNHSDGPYGENLA-KAYPDLNAADAVKLWVDEKDNYDYNSNSCVGG-DCGHYTQVVW  286
            DC L HS GPYGENL   +  D  AADAVK WVDEK  YDYN+N+C  G  CGHYTQVVW
Sbjct  67   DCQLKHSGGPYGENLFWGSGADFTAADAVKSWVDEKQWYDYNTNTCASGHQCGHYTQVVW  126

Query  285  RSSVRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            R S  +GC R +CN+G   I C+Y P GN+ GQRPY
Sbjct  127  RDSTNIGCARVKCNSGAIFIICNYKPPGNIVGQRPY  162



>ref|XP_010270442.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=161

 Score =   173 bits (439),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 106/153 (69%), Gaps = 0/153 (0%)
 Frame = -2

Query  636  VALLSVMMIAMFDLSGAQNAPADYLNPHNDARDEVGVPHMTWDNKLASYAQNHADSLTGD  457
            + LL+ ++ A+F +S AQ +P DYL  HN+AR ++G+P +TWDNKLASYAQ++A+    D
Sbjct  9    LTLLASLVFALFHVSLAQTSPKDYLKAHNEARAKLGIPPLTWDNKLASYAQDYANKRIED  68

Query  456  CALNHSDGPYGENLAKAYPDLNAADAVKLWVDEKDNYDYNSNSCVGGDCGHYTQVVWRSS  277
            C L HS   YGEN+A A   ++A +AV +W+DE+  YD+ SN+C GGDC HYTQVVWR S
Sbjct  69   CELLHSTMDYGENIATASWSMSAKEAVDMWIDERPFYDHASNTCKGGDCLHYTQVVWRDS  128

Query  276  VRLGCGRARCNNGWWLISCSYDPAGNVSGQRPY  178
            V LGC  + C  G     C YDP GNV  QRPY
Sbjct  129  VHLGCAISNCKAGGSFAICLYDPPGNVITQRPY  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1578137067990