BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31086_g1_i1 len=391 path=[371:0-390]

Length=391
                                                                      Score     E

gb|KHN47961.1|  hypothetical protein glysoja_015431                   54.3    3e-07   
gb|KCW87091.1|  hypothetical protein EUGRSUZ_B03622                   54.3    4e-07   
ref|XP_007159400.1|  hypothetical protein PHAVU_002G235100g           53.9    4e-07   
ref|XP_006580155.1|  PREDICTED: uncharacterized protein LOC102660563  53.1    2e-06   
ref|XP_007014723.1|  Uncharacterized protein TCM_040163               51.6    3e-06   
gb|KDP26935.1|  hypothetical protein JCGZ_21028                       50.4    7e-06   
emb|CCH50978.1|  T4.17                                                50.4    8e-06   
ref|XP_006368543.1|  hypothetical protein POPTR_0001s04550g           49.7    1e-05   
gb|ABK22003.1|  unknown                                               51.2    3e-05   Picea sitchensis
ref|XP_007207797.1|  hypothetical protein PRUPE_ppa024522mg           48.5    3e-05   
gb|KDO63004.1|  hypothetical protein CISIN_1g038260mg                 48.5    3e-05   
ref|XP_002532063.1|  conserved hypothetical protein                   48.5    3e-05   Ricinus communis
ref|XP_002527054.1|  conserved hypothetical protein                   48.5    3e-05   Ricinus communis
ref|XP_006445826.1|  hypothetical protein CICLE_v10017653mg           47.8    7e-05   
ref|XP_002527060.1|  conserved hypothetical protein                   47.4    1e-04   Ricinus communis
ref|XP_006445827.1|  hypothetical protein CICLE_v10018091mg           47.8    1e-04   
ref|XP_009380445.1|  PREDICTED: uncharacterized protein LOC103968840  48.9    1e-04   
ref|XP_002527055.1|  conserved hypothetical protein                   47.0    1e-04   Ricinus communis
ref|XP_009399794.1|  PREDICTED: uncharacterized protein LOC103984094  48.9    1e-04   
ref|XP_002299122.1|  hypothetical protein POPTR_0001s04540g           47.0    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011093736.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  48.9    2e-04   
ref|XP_010321083.1|  PREDICTED: uncharacterized protein LOC104647394  48.1    2e-04   
ref|XP_010101134.1|  hypothetical protein L484_016698                 46.2    2e-04   
ref|XP_007014725.1|  Uncharacterized protein TCM_040179               46.2    2e-04   
ref|XP_009622813.1|  PREDICTED: uncharacterized protein LOC104114142  48.5    2e-04   
ref|XP_003601631.1|  hypothetical protein MTR_3g083750                46.2    3e-04   
ref|XP_006338187.1|  PREDICTED: uncharacterized protein LOC102602872  47.8    3e-04   
ref|XP_006858321.1|  hypothetical protein AMTR_s00064p00123160        47.4    7e-04   
ref|XP_009801493.1|  PREDICTED: uncharacterized protein LOC104247231  47.0    7e-04   
ref|XP_008220478.1|  PREDICTED: uncharacterized protein LOC103320559  47.4    8e-04   



>gb|KHN47961.1| hypothetical protein glysoja_015431 [Glycine soja]
Length=74

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ED+NK+AD FIN+FR+QL+ ERE S KRFQ+MI+ G 
Sbjct  38   EDINKMADAFINNFRKQLKIERENSFKRFQDMIHGGA  74



>gb|KCW87091.1| hypothetical protein EUGRSUZ_B03622 [Eucalyptus grandis]
Length=78

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            D+N+LAD FI +FR QLR +REES+KRFQEMI+RG 
Sbjct  43   DINELADAFIRNFRNQLRIQREESLKRFQEMISRGV  78



>ref|XP_007159400.1| hypothetical protein PHAVU_002G235100g [Phaseolus vulgaris]
 gb|ESW31394.1| hypothetical protein PHAVU_002G235100g [Phaseolus vulgaris]
Length=73

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ED+NK+AD FIN+FR+QL+ ER  S++RF +M+NRG 
Sbjct  36   EDINKMADAFINNFRKQLKIERANSLRRFHDMVNRGA  72



>ref|XP_006580155.1| PREDICTED: uncharacterized protein LOC102660563 [Glycine max]
Length=139

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            +D+NK+AD FIN+ R+QL+ ERE S K FQ+MINRG 
Sbjct  103  DDINKMADAFINNCRKQLKIERENSFKHFQDMINRGA  139



>ref|XP_007014723.1| Uncharacterized protein TCM_040163 [Theobroma cacao]
 gb|EOY32342.1| Uncharacterized protein TCM_040163 [Theobroma cacao]
Length=75

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            DVN+LAD FI +FR QL+ +REES K FQEMINRG 
Sbjct  40   DVNELADAFIKNFRNQLKIQREESFKCFQEMINRGV  75



>gb|KDP26935.1| hypothetical protein JCGZ_21028 [Jatropha curcas]
Length=73

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            D+N+LAD FI +FR QL+ +R ES+KRFQEMI+RG 
Sbjct  38   DINELADAFIKNFRDQLKIQRAESLKRFQEMISRGV  73



>emb|CCH50978.1| T4.17 [Malus x robusta]
Length=77

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            DVN++AD FI  FR QL+ +REES KRFQEM+ RG 
Sbjct  42   DVNEMADAFIKKFRNQLKIQREESFKRFQEMLARGV  77



>ref|XP_006368543.1| hypothetical protein POPTR_0001s04550g [Populus trichocarpa]
 gb|ERP65112.1| hypothetical protein POPTR_0001s04550g [Populus trichocarpa]
Length=75

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ED+N+ AD FI +FR QL+ +R++S+KRFQEMI+RG 
Sbjct  39   EDINEKADAFIKNFRNQLKIQRQDSLKRFQEMISRGA  75



>gb|ABK22003.1| unknown [Picea sitchensis]
Length=237

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            E+VN  ADDFIN F+ QL+ +R ESI R+++MINRG
Sbjct  201  EEVNAKADDFINKFKHQLKLQRLESIMRYKDMINRG  236



>ref|XP_007207797.1| hypothetical protein PRUPE_ppa024522mg [Prunus persica]
 gb|EMJ08996.1| hypothetical protein PRUPE_ppa024522mg [Prunus persica]
Length=74

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            D+N++AD FI  FR QL+ +REES KRFQE+I RG 
Sbjct  39   DINEMADAFIKKFRNQLKIQREESFKRFQEIIARGV  74



>gb|KDO63004.1| hypothetical protein CISIN_1g038260mg [Citrus sinensis]
Length=76

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            D+N+LAD FI +FR  L+ +R+ES KR+QEMI+RG
Sbjct  41   DINELADAFIKNFRNHLKIQRDESFKRYQEMISRG  75



>ref|XP_002532063.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30318.1| conserved hypothetical protein [Ricinus communis]
Length=76

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            +D+N+ AD FI +F  QLR +REES KRFQEMI+RG 
Sbjct  40   DDINERADAFIKNFHNQLRIQREESFKRFQEMISRGV  76



>ref|XP_002527054.1| conserved hypothetical protein [Ricinus communis]
 ref|XP_002527056.1| conserved hypothetical protein [Ricinus communis]
 ref|XP_002534680.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27705.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35298.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35300.1| conserved hypothetical protein [Ricinus communis]
Length=72

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            D+N LAD FI +F  QL+ +REESIKR++EMI RG 
Sbjct  37   DINLLADVFIKNFHNQLKIQREESIKRYKEMIARGA  72



>ref|XP_006445826.1| hypothetical protein CICLE_v10017653mg [Citrus clementina]
 gb|ESR59066.1| hypothetical protein CICLE_v10017653mg [Citrus clementina]
 gb|KDO63005.1| hypothetical protein CISIN_1g038965mg [Citrus sinensis]
Length=70

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            D+N+LAD FI +FR QL+ +R+ES KR+QEM+ RG 
Sbjct  35   DINELADAFIMNFRNQLKIQRDESFKRYQEMLARGV  70



>ref|XP_002527060.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35304.1| conserved hypothetical protein [Ricinus communis]
Length=72

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ED+N LAD FI +F  QL+ + +ESIKR++EMI RG 
Sbjct  36   EDINLLADVFIKNFHNQLKIQHQESIKRYKEMIARGA  72



>ref|XP_006445827.1| hypothetical protein CICLE_v10018091mg [Citrus clementina]
 gb|ESR59067.1| hypothetical protein CICLE_v10018091mg [Citrus clementina]
Length=122

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            D+N+LAD FI +FR  L  +R+ES KR+QEMI+RG
Sbjct  41   DINELADAFIKNFRNHLEIQRDESFKRYQEMISRG  75



>ref|XP_009380445.1| PREDICTED: uncharacterized protein LOC103968840 [Musa acuminata 
subsp. malaccensis]
Length=216

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            E+V+  ADDFIN FR QL+ +R  SI R++EM+NRG+
Sbjct  180  EEVDARADDFINRFRHQLKLQRLASIMRYKEMLNRGS  216



>ref|XP_002527055.1| conserved hypothetical protein [Ricinus communis]
 ref|XP_002534678.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27703.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35299.1| conserved hypothetical protein [Ricinus communis]
Length=72

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            D+N LAD FI +F  QL+ +RE+SIKR++EMI RG 
Sbjct  37   DINLLADVFIKNFHNQLKIQREDSIKRYKEMIARGA  72



>ref|XP_009399794.1| PREDICTED: uncharacterized protein LOC103984094 [Musa acuminata 
subsp. malaccensis]
Length=217

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ++V+  ADDFIN FR+QLR +R ESI R++EM+ RG+
Sbjct  181  DEVDARADDFINRFRQQLRLQRLESIARYKEMLTRGS  217



>ref|XP_002299122.1| hypothetical protein POPTR_0001s04540g [Populus trichocarpa]
 gb|EEE83927.1| hypothetical protein POPTR_0001s04540g [Populus trichocarpa]
Length=77

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ED+N+ AD FI +FR QL+ +R++S+KRFQE I+RG 
Sbjct  41   EDINEKADAFIKNFRHQLKIQRQDSLKRFQERISRGV  77



>ref|XP_011093736.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105173623 
[Sesamum indicum]
Length=228

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            E V+  ADDFIN FR+QL+ +R +SI R++EM+NRGT
Sbjct  190  EAVDAKADDFINRFRQQLKLQRLDSILRYREMLNRGT  226



>ref|XP_010321083.1| PREDICTED: uncharacterized protein LOC104647394 [Solanum lycopersicum]
Length=189

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            E V+K ADDFIN FR+QL+ +R  SI R+++M+NRG
Sbjct  150  EAVDKKADDFINKFRQQLKLQRLHSILRYKQMLNRG  185



>ref|XP_010101134.1| hypothetical protein L484_016698 [Morus notabilis]
 gb|EXB87352.1| hypothetical protein L484_016698 [Morus notabilis]
Length=74

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            +D+N  A+ FI +FR QL+ +REES+KRF EMI RG 
Sbjct  38   DDINDQAEAFIKNFRNQLKIQREESLKRFHEMIARGV  74



>ref|XP_007014725.1| Uncharacterized protein TCM_040179 [Theobroma cacao]
 gb|EOY32344.1| Uncharacterized protein TCM_040179 [Theobroma cacao]
Length=71

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEM  73
            D+NKLAD FI++FR+QL ++R+E IK +QEM
Sbjct  39   DINKLADAFISNFRKQLTYQRDEPIKYYQEM  69



>ref|XP_009622813.1| PREDICTED: uncharacterized protein LOC104114142 [Nicotiana tomentosiformis]
Length=232

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            E VN+ ADDFIN FR+QL+ +R +SI R++EM+N+G
Sbjct  194  EAVNEKADDFINKFRQQLKLQRVDSIIRYKEMLNKG  229



>ref|XP_003601631.1| hypothetical protein MTR_3g083750 [Medicago truncatula]
 gb|AES71882.1| DUF761 domain protein [Medicago truncatula]
Length=75

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            ED+N  AD FI +FR+QL+ ER+ES++ F EM  RG 
Sbjct  39   EDINMKADTFITNFRKQLKIERQESLQHFHEMTRRGA  75



>ref|XP_006338187.1| PREDICTED: uncharacterized protein LOC102602872 [Solanum tuberosum]
Length=201

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            E V+K ADDFIN FR+QL+ +R  SI R+ +M+NRG
Sbjct  162  EAVDKKADDFINKFRQQLKLQRLHSILRYNQMLNRG  197



>ref|XP_006858321.1| hypothetical protein AMTR_s00064p00123160 [Amborella trichopoda]
 gb|ERN19788.1| hypothetical protein AMTR_s00064p00123160 [Amborella trichopoda]
Length=234

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  165  DVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            +V+  ADDFIN F++QL+ +R ES+ R++EMINRG
Sbjct  199  EVDAKADDFINKFKQQLKLQRLESLVRYKEMINRG  233



>ref|XP_009801493.1| PREDICTED: uncharacterized protein LOC104247231 [Nicotiana sylvestris]
Length=235

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRG  61
            E V++ ADDFIN FR+QL+ +R +SI R++EM+NRG
Sbjct  197  EAVDEKADDFINMFRQQLKLQRLDSIIRYKEMLNRG  232



>ref|XP_008220478.1| PREDICTED: uncharacterized protein LOC103320559 [Prunus mume]
Length=300

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  168  EDVNKLADDFINSFRRQLRFEREESIKRFQEMINRGT  58
            E+V+  ADDFIN F+ QL+ +R +SI R+++M+NRGT
Sbjct  264  EEVDAKADDFINKFKNQLKLQRLDSIIRYKDMLNRGT  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 528968723284