BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31159_g1_i1 len=419 path=[1:0-418]

Length=419
                                                                      Score     E

gb|EPS62652.1|  hypothetical protein M569_12138                         109   2e-25   
ref|XP_009611972.1|  PREDICTED: clathrin heavy chain 1-like             110   1e-24   
ref|XP_009783811.1|  PREDICTED: clathrin heavy chain 1-like isofo...    110   2e-24   
ref|XP_004240929.1|  PREDICTED: clathrin heavy chain 1                  109   3e-24   
ref|XP_006338824.1|  PREDICTED: clathrin heavy chain 1-like             108   3e-24   
ref|XP_009631458.1|  PREDICTED: clathrin heavy chain 1                  108   4e-24   
ref|XP_009617483.1|  PREDICTED: clathrin heavy chain 2-like             108   4e-24   
ref|XP_009758522.1|  PREDICTED: clathrin heavy chain 1                  108   4e-24   
ref|XP_011084891.1|  PREDICTED: clathrin heavy chain 2                  108   4e-24   
ref|XP_009786959.1|  PREDICTED: clathrin heavy chain 2-like             108   5e-24   
gb|EPS71155.1|  hypothetical protein M569_03602                         101   7e-24   
gb|KDP44739.1|  hypothetical protein JCGZ_01239                         107   8e-24   
emb|CDP13994.1|  unnamed protein product                                107   1e-23   
ref|XP_004239947.1|  PREDICTED: clathrin heavy chain 1-like             107   1e-23   
ref|XP_006355648.1|  PREDICTED: clathrin heavy chain 1-like             107   1e-23   
ref|XP_004500501.1|  PREDICTED: clathrin heavy chain 1-like             107   1e-23   
ref|XP_006356463.1|  PREDICTED: clathrin heavy chain 1-like             106   2e-23   
ref|XP_004138417.1|  PREDICTED: clathrin heavy chain 1-like             106   3e-23   
ref|XP_008441473.1|  PREDICTED: clathrin heavy chain 1 isoform X1       106   3e-23   
ref|XP_008441475.1|  PREDICTED: clathrin heavy chain 1 isoform X2       106   3e-23   
ref|XP_011035910.1|  PREDICTED: clathrin heavy chain 1                  105   4e-23   
ref|XP_010102785.1|  hypothetical protein L484_007592                   100   5e-23   
gb|KGN45795.1|  hypothetical protein Csa_6G011710                       105   6e-23   
ref|XP_008221242.1|  PREDICTED: clathrin heavy chain 1-like             105   6e-23   
ref|XP_007008924.1|  Clathrin, heavy chain isoform 1                    105   6e-23   
ref|XP_008343647.1|  PREDICTED: clathrin heavy chain 2-like             100   7e-23   
ref|XP_007208396.1|  hypothetical protein PRUPE_ppa000132mg             105   7e-23   
ref|XP_007008925.1|  Clathrin, heavy chain isoform 2                    105   7e-23   
ref|XP_011076674.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...    105   7e-23   
ref|XP_007008926.1|  Clathrin, heavy chain isoform 3                    104   1e-22   
ref|XP_002316201.2|  clathrin heavy chain family protein                104   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007008927.1|  Clathrin, heavy chain isoform 4                    104   1e-22   
emb|CDY08549.1|  BnaA05g27850D                                          104   1e-22   
ref|XP_009396867.1|  PREDICTED: clathrin heavy chain 1-like isofo...    104   1e-22   
gb|AHV90401.1|  clathrin heavy chain 2                                  104   1e-22   
ref|XP_006407764.1|  hypothetical protein EUTSA_v10019886mg             104   1e-22   
ref|XP_009396866.1|  PREDICTED: clathrin heavy chain 1-like isofo...    104   1e-22   
ref|XP_002528311.1|  clathrin heavy chain, putative                     104   1e-22   Ricinus communis
ref|XP_009146750.1|  PREDICTED: clathrin heavy chain 1                  104   1e-22   
emb|CDY00997.1|  BnaC05g42030D                                          104   1e-22   
ref|XP_006407470.1|  hypothetical protein EUTSA_v10019884mg             103   2e-22   
ref|XP_009122366.1|  PREDICTED: clathrin heavy chain 1-like             103   2e-22   
emb|CDY36301.1|  BnaA01g31170D                                          103   2e-22   
emb|CDY36318.1|  BnaA01g31000D                                          103   2e-22   
ref|XP_010461980.1|  PREDICTED: clathrin heavy chain 2 isoform X1       103   2e-22   
ref|XP_006843645.1|  hypothetical protein AMTR_s00007p00168430          103   2e-22   
ref|XP_010558070.1|  PREDICTED: clathrin heavy chain 1                  103   2e-22   
ref|XP_010462053.1|  PREDICTED: clathrin heavy chain 2 isoform X2       103   2e-22   
ref|XP_006300235.1|  hypothetical protein CARUB_v10016475mg             103   2e-22   
ref|XP_003538833.1|  PREDICTED: clathrin heavy chain 1-like             103   2e-22   
ref|XP_010999397.1|  PREDICTED: clathrin heavy chain 2 isoform X3       103   2e-22   
ref|XP_009353932.1|  PREDICTED: clathrin heavy chain 2-like             103   2e-22   
emb|CDY00724.1|  BnaC03g37080D                                          103   3e-22   
emb|CDX73889.1|  BnaA03g31580D                                          103   3e-22   
ref|XP_006435764.1|  hypothetical protein CICLE_v10030488mg             103   3e-22   
ref|XP_010464461.1|  PREDICTED: clathrin heavy chain 2-like             103   3e-22   
ref|XP_011048924.1|  PREDICTED: clathrin heavy chain 1 isoform X1       103   3e-22   
gb|KFK38494.1|  hypothetical protein AALP_AA3G120700                    103   3e-22   
ref|XP_008354979.1|  PREDICTED: clathrin heavy chain 2-like             103   3e-22   
ref|XP_009386478.1|  PREDICTED: clathrin heavy chain 1-like             103   3e-22   
ref|XP_006306581.1|  hypothetical protein CARUB_v10008081mg             103   3e-22   
ref|XP_002311238.2|  clathrin heavy chain family protein                103   3e-22   Populus trichocarpa [western balsam poplar]
ref|NP_187466.4|  Clathrin, heavy chain                                 103   3e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71721.1|  hypothetical protein VITISV_012220                     100   3e-22   Vitis vinifera
gb|KHG11889.1|  Clathrin heavy chain 2 -like protein                    102   4e-22   
ref|XP_006598484.1|  PREDICTED: uncharacterized protein LOC102662422  99.0    4e-22   
gb|KDO68931.1|  hypothetical protein CISIN_1g000428mg                   102   4e-22   
gb|KHN18252.1|  Clathrin heavy chain 2                                96.7    4e-22   
ref|XP_003538472.1|  PREDICTED: clathrin heavy chain 1-like             102   4e-22   
ref|XP_010554676.1|  PREDICTED: clathrin heavy chain 1-like             102   4e-22   
gb|KHG02496.1|  Clathrin heavy chain 2                                  102   4e-22   
gb|KHG02495.1|  Clathrin heavy chain 2                                  102   4e-22   
ref|XP_009400000.1|  PREDICTED: clathrin heavy chain 1                  102   4e-22   
ref|XP_004500281.1|  PREDICTED: clathrin heavy chain 1-like             102   5e-22   
ref|XP_002884683.1|  hypothetical protein ARALYDRAFT_896987             102   6e-22   
ref|XP_010264592.1|  PREDICTED: clathrin heavy chain 1-like             102   7e-22   
ref|XP_010534608.1|  PREDICTED: clathrin heavy chain 2-like             102   8e-22   
ref|XP_010464809.1|  PREDICTED: clathrin heavy chain 1-like             102   8e-22   
ref|XP_010488269.1|  PREDICTED: clathrin heavy chain 1                  102   8e-22   
ref|XP_010486756.1|  PREDICTED: clathrin heavy chain 1-like             102   8e-22   
ref|XP_006299090.1|  hypothetical protein CARUB_v10015228mg             102   9e-22   
ref|XP_010253796.1|  PREDICTED: clathrin heavy chain 2                  101   1e-21   
ref|XP_003516582.1|  PREDICTED: clathrin heavy chain 2-like             101   1e-21   
ref|XP_007016899.1|  Clathrin, heavy chain isoform 1                    101   1e-21   
ref|XP_007016902.1|  Clathrin, heavy chain isoform 4                    101   1e-21   
emb|CDX74011.1|  BnaA03g30360D                                          101   1e-21   
ref|XP_009135023.1|  PREDICTED: clathrin heavy chain 2-like             101   1e-21   
ref|XP_002269905.1|  PREDICTED: clathrin heavy chain 1                  101   1e-21   Vitis vinifera
emb|CDY07954.1|  BnaC03g35690D                                          101   1e-21   
ref|XP_010922576.1|  PREDICTED: clathrin heavy chain 1                  101   1e-21   
ref|XP_007218882.1|  hypothetical protein PRUPE_ppa000130mg             101   1e-21   
ref|XP_009369185.1|  PREDICTED: clathrin heavy chain 2-like             101   1e-21   
ref|XP_008369270.1|  PREDICTED: clathrin heavy chain 2-like isofo...    101   1e-21   
ref|XP_008374148.1|  PREDICTED: clathrin heavy chain 1                  101   1e-21   
ref|XP_010689491.1|  PREDICTED: clathrin heavy chain 1                  101   1e-21   
gb|KHG27324.1|  Clathrin heavy chain 2 -like protein                    101   1e-21   
ref|XP_009338936.1|  PREDICTED: clathrin heavy chain 2-like             101   1e-21   
emb|CDY27997.1|  BnaC05g43990D                                          101   1e-21   
ref|XP_009369618.1|  PREDICTED: clathrin heavy chain 2-like             101   1e-21   
ref|XP_009345101.1|  PREDICTED: clathrin heavy chain 1                  101   1e-21   
ref|XP_011003918.1|  PREDICTED: clathrin heavy chain 1-like             101   1e-21   
ref|XP_010907410.1|  PREDICTED: clathrin heavy chain 1-like             101   2e-21   
ref|XP_008362742.1|  PREDICTED: clathrin heavy chain 1                  101   2e-21   
ref|XP_008369269.1|  PREDICTED: clathrin heavy chain 2-like isofo...    101   2e-21   
gb|AAG51341.1|AC012562_2  putative clathrin heavy chain, 3' parti...    100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016904.1|  Clathrin, heavy chain isoform 6                    101   2e-21   
ref|XP_008805151.1|  PREDICTED: clathrin heavy chain 1                  101   2e-21   
ref|XP_004295773.1|  PREDICTED: clathrin heavy chain 1-like             100   2e-21   
ref|XP_009385547.1|  PREDICTED: clathrin heavy chain 1-like             100   2e-21   
ref|XP_007016903.1|  Clathrin, heavy chain isoform 5                    100   2e-21   
ref|XP_002276855.1|  PREDICTED: clathrin heavy chain 2                  100   2e-21   Vitis vinifera
gb|KHN31288.1|  Clathrin heavy chain 1                                  100   2e-21   
emb|CDY35984.1|  BnaA05g29660D                                          100   3e-21   
ref|XP_009147186.1|  PREDICTED: clathrin heavy chain 2                  100   3e-21   
gb|EYU20032.1|  hypothetical protein MIMGU_mgv1a022713mg                100   3e-21   
ref|XP_007146784.1|  hypothetical protein PHAVU_006G069700g             100   4e-21   
ref|XP_009400774.1|  PREDICTED: clathrin heavy chain 1-like             100   4e-21   
ref|XP_003518313.1|  PREDICTED: clathrin heavy chain 1-like             100   4e-21   
ref|XP_002313985.1|  hypothetical protein POPTR_0009s07740g           99.8    4e-21   Populus trichocarpa [western balsam poplar]
gb|AFW55791.1|  putative clathrin heavy chain family protein          95.1    5e-21   
gb|KHN46140.1|  Clathrin heavy chain 1                                99.8    6e-21   
ref|XP_009397098.1|  PREDICTED: clathrin heavy chain 1-like           99.8    6e-21   
gb|KEH34327.1|  clathrin heavy chain                                  99.4    6e-21   
ref|XP_003544075.1|  PREDICTED: clathrin heavy chain 2-like           99.4    6e-21   
gb|KHN38581.1|  Clathrin heavy chain 2                                99.4    6e-21   
ref|XP_003519402.1|  PREDICTED: clathrin heavy chain 2-like           99.4    6e-21   
gb|KHN48575.1|  Clathrin heavy chain 2                                99.4    7e-21   
gb|AES71175.2|  clathrin heavy chain                                  99.4    7e-21   
ref|XP_003600924.1|  Clathrin heavy chain                             99.4    7e-21   
ref|XP_008805008.1|  PREDICTED: clathrin heavy chain 1-like           99.4    7e-21   
ref|XP_004307649.1|  PREDICTED: clathrin heavy chain 1-like           99.4    7e-21   
ref|XP_010098908.1|  Clathrin heavy chain 1                           99.4    8e-21   
ref|NP_187724.2|  Clathrin, heavy chain                               99.0    9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884831.1|  hypothetical protein ARALYDRAFT_478454           99.0    9e-21   
gb|AAF01510.1|AC009991_6  putative clathrin heavy chain               99.0    9e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EYU26805.1|  hypothetical protein MIMGU_mgv1a000127mg              99.0    1e-20   
ref|XP_010067547.1|  PREDICTED: clathrin heavy chain 2                98.6    1e-20   
ref|XP_003544300.1|  PREDICTED: clathrin heavy chain 1-like           98.6    1e-20   
gb|KHN40089.1|  Clathrin heavy chain 1                                98.6    1e-20   
gb|KHN04772.1|  Clathrin heavy chain 1                                98.6    1e-20   
ref|XP_002448861.1|  hypothetical protein SORBIDRAFT_05g000445        95.1    2e-20   Sorghum bicolor [broomcorn]
ref|XP_007163558.1|  hypothetical protein PHAVU_001G244300g           98.2    2e-20   
ref|XP_004491025.1|  PREDICTED: clathrin heavy chain 2-like           98.2    2e-20   
ref|XP_007141753.1|  hypothetical protein PHAVU_008G222800g           97.8    2e-20   
ref|XP_010685522.1|  PREDICTED: clathrin heavy chain 1                97.1    4e-20   
ref|XP_004235240.1|  PREDICTED: clathrin heavy chain 1-like           97.1    4e-20   
ref|XP_006663144.1|  PREDICTED: clathrin heavy chain 1-like           95.1    4e-20   
ref|XP_010031192.1|  PREDICTED: clathrin heavy chain 1 isoform X2     96.7    5e-20   
ref|XP_010031191.1|  PREDICTED: clathrin heavy chain 1 isoform X1     96.7    5e-20   
gb|KCW50455.1|  hypothetical protein EUGRSUZ_J00193                   96.7    6e-20   
gb|KCW50456.1|  hypothetical protein EUGRSUZ_J00193                   96.7    6e-20   
ref|XP_008662354.1|  PREDICTED: clathrin heavy chain 1-like           96.3    9e-20   
ref|NP_001236999.1|  clathrin heavy chain                             95.9    9e-20   
ref|XP_002298486.2|  hypothetical protein POPTR_0001s28540g           95.9    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008667181.1|  PREDICTED: uncharacterized protein LOC100193...  95.9    1e-19   
ref|XP_008676402.1|  PREDICTED: clathrin heavy chain 1-like           95.9    1e-19   
ref|XP_008667182.1|  PREDICTED: uncharacterized protein LOC100193...  95.9    1e-19   
ref|XP_004978593.1|  PREDICTED: clathrin heavy chain 1-like           95.9    1e-19   
ref|XP_008679323.1|  PREDICTED: clathrin heavy chain 1-like           95.9    1e-19   
ref|XP_004977646.1|  PREDICTED: clathrin heavy chain 1-like isofo...  95.9    1e-19   
ref|XP_004977645.1|  PREDICTED: clathrin heavy chain 1-like isofo...  95.9    1e-19   
ref|XP_006663706.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  95.1    2e-19   
ref|XP_001753098.1|  predicted protein                                95.1    2e-19   
ref|XP_001772180.1|  predicted protein                                95.1    2e-19   
gb|EMT06756.1|  Clathrin heavy chain 1                                94.7    3e-19   
gb|EMS67801.1|  Clathrin heavy chain 1                                94.7    3e-19   
ref|XP_003579054.1|  PREDICTED: clathrin heavy chain 1                94.4    3e-19   
gb|EMT21111.1|  Clathrin heavy chain 1                                94.4    4e-19   
gb|EMS67808.1|  Clathrin heavy chain 1                                94.0    5e-19   
gb|EAY81974.1|  hypothetical protein OsI_37152                        94.0    5e-19   Oryza sativa Indica Group [Indian rice]
sp|Q2RBN7.1|CLH1_ORYSJ  RecName: Full=Clathrin heavy chain 1          94.0    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19365.1|  hypothetical protein OsJ_34919                        94.0    5e-19   Oryza sativa Japonica Group [Japonica rice]
sp|Q2QYW2.1|CLH2_ORYSJ  RecName: Full=Clathrin heavy chain 2          94.0    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19358.1|  hypothetical protein OsJ_34910                        94.0    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68683.1|  hypothetical protein OsI_37138                        93.6    6e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_001785223.1|  predicted protein                                93.6    6e-19   
ref|XP_003616661.1|  Clathrin heavy chain                             93.6    7e-19   
ref|XP_006403036.1|  hypothetical protein EUTSA_v10005737mg           93.6    7e-19   
ref|XP_002974286.1|  hypothetical protein SELMODRAFT_149750           92.0    2e-18   
ref|XP_002985659.1|  hypothetical protein SELMODRAFT_157554           92.0    2e-18   
ref|XP_003576374.1|  PREDICTED: clathrin heavy chain 1-like           90.1    1e-17   
emb|CDJ26527.1|  unnamed protein product                              86.7    2e-17   
gb|KHN42022.1|  Clathrin heavy chain 1                                88.6    3e-17   
ref|XP_001780056.1|  predicted protein                                88.2    5e-17   
gb|KFK34843.1|  hypothetical protein AALP_AA5G200400                  87.8    7e-17   
gb|AHJ61542.1|  clathrin heavy chain protein 2                        85.1    5e-16   
ref|XP_005651179.1|  clathrin heavy chain                             82.0    7e-15   
ref|XP_010684108.1|  PREDICTED: probable clathrin heavy chain         75.9    9e-15   
ref|XP_002500555.1|  predicted protein                                80.1    3e-14   Micromonas commoda
ref|XP_003056200.1|  predicted protein                                77.0    3e-13   
gb|AGC82051.1|  clathrin heavy chain 1                                75.9    6e-13   
ref|XP_002950685.1|  vesicle coat protein clathrin, heavy chain       75.9    7e-13   
ref|XP_007515722.1|  predicted protein                                73.9    3e-12   
ref|XP_002967547.1|  hypothetical protein SELMODRAFT_88182            72.4    9e-12   
ref|XP_002981797.1|  hypothetical protein SELMODRAFT_115182           72.4    1e-11   
ref|XP_001699806.1|  clathrin heavy chain                             71.6    2e-11   Chlamydomonas reinhardtii
emb|CEF96597.1|  Clathrin, heavy chain/VPS, 7-fold repeat             70.9    4e-11   
gb|KDD74078.1|  hypothetical protein H632_c1591p0                     64.7    4e-10   
ref|XP_005844264.1|  hypothetical protein CHLNCDRAFT_139336           66.6    8e-10   
gb|AAX26820.2|  SJCHGC08008 protein                                   62.8    2e-09   Schistosoma japonicum
ref|XP_008561998.1|  PREDICTED: clathrin heavy chain 1-like           62.0    2e-09   
gb|KFB40523.1|  AGAP003021-PA-like protein                            64.3    5e-09   
gb|ETN62753.1|  clathrin heavy chain                                  64.3    5e-09   
ref|XP_009173364.1|  hypothetical protein T265_14758                  63.5    5e-09   
ref|XP_005535763.1|  clathrin heavy chain                             64.3    6e-09   
ref|XP_004742653.1|  PREDICTED: clathrin heavy chain 2 isoform X1     63.9    6e-09   
ref|XP_004742654.1|  PREDICTED: clathrin heavy chain 2 isoform X2     63.9    6e-09   
ref|XP_001656876.1|  clathrin heavy chain                             63.9    6e-09   Aedes aegypti
ref|XP_005391841.1|  PREDICTED: clathrin heavy chain 2 isoform X3     63.9    7e-09   
ref|XP_007520838.1|  PREDICTED: clathrin heavy chain 2 isoform X1     63.9    7e-09   
ref|XP_004547067.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    8e-09   
ref|XP_005391840.1|  PREDICTED: clathrin heavy chain 2 isoform X2     63.5    8e-09   
ref|XP_006790022.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    8e-09   
ref|XP_005334583.1|  PREDICTED: clathrin heavy chain 2                63.5    8e-09   
ref|XP_005391839.1|  PREDICTED: clathrin heavy chain 2 isoform X1     63.5    9e-09   
dbj|GAM29363.1|  hypothetical protein SAMD00019534_125390             63.5    9e-09   
ref|XP_005738261.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_008416354.1|  PREDICTED: clathrin heavy chain 2 isoform X3     63.5    9e-09   
ref|XP_007520839.1|  PREDICTED: clathrin heavy chain 2 isoform X2     63.5    9e-09   
ref|XP_005738262.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_003451136.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_005473587.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_005738259.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_008416356.1|  PREDICTED: clathrin heavy chain 2 isoform X5     63.5    9e-09   
ref|XP_008416355.1|  PREDICTED: clathrin heavy chain 2 isoform X4     63.5    9e-09   
ref|XP_005738263.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_005738260.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_005473586.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_007563569.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_005473585.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_007563568.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_008416353.1|  PREDICTED: clathrin heavy chain 2 isoform X2     63.5    9e-09   
ref|XP_008416352.1|  PREDICTED: clathrin heavy chain 2 isoform X1     63.5    9e-09   
ref|XP_004547065.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_005473588.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    9e-09   
ref|XP_006790019.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_005924469.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_006790020.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_005924472.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_005924470.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_008283124.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_006790021.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_005924471.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_008283127.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_004547066.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_008283126.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_006790018.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_005924468.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_010732569.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_010732567.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
ref|XP_010732568.1|  PREDICTED: clathrin heavy chain 1-like isofo...  63.5    1e-08   
gb|KGB31720.1|  Clathrin heavy chain 2                                61.2    1e-08   
ref|XP_003975201.1|  PREDICTED: clathrin heavy chain 1-like           63.2    1e-08   
gb|AAH90296.1|  Cltcb protein                                         58.9    1e-08   Danio rerio [leopard danio]
dbj|BAE42637.1|  unnamed protein product                              62.0    1e-08   Mus musculus [mouse]
ref|XP_010782542.1|  PREDICTED: clathrin heavy chain 2                63.2    1e-08   
pdb|1C9L|A  Chain A, Peptide-In-Groove Interactions Link Target P...  62.0    1e-08   
pdb|1UTC|A  Chain A, Clathrin Terminal Domain Complexed With Tlpw...  62.0    1e-08   
pdb|2XZG|A  Chain A, Clathrin Terminal Domain Complexed With Pits...  62.0    1e-08   
pdb|1C9I|A  Chain A, Peptide-In-Groove Interactions Link Target P...  62.0    1e-08   
pdb|4G55|A  Chain A, Clathrin Terminal Domain Complexed With Pits...  62.0    1e-08   
dbj|BAE33881.1|  unnamed protein product                              62.4    1e-08   Mus musculus [mouse]
pdb|1BPO|A  Chain A, Clathrin Heavy-Chain Terminal Domain And Linker  62.4    1e-08   
dbj|BAE34510.1|  unnamed protein product                              62.4    1e-08   Mus musculus [mouse]
ref|XP_010774851.1|  PREDICTED: clathrin heavy chain 1-like           58.5    1e-08   
ref|XP_008065212.1|  PREDICTED: clathrin heavy chain 2 isoform X1     62.8    2e-08   
ref|XP_005793203.1|  clathrin heavy chain                             62.8    2e-08   
ref|XP_004358499.1|  clathrin heavy chain                             58.2    2e-08   
ref|XP_007427712.1|  PREDICTED: clathrin heavy chain 1                62.8    2e-08   
ref|XP_008065213.1|  PREDICTED: clathrin heavy chain 2 isoform X2     62.4    2e-08   
ref|XP_006938778.1|  PREDICTED: clathrin heavy chain 2                62.4    2e-08   
ref|XP_010874789.1|  PREDICTED: clathrin heavy chain 2 isoform X4     62.4    2e-08   
ref|XP_010874788.1|  PREDICTED: clathrin heavy chain 2 isoform X3     62.4    2e-08   
emb|CDQ62746.1|  unnamed protein product                              62.4    2e-08   
ref|XP_010874787.1|  PREDICTED: clathrin heavy chain 2 isoform X2     62.4    2e-08   
ref|XP_010874786.1|  PREDICTED: clathrin heavy chain 2 isoform X1     62.4    2e-08   
ref|XP_007904368.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.4    2e-08   
ref|XP_005636651.1|  PREDICTED: clathrin heavy chain 2 isoform X2     62.4    2e-08   
ref|XP_010859905.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.4    2e-08   
ref|XP_009234759.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.4    2e-08   
gb|EDM05573.1|  clathrin, heavy polypeptide (Hc), isoform CRA_a       62.4    2e-08   
ref|XP_007481847.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.4    2e-08   
pdb|1XI4|A  Chain A, Clathrin D6 Coat                                 62.4    2e-08   
ref|XP_006983262.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.4    2e-08   
ref|XP_010859904.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.4    3e-08   
ref|XP_004870416.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.4    3e-08   
ref|XP_009234760.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.4    3e-08   
tpg|DAA19159.1|  TPA: clathrin heavy chain 1                          62.4    3e-08   
gb|AAH51800.1|  CLTC protein                                          62.4    3e-08   
ref|XP_004377915.1|  PREDICTED: clathrin heavy chain 1                62.4    3e-08   
gb|EGV96630.1|  Clathrin heavy chain 1                                62.4    3e-08   
ref|XP_007904366.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.4    3e-08   
ref|XP_007904367.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_007642561.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_006940204.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_006640921.1|  PREDICTED: clathrin heavy chain 1-like isofo...  62.0    3e-08   
ref|XP_010625021.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_006640922.1|  PREDICTED: clathrin heavy chain 1-like isofo...  62.0    3e-08   
gb|KFO32165.1|  Clathrin heavy chain 1                                62.0    3e-08   
ref|XP_010859906.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_007122595.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_007072724.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin, he...  62.0    3e-08   
ref|XP_005298835.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_010859907.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.0    3e-08   
ref|XP_007122596.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.0    3e-08   
ref|XP_005298837.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_005298836.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_006983261.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_004809015.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_005298838.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.0    3e-08   
ref|XP_004707066.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_004607528.1|  PREDICTED: clathrin heavy chain 2 isoform X1     62.0    3e-08   
ref|XP_005986939.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
emb|CAE45761.1|  hypothetical protein                                 62.0    3e-08   
ref|XP_006534048.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_006740377.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_006065491.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_006534047.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_006534046.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_007481846.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|NP_001003908.1|  clathrin heavy chain 1                           62.0    3e-08   
ref|XP_006265697.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_004457666.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|NP_062172.1|  clathrin heavy chain 1                              62.0    3e-08   
ref|NP_776448.1|  clathrin heavy chain 1                              62.0    3e-08   
ref|XP_537700.2|  PREDICTED: clathrin heavy chain 1 isoformX1         62.0    3e-08   
ref|XP_008840888.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_008069024.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_008840887.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_008069023.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_004747321.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_008840886.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_008069021.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_008995206.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_008840890.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.0    3e-08   
ref|XP_008069025.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.0    3e-08   
ref|XP_004707067.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_008147703.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|NP_001275582.1|  clathrin heavy chain 1 isoform 2                 62.0    3e-08   
ref|XP_010572066.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_008009437.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_006247170.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_005003559.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_006247169.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_005858637.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_003227325.1|  PREDICTED: clathrin heavy chain 1 isoform X4     62.0    3e-08   
ref|XP_008118648.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
emb|CDQ75053.1|  unnamed protein product                              62.0    3e-08   
ref|XP_008009438.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_006924955.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|NP_004850.1|  clathrin heavy chain 1 isoform 1                    62.0    3e-08   
ref|NP_001073586.1|  clathrin heavy chain 1                           62.0    3e-08   
ref|XP_006247171.1|  PREDICTED: clathrin heavy chain 1 isoform X3     62.0    3e-08   
ref|XP_004908123.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  62.0    3e-08   
ref|XP_001108647.2|  PREDICTED: clathrin heavy chain 1 isoform 4      62.0    3e-08   
gb|EHH24868.1|  hypothetical protein EGK_08596                        62.0    3e-08   
ref|XP_008118647.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_008118646.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_008269420.1|  PREDICTED: clathrin heavy chain 1 isoform X2     62.0    3e-08   
ref|XP_005141763.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_005076953.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_008269419.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_005350524.1|  PREDICTED: clathrin heavy chain 1 isoform X1     62.0    3e-08   
ref|XP_004664516.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_006832436.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_005525768.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
ref|XP_004591024.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
gb|AET25568.1|  clathrin heavy chain                                  62.0    3e-08   
ref|XP_003278537.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  62.0    3e-08   
dbj|BAC65475.2|  mKIAA0034 protein                                    62.0    3e-08   
ref|XP_006908691.1|  PREDICTED: clathrin heavy chain 2 isoform X1     62.0    3e-08   
ref|XP_006016183.1|  PREDICTED: clathrin heavy chain 1                62.0    3e-08   
dbj|BAA04801.2|  KIAA0034                                             61.6    3e-08   
emb|CAD20886.1|  clathrin heavy-chain                                 61.6    3e-08   
ref|XP_004628048.1|  PREDICTED: clathrin heavy chain 2 isoform X1     61.6    4e-08   
ref|XP_004325097.1|  PREDICTED: clathrin heavy chain 1                61.6    4e-08   
ref|XP_007449155.1|  PREDICTED: clathrin heavy chain 1                61.6    4e-08   
ref|XP_004607529.1|  PREDICTED: clathrin heavy chain 2 isoform X2     61.6    4e-08   
dbj|BAN20627.1|  clathrin heavy chain                                 61.6    4e-08   
gb|EJU03897.1|  clathrin heavy chain                                  61.6    4e-08   
ref|XP_004684490.1|  PREDICTED: clathrin heavy chain 1 isoform X2     61.6    4e-08   
ref|XP_006908692.1|  PREDICTED: clathrin heavy chain 2 isoform X2     61.6    4e-08   
ref|XP_004684489.1|  PREDICTED: clathrin heavy chain 1 isoform X1     61.6    4e-08   
ref|XP_005706491.1|  clathrin, heavy polypeptide                      61.6    4e-08   
ref|XP_007533727.1|  PREDICTED: clathrin heavy chain 1                61.6    4e-08   
gb|EHB17756.1|  Clathrin heavy chain 1                                61.2    4e-08   
ref|XP_007190408.1|  PREDICTED: clathrin heavy chain 1-like           61.2    5e-08   
ref|XP_004628049.1|  PREDICTED: clathrin heavy chain 2 isoform X2     61.2    5e-08   
ref|XP_005708159.1|  clathrin, heavy polypeptide                      61.2    5e-08   
ref|XP_005568053.1|  PREDICTED: clathrin heavy chain 2 isoform X4     61.2    5e-08   
gb|EHJ79063.1|  clathrin heavy chain                                  61.2    5e-08   
ref|XP_005568051.1|  PREDICTED: clathrin heavy chain 2 isoform X2     61.2    5e-08   
ref|XP_009215041.1|  PREDICTED: clathrin heavy chain 2 isoform X3     61.2    5e-08   
ref|XP_005568050.1|  PREDICTED: clathrin heavy chain 2 isoform X1     61.2    5e-08   
ref|XP_003905261.1|  PREDICTED: clathrin heavy chain 2 isoform X1     61.2    5e-08   
ref|XP_001112729.2|  PREDICTED: clathrin heavy chain 2                61.2    5e-08   
gb|KFM64868.1|  Clathrin heavy chain 1                                61.2    5e-08   
ref|XP_006745053.1|  PREDICTED: clathrin heavy chain 2                60.8    6e-08   
ref|XP_311856.3|  AGAP003021-PA                                       60.8    6e-08   
ref|XP_002055667.1|  GJ19488                                          60.8    6e-08   
ref|XP_010354654.1|  PREDICTED: clathrin heavy chain 2 isoform X1     60.8    7e-08   
ref|XP_008334352.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  60.8    7e-08   
emb|CAG07842.1|  unnamed protein product                              60.8    7e-08   
ref|XP_010354655.1|  PREDICTED: clathrin heavy chain 2 isoform X2     60.8    7e-08   
ref|XP_003740941.1|  PREDICTED: clathrin heavy chain 1                60.8    7e-08   
ref|XP_007973247.1|  PREDICTED: clathrin heavy chain 2 isoform X2     60.8    8e-08   
ref|XP_009004827.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  60.8    8e-08   
ref|XP_007973246.1|  PREDICTED: clathrin heavy chain 2 isoform X1     60.8    8e-08   
ref|XP_002010210.1|  GI14823                                          60.8    8e-08   
ref|XP_007973248.1|  PREDICTED: clathrin heavy chain 2 isoform X3     60.5    8e-08   
ref|XP_008248460.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  60.5    8e-08   
ref|XP_001992484.1|  GH24776                                          60.5    8e-08   
ref|XP_010354656.1|  PREDICTED: clathrin heavy chain 2 isoform X3     60.5    8e-08   
ref|XP_007973249.1|  PREDICTED: clathrin heavy chain 2 isoform X4     60.5    9e-08   
gb|EFA76771.1|  clathrin heavy chain                                  60.5    1e-07   
ref|XP_006902589.1|  PREDICTED: clathrin heavy chain 2                60.5    1e-07   
ref|NP_001011039.1|  clathrin, heavy chain (Hc)                       60.5    1e-07   
gb|EFW42353.2|  clathrin heavy chain 1                                60.1    1e-07   
ref|XP_004945535.1|  PREDICTED: clathrin heavy chain 1 isoform X3     60.1    1e-07   
ref|XP_415060.2|  PREDICTED: clathrin heavy chain 1 isoform X2        60.1    1e-07   
ref|NP_001136443.1|  clathrin heavy chain                             60.1    1e-07   
ref|XP_007973254.1|  PREDICTED: clathrin heavy chain 2 isoform X7     60.1    1e-07   
ref|XP_004945536.1|  PREDICTED: clathrin heavy chain 1 isoform X4     60.1    1e-07   
ref|NP_001085860.1|  clathrin, heavy chain (Hc)                       60.1    1e-07   
ref|NP_001181907.1|  clathrin, heavy chain b (Hc)                     60.1    1e-07   
ref|XP_005157482.1|  PREDICTED: clathrin, heavy chain b (Hc) isof...  60.1    1e-07   
ref|XP_005157481.1|  PREDICTED: clathrin, heavy chain b (Hc) isof...  60.1    1e-07   
ref|XP_005157480.1|  PREDICTED: clathrin, heavy chain b (Hc) isof...  60.1    1e-07   
emb|CDQ71569.1|  unnamed protein product                              58.9    1e-07   
ref|XP_008283061.1|  PREDICTED: clathrin heavy chain 1 isoform X1     60.1    1e-07   
ref|XP_008283062.1|  PREDICTED: clathrin heavy chain 1 isoform X2     60.1    1e-07   
ref|XP_004414982.1|  PREDICTED: clathrin heavy chain 2                60.1    1e-07   
emb|CDQ63521.1|  unnamed protein product                              59.3    1e-07   
emb|CDQ78245.1|  unnamed protein product                              59.3    1e-07   
ref|XP_007973255.1|  PREDICTED: clathrin heavy chain 2 isoform X8     59.7    1e-07   
ref|XP_007235491.1|  PREDICTED: clathrin heavy chain 1-like           59.3    2e-07   
ref|XP_008424141.1|  PREDICTED: clathrin heavy chain 1 isoform X6     59.7    2e-07   
ref|XP_003441652.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.7    2e-07   
ref|XP_005474633.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.7    2e-07   
ref|XP_005474632.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.7    2e-07   
ref|XP_005474631.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.7    2e-07   
ref|XP_005474634.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.7    2e-07   
ref|XP_010774135.1|  PREDICTED: clathrin heavy chain 1                59.7    2e-07   
ref|XP_008424140.1|  PREDICTED: clathrin heavy chain 1 isoform X5     59.7    2e-07   
ref|XP_004075901.1|  PREDICTED: clathrin heavy chain 1-like           59.7    2e-07   
gb|EST04516.1|  vesicle coat protein clathrin                         59.7    2e-07   
ref|XP_008331047.1|  PREDICTED: clathrin heavy chain 1 isoform X3     59.7    2e-07   
ref|XP_008331046.1|  PREDICTED: clathrin heavy chain 1 isoform X2     59.7    2e-07   
ref|XP_008331045.1|  PREDICTED: clathrin heavy chain 1 isoform X1     59.7    2e-07   
ref|XP_003970777.1|  PREDICTED: clathrin heavy chain 1-like           59.3    2e-07   
ref|XP_002424037.1|  clathrin heavy chain, putative                   59.3    2e-07   
ref|XP_005808346.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_006724390.1|  PREDICTED: clathrin heavy chain 2 isoform X6     59.3    2e-07   
gb|AAC50494.1|  muscle clathrin heavy chain                           59.3    2e-07   
ref|XP_003814088.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin hea...  59.3    2e-07   
ref|XP_001154119.1|  PREDICTED: clathrin heavy chain 2 isoform X10    59.3    2e-07   
ref|XP_009436042.1|  PREDICTED: clathrin heavy chain 2 isoform X4     59.3    2e-07   
ref|XP_009436041.1|  PREDICTED: clathrin heavy chain 2 isoform X3     59.3    2e-07   
ref|NP_009029.3|  clathrin heavy chain 2 isoform 1                    59.3    2e-07   
ref|XP_005808348.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_010747303.1|  PREDICTED: clathrin heavy chain 1 isoform X1     59.3    2e-07   
ref|XP_005808347.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_010747305.1|  PREDICTED: clathrin heavy chain 1 isoform X2     59.3    2e-07   
ref|XP_005808349.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_008424136.1|  PREDICTED: clathrin heavy chain 1 isoform X2     59.3    2e-07   
ref|XP_008424135.1|  PREDICTED: clathrin heavy chain 1 isoform X1     59.3    2e-07   
ref|XP_008424139.1|  PREDICTED: clathrin heavy chain 1 isoform X4     59.3    2e-07   
ref|XP_007575990.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_008424137.1|  PREDICTED: clathrin heavy chain 1 isoform X3     59.3    2e-07   
gb|AAT68095.1|  clatherin heavy chain                                 59.3    2e-07   
gb|AAI63714.1|  Clathrin, heavy polypeptide a (Hc)                    59.3    2e-07   
ref|NP_001005391.2|  clathrin, heavy polypeptide a                    59.3    2e-07   
ref|XP_005172697.1|  PREDICTED: clathrin, heavy polypeptide a iso...  59.3    2e-07   
ref|XP_009303633.1|  PREDICTED: clathrin, heavy polypeptide a iso...  59.3    2e-07   
ref|XP_009303632.1|  PREDICTED: clathrin, heavy polypeptide a iso...  59.3    2e-07   
emb|CDJ87311.1|  Clathrin domain containing protein                   59.3    2e-07   
emb|CAA64752.1|  clathrin heavy chain polypeptide                     59.3    2e-07   
ref|XP_009436040.1|  PREDICTED: clathrin heavy chain 2 isoform X2     59.3    2e-07   
ref|XP_002830888.1|  PREDICTED: clathrin heavy chain 2 isoform X1     59.3    2e-07   
ref|XP_008306728.1|  PREDICTED: clathrin heavy chain 1-like           59.3    2e-07   
ref|XP_009436045.1|  PREDICTED: clathrin heavy chain 2 isoform X7     59.3    2e-07   
gb|AAB40908.1|  clathrin heavy chain 2                                59.3    2e-07   
ref|XP_006724389.1|  PREDICTED: clathrin heavy chain 2 isoform X5     59.3    2e-07   
ref|XP_005277857.1|  PREDICTED: clathrin heavy chain 2 isoform X1     59.3    2e-07   
ref|XP_009436039.1|  PREDICTED: clathrin heavy chain 2 isoform X1     59.3    2e-07   
gb|EYC36764.1|  hypothetical protein Y032_0859g2728                   55.5    2e-07   
ref|XP_007261506.1|  clathrin heavy chain                             59.3    2e-07   
ref|XP_009436043.1|  PREDICTED: clathrin heavy chain 2 isoform X5     59.3    2e-07   
ref|XP_010718251.1|  PREDICTED: clathrin heavy chain 2 isoform X5     59.3    2e-07   
ref|XP_010731878.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_010731879.1|  PREDICTED: clathrin heavy chain 1-like isofo...  59.3    2e-07   
ref|XP_006679401.1|  hypothetical protein BATDEDRAFT_19878            59.3    2e-07   
ref|XP_004694990.1|  PREDICTED: clathrin heavy chain 2                59.3    2e-07   
emb|CBY19011.1|  unnamed protein product                              59.3    3e-07   
emb|CBY36375.1|  unnamed protein product                              59.3    3e-07   
ref|XP_007490545.1|  PREDICTED: clathrin heavy chain 1-like           58.9    3e-07   
ref|XP_003317137.1|  PREDICTED: clathrin heavy chain 2 isoform X12    58.9    3e-07   
ref|XP_008274132.1|  PREDICTED: clathrin heavy chain 1-like isofo...  58.9    3e-07   
ref|XP_008274133.1|  PREDICTED: clathrin heavy chain 1-like isofo...  58.9    3e-07   
ref|NP_001826.3|  clathrin heavy chain 2 isoform 2                    58.9    3e-07   



>gb|EPS62652.1| hypothetical protein M569_12138, partial [Genlisea aurea]
Length=493

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  VALQVRSSDSaaamaaanAPITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQ  41
            V  Q+RSS+   AMAAANAPITM+E LTL+SIG+NPQFITFT+VTMESDK+ICVRETAPQ
Sbjct  6    VIFQIRSSE-ILAMAAANAPITMKEALTLTSIGINPQFITFTHVTMESDKYICVRETAPQ  64

Query  40   NSVVIVDMNMPMQ  2
            NSVVIVDMNMPMQ
Sbjct  65   NSVVIVDMNMPMQ  77



>ref|XP_009611972.1| PREDICTED: clathrin heavy chain 1-like [Nicotiana tomentosiformis]
Length=1700

 Score =   110 bits (275),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTLSSIGVNPQFITFTNVTMESDK+ICVRETAPQNSVVIVDMNMPMQ
Sbjct  7    PITMKEALTLSSIGVNPQFITFTNVTMESDKYICVRETAPQNSVVIVDMNMPMQ  60



>ref|XP_009783811.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Nicotiana 
sylvestris]
Length=1705

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTLSS+GVNPQFITFTNVTMESDK+ICVRETAPQNSVVIVDMNMPMQ
Sbjct  7    PITMKEALTLSSVGVNPQFITFTNVTMESDKYICVRETAPQNSVVIVDMNMPMQ  60



>ref|XP_004240929.1| PREDICTED: clathrin heavy chain 1 [Solanum lycopersicum]
Length=1701

 Score =   109 bits (272),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+ETLTL SIGVNPQFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKETLTLQSIGVNPQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_006338824.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum]
Length=1701

 Score =   108 bits (271),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+ETLTL SIGVNPQFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKETLTLQSIGVNPQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_009631458.1| PREDICTED: clathrin heavy chain 1 [Nicotiana tomentosiformis]
Length=1702

 Score =   108 bits (271),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIGVNPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLQSIGVNPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009617483.1| PREDICTED: clathrin heavy chain 2-like [Nicotiana tomentosiformis]
Length=1705

 Score =   108 bits (270),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIGVNPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLQSIGVNPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009758522.1| PREDICTED: clathrin heavy chain 1 [Nicotiana sylvestris]
Length=1707

 Score =   108 bits (270),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIGVNPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLQSIGVNPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_011084891.1| PREDICTED: clathrin heavy chain 2 [Sesamum indicum]
Length=1706

 Score =   108 bits (270),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+SIG+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLTSIGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009786959.1| PREDICTED: clathrin heavy chain 2-like [Nicotiana sylvestris]
Length=1705

 Score =   108 bits (270),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIGVNPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLQSIGVNPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>gb|EPS71155.1| hypothetical protein M569_03602, partial [Genlisea aurea]
Length=164

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL+S+G+NPQFITFT+VTMESDK+ICVRET+PQNSVVIVDMNMPMQ
Sbjct  22   PILMKEVLTLTSVGINPQFITFTHVTMESDKYICVRETSPQNSVVIVDMNMPMQ  75



>gb|KDP44739.1| hypothetical protein JCGZ_01239 [Jatropha curcas]
Length=1706

 Score =   107 bits (268),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>emb|CDP13994.1| unnamed protein product [Coffea canephora]
Length=1706

 Score =   107 bits (267),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E+LTL+SIG+NPQFITFTNVTMESDK+IC+RET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKESLTLTSIGINPQFITFTNVTMESDKYICIRETSPQNSVVIIDMNMPMQ  60



>ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum]
Length=1706

 Score =   107 bits (267),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIGVNPQFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLQSIGVNPQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum]
Length=1707

 Score =   107 bits (267),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIGVNPQFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLQSIGVNPQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_004500501.1| PREDICTED: clathrin heavy chain 1-like [Cicer arietinum]
Length=1702

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRETLTL SIG+NPQFITFT+VTMESDK+ICVRETAPQNSVVIVDMNMPMQ
Sbjct  7    PILMRETLTLPSIGINPQFITFTHVTMESDKYICVRETAPQNSVVIVDMNMPMQ  60



>ref|XP_006356463.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum]
Length=1699

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTLSSIGVNPQFITFTNVTMESDK+ICVRET+PQNSVVI+DM+MPMQ
Sbjct  7    PITMKEALTLSSIGVNPQFITFTNVTMESDKYICVRETSPQNSVVIIDMSMPMQ  60



>ref|XP_004138417.1| PREDICTED: clathrin heavy chain 1-like [Cucumis sativus]
 ref|XP_004160726.1| PREDICTED: clathrin heavy chain 1-like [Cucumis sativus]
Length=1707

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E +TL SIG+NPQFITFT+VTMESDKFICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEAITLPSIGINPQFITFTHVTMESDKFICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_008441473.1| PREDICTED: clathrin heavy chain 1 isoform X1 [Cucumis melo]
Length=1733

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E +TL SIG+NPQFITFT+VTMESDKFICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEAITLPSIGINPQFITFTHVTMESDKFICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_008441475.1| PREDICTED: clathrin heavy chain 1 isoform X2 [Cucumis melo]
Length=1707

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E +TL SIG+NPQFITFT+VTMESDKFICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEAITLPSIGINPQFITFTHVTMESDKFICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_011035910.1| PREDICTED: clathrin heavy chain 1 [Populus euphratica]
Length=1705

 Score =   105 bits (263),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010102785.1| hypothetical protein L484_007592 [Morus notabilis]
 gb|EXB94098.1| hypothetical protein L484_007592 [Morus notabilis]
Length=221

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITMRETLTL+SIG+N QFITFT+VTMESDKFICVRETAPQNS+VIVDMN P Q
Sbjct  7    PITMRETLTLASIGINTQFITFTHVTMESDKFICVRETAPQNSIVIVDMNAPNQ  60



>gb|KGN45795.1| hypothetical protein Csa_6G011710 [Cucumis sativus]
Length=1497

 Score =   105 bits (262),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E +TL SIG+NPQFITFT+VTMESDKFICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEAITLPSIGINPQFITFTHVTMESDKFICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_008221242.1| PREDICTED: clathrin heavy chain 1-like [Prunus mume]
Length=1699

 Score =   105 bits (262),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+ETLTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PMTMKETLTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_007008924.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
 gb|EOY17734.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
Length=1705

 Score =   105 bits (261),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEVLTLPSIGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_008343647.1| PREDICTED: clathrin heavy chain 2-like [Malus domestica]
Length=252

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_007208396.1| hypothetical protein PRUPE_ppa000132mg [Prunus persica]
 gb|EMJ09595.1| hypothetical protein PRUPE_ppa000132mg [Prunus persica]
Length=1699

 Score =   105 bits (261),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+ETLTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PMTMKETLTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_007008925.1| Clathrin, heavy chain isoform 2, partial [Theobroma cacao]
 gb|EOY17735.1| Clathrin, heavy chain isoform 2, partial [Theobroma cacao]
Length=1667

 Score =   105 bits (261),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEVLTLPSIGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_011076674.1| PREDICTED: LOW QUALITY PROTEIN: clathrin heavy chain 1-like [Sesamum 
indicum]
Length=1706

 Score =   105 bits (261),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLTSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_007008926.1| Clathrin, heavy chain isoform 3 [Theobroma cacao]
 gb|EOY17736.1| Clathrin, heavy chain isoform 3 [Theobroma cacao]
Length=1532

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEVLTLPSIGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_002316201.2| clathrin heavy chain family protein [Populus trichocarpa]
 gb|EEF02372.2| clathrin heavy chain family protein [Populus trichocarpa]
Length=1705

 Score =   104 bits (260),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL +IG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPAIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_007008927.1| Clathrin, heavy chain isoform 4 [Theobroma cacao]
 gb|EOY17737.1| Clathrin, heavy chain isoform 4 [Theobroma cacao]
Length=1450

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEVLTLPSIGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>emb|CDY08549.1| BnaA05g27850D [Brassica napus]
Length=1545

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009396867.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1719

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVIVDMNMPMQ
Sbjct  7    PIVMREALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIVDMNMPMQ  60



>gb|AHV90401.1| clathrin heavy chain 2 [Lotus japonicus]
Length=1702

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITMRE LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVIVDM+MPMQ
Sbjct  8    PITMREALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIVDMSMPMQ  61



>ref|XP_006407764.1| hypothetical protein EUTSA_v10019886mg [Eutrema salsugineum]
 gb|ESQ49217.1| hypothetical protein EUTSA_v10019886mg [Eutrema salsugineum]
Length=1702

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009396866.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1743

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVIVDMNMPMQ
Sbjct  7    PIVMREALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIVDMNMPMQ  60



>ref|XP_002528311.1| clathrin heavy chain, putative [Ricinus communis]
 gb|EEF34069.1| clathrin heavy chain, putative [Ricinus communis]
Length=1705

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL +IG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPTIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009146750.1| PREDICTED: clathrin heavy chain 1 [Brassica rapa]
Length=1707

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>emb|CDY00997.1| BnaC05g42030D [Brassica napus]
Length=1707

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_006407470.1| hypothetical protein EUTSA_v10019884mg [Eutrema salsugineum]
 gb|ESQ48923.1| hypothetical protein EUTSA_v10019884mg [Eutrema salsugineum]
Length=1706

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009122366.1| PREDICTED: clathrin heavy chain 1-like [Brassica rapa]
Length=1707

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>emb|CDY36301.1| BnaA01g31170D [Brassica napus]
Length=1680

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>emb|CDY36318.1| BnaA01g31000D [Brassica napus]
Length=736

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010461980.1| PREDICTED: clathrin heavy chain 2 isoform X1 [Camelina sativa]
Length=1729

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_006843645.1| hypothetical protein AMTR_s00007p00168430 [Amborella trichopoda]
 gb|ERN05320.1| hypothetical protein AMTR_s00007p00168430 [Amborella trichopoda]
Length=1703

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+S+G+NPQFITFT+VTMES+K+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEALTLTSLGINPQFITFTHVTMESEKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010558070.1| PREDICTED: clathrin heavy chain 1 [Tarenaya hassleriana]
Length=1701

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010462053.1| PREDICTED: clathrin heavy chain 2 isoform X2 [Camelina sativa]
 ref|XP_010462124.1| PREDICTED: clathrin heavy chain 2 isoform X3 [Camelina sativa]
Length=1703

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_006300235.1| hypothetical protein CARUB_v10016475mg [Capsella rubella]
 gb|EOA33133.1| hypothetical protein CARUB_v10016475mg [Capsella rubella]
Length=1730

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEILTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_003538833.1| PREDICTED: clathrin heavy chain 1-like [Glycine max]
Length=1702

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRETLTL+S+G+NPQFITFT+VTMESDK+ICVRETAPQNSVV++DM MPMQ
Sbjct  6    PIAMRETLTLASVGINPQFITFTHVTMESDKYICVRETAPQNSVVMIDMTMPMQ  59



>ref|XP_010999397.1| PREDICTED: clathrin heavy chain 2 isoform X3 [Populus euphratica]
Length=1710

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEVLTLPSIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMHMPMQ  60



>ref|XP_009353932.1| PREDICTED: clathrin heavy chain 2-like [Pyrus x bretschneideri]
Length=1699

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PMTMKEALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>emb|CDY00724.1| BnaC03g37080D [Brassica napus]
Length=1680

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>emb|CDX73889.1| BnaA03g31580D [Brassica napus]
Length=1683

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_006435764.1| hypothetical protein CICLE_v10030488mg [Citrus clementina]
 ref|XP_006486297.1| PREDICTED: clathrin heavy chain 1-like [Citrus sinensis]
 gb|ESR49004.1| hypothetical protein CICLE_v10030488mg [Citrus clementina]
Length=1701

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI+M+E LTL S+G+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMN PMQ
Sbjct  7    PISMKEVLTLPSVGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNQPMQ  60



>ref|XP_010464461.1| PREDICTED: clathrin heavy chain 2-like [Camelina sativa]
Length=1703

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_011048924.1| PREDICTED: clathrin heavy chain 1 isoform X1 [Populus euphratica]
Length=1705

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEVLTLPSIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMHMPMQ  60



>gb|KFK38494.1| hypothetical protein AALP_AA3G120700 [Arabis alpina]
Length=1708

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_008354979.1| PREDICTED: clathrin heavy chain 2-like [Malus domestica]
Length=1699

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PMTMKEALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_009386478.1| PREDICTED: clathrin heavy chain 1-like [Musa acuminata subsp. 
malaccensis]
Length=1705

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+NPQFITFT+VTMESDK++CVRET+PQNSVVIVDMNMPMQ
Sbjct  7    PIVMREALTLPSIGINPQFITFTHVTMESDKYVCVRETSPQNSVVIVDMNMPMQ  60



>ref|XP_006306581.1| hypothetical protein CARUB_v10008081mg [Capsella rubella]
 gb|EOA39479.1| hypothetical protein CARUB_v10008081mg [Capsella rubella]
Length=1703

 Score =   103 bits (256),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEILTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_002311238.2| clathrin heavy chain family protein [Populus trichocarpa]
 gb|EEE88605.2| clathrin heavy chain family protein [Populus trichocarpa]
Length=1705

 Score =   103 bits (256),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEVLTLPSIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMHMPMQ  60



>ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana]
 sp|Q0WLB5.1|CLAH2_ARATH RecName: Full=Clathrin heavy chain 2 [Arabidopsis thaliana]
 dbj|BAF02092.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74644.1| Clathrin, heavy chain [Arabidopsis thaliana]
Length=1703

 Score =   103 bits (256),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>emb|CAN71721.1| hypothetical protein VITISV_012220 [Vitis vinifera]
Length=393

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI+M+E LTLSSIG++PQF+TFT+VTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PISMKEALTLSSIGISPQFMTFTHVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>gb|KHG11889.1| Clathrin heavy chain 2 -like protein [Gossypium arboreum]
Length=1363

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG++PQFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEVLTLPSIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_006598484.1| PREDICTED: uncharacterized protein LOC102662422 [Glycine max]
Length=269

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SI +NPQFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  7    PIAMREALTLPSIDINPQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  60



>gb|KDO68931.1| hypothetical protein CISIN_1g000428mg [Citrus sinensis]
Length=1520

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI+M+E LTL S+G+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DMN PMQ
Sbjct  7    PISMKEVLTLPSVGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNQPMQ  60



>gb|KHN18252.1| Clathrin heavy chain 2 [Glycine soja]
Length=160

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SI +NPQFITFT+VTMESDK+ICVRE APQNSVVI+DMNMP Q
Sbjct  7    PIAMREALTLPSIDINPQFITFTHVTMESDKYICVREMAPQNSVVIIDMNMPNQ  60



>ref|XP_003538472.1| PREDICTED: clathrin heavy chain 1-like [Glycine max]
Length=1700

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRETLTL +IG+NPQFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  7    PIAMRETLTLPTIGINPQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  60



>ref|XP_010554676.1| PREDICTED: clathrin heavy chain 1-like [Tarenaya hassleriana]
Length=1708

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI+M+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PISMKEILTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>gb|KHG02496.1| Clathrin heavy chain 2 [Gossypium arboreum]
Length=1257

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PIAMKEVLTLPSVGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>gb|KHG02495.1| Clathrin heavy chain 2 [Gossypium arboreum]
Length=1323

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PIAMKEVLTLPSVGINPQFITFTNVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_009400000.1| PREDICTED: clathrin heavy chain 1 [Musa acuminata subsp. malaccensis]
Length=1703

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+NPQFITFT+VTMESDK+ICVRET+P+NSVVIVDMNMPMQ
Sbjct  7    PIVMREALTLPSIGINPQFITFTHVTMESDKYICVRETSPENSVVIVDMNMPMQ  60



>ref|XP_004500281.1| PREDICTED: clathrin heavy chain 1-like [Cicer arietinum]
Length=1702

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDKFICVRETAP NSVV++DMNMPMQ
Sbjct  6    PITMKEALTLGSVGINPQFITFTHVTMESDKFICVRETAPSNSVVMIDMNMPMQ  59



>ref|XP_002884683.1| hypothetical protein ARALYDRAFT_896987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60942.1| hypothetical protein ARALYDRAFT_896987 [Arabidopsis lyrata subsp. 
lyrata]
Length=1703

 Score =   102 bits (254),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_010264592.1| PREDICTED: clathrin heavy chain 1-like [Nelumbo nucifera]
Length=1705

 Score =   102 bits (254),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MPMQ
Sbjct  7    PITMKEALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPMQ  60



>ref|XP_010534608.1| PREDICTED: clathrin heavy chain 2-like [Tarenaya hassleriana]
Length=1720

 Score =   102 bits (253),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEILTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010464809.1| PREDICTED: clathrin heavy chain 1-like [Camelina sativa]
Length=1702

 Score =   102 bits (253),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010488269.1| PREDICTED: clathrin heavy chain 1 [Camelina sativa]
Length=1702

 Score =   102 bits (253),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010486756.1| PREDICTED: clathrin heavy chain 1-like [Camelina sativa]
Length=1702

 Score =   102 bits (253),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_006299090.1| hypothetical protein CARUB_v10015228mg [Capsella rubella]
 gb|EOA31988.1| hypothetical protein CARUB_v10015228mg [Capsella rubella]
Length=1702

 Score =   102 bits (253),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_010253796.1| PREDICTED: clathrin heavy chain 2 [Nelumbo nucifera]
Length=1700

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVIVDMNMP Q
Sbjct  7    PITMKEALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIVDMNMPNQ  60



>ref|XP_003516582.1| PREDICTED: clathrin heavy chain 2-like [Glycine max]
Length=1702

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+NPQFITFT+VTMESDK+ICVRETAPQNSVV++DM MPMQ
Sbjct  6    PIIMREALTLASVGINPQFITFTHVTMESDKYICVRETAPQNSVVMIDMTMPMQ  59



>ref|XP_007016899.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
 ref|XP_007016900.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
 ref|XP_007016901.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
 gb|EOY34518.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
 gb|EOY34519.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
 gb|EOY34520.1| Clathrin, heavy chain isoform 1 [Theobroma cacao]
Length=1703

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P++M+ETLTL SIG+NPQFI+FT+VTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PLSMKETLTLPSIGINPQFISFTHVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_007016902.1| Clathrin, heavy chain isoform 4 [Theobroma cacao]
 gb|EOY34521.1| Clathrin, heavy chain isoform 4 [Theobroma cacao]
Length=1659

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P++M+ETLTL SIG+NPQFI+FT+VTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PLSMKETLTLPSIGINPQFISFTHVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>emb|CDX74011.1| BnaA03g30360D [Brassica napus]
Length=1678

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_009135023.1| PREDICTED: clathrin heavy chain 2-like [Brassica rapa]
Length=1704

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_002269905.1| PREDICTED: clathrin heavy chain 1 [Vitis vinifera]
 emb|CAN79917.1| hypothetical protein VITISV_005429 [Vitis vinifera]
 emb|CBI25457.3| unnamed protein product [Vitis vinifera]
Length=1704

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G++PQFITFT+VTMESDK++CVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSLGISPQFITFTHVTMESDKYLCVRETAPQNSVVIIDMNMPMQ  60



>emb|CDY07954.1| BnaC03g35690D [Brassica napus]
Length=1675

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_010922576.1| PREDICTED: clathrin heavy chain 1 [Elaeis guineensis]
Length=1707

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI+MRE LTL +IG+NPQFITFT+VTMES+K+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PISMREALTLPTIGINPQFITFTHVTMESEKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_007218882.1| hypothetical protein PRUPE_ppa000130mg [Prunus persica]
 ref|XP_008233776.1| PREDICTED: clathrin heavy chain 1 [Prunus mume]
 gb|EMJ20081.1| hypothetical protein PRUPE_ppa000130mg [Prunus persica]
Length=1701

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_009369185.1| PREDICTED: clathrin heavy chain 2-like [Pyrus x bretschneideri]
Length=1705

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_008369270.1| PREDICTED: clathrin heavy chain 2-like isoform X2 [Malus domestica]
Length=1705

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_008374148.1| PREDICTED: clathrin heavy chain 1 [Malus domestica]
Length=1705

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_010689491.1| PREDICTED: clathrin heavy chain 1 [Beta vulgaris subsp. vulgaris]
Length=1706

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+NPQFITF NVTMES+K+ICVRET+PQNSVVIVDMNMPMQ
Sbjct  7    PIVMKEVLTLPSIGINPQFITFNNVTMESEKYICVRETSPQNSVVIVDMNMPMQ  60



>gb|KHG27324.1| Clathrin heavy chain 2 -like protein [Gossypium arboreum]
Length=1322

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG++PQFITFTNVTMES+K+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIAMKEVLTLPSIGISPQFITFTNVTMESEKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_009338936.1| PREDICTED: clathrin heavy chain 2-like [Pyrus x bretschneideri]
Length=1702

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MPMQ
Sbjct  7    PMTMKEALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPMQ  60



>emb|CDY27997.1| BnaC05g43990D [Brassica napus]
Length=1600

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_009369618.1| PREDICTED: clathrin heavy chain 2-like [Pyrus x bretschneideri]
Length=1702

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MPMQ
Sbjct  7    PMTMKEALTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPMQ  60



>ref|XP_009345101.1| PREDICTED: clathrin heavy chain 1 [Pyrus x bretschneideri]
Length=1705

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_011003918.1| PREDICTED: clathrin heavy chain 1-like [Populus euphratica]
Length=1702

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFI FT+VTMES+K+IC+RETAPQNSVVIVDMNMPMQ
Sbjct  7    PITMKEALTLPSLGINPQFINFTHVTMESEKYICIRETAPQNSVVIVDMNMPMQ  60



>ref|XP_010907410.1| PREDICTED: clathrin heavy chain 1-like [Elaeis guineensis]
Length=1701

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITMRE LTL S+G+NPQFITFT+V MES+K+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMREALTLPSLGINPQFITFTHVAMESEKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_008362742.1| PREDICTED: clathrin heavy chain 1 [Malus domestica]
Length=1579

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>ref|XP_008369269.1| PREDICTED: clathrin heavy chain 2-like isoform X1 [Malus domestica]
Length=1734

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VI+DM+MPMQ
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSIVIIDMSMPMQ  60



>gb|AAG51341.1|AC012562_2 putative clathrin heavy chain, 3' partial; 6334-1 [Arabidopsis 
thaliana]
Length=1280

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_007016904.1| Clathrin, heavy chain isoform 6 [Theobroma cacao]
 gb|EOY34523.1| Clathrin, heavy chain isoform 6 [Theobroma cacao]
Length=1648

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P++M+ETLTL SIG+NPQFI+FT+VTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PLSMKETLTLPSIGINPQFISFTHVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_008805151.1| PREDICTED: clathrin heavy chain 1 [Phoenix dactylifera]
Length=1706

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL S+G+NPQFITFT+VTMES+K+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PIAMREALTLPSLGINPQFITFTHVTMESEKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_004295773.1| PREDICTED: clathrin heavy chain 1-like [Fragaria vesca subsp. 
vesca]
Length=1705

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+TM+E LTL SIG+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MPMQ
Sbjct  9    PMTMKEQLTLPSIGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPMQ  62



>ref|XP_009385547.1| PREDICTED: clathrin heavy chain 1-like [Musa acuminata subsp. 
malaccensis]
Length=1705

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+N QFITFT+VTMESDK+ICVRET+PQNSVVIVDMNMPMQ
Sbjct  7    PIVMREVLTLPSIGINSQFITFTHVTMESDKYICVRETSPQNSVVIVDMNMPMQ  60



>ref|XP_007016903.1| Clathrin, heavy chain isoform 5 [Theobroma cacao]
 gb|EOY34522.1| Clathrin, heavy chain isoform 5 [Theobroma cacao]
Length=1481

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P++M+ETLTL SIG+NPQFI+FT+VTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PLSMKETLTLPSIGINPQFISFTHVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_002276855.1| PREDICTED: clathrin heavy chain 2 [Vitis vinifera]
 emb|CBI15929.3| unnamed protein product [Vitis vinifera]
Length=1705

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI+M+E LTLSSIG++PQF+TFT+VTMESDK+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PISMKEALTLSSIGISPQFMTFTHVTMESDKYICVRETAPQNSVVIIDMSMPMQ  60



>gb|KHN31288.1| Clathrin heavy chain 1 [Glycine soja]
Length=1479

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITMRE LTL SIG+NPQFITFT+VTMESDK+ICVRETAPQNSVVI+DMNM  Q
Sbjct  7    PITMREALTLPSIGINPQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMSNQ  60



>emb|CDY35984.1| BnaA05g29660D [Brassica napus]
Length=1606

 Score =   100 bits (249),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PIT++E LTL S+G+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITLKEVLTLPSVGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_009147186.1| PREDICTED: clathrin heavy chain 2 [Brassica rapa]
Length=1694

 Score =   100 bits (249),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PIT++E LTL S+G+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PITLKEVLTLPSVGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ  60



>gb|EYU20032.1| hypothetical protein MIMGU_mgv1a022713mg, partial [Erythranthe 
guttata]
Length=1229

 Score =   100 bits (248),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+SIG+NPQFITFTNVTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PITMKEALTLTSIGINPQFITFTNVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>ref|XP_007146784.1| hypothetical protein PHAVU_006G069700g [Phaseolus vulgaris]
 gb|ESW18778.1| hypothetical protein PHAVU_006G069700g [Phaseolus vulgaris]
Length=1717

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL S+G+NPQFITFT+VTMESDK+ICVRETAPQNSVV++DM MPMQ
Sbjct  6    PIAMREALTLGSVGINPQFITFTHVTMESDKYICVRETAPQNSVVMIDMAMPMQ  59



>ref|XP_009400774.1| PREDICTED: clathrin heavy chain 1-like [Musa acuminata subsp. 
malaccensis]
Length=1705

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL S+G+NPQF+TFT+VTMESDK+ICVRETAPQNS+VI+DM+MPMQ
Sbjct  7    PIAMREVLTLPSLGINPQFVTFTHVTMESDKYICVRETAPQNSLVIIDMSMPMQ  60



>ref|XP_003518313.1| PREDICTED: clathrin heavy chain 1-like [Glycine max]
Length=1706

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+ETLTL S+G+N QFITFT+VTMESDK+ICVRET PQNSVVI+DM+MPMQ
Sbjct  6    PITMKETLTLGSVGINQQFITFTHVTMESDKYICVRETGPQNSVVIIDMSMPMQ  59



>ref|XP_002313985.1| hypothetical protein POPTR_0009s07740g [Populus trichocarpa]
 gb|EEE87940.1| hypothetical protein POPTR_0009s07740g [Populus trichocarpa]
Length=1690

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFI FT+VTMES+K+IC+RET+PQNSVVIVDMNMPMQ
Sbjct  7    PITMKEALTLPSLGINPQFINFTHVTMESEKYICIRETSPQNSVVIVDMNMPMQ  60



>gb|AFW55791.1| putative clathrin heavy chain family protein [Zea mays]
Length=233

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>gb|KHN46140.1| Clathrin heavy chain 1 [Glycine soja]
Length=1553

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+ETLTL S+G+N QFITFT+VTMESDK+ICVRET PQNSVVI+DM+MPMQ
Sbjct  6    PITMKETLTLGSVGINQQFITFTHVTMESDKYICVRETGPQNSVVIIDMSMPMQ  59



>ref|XP_009397098.1| PREDICTED: clathrin heavy chain 1-like [Musa acuminata subsp. 
malaccensis]
Length=1705

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNS+VIVDM+MPMQ
Sbjct  7    PIAMREALTLPSLGINPQFITFTHVTMESDKYICVRETSPQNSLVIVDMSMPMQ  60



>gb|KEH34327.1| clathrin heavy chain [Medicago truncatula]
Length=1704

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMES+KFICVRET P NSVV++DMNMPMQ
Sbjct  6    PITMKEALTLGSVGINPQFITFTHVTMESEKFICVRETGPSNSVVMIDMNMPMQ  59



>ref|XP_003544075.1| PREDICTED: clathrin heavy chain 2-like [Glycine max]
Length=1700

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  7    PITMKEALTLPSIGINSQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  60



>gb|KHN38581.1| Clathrin heavy chain 2 [Glycine soja]
Length=1701

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  7    PITMKEALTLPSIGINSQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  60



>ref|XP_003519402.1| PREDICTED: clathrin heavy chain 2-like [Glycine max]
Length=1707

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  7    PITMKEALTLPSIGINSQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  60



>gb|KHN48575.1| Clathrin heavy chain 2 [Glycine soja]
Length=1540

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  7    PITMKEALTLPSIGINSQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  60



>gb|AES71175.2| clathrin heavy chain [Medicago truncatula]
Length=1705

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+NPQ ITFT+VTMESDK+ICVRETAPQNSVVIVDMNMP Q
Sbjct  8    PILMREALTLPSIGINPQHITFTHVTMESDKYICVRETAPQNSVVIVDMNMPNQ  61



>ref|XP_003600924.1| Clathrin heavy chain [Medicago truncatula]
Length=1742

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG+NPQ ITFT+VTMESDK+ICVRETAPQNSVVIVDMNMP Q
Sbjct  8    PILMREALTLPSIGINPQHITFTHVTMESDKYICVRETAPQNSVVIVDMNMPNQ  61



>ref|XP_008805008.1| PREDICTED: clathrin heavy chain 1-like [Phoenix dactylifera]
Length=1706

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL S+GVNPQFITFT+VTMES+K+ICVRET+PQNSVVI+DMNMP Q
Sbjct  7    PIAMREALTLPSLGVNPQFITFTHVTMESEKYICVRETSPQNSVVIIDMNMPTQ  60



>ref|XP_004307649.1| PREDICTED: clathrin heavy chain 1-like [Fragaria vesca subsp. 
vesca]
Length=1708

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFITFT+VTMESDK+ICVRETAPQNS+VI+DM+MP Q
Sbjct  7    PITMKEALTLPSVGINPQFITFTHVTMESDKYICVRETAPQNSIVIIDMSMPNQ  60



>ref|XP_010098908.1| Clathrin heavy chain 1 [Morus notabilis]
 gb|EXB76111.1| Clathrin heavy chain 1 [Morus notabilis]
Length=1769

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL SIG++PQFITFT+VTMESDK+ICVRETAPQNS+VIVDMN+P Q
Sbjct  7    PIAMREALTLPSIGISPQFITFTHVTMESDKYICVRETAPQNSIVIVDMNLPNQ  60



>ref|NP_187724.2| Clathrin, heavy chain [Arabidopsis thaliana]
 sp|Q0WNJ6.1|CLAH1_ARATH RecName: Full=Clathrin heavy chain 1 [Arabidopsis thaliana]
 dbj|BAF01303.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75005.1| Clathrin, heavy chain [Arabidopsis thaliana]
Length=1705

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+  QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSVGIGQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>ref|XP_002884831.1| hypothetical protein ARALYDRAFT_478454 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61090.1| hypothetical protein ARALYDRAFT_478454 [Arabidopsis lyrata subsp. 
lyrata]
Length=1702

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+  QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSVGIGQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>gb|AAF01510.1|AC009991_6 putative clathrin heavy chain [Arabidopsis thaliana]
 gb|AAG50967.1|AC073395_9 clathrin heavy chain, putative; 28833-19741 [Arabidopsis thaliana]
Length=1705

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+  QFITFTNVTMESDK+ICVRETAPQNSVVI+DMNMPMQ
Sbjct  7    PIIMKEVLTLPSVGIGQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ  60



>gb|EYU26805.1| hypothetical protein MIMGU_mgv1a000127mg [Erythranthe guttata]
Length=1709

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+SIG+N QFITFTNVTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PITMKEALTLTSIGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>ref|XP_010067547.1| PREDICTED: clathrin heavy chain 2 [Eucalyptus grandis]
 gb|KCW65695.1| hypothetical protein EUGRSUZ_G03075 [Eucalyptus grandis]
Length=1707

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G++PQFITFT+VTMES+K+ICVRETAPQNSVVI+DM+MPMQ
Sbjct  7    PITMKEALTLPSLGISPQFITFTHVTMESEKYICVRETAPQNSVVIIDMSMPMQ  60



>ref|XP_003544300.1| PREDICTED: clathrin heavy chain 1-like [Glycine max]
Length=1703

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+ET TL S+G+N QFITFT+VTMESDK+ICVRET PQNSVVI+DM+MPMQ
Sbjct  6    PITMKETFTLGSVGINQQFITFTHVTMESDKYICVRETGPQNSVVIIDMSMPMQ  59



>gb|KHN40089.1| Clathrin heavy chain 1 [Glycine soja]
Length=1513

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+ET TL S+G+N QFITFT+VTMESDK+ICVRET PQNSVVI+DM+MPMQ
Sbjct  6    PITMKETFTLGSVGINQQFITFTHVTMESDKYICVRETGPQNSVVIIDMSMPMQ  59



>gb|KHN04772.1| Clathrin heavy chain 1 [Glycine soja]
Length=1691

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  MRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            MRETLTL +IG+NPQFITFT+VTMESDK+ICVRETAPQNSVVI+DMNMP Q
Sbjct  1    MRETLTLPTIGINPQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ  51



>ref|XP_002448861.1| hypothetical protein SORBIDRAFT_05g000445 [Sorghum bicolor]
 ref|XP_002441665.1| hypothetical protein SORBIDRAFT_08g000475 [Sorghum bicolor]
 gb|EES07849.1| hypothetical protein SORBIDRAFT_05g000445 [Sorghum bicolor]
 gb|EES15503.1| hypothetical protein SORBIDRAFT_08g000475 [Sorghum bicolor]
Length=347

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_007163558.1| hypothetical protein PHAVU_001G244300g [Phaseolus vulgaris]
 gb|ESW35552.1| hypothetical protein PHAVU_001G244300g [Phaseolus vulgaris]
Length=1701

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL SIG+NPQFITFT+VTMES+K+ICVRET+PQNSVVIVDMNMP Q
Sbjct  7    PIAMKEALTLPSIGINPQFITFTHVTMESEKYICVRETSPQNSVVIVDMNMPNQ  60



>ref|XP_004491025.1| PREDICTED: clathrin heavy chain 2-like [Cicer arietinum]
Length=1704

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+N QFITFT+VTMESDK+ICVRETAPQNSVVIVDM+MPMQ
Sbjct  7    PIAMKEVLTLPSVGINTQFITFTHVTMESDKYICVRETAPQNSVVIVDMSMPMQ  60



>ref|XP_007141753.1| hypothetical protein PHAVU_008G222800g [Phaseolus vulgaris]
 gb|ESW13747.1| hypothetical protein PHAVU_008G222800g [Phaseolus vulgaris]
Length=1707

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL SIG+N QFITFT+VTMESDK+ICVRET+PQNSVVI+DMNMP Q
Sbjct  7    PITMKEALTLPSIGINTQFITFTHVTMESDKYICVRETSPQNSVVIIDMNMPNQ  60



>ref|XP_010685522.1| PREDICTED: clathrin heavy chain 1 [Beta vulgaris subsp. vulgaris]
Length=1705

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PIVMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPSQ  60



>ref|XP_004235240.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum]
Length=1702

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+ETLTL S GVN QFI FTNVTMES+K+ICVRET+PQNSVVI+DMNMPMQ
Sbjct  7    PIIMKETLTLPSAGVNQQFINFTNVTMESEKYICVRETSPQNSVVIIDMNMPMQ  60



>ref|XP_006663144.1| PREDICTED: clathrin heavy chain 1-like [Oryza brachyantha]
Length=488

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTLSS+G+ PQF+TFT+VTMESDK+ICVRET+PQNSVVI+DM MP Q
Sbjct  7    PIAMREALTLSSLGIAPQFVTFTHVTMESDKYICVRETSPQNSVVIIDMAMPNQ  60



>ref|XP_010031192.1| PREDICTED: clathrin heavy chain 1 isoform X2 [Eucalyptus grandis]
 gb|KCW50454.1| hypothetical protein EUGRSUZ_J00193 [Eucalyptus grandis]
Length=1705

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PIAMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>ref|XP_010031191.1| PREDICTED: clathrin heavy chain 1 isoform X1 [Eucalyptus grandis]
Length=1734

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PIAMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>gb|KCW50455.1| hypothetical protein EUGRSUZ_J00193 [Eucalyptus grandis]
Length=1586

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PIAMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>gb|KCW50456.1| hypothetical protein EUGRSUZ_J00193 [Eucalyptus grandis]
Length=1575

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+NPQFITFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PIAMKEALTLPSVGINPQFITFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>ref|XP_008662354.1| PREDICTED: clathrin heavy chain 1-like [Zea mays]
 gb|AFW55790.1| putative clathrin heavy chain family protein [Zea mays]
Length=1707

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|NP_001236999.1| clathrin heavy chain [Glycine max]
 gb|AAC49294.1| clathrin heavy chain [Glycine max]
Length=1700

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRETLT  +IG+NPQFITFT+VTMESDK+I VRETAPQ+SVVI+DMNMP Q
Sbjct  7    PIAMRETLTFPTIGINPQFITFTHVTMESDKYISVRETAPQDSVVIIDMNMPNQ  60



>ref|XP_002298486.2| hypothetical protein POPTR_0001s28540g [Populus trichocarpa]
 gb|EEE83291.2| hypothetical protein POPTR_0001s28540g [Populus trichocarpa]
Length=1810

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL S+G+NPQFI FT+VTMES+K+IC+RETAPQNSVVIVDM+MP Q
Sbjct  106  PITMKEALTLPSLGINPQFINFTHVTMESEKYICIRETAPQNSVVIVDMSMPAQ  159



>ref|XP_008667181.1| PREDICTED: uncharacterized protein LOC100193501 isoform X1 [Zea 
mays]
 gb|AGH24537.1| clathrin heavy chain 2 [Zea mays]
 tpg|DAA64538.1| TPA_exp: clathrin heavy chain 2 [Zea mays]
Length=1746

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_008676402.1| PREDICTED: clathrin heavy chain 1-like [Zea mays]
Length=1707

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_008667182.1| PREDICTED: uncharacterized protein LOC100193501 isoform X2 [Zea 
mays]
Length=1710

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_004978593.1| PREDICTED: clathrin heavy chain 1-like [Setaria italica]
Length=1710

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_008679323.1| PREDICTED: clathrin heavy chain 1-like [Zea mays]
Length=1702

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_004977646.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Setaria italica]
Length=1710

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_004977645.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Setaria italica]
Length=1743

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  60



>ref|XP_006663706.1| PREDICTED: LOW QUALITY PROTEIN: clathrin heavy chain 1-like [Oryza 
brachyantha]
Length=1708

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTLSS+G+ PQF+TFT+VTMESDK+ICVRET+PQNSVVI+DM MP Q
Sbjct  7    PIAMREALTLSSLGIAPQFVTFTHVTMESDKYICVRETSPQNSVVIIDMAMPNQ  60



>ref|XP_001753098.1| predicted protein [Physcomitrella patens]
 gb|EDQ82139.1| predicted protein [Physcomitrella patens]
Length=1712

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+S+G+N QF+TFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PITMKEALTLTSLGINQQFVTFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>ref|XP_001772180.1| predicted protein [Physcomitrella patens]
 gb|EDQ62993.1| predicted protein [Physcomitrella patens]
Length=1709

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E LTL+S+G+N QF+TFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PITMKEALTLTSLGINQQFVTFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>gb|EMT06756.1| Clathrin heavy chain 1 [Aegilops tauschii]
Length=1728

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQFITFT+VTMESD++ICVRET+PQNSVVI+DM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFITFTHVTMESDRYICVRETSPQNSVVIIDMAMPSQ  60



>gb|EMS67801.1| Clathrin heavy chain 1 [Triticum urartu]
Length=1708

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQFITFT+VTMESD++ICVRET+PQNSVVI+DM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFITFTHVTMESDRYICVRETSPQNSVVIIDMAMPSQ  60



>ref|XP_003579054.1| PREDICTED: clathrin heavy chain 1 [Brachypodium distachyon]
Length=1710

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMESD++ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESDRYICVRETSPQNSVVIVDMAMPSQ  60



>gb|EMT21111.1| Clathrin heavy chain 1 [Aegilops tauschii]
Length=1724

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMESD++ICVRET+PQNSVVI+DM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESDRYICVRETSPQNSVVIIDMAMPSQ  60



>gb|EMS67808.1| Clathrin heavy chain 1 [Triticum urartu]
Length=1724

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMESD++ICVRET+PQNSVVI+DM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESDRYICVRETSPQNSVVIIDMAMPSQ  60



>gb|EAY81974.1| hypothetical protein OsI_37152 [Oryza sativa Indica Group]
Length=1561

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ  60



>sp|Q2RBN7.1|CLH1_ORYSJ RecName: Full=Clathrin heavy chain 1 [Oryza sativa Japonica Group]
 gb|ABA91061.1| Clathrin heavy chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=1708

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ  60



>gb|EAZ19365.1| hypothetical protein OsJ_34919 [Oryza sativa Japonica Group]
Length=1708

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ  60



>sp|Q2QYW2.1|CLH2_ORYSJ RecName: Full=Clathrin heavy chain 2 [Oryza sativa Japonica Group]
 gb|ABA95598.1| Clathrin heavy chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=1708

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ  60



>gb|EAZ19358.1| hypothetical protein OsJ_34910 [Oryza sativa Japonica Group]
Length=1708

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ  60



>gb|EEC68683.1| hypothetical protein OsI_37138 [Oryza sativa Indica Group]
Length=1497

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQF+TFT+VTMES+K+ICVRET+PQNSVVIVDM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ  60



>ref|XP_001785223.1| predicted protein [Physcomitrella patens]
 gb|EDQ49964.1| predicted protein [Physcomitrella patens]
Length=1715

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+N QF+TFT+VTMESDK+ICVRET+PQNSVVI+DM+MP Q
Sbjct  7    PIAMREALTLTSLGINQQFVTFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ  60



>ref|XP_003616661.1| Clathrin heavy chain [Medicago truncatula]
 gb|AES99619.1| clathrin heavy chain [Medicago truncatula]
Length=1706

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL S+G+N QFITFT+VTMESDK+ICVRET+PQNSVVIVDM+MP Q
Sbjct  7    PIAMKEVLTLPSVGINAQFITFTHVTMESDKYICVRETSPQNSVVIVDMSMPNQ  60



>ref|XP_006403036.1| hypothetical protein EUTSA_v10005737mg [Eutrema salsugineum]
 gb|ESQ44489.1| hypothetical protein EUTSA_v10005737mg [Eutrema salsugineum]
Length=1712

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI M+E LTL+S+G+NPQ I FT+VTMESDK+ICVRETAPQNSVVI+DM+MP Q
Sbjct  7    PINMKEILTLTSVGINPQSINFTSVTMESDKYICVRETAPQNSVVIIDMSMPTQ  60



>ref|XP_002974286.1| hypothetical protein SELMODRAFT_149750 [Selaginella moellendorffii]
 gb|EFJ24508.1| hypothetical protein SELMODRAFT_149750 [Selaginella moellendorffii]
Length=1700

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E L L+S+G+NPQ ITF +VTMES+K+ICVRET PQNSVVI+DMN+P+Q
Sbjct  7    PITMKEALVLTSLGINPQCITFNHVTMESEKYICVRETTPQNSVVIIDMNLPLQ  60



>ref|XP_002985659.1| hypothetical protein SELMODRAFT_157554 [Selaginella moellendorffii]
 gb|EFJ13237.1| hypothetical protein SELMODRAFT_157554 [Selaginella moellendorffii]
Length=1700

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM+E L L+S+G+NPQ ITF +VTMES+K+ICVRET PQNSVVI+DMN+P+Q
Sbjct  7    PITMKEALVLTSLGINPQCITFNHVTMESEKYICVRETTPQNSVVIIDMNLPLQ  60



>ref|XP_003576374.1| PREDICTED: clathrin heavy chain 1-like [Brachypodium distachyon]
Length=1708

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  MRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            MRE LTL+S+G+ PQF+TFT+VTMESD++ICVRET+PQNSVVIVDM MP Q
Sbjct  11   MREALTLTSLGIAPQFVTFTHVTMESDRYICVRETSPQNSVVIVDMAMPSQ  61



>emb|CDJ26527.1| unnamed protein product [Triticum aestivum]
Length=356

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQ-NSVVIVDMNMPMQ  2
            PI MRE LTL+S+G+ PQFITFT+VTMESD++ICVRET+PQ NS+V++DM MP Q
Sbjct  7    PIAMREALTLTSLGIAPQFITFTHVTMESDRYICVRETSPQGNSLVMIDMAMPSQ  61



>gb|KHN42022.1| Clathrin heavy chain 1 [Glycine soja]
Length=1520

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  LTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            L L+S+G+NPQFITFT+VTMESDK+ICVRETAPQNSVV++DM MPMQ
Sbjct  61   LQLASVGINPQFITFTHVTMESDKYICVRETAPQNSVVMIDMTMPMQ  107



>ref|XP_001780056.1| predicted protein [Physcomitrella patens]
 gb|EDQ55159.1| predicted protein [Physcomitrella patens]
Length=1697

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PIT++E L L+SIG+ PQF+TFT+VTM+SDK+ICVRET+PQN+VVI+DM  PMQ
Sbjct  6    PITVKEALALTSIGILPQFVTFTHVTMDSDKYICVRETSPQNNVVIIDMASPMQ  59



>gb|KFK34843.1| hypothetical protein AALP_AA5G200400 [Arabis alpina]
Length=1698

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PITM E  TLSS+ +N QFITFTNVTMESDK+IC+RET+P NSVVI+DM+ P+Q
Sbjct  7    PITMTEVFTLSSLEINQQFITFTNVTMESDKYICLRETSPANSVVIIDMSKPLQ  60



>gb|AHJ61542.1| clathrin heavy chain protein 2 [Lotus japonicus]
 gb|AHV90398.1| clathrin heavy chain 1 [Lotus japonicus]
Length=1700

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  MRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            M+E LTL ++G+N QFI FT+VTMESDK+ICVRETAPQ+SVVIVDM+MP Q
Sbjct  11   MKEVLTLPTLGINTQFINFTHVTMESDKYICVRETAPQSSVVIVDMSMPNQ  61



>ref|XP_005651179.1| clathrin heavy chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26635.1| clathrin heavy chain [Coccomyxa subellipsoidea C-169]
Length=1700

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPM  5
            PIT++E L L ++G+N QFI+FTNVTMESDKFIC+RET   NSVVIVD+  P+
Sbjct  6    PITLKEALLLPNLGINQQFISFTNVTMESDKFICIRETGASNSVVIVDLAAPL  58



>ref|XP_010684108.1| PREDICTED: probable clathrin heavy chain [Beta vulgaris subsp. 
vulgaris]
Length=103

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  127  IGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            +G+NP+FITF++VTMES+K+ICVRET+PQNSVVI+DM+MP Q
Sbjct  52   VGINPEFITFSHVTMESNKYICVRETSPQNSVVIIDMSMPSQ  93



>ref|XP_002500555.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61813.1| predicted protein [Micromonas sp. RCC299]
Length=1691

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPM  5
            P+T++E ++L+S G+NPQ I+FTN+TMES+KFICVRET   NSVVIVDM  PM
Sbjct  5    PVTVKEVVSLTSSGINPQNISFTNLTMESEKFICVRETGAANSVVIVDMAQPM  57



>ref|XP_003056200.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59576.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1702

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PIT++E ++L+S G+NPQ I+FTN+TMES+ FICVRET   NSV+IVDM  P Q
Sbjct  5    PITVKEIVSLTSCGINPQCISFTNLTMESENFICVRETGVANSVIIVDMASPAQ  58



>gb|AGC82051.1| clathrin heavy chain 1 [Zea mays]
Length=1693

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 9/54 (17%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI MRE LT         F+TFT+VTMES+K+ICVRET+PQNSVVI+DM MPMQ
Sbjct  7    PIAMREALT---------FVTFTHVTMESEKYICVRETSPQNSVVIIDMAMPMQ  51



>ref|XP_002950685.1| vesicle coat protein clathrin, heavy chain [Volvox carteri f. 
nagariensis]
 gb|EFJ48431.1| vesicle coat protein clathrin, heavy chain [Volvox carteri f. 
nagariensis]
Length=1716

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPM  5
            P+ ++E L+L SIGV   FI+F NVTMESDK+IC+RET  QN+VVIVDM+ P+
Sbjct  6    PLLVQEKLSLPSIGVAQDFISFKNVTMESDKYICIRETGAQNTVVIVDMSNPL  58



>ref|XP_007515722.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14601.1| predicted protein [Bathycoccus prasinos]
Length=1703

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            P+ + E + L+S+G+NP  I+FTNVTMES+KFICVRET   N+VVIVD+  P Q
Sbjct  5    PVNVSEAIQLTSLGINPSMISFTNVTMESEKFICVRETGTANAVVIVDVASPSQ  58



>ref|XP_002967547.1| hypothetical protein SELMODRAFT_88182 [Selaginella moellendorffii]
 gb|EFJ30894.1| hypothetical protein SELMODRAFT_88182 [Selaginella moellendorffii]
Length=1717

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI  +E ++L+ +G+  QF+ F+ VTMES+K+ICVRET+PQNS++IVD+++P Q
Sbjct  7    PIVTKEIVSLTGLGIGAQFVGFSFVTMESEKYICVRETSPQNSLMIVDLSVPKQ  60



>ref|XP_002981797.1| hypothetical protein SELMODRAFT_115182 [Selaginella moellendorffii]
 gb|EFJ17279.1| hypothetical protein SELMODRAFT_115182 [Selaginella moellendorffii]
Length=1695

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPMQ  2
            PI  +E ++L+ +G+  QF+ F+ VTMES+K+ICVRET+PQNS++IVD+++P Q
Sbjct  7    PIVTKEIVSLTGLGIGAQFVGFSFVTMESEKYICVRETSPQNSLMIVDLSVPKQ  60



>ref|XP_001699806.1| clathrin heavy chain [Chlamydomonas reinhardtii]
 gb|EDP07502.1| clathrin heavy chain [Chlamydomonas reinhardtii]
Length=1738

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPM  5
            P+ + E L L SIGV   FI+F NV+MES+K+ICVRET  QN+VVIVDM+ P+
Sbjct  4    PLLVSEKLLLPSIGVAQDFISFKNVSMESEKYICVRETGAQNTVVIVDMSNPL  56



>emb|CEF96597.1| Clathrin, heavy chain/VPS, 7-fold repeat [Ostreococcus tauri]
Length=1694

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMPM  5
            P+++RE + L + GVNPQ I+FTN+TMESDK+ICVRE+   N+VVIV++  P+
Sbjct  6    PVSVREAVQLKTCGVNPQCISFTNLTMESDKYICVRESGATNNVVIVEVANPL  58



>gb|KDD74078.1| hypothetical protein H632_c1591p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=235

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMP  8
            PI +RE + L ++G+    ITFTNVT+ESDK++CVRET P N + I+D++ P
Sbjct  7    PINVREVVNLPNLGIQSGSITFTNVTLESDKYLCVRETTPTNQLTILDLSNP  58



>ref|XP_005844264.1| hypothetical protein CHLNCDRAFT_139336 [Chlorella variabilis]
 gb|EFN52162.1| hypothetical protein CHLNCDRAFT_139336 [Chlorella variabilis]
Length=1638

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNSVVIVDMNMP  8
            PI ++E L L S+GV    ITFTNVTMESDK ICVRET  Q+ +VI+D   P
Sbjct  5    PIGLKEVLNLQSLGVQQNAITFTNVTMESDKHICVRETGDQSQLVIIDTANP  56



>gb|AAX26820.2| SJCHGC08008 protein [Schistosoma japonicum]
Length=239

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E L L S+G+ P  I F+ +TMESDKFICVRE T   + VVI+DMN PM
Sbjct  21   PIKFQEHLQLVSVGIQPSSIGFSTLTMESDKFICVREKTGDTSQVVIIDMNDPM  74



>ref|XP_008561998.1| PREDICTED: clathrin heavy chain 1-like, partial [Galeopterus 
variegatus]
Length=176

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRET-APQNSVVIVDMNMP  8
            PI  +E L L ++G+NP  I F+ +TMESDKFIC+RE    Q  VVI+DMN P
Sbjct  6    PIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDP  58



>gb|KFB40523.1| AGAP003021-PA-like protein [Anopheles sinensis]
Length=1676

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNS-VVIVDMN  14
            PI  +E L L++I +NP  I+FTN+TMESDKFICVRE   + + VVI+DMN
Sbjct  6    PIRFQEHLQLTNININPSSISFTNLTMESDKFICVREKVGETAQVVIIDMN  56



>gb|ETN62753.1| clathrin heavy chain [Anopheles darlingi]
Length=1677

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNS-VVIVDMN  14
            PI  +E L L++I +NP  I+FTN+TMESDKFICVRE   + + VVI+DMN
Sbjct  6    PIRFQEHLQLTNININPSSISFTNLTMESDKFICVREKVGETAQVVIIDMN  56



>ref|XP_009173364.1| hypothetical protein T265_14758, partial [Opisthorchis viverrini]
 gb|KER22904.1| hypothetical protein T265_14758, partial [Opisthorchis viverrini]
Length=478

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E L L+S+G+ P  I F+ +TMESDKFIC+RE T   + VVI+DMN PM
Sbjct  2    PIKFQEHLQLASLGIQPNNIGFSTLTMESDKFICIREKTGDTSQVVIIDMNDPM  55



>ref|XP_005535763.1| clathrin heavy chain [Cyanidioschyzon merolae strain 10D]
 dbj|BAM79477.1| clathrin heavy chain [Cyanidioschyzon merolae strain 10D]
Length=1726

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQ-NSVVIVDMNMPMQ  2
            P+   E  TL S+G++P  I+F+NVTMESD+ ICVRET+ Q N + I+D+  P Q
Sbjct  5    PVVFEELFTLPSVGISPTHISFSNVTMESDRVICVRETSDQGNKLAIIDVTKPDQ  59



>ref|XP_004742653.1| PREDICTED: clathrin heavy chain 2 isoform X1 [Mustela putorius 
furo]
 ref|XP_004817064.1| PREDICTED: clathrin heavy chain 2 isoform X1 [Mustela putorius 
furo]
Length=1673

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E   L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DMN PM
Sbjct  6    PIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMNDPM  59



>ref|XP_004742654.1| PREDICTED: clathrin heavy chain 2 isoform X2 [Mustela putorius 
furo]
 ref|XP_004817065.1| PREDICTED: clathrin heavy chain 2 isoform X2 [Mustela putorius 
furo]
Length=1640

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E   L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DMN PM
Sbjct  6    PIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMNDPM  59



>ref|XP_001656876.1| clathrin heavy chain [Aedes aegypti]
 ref|XP_001656877.1| clathrin heavy chain [Aedes aegypti]
 ref|XP_001656878.1| clathrin heavy chain [Aedes aegypti]
 gb|EAT34109.1| AAEL013614-PB [Aedes aegypti]
 gb|EAT34110.1| AAEL013614-PA [Aedes aegypti]
 gb|EAT34111.1| AAEL013614-PC [Aedes aegypti]
Length=1677

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQNS-VVIVDMN  14
            PI  +E L L++I +NP  I+FTN+TMESDKFICVRE   + + VVI+DMN
Sbjct  6    PIRFQEHLQLTNININPSSISFTNLTMESDKFICVREKIGETAQVVIIDMN  56



>ref|XP_005391841.1| PREDICTED: clathrin heavy chain 2 isoform X3 [Chinchilla lanigera]
 ref|XP_005391842.1| PREDICTED: clathrin heavy chain 2 isoform X4 [Chinchilla lanigera]
Length=1640

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E   L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DMN PM
Sbjct  6    PIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMNDPM  59



>ref|XP_007520838.1| PREDICTED: clathrin heavy chain 2 isoform X1 [Erinaceus europaeus]
Length=1640

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETA-PQNSVVIVDMNMPM  5
            PI  +E L L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DM+ PM
Sbjct  6    PIRFQEHLQLQNLGINPTSIGFSTLTMESDKFICVREKVREQTQVVIIDMSDPM  59



>ref|XP_004547067.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Maylandia 
zebra]
Length=1646

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005391840.1| PREDICTED: clathrin heavy chain 2 isoform X2 [Chinchilla lanigera]
Length=1652

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E   L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DMN PM
Sbjct  6    PIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMNDPM  59



>ref|XP_006790022.1| PREDICTED: clathrin heavy chain 1-like isoform X5 [Neolamprologus 
brichardi]
Length=1646

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005334583.1| PREDICTED: clathrin heavy chain 2 [Ictidomys tridecemlineatus]
Length=1640

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E   L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DMN PM
Sbjct  6    PIRFQEHFQLPNLGINPTNIGFSTLTMESDKFICVREKVGEQAQVVIIDMNDPM  59



>ref|XP_005391839.1| PREDICTED: clathrin heavy chain 2 isoform X1 [Chinchilla lanigera]
Length=1673

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMPM  5
            PI  +E   L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DMN PM
Sbjct  6    PIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIIDMNDPM  59



>dbj|GAM29363.1| hypothetical protein SAMD00019534_125390 [Acytostelium subglobosum 
LB1]
Length=1692

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETAPQ--NSVVIVDMNMPMQ  2
            PI  +E L LS++G+  Q I F  +TMES+K+IC+RETAP   N+VVI+D + P Q
Sbjct  5    PIVFKEVLQLSNLGIGAQAIGFATLTMESEKYICIRETAPNGGNNVVIIDTDNPSQ  60



>ref|XP_005738261.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Pundamilia 
nyererei]
Length=1677

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008416354.1| PREDICTED: clathrin heavy chain 2 isoform X3 [Poecilia reticulata]
Length=1697

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_007520839.1| PREDICTED: clathrin heavy chain 2 isoform X2 [Erinaceus europaeus]
Length=1583

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRETA-PQNSVVIVDMNMPM  5
            PI  +E L L ++G+NP  I F+ +TMESDKFICVRE    Q  VVI+DM+ PM
Sbjct  6    PIRFQEHLQLQNLGINPTSIGFSTLTMESDKFICVREKVREQTQVVIIDMSDPM  59



>ref|XP_005738262.1| PREDICTED: clathrin heavy chain 1-like isoform X4 [Pundamilia 
nyererei]
Length=1676

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_003451136.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Oreochromis 
niloticus]
Length=1676

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005473587.1| PREDICTED: clathrin heavy chain 1-like isoform X4 [Oreochromis 
niloticus]
Length=1677

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005738259.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Pundamilia 
nyererei]
Length=1686

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008416356.1| PREDICTED: clathrin heavy chain 2 isoform X5 [Poecilia reticulata]
Length=1689

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008416355.1| PREDICTED: clathrin heavy chain 2 isoform X4 [Poecilia reticulata]
Length=1690

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005738263.1| PREDICTED: clathrin heavy chain 1-like isoform X5 [Pundamilia 
nyererei]
Length=1677

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005738260.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Pundamilia 
nyererei]
Length=1685

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005473586.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Oreochromis 
niloticus]
Length=1685

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_007563569.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Poecilia formosa]
Length=1686

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005473585.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Oreochromis 
niloticus]
Length=1686

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_007563568.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Poecilia formosa]
Length=1687

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008416353.1| PREDICTED: clathrin heavy chain 2 isoform X2 [Poecilia reticulata]
Length=1698

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008416352.1| PREDICTED: clathrin heavy chain 2 isoform X1 [Poecilia reticulata]
Length=1699

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_004547065.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Maylandia 
zebra]
Length=1676

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005473588.1| PREDICTED: clathrin heavy chain 1-like isoform X5 [Oreochromis 
niloticus]
Length=1677

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_006790019.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Neolamprologus 
brichardi]
Length=1685

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005924469.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Haplochromis 
burtoni]
Length=1685

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_006790020.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Neolamprologus 
brichardi]
Length=1677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005924472.1| PREDICTED: clathrin heavy chain 1-like isoform X5 [Haplochromis 
burtoni]
Length=1677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005924470.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Haplochromis 
burtoni]
Length=1677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008283124.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Stegastes 
partitus]
Length=1686

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_006790021.1| PREDICTED: clathrin heavy chain 1-like isoform X4 [Neolamprologus 
brichardi]
Length=1676

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005924471.1| PREDICTED: clathrin heavy chain 1-like isoform X4 [Haplochromis 
burtoni]
Length=1676

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008283127.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Stegastes 
partitus]
Length=1677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_004547066.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Maylandia 
zebra]
Length=1677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_008283126.1| PREDICTED: clathrin heavy chain 1-like isoform X2 [Stegastes 
partitus]
Length=1684

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_006790018.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Neolamprologus 
brichardi]
Length=1686

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_005924468.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Haplochromis 
burtoni]
Length=1686

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNLGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_010732569.1| PREDICTED: clathrin heavy chain 1-like isoform X3 [Larimichthys 
crocea]
Length=1705

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNMGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



>ref|XP_010732567.1| PREDICTED: clathrin heavy chain 1-like isoform X1 [Larimichthys 
crocea]
Length=1725

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  163  PITMRETLTLSSIGVNPQFITFTNVTMESDKFICVRE-TAPQNSVVIVDMNMP  8
            PI  +E L L ++GVNP  I F+ +TMESDKFIC+RE    QN VVIVDM+ P
Sbjct  6    PIRFQEHLQLQNMGVNPANIGFSYLTMESDKFICIREKVGEQNQVVIVDMSDP  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515322439940