BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c31065_g1_i1 len=947 path=[925:0-946]

Length=947
                                                                      Score     E

ref|XP_004242717.1|  PREDICTED: uncharacterized protein LOC101254005    368   4e-124   
ref|XP_006359544.1|  PREDICTED: uncharacterized protein LOC102595808    367   8e-124   
ref|XP_009804618.1|  PREDICTED: uncharacterized protein LOC104249821    367   2e-123   
ref|XP_009606794.1|  PREDICTED: uncharacterized protein LOC104101087    350   7e-117   
ref|XP_002268060.1|  PREDICTED: uncharacterized protein LOC100255118    349   1e-116   Vitis vinifera
emb|CBI25580.3|  unnamed protein product                                343   3e-115   
ref|XP_007202935.1|  hypothetical protein PRUPE_ppa016750mg             343   2e-114   
ref|XP_008242911.1|  PREDICTED: uncharacterized protein LOC103341207    343   2e-114   
emb|CAN72910.1|  hypothetical protein VITISV_018847                     343   3e-114   Vitis vinifera
ref|XP_009338405.1|  PREDICTED: uncharacterized protein LOC103930756    340   5e-113   
ref|XP_004287237.1|  PREDICTED: uncharacterized protein LOC101296995    339   7e-113   
ref|XP_007013648.1|  Chlororespiratory reduction 6                      338   1e-112   
ref|XP_010049902.1|  PREDICTED: uncharacterized protein LOC104438450    338   2e-112   
ref|XP_009358528.1|  PREDICTED: uncharacterized protein LOC103949152    337   8e-112   
ref|XP_008367772.1|  PREDICTED: uncharacterized protein LOC103431396    335   3e-111   
gb|KDP30194.1|  hypothetical protein JCGZ_16976                         335   3e-111   
ref|XP_007155102.1|  hypothetical protein PHAVU_003G173400g             330   4e-109   
ref|XP_002532510.1|  conserved hypothetical protein                     327   6e-108   Ricinus communis
emb|CDY55524.1|  BnaA04g29490D                                          327   7e-108   
ref|XP_009118176.1|  PREDICTED: uncharacterized protein LOC103843...    326   8e-108   
gb|EYU25282.1|  hypothetical protein MIMGU_mgv1a012629mg                324   3e-107   
ref|XP_010545053.1|  PREDICTED: uncharacterized protein LOC104817530    324   4e-107   
ref|XP_010098973.1|  hypothetical protein L484_025633                   322   3e-106   
ref|XP_006473934.1|  PREDICTED: uncharacterized protein LOC102614430    322   4e-106   
ref|XP_009118183.1|  PREDICTED: uncharacterized protein LOC103843...    321   1e-105   
ref|XP_011020255.1|  PREDICTED: uncharacterized protein LOC105122694    320   3e-105   
gb|KDO59318.1|  hypothetical protein CISIN_1g025198mg                   319   6e-105   
emb|CDY27466.1|  BnaC04g51070D                                          319   7e-105   
ref|XP_010244869.1|  PREDICTED: uncharacterized protein LOC104588577    318   8e-105   
emb|CDP10504.1|  unnamed protein product                                319   2e-104   
ref|XP_006381064.1|  hypothetical protein POPTR_0006s05910g             318   2e-104   
ref|XP_011084059.1|  PREDICTED: uncharacterized protein LOC105166415    317   4e-104   
ref|XP_004508406.1|  PREDICTED: uncharacterized protein LOC101508703    317   5e-104   
ref|XP_010507833.1|  PREDICTED: uncharacterized protein LOC104784504    316   6e-104   
ref|XP_006453726.1|  hypothetical protein CICLE_v10009248mg             317   7e-104   
ref|XP_010506840.1|  PREDICTED: uncharacterized protein LOC104783380    315   2e-103   
ref|XP_006397987.1|  hypothetical protein EUTSA_v10001598mg             315   2e-103   
gb|KFK37544.1|  hypothetical protein AALP_AA4G270700                    315   2e-103   
ref|XP_010518510.1|  PREDICTED: uncharacterized protein LOC104793780    314   4e-103   
gb|KGN65205.1|  hypothetical protein Csa_1G264560                       311   1e-101   
ref|XP_008443914.1|  PREDICTED: uncharacterized protein LOC103487393    310   1e-101   
ref|XP_006294881.1|  hypothetical protein CARUB_v10023930mg             310   2e-101   
gb|AFK47429.1|  unknown                                                 309   5e-101   
ref|XP_003609496.1|  hypothetical protein MTR_4g116350                  308   9e-101   
ref|XP_002880333.1|  hypothetical protein ARALYDRAFT_483982             306   2e-100   
ref|XP_004146707.1|  PREDICTED: uncharacterized protein LOC101216098    306   6e-100   
ref|NP_566113.1|  chlororespiratory reduction 6                         306   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003541494.1|  PREDICTED: uncharacterized protein LOC100810072    304   4e-99    
ref|NP_001236201.1|  uncharacterized protein LOC100526934               304   5e-99    
gb|AFK45942.1|  unknown                                                 303   7e-99    
gb|KHN47131.1|  hypothetical protein glysoja_022432                     297   6e-97    
ref|XP_004972750.1|  PREDICTED: uncharacterized protein LOC101779386    296   9e-96    
ref|XP_010927346.1|  PREDICTED: uncharacterized protein LOC105049414    292   8e-95    
ref|XP_009407363.1|  PREDICTED: uncharacterized protein LOC103990061    289   2e-93    
ref|XP_010687776.1|  PREDICTED: uncharacterized protein LOC104901846    289   9e-93    
ref|XP_006843798.1|  hypothetical protein AMTR_s00007p00251190          286   2e-92    
ref|NP_001061079.1|  Os08g0167500                                       287   2e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659871.1|  PREDICTED: uncharacterized protein LOC102706590    283   3e-91    
ref|XP_002462363.1|  hypothetical protein SORBIDRAFT_02g024420          283   9e-91    Sorghum bicolor [broomcorn]
dbj|BAJ85020.1|  predicted protein                                      282   2e-90    
ref|NP_001143060.1|  uncharacterized protein LOC100275531               282   2e-90    Zea mays [maize]
ref|NP_973713.1|  chlororespiratory reduction 6                         278   8e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609497.1|  hypothetical protein MTR_4g116350                  278   1e-89    
ref|XP_003573432.1|  PREDICTED: uncharacterized protein LOC100826985    280   2e-89    
ref|NP_001141945.1|  uncharacterized protein LOC100274094               278   1e-88    Zea mays [maize]
ref|XP_008813148.1|  PREDICTED: uncharacterized protein LOC103723854    272   2e-86    
gb|EMT06357.1|  hypothetical protein F775_08951                         273   2e-86    
gb|EMS53871.1|  hypothetical protein TRIUR3_09163                       258   9e-81    
gb|KHG21346.1|  Endonuclease V                                          240   1e-75    
gb|AFW61122.1|  hypothetical protein ZEAMMB73_152027                    221   5e-68    
ref|XP_010241962.1|  PREDICTED: uncharacterized protein LOC104586...    220   2e-67    
ref|XP_010241960.1|  PREDICTED: uncharacterized protein LOC104586...    220   2e-67    
gb|ACF87295.1|  unknown                                                 219   3e-67    Zea mays [maize]
ref|XP_006453725.1|  hypothetical protein CICLE_v10009248mg             214   1e-64    
ref|XP_002968466.1|  hypothetical protein SELMODRAFT_89955              204   2e-61    
ref|XP_002970640.1|  hypothetical protein SELMODRAFT_93194              204   3e-61    
ref|XP_001773409.1|  predicted protein                                  196   5e-58    
ref|XP_002443922.1|  hypothetical protein SORBIDRAFT_07g004440          190   3e-55    Sorghum bicolor [broomcorn]
ref|WP_015194536.1|  protein of unknown function DUF1817                165   3e-46    
ref|WP_016950237.1|  hypothetical protein                               165   3e-46    
ref|WP_015180582.1|  hypothetical protein                               163   1e-45    
ref|WP_026099104.1|  hypothetical protein                               162   4e-45    
ref|WP_013189916.1|  hypothetical protein                               162   5e-45    
ref|WP_015214173.1|  protein of unknown function DUF1817                160   2e-44    
ref|WP_017714124.1|  hypothetical protein                               159   4e-44    
ref|WP_015209649.1|  hypothetical protein                               160   4e-44    
ref|WP_028083988.1|  hypothetical protein                               159   4e-44    
ref|WP_039201350.1|  hypothetical protein                               159   4e-44    
ref|WP_027401722.1|  hypothetical protein                               159   6e-44    
ref|WP_029636387.1|  hypothetical protein [                             159   6e-44    
ref|WP_026719968.1|  hypothetical protein                               159   6e-44    
ref|WP_019507614.1|  hypothetical protein                               158   1e-43    
ref|WP_009630909.1|  hypothetical protein                               157   2e-43    
ref|WP_008186432.1|  hypothetical protein                               158   2e-43    
ref|WP_016872678.1|  hypothetical protein                               157   2e-43    
ref|WP_015083114.1|  hypothetical protein                               157   2e-43    
ref|WP_037216183.1|  hypothetical protein                               157   3e-43    
ref|WP_006631999.1|  hypothetical protein                               157   3e-43    
ref|WP_015179478.1|  protein of unknown function DUF1817                157   3e-43    
ref|WP_017296008.1|  hypothetical protein                               157   3e-43    
ref|WP_006277118.1|  hypothetical protein                               156   8e-43    
ref|WP_039748768.1|  hypothetical protein                               155   9e-43    
gb|EKQ69676.1|  hypothetical protein OsccyDRAFT_2317                    156   1e-42    
ref|WP_015111941.1|  hypothetical protein                               155   1e-42    
ref|WP_036530487.1|  hypothetical protein                               155   2e-42    
ref|WP_036616572.1|  hypothetical protein                               155   2e-42    
ref|WP_009459438.1|  hypothetical protein                               155   2e-42    
ref|WP_015145884.1|  hypothetical protein                               155   2e-42    
ref|WP_028090849.1|  hypothetical protein                               155   2e-42    
ref|WP_015954406.1|  hypothetical protein                               154   3e-42    
ref|WP_012411315.1|  hypothetical protein                               155   3e-42    
ref|WP_015128076.1|  hypothetical protein                               154   3e-42    
ref|WP_015196559.1|  hypothetical protein                               154   3e-42    
ref|WP_016867022.1|  hypothetical protein                               154   3e-42    
ref|WP_016871401.1|  hypothetical protein                               154   4e-42    
ref|WP_009342725.1|  hypothetical protein                               154   6e-42    
ref|WP_023065290.1|  hypothetical protein                               154   6e-42    
ref|WP_017322417.1|  hypothetical protein                               154   6e-42    
ref|WP_015173061.1|  hypothetical protein                               153   8e-42    
ref|WP_006105681.1|  hypothetical protein                               153   8e-42    
ref|WP_041035946.1|  hypothetical protein                               153   1e-41    
ref|WP_015140048.1|  hypothetical protein                               153   1e-41    
ref|WP_017298125.1|  hypothetical protein                               152   2e-41    
ref|WP_036477050.1|  hypothetical protein                               152   3e-41    
ref|WP_027842981.1|  hypothetical protein                               152   3e-41    
ref|WP_009784176.1|  hypothetical protein                               152   4e-41    
ref|WP_007357170.1|  MULTISPECIES: hypothetical protein                 152   4e-41    
ref|WP_011610449.1|  hypothetical protein                               151   5e-41    
ref|WP_006511925.1|  hypothetical protein                               151   5e-41    
ref|WP_011319198.1|  hypothetical protein                               151   5e-41    
ref|WP_026796843.1|  hypothetical protein                               151   6e-41    
ref|WP_010999293.1|  hypothetical protein                               150   1e-40    
ref|WP_035999280.1|  hypothetical protein                               150   1e-40    
gb|KEI67783.1|  hypothetical protein A19Y_2933                          150   1e-40    
ref|WP_016859816.1|  hypothetical protein                               150   1e-40    
ref|WP_026736512.1|  hypothetical protein                               150   1e-40    
ref|WP_015203012.1|  hypothetical protein                               150   2e-40    
ref|WP_014274929.1|  hypothetical protein                               149   3e-40    
ref|WP_039729456.1|  hypothetical protein                               149   3e-40    
gb|KIJ82873.1|  hypothetical protein SD80_14430                         149   4e-40    
ref|WP_038331117.1|  hypothetical protein                               149   5e-40    
gb|KIE13309.1|  hypothetical protein DA73_0208105                       149   5e-40    
ref|WP_015189115.1|  protein of unknown function DUF1817                149   5e-40    
ref|WP_035736296.1|  hypothetical protein                               149   5e-40    
ref|WP_026788341.1|  MULTISPECIES: hypothetical protein                 149   6e-40    
ref|WP_006195352.1|  hypothetical protein                               148   1e-39    
ref|WP_015153493.1|  hypothetical protein                               147   1e-39    
ref|WP_039715757.1|  hypothetical protein                               147   2e-39    
ref|WP_015118041.1|  hypothetical protein                               147   2e-39    
ref|WP_006668044.1|  hypothetical protein                               147   2e-39    
ref|WP_006620786.1|  MULTISPECIES: hypothetical protein                 147   2e-39    
ref|WP_013323654.1|  hypothetical protein                               147   2e-39    
ref|WP_012628714.1|  hypothetical protein                               147   3e-39    
ref|WP_017652680.1|  hypothetical protein                               146   5e-39    
ref|WP_017313060.1|  hypothetical protein                               146   5e-39    
ref|WP_040929998.1|  hypothetical protein                               146   6e-39    
ref|WP_017314472.1|  hypothetical protein                               145   7e-39    
ref|WP_015221066.1|  hypothetical protein                               145   1e-38    
gb|EYU25277.1|  hypothetical protein MIMGU_mgv11b023065mg               144   2e-38    
ref|WP_017746809.1|  hypothetical protein                               145   2e-38    
ref|WP_017324362.1|  hypothetical protein                               145   2e-38    
ref|WP_015224811.1|  hypothetical protein                               144   2e-38    
ref|WP_008272700.1|  hypothetical protein                               144   3e-38    
ref|WP_008227447.1|  expressed protein                                  144   3e-38    
ref|WP_017663680.1|  hypothetical protein                               144   3e-38    
ref|WP_015151097.1|  hypothetical protein                               144   3e-38    
ref|WP_038015865.1|  hypothetical protein                               144   4e-38    
gb|EDX87864.1|  conserved domain protein                                144   4e-38    Synechococcus sp. PCC 7335
ref|WP_022605158.1|  hypothetical protein                               144   4e-38    
ref|WP_035985631.1|  hypothetical protein                               143   6e-38    
ref|WP_010871386.1|  hypothetical protein                               143   8e-38    
ref|WP_008231398.1|  expressed protein                                  142   1e-37    
ref|WP_035157715.1|  hypothetical protein                               142   2e-37    
ref|WP_015166679.1|  hypothetical protein                               142   2e-37    
ref|WP_019500379.1|  hypothetical protein                               141   4e-37    
ref|WP_019493241.1|  hypothetical protein                               141   4e-37    
ref|WP_027268969.1|  hypothetical protein                               140   6e-37    
ref|WP_028947954.1|  hypothetical protein                               140   7e-37    
ref|WP_015166888.1|  hypothetical protein                               140   9e-37    
ref|WP_015162687.1|  hypothetical protein                               140   1e-36    
ref|WP_009544716.1|  MULTISPECIES: hypothetical protein                 140   1e-36    
ref|WP_007304396.1|  hypothetical protein                               139   2e-36    
ref|WP_031291690.1|  hypothetical protein                               139   3e-36    
ref|WP_006527312.1|  hypothetical protein                               138   6e-36    
ref|WP_012595026.1|  MULTISPECIES: hypothetical protein                 137   1e-35    
gb|ESA38266.1|  hypothetical protein N836_33090                         138   2e-35    
ref|WP_015223736.1|  hypothetical protein                               136   3e-35    
ref|WP_017305509.1|  hypothetical protein                               135   4e-35    
ref|WP_006517782.1|  hypothetical protein                               135   4e-35    
ref|WP_011432033.1|  hypothetical protein                               135   8e-35    
ref|WP_011431052.1|  hypothetical protein                               135   9e-35    
ref|WP_024124415.1|  protein of unknown function DUF1817                134   1e-34    
ref|WP_011057132.1|  hypothetical protein                               134   2e-34    
ref|WP_010468660.1|  hypothetical protein                               134   3e-34    
ref|WP_015229224.1|  hypothetical protein                               133   6e-34    
ref|WP_030006971.1|  hypothetical protein                               132   9e-34    
ref|WP_024545643.1|  hypothetical protein                               131   2e-33    
ref|WP_012166459.1|  hypothetical protein                               131   3e-33    
ref|WP_012307260.1|  hypothetical protein                               130   3e-33    
ref|WP_040054310.1|  hypothetical protein                               130   3e-33    
ref|WP_017287899.1|  hypothetical protein                               130   4e-33    
dbj|BAP18434.1|  hypothetical protein ETSB_1722                         130   7e-33    
ref|WP_016516710.1|  hypothetical protein                               129   9e-33    
ref|WP_002738641.1|  hypothetical protein                               129   9e-33    
ref|WP_023172758.1|  hypothetical protein                               129   1e-32    
ref|WP_002786304.1|  hypothetical protein                               129   1e-32    
ref|WP_012954294.1|  hypothetical protein                               128   3e-32    
dbj|GAL94128.1|  hypothetical protein N44_02708                         128   3e-32    
ref|WP_011242755.1|  MULTISPECIES: hypothetical protein                 127   5e-32    
ref|WP_002800953.1|  hypothetical protein                               127   5e-32    
ref|WP_011143485.1|  hypothetical protein                               127   8e-32    
ref|WP_002766360.1|  hypothetical protein                               127   2e-31    
ref|WP_008206060.1|  hypothetical protein                               126   2e-31    
ref|WP_002759148.1|  hypothetical protein                               125   2e-31    
ref|WP_002795611.1|  hypothetical protein                               125   4e-31    
ref|WP_009626619.1|  protein of unknown function DUF1817                124   1e-30    
ref|WP_002781366.1|  hypothetical protein                               123   2e-30    
ref|WP_015135958.1|  hypothetical protein                               123   2e-30    
ref|WP_015123274.1|  hypothetical protein                               120   4e-29    
gb|ABD96319.1|  unknown                                                 101   2e-22    uncultured marine type-A Synechococcus GOM 3O6
gb|ABB92194.1|  hypothetical protein                                    101   3e-22    uncultured marine type-A Synechococcus 4O4
ref|WP_007097408.1|  hypothetical protein                               100   5e-22    
ref|XP_006473931.1|  PREDICTED: uncharacterized protein LOC102613...  99.4    7e-22    
ref|WP_025781608.1|  hypothetical protein                             99.8    1e-21    
ref|WP_006171075.1|  hypothetical protein                             99.8    1e-21    
ref|WP_011128589.1|  hypothetical protein                             99.4    1e-21    
gb|ABB92241.1|  conserved hypothetical protein                        97.8    4e-21    uncultured marine type-A Synechococcus 5B2
ref|YP_002049518.1|  hypothetical protein PCC_0899                    98.2    5e-21    Paulinella chromatophora
ref|WP_009789290.1|  hypothetical protein                             97.4    6e-21    
ref|WP_010316588.1|  hypothetical protein                             97.8    6e-21    
gb|ABD96472.1|  unknown                                               97.1    9e-21    uncultured marine type-A Synechococcus GOM 5D20
ref|WP_011360395.1|  hypothetical protein                             96.3    2e-20    
gb|ABD96367.1|  unknown                                               95.1    5e-20    uncultured marine type-A Synechococcus GOM 3O12
ref|WP_038556234.1|  hypothetical protein                             94.7    7e-20    
gb|AII47268.1|  hypothetical protein KR49_12790                       94.7    7e-20    
ref|WP_006910187.1|  hypothetical protein                             94.4    8e-20    
gb|ABD96265.1|  unknown                                               94.0    1e-19    uncultured marine type-A Synechococcus GOM 3M9
ref|WP_015107709.1|  hypothetical protein                             93.6    2e-19    
ref|WP_011935993.1|  hypothetical protein                             93.2    2e-19    
ref|WP_038543718.1|  hypothetical protein                             92.8    2e-19    
ref|WP_011619894.1|  hypothetical protein                             93.2    3e-19    
ref|WP_007101958.1|  hypothetical protein                             92.8    3e-19    
ref|WP_011363737.1|  hypothetical protein                             91.7    6e-19    
ref|XP_002325174.2|  hypothetical protein POPTR_0018s12350g           88.6    1e-18    Populus trichocarpa [western balsam poplar]
ref|WP_028951499.1|  hypothetical protein                             90.5    2e-18    
ref|WP_029552879.1|  hypothetical protein                             89.4    4e-18    
gb|AHF64311.1|  hypothetical protein Syncc8109_1967                   89.0    6e-18    
ref|WP_006853359.1|  hypothetical protein                             89.0    7e-18    
ref|WP_035829206.1|  hypothetical protein                             89.0    8e-18    
ref|WP_006043637.1|  hypothetical protein                             86.3    6e-17    
ref|WP_011932578.1|  hypothetical protein                             85.5    1e-16    
emb|CCQ66725.1|  hypothetical protein CWATWH0402_3406                 63.9    1e-09    



>ref|XP_004242717.1| PREDICTED: uncharacterized protein LOC101254005 [Solanum lycopersicum]
Length=251

 Score =   368 bits (944),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 207/250 (83%), Gaps = 7/250 (3%)
 Frame = -3

Query  909  MASIR--HTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
            MAS R  HTLSS+ LKQ IPSL P    S K N        +  S    A F   V+FNP
Sbjct  1    MASTRPLHTLSST-LKQTIPSLVPLINISHKSNSISFTFSSSSSSSRQFATF---VSFNP  56

Query  735  SGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKP  556
            SGNFDLSLYDD+ NIE A PPMPP+EGRYEVVI+ D+I+ LDLSPFQNATGI+SP  AKP
Sbjct  57   SGNFDLSLYDDQENIEVAPPPMPPSEGRYEVVIDNDIIQRLDLSPFQNATGISSPLSAKP  116

Query  555  KDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYA  376
            K+F+ERTIGFTIN+KRED+YDPRELSEFP+IRLWFVRLDATYPWLP+LLDWRAGELARYA
Sbjct  117  KEFMERTIGFTINYKREDKYDPRELSEFPDIRLWFVRLDATYPWLPILLDWRAGELARYA  176

Query  375  AMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAI  196
            AMLVPHQM+MK+GVVFNPEALELFVM KVF+VYSWLKQ+   P PRLKTKDMARMLGF I
Sbjct  177  AMLVPHQMSMKMGVVFNPEALELFVMNKVFVVYSWLKQN-EIPMPRLKTKDMARMLGFGI  235

Query  195  GDELFDLIDK  166
            GDELFDLIDK
Sbjct  236  GDELFDLIDK  245



>ref|XP_006359544.1| PREDICTED: uncharacterized protein LOC102595808 [Solanum tuberosum]
Length=249

 Score =   367 bits (942),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 190/250 (76%), Positives = 210/250 (84%), Gaps = 9/250 (4%)
 Frame = -3

Query  909  MASIR--HTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
            MAS R  HTLSS+ LKQ IPSL P+   S K N S S   P+  SL   A F   V+FNP
Sbjct  1    MASTRPLHTLSST-LKQTIPSLVPFIINSHKSN-SISFTFPSS-SLRQVATF---VSFNP  54

Query  735  SGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKP  556
            SGNFDLSLYDD+ NIE A PPMPP+EGRYEVVI+  +I+ LDLSPFQNATGI+SP  AKP
Sbjct  55   SGNFDLSLYDDQENIEVAPPPMPPSEGRYEVVIDNGIIQHLDLSPFQNATGISSPLSAKP  114

Query  555  KDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYA  376
            K+F+ERTIGFTIN+KRED+YD RELSEFP+IRLWFVRLDATYPWLP+LLDWRAGELARYA
Sbjct  115  KEFMERTIGFTINYKREDKYDLRELSEFPDIRLWFVRLDATYPWLPILLDWRAGELARYA  174

Query  375  AMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAI  196
            AMLVPHQM+MK+GVVFNPEALELFVM KVF+VYSWLKQ+   P PRLKTKDMARMLGF I
Sbjct  175  AMLVPHQMSMKMGVVFNPEALELFVMNKVFVVYSWLKQN-EIPMPRLKTKDMARMLGFGI  233

Query  195  GDELFDLIDK  166
            GDELFDLIDK
Sbjct  234  GDELFDLIDK  243



>ref|XP_009804618.1| PREDICTED: uncharacterized protein LOC104249821 [Nicotiana sylvestris]
Length=262

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 206/252 (82%), Gaps = 5/252 (2%)
 Frame = -3

Query  909  MASIR--HTLSSSPLKQHIPSLTPYTTTSCKHNFSYS-KLCPAHLSLHAHAPFSCSVAFN  739
            MAS +  HTLSS PLKQ IPS  P  +     +FS S                + SVAFN
Sbjct  8    MASTKPLHTLSS-PLKQTIPSFVPLISYKPNSDFSISFTSSSQVNQQSQLRQVAASVAFN  66

Query  738  PSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            PSGNFDLSLYD++ N E A PPMPPTEGRYEVVI+ D+I+ LDLSPFQNATG++SP  AK
Sbjct  67   PSGNFDLSLYDEQENTEVAPPPMPPTEGRYEVVIDNDIIQRLDLSPFQNATGLSSPLSAK  126

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK+F+ERTIGFTIN+KRED+YDPRELSEFP+IRLWF+RLDATYPWLPVLLDWRAGELARY
Sbjct  127  PKEFLERTIGFTINYKREDKYDPRELSEFPDIRLWFIRLDATYPWLPVLLDWRAGELARY  186

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQM+MK+GVVFNPEALELFVM KVF+VYSWLKQ+   P PRLKTKDMARMLGF 
Sbjct  187  AAMLVPHQMSMKMGVVFNPEALELFVMNKVFVVYSWLKQN-EIPMPRLKTKDMARMLGFG  245

Query  198  IGDELFDLIDKY  163
            IGDELFDLIDK+
Sbjct  246  IGDELFDLIDKH  257



>ref|XP_009606794.1| PREDICTED: uncharacterized protein LOC104101087 [Nicotiana tomentosiformis]
Length=258

 Score =   350 bits (897),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 204/255 (80%), Gaps = 8/255 (3%)
 Frame = -3

Query  909  MASIR--HTLSSSPLKQHIPSLTP---YTTTSCKHNFSYSKLCPAHLSLHAH-APFSCSV  748
            MAS +  HTLSS PLKQ IP+  P   Y   S       S    + ++  +     +  V
Sbjct  1    MASTKPLHTLSS-PLKQTIPAFVPLISYKPNSDFSTSFTSSSSSSQVNQESQLRQVAVFV  59

Query  747  AFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPS  568
            AFNPSGNFDL LYD++ N E A PPMPPTEGRYEVVI+ D+IR LDLSPFQ ATG++SP 
Sbjct  60   AFNPSGNFDLPLYDEQENTEVAPPPMPPTEGRYEVVIDNDIIRRLDLSPFQIATGLSSPL  119

Query  567  HAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGEL  388
             AKPK+F+ERTIGFTIN+ +ED+YDPRELSEFP+IRLWFVRLDATYPWLPVLLDWRAGEL
Sbjct  120  SAKPKEFLERTIGFTINYAKEDKYDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGEL  179

Query  387  ARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARML  208
            ARYAAMLVPHQM+MK+GVVFNPEALELFVM KVF+VYSWLKQ+   P PRLKTKDMARML
Sbjct  180  ARYAAMLVPHQMSMKMGVVFNPEALELFVMNKVFVVYSWLKQN-EIPMPRLKTKDMARML  238

Query  207  GFAIGDELFDLIDKY  163
            GF IGDELFDLIDK+
Sbjct  239  GFGIGDELFDLIDKH  253



>ref|XP_002268060.1| PREDICTED: uncharacterized protein LOC100255118 [Vitis vinifera]
 emb|CAN77780.1| hypothetical protein VITISV_004173 [Vitis vinifera]
Length=254

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 198/239 (83%), Gaps = 5/239 (2%)
 Frame = -3

Query  870  KQHIPSLTPYTTTSCKHNF-SYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENN  694
            K  IPS +P+    CK  F S   L  +HL+       + SVAFNPSGNFDLS+YDDE++
Sbjct  17   KHAIPSPSPWIF--CKPTFDSTVSLSMSHLNRLPRL-VAVSVAFNPSGNFDLSIYDDEDD  73

Query  693  IERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINF  514
              + +PPMPPTEGR EVVI+ DVIR LDLSPF  ATGITSPS A+PK+F+ERTIGFTIN+
Sbjct  74   STKVSPPMPPTEGRIEVVIDNDVIRRLDLSPFHTATGITSPSSAEPKEFLERTIGFTINY  133

Query  513  KREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGV  334
             RED +DPRELSEFP+IRLWFVRLDATYPWLPV+LDWRAGELARY AMLVPHQMNM++GV
Sbjct  134  TREDPHDPRELSEFPDIRLWFVRLDATYPWLPVVLDWRAGELARYTAMLVPHQMNMRMGV  193

Query  333  VFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPL  157
            VFNPEALELF+MKKVF+VYSWLKQH   P PRLKT DMARMLGF IGDELFDLID++PL
Sbjct  194  VFNPEALELFIMKKVFVVYSWLKQH-KIPKPRLKTSDMARMLGFGIGDELFDLIDQHPL  251



>emb|CBI25580.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   343 bits (881),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGI  580
            + SVAFNPSGNFDLS+YDDE++  + +PPMPPTEGR EVVI+ DVIR LDLSPF  ATGI
Sbjct  12   AVSVAFNPSGNFDLSIYDDEDDSTKVSPPMPPTEGRIEVVIDNDVIRRLDLSPFHTATGI  71

Query  579  TSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWR  400
            TSPS A+PK+F+ERTIGFTIN+ RED +DPRELSEFP+IRLWFVRLDATYPWLPV+LDWR
Sbjct  72   TSPSSAEPKEFLERTIGFTINYTREDPHDPRELSEFPDIRLWFVRLDATYPWLPVVLDWR  131

Query  399  AGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDM  220
            AGELARY AMLVPHQMNM++GVVFNPEALELF+MKKVF+VYSWLKQH   P PRLKT DM
Sbjct  132  AGELARYTAMLVPHQMNMRMGVVFNPEALELFIMKKVFVVYSWLKQH-KIPKPRLKTSDM  190

Query  219  ARMLGFAIGDELFDLIDKYPL  157
            ARMLGF IGDELFDLID++PL
Sbjct  191  ARMLGFGIGDELFDLIDQHPL  211



>ref|XP_007202935.1| hypothetical protein PRUPE_ppa016750mg [Prunus persica]
 gb|EMJ04134.1| hypothetical protein PRUPE_ppa016750mg [Prunus persica]
Length=253

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/255 (68%), Positives = 205/255 (80%), Gaps = 7/255 (3%)
 Frame = -3

Query  909  MASIRHTL---SSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFN  739
            MA+I  TL    SS  +Q I S  P+T      + S + L  ++L+       + SVAFN
Sbjct  1    MAAIFQTLLPICSS--RQAISSPAPWTPLRPPISDSMASLAISNLN-RRQGQVAVSVAFN  57

Query  738  PSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            PSGNFD+SLYD+E +  +  PPMPP+EGR+E+V++ DVIR LDLSPF +ATGIT+PS AK
Sbjct  58   PSGNFDISLYDEEEDTSKVEPPMPPSEGRFEIVLDNDVIRGLDLSPFHSATGITNPSSAK  117

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK+F+ERTIGFTIN+ RED  D RELSEFP+IRLWF+RLDA+YPWLPVLLDWRAGELARY
Sbjct  118  PKEFLERTIGFTINYTREDPRDLRELSEFPDIRLWFLRLDASYPWLPVLLDWRAGELARY  177

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQMNM++GVVFNPEALELFVM+KVFIVYSWLKQH   P PRLKT DMARMLGF 
Sbjct  178  AAMLVPHQMNMRMGVVFNPEALELFVMQKVFIVYSWLKQH-DIPKPRLKTSDMARMLGFG  236

Query  198  IGDELFDLIDKYPLE  154
            IGDEL+DLIDK+PL+
Sbjct  237  IGDELYDLIDKHPLK  251



>ref|XP_008242911.1| PREDICTED: uncharacterized protein LOC103341207 [Prunus mume]
Length=253

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 205/255 (80%), Gaps = 7/255 (3%)
 Frame = -3

Query  909  MASIRHTLSSSPL---KQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFN  739
            MA+I  TL   P+   +Q I S  P+T      + S + L  ++L+       + SVAFN
Sbjct  1    MAAIFQTLL--PICYSRQAISSPAPWTPLRPPISDSIASLAISNLN-RRQGQVAVSVAFN  57

Query  738  PSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            PSGNFD+SLYD+E +  +  PPMPP+EGR+E+V++ DVIR LDLSPF +ATGIT+PS AK
Sbjct  58   PSGNFDISLYDEEEDTSKVEPPMPPSEGRFEIVLDNDVIRGLDLSPFHSATGITNPSSAK  117

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWF+RLDA+YPWLPVLLDWRAGELARY
Sbjct  118  PKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFLRLDASYPWLPVLLDWRAGELARY  177

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQMN ++GVVFNPEALELFVM+KVFIVYSWLKQH   P PRLKT DMARMLGF 
Sbjct  178  AAMLVPHQMNTRMGVVFNPEALELFVMQKVFIVYSWLKQH-DIPKPRLKTSDMARMLGFG  236

Query  198  IGDELFDLIDKYPLE  154
            IGDEL+DLIDK+PL+
Sbjct  237  IGDELYDLIDKHPLK  251



>emb|CAN72910.1| hypothetical protein VITISV_018847 [Vitis vinifera]
Length=256

 Score =   343 bits (879),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 188/225 (84%), Gaps = 3/225 (1%)
 Frame = -3

Query  828  CKHNF-SYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGR  652
            CK  F S   L  +HL+       + SVAFNPSGNFDLS YDDE++  + +PPMPP EGR
Sbjct  31   CKPTFDSTVSLSXSHLNRLPRL-VAVSVAFNPSGNFDLSJYDDEDDSTKVSPPMPPXEGR  89

Query  651  YEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
             EV I+ DVIR LDLSPF  ATGITSPS A+PK+F+ERTIGFTIN+ RED +DPRELSEF
Sbjct  90   IEVXIDNDVIRRLDLSPFHTATGITSPSSAEPKEFLERTIGFTINYTREDPHDPRELSEF  149

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            P+IRLWFVRLDATYPWLPV+LDWRAGELARY AMLVPHQMNM++GVVFNPEALELF+MKK
Sbjct  150  PDIRLWFVRLDATYPWLPVVLDWRAGELARYTAMLVPHQMNMRMGVVFNPEALELFIMKK  209

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPL  157
            VF+VYSWLKQH   P PRLKT DMARMLGF IGDELFDLID++PL
Sbjct  210  VFVVYSWLKQH-KIPKPRLKTSDMARMLGFGIGDELFDLIDQHPL  253



>ref|XP_009338405.1| PREDICTED: uncharacterized protein LOC103930756 [Pyrus x bretschneideri]
Length=254

 Score =   340 bits (871),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 198/255 (78%), Gaps = 12/255 (5%)
 Frame = -3

Query  915  FPMASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
             P+ S R T+ SSP     PS  P    S     S + L  +  +       + SVAFNP
Sbjct  9    LPLCSSRQTILSSP-----PSWIPLKPISD----SMASLAISQFN-RQQGQVAVSVAFNP  58

Query  735  SGNFDLSLYDDENNIE-RAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            SGNFD+SLYD+E +   +  PPMPP+EGR+E+VI+ DVIR LDLSPF  ATGIT PS AK
Sbjct  59   SGNFDISLYDEEEDTSSKVEPPMPPSEGRFEIVIDNDVIRGLDLSPFHTATGITIPSSAK  118

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWF+RLDA YPWLPVLLDWRAGELARY
Sbjct  119  PKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFLRLDAAYPWLPVLLDWRAGELARY  178

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQMNM++GVVFNPEALELFVM+KVF+VYSWLK+H   P PRLKT DMARMLGF 
Sbjct  179  AAMLVPHQMNMRMGVVFNPEALELFVMQKVFVVYSWLKEH-DIPKPRLKTSDMARMLGFG  237

Query  198  IGDELFDLIDKYPLE  154
            IGDEL+DLIDK+PL+
Sbjct  238  IGDELYDLIDKHPLK  252



>ref|XP_004287237.1| PREDICTED: uncharacterized protein LOC101296995 [Fragaria vesca 
subsp. vesca]
Length=251

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 201/255 (79%), Gaps = 11/255 (4%)
 Frame = -3

Query  909  MASIRHTL----SSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAF  742
            MA++  TL    SSS  +Q+     P+ T S   + S + L  +HL        + SVAF
Sbjct  1    MAAVFQTLLPICSSSSSRQN-----PWNTPSRPISDSMASLPISHL-YRQQGQVAVSVAF  54

Query  741  NPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHA  562
            NPSGNFD+SLYDD+ +  +  PPMPP+EGR+E+VI+ DVIR LDL+PF  ATGIT+PS A
Sbjct  55   NPSGNFDISLYDDDEDTSKVEPPMPPSEGRFEIVIDNDVIRRLDLTPFHTATGITNPSSA  114

Query  561  KPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELAR  382
            KPK+++ERTIGFTIN+ RED  DPRELSEFP+IRLWFVRLDA YPWLPVLLDWRAGELAR
Sbjct  115  KPKEYLERTIGFTINYTREDPRDPRELSEFPDIRLWFVRLDAAYPWLPVLLDWRAGELAR  174

Query  381  YAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGF  202
            YAAMLVPHQMNM++GVVFNPEALELFVM+KVF++Y WLKQH   P PRLKT DMARMLGF
Sbjct  175  YAAMLVPHQMNMRMGVVFNPEALELFVMQKVFVIYLWLKQH-NIPKPRLKTSDMARMLGF  233

Query  201  AIGDELFDLIDKYPL  157
             I DEL+DLIDK+P+
Sbjct  234  GIEDELYDLIDKHPI  248



>ref|XP_007013648.1| Chlororespiratory reduction 6 [Theobroma cacao]
 gb|EOY31267.1| Chlororespiratory reduction 6 [Theobroma cacao]
Length=254

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 201/251 (80%), Gaps = 13/251 (5%)
 Frame = -3

Query  903  SIRHTLSSSPLKQHIPSLTPYTTTSCKH-NFSYSKLCPAHLSLHAHAPFSCSVAFNPSGN  727
            S++HT+        IPS TP+   SCK  + S + L     S       + SV+FNPSGN
Sbjct  14   SLKHTI--------IPSSTPWI--SCKPISGSVAALTITRFS-RQRGQVAVSVSFNPSGN  62

Query  726  FDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDF  547
            FDLSLY DE++  +  PP+PP+EGR++VVI+ D IR LDLSPFQ ATGITSPS A+ K+F
Sbjct  63   FDLSLYGDEDDSPQVEPPLPPSEGRFDVVIDNDAIRRLDLSPFQIATGITSPSSAEAKEF  122

Query  546  VERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAML  367
            +ERTIGFTIN+ R+D +DPRELSEFP+IRLWFVRLDATYPWLPVLLDWRAGELARYAAML
Sbjct  123  LERTIGFTINYTRDDPHDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAML  182

Query  366  VPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDE  187
            VPHQM+M++GVVFNPEALELF+MKKVFIVY+WLKQ  G P PRLKT DMARMLGF IGDE
Sbjct  183  VPHQMSMRMGVVFNPEALELFIMKKVFIVYAWLKQQ-GIPKPRLKTSDMARMLGFGIGDE  241

Query  186  LFDLIDKYPLE  154
            LFDLID++ L+
Sbjct  242  LFDLIDQHALD  252



>ref|XP_010049902.1| PREDICTED: uncharacterized protein LOC104438450 [Eucalyptus grandis]
 ref|XP_010049903.1| PREDICTED: uncharacterized protein LOC104438450 [Eucalyptus grandis]
 gb|KCW82729.1| hypothetical protein EUGRSUZ_C04107 [Eucalyptus grandis]
Length=256

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 197/245 (80%), Gaps = 4/245 (2%)
 Frame = -3

Query  888  LSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLY  709
            LS SP++  +PS  P+  +  +   + S L P        A  S SVAFNPSG+FDLSL 
Sbjct  14   LSPSPVRL-LPSSPPWIPS--RPTSTSSTLLPTSRLSERRADVSASVAFNPSGSFDLSLD  70

Query  708  DDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIG  529
             DE +  + APPMPPTEGR+EVVI+ DVIR LDLSPFQ ATGITSP  A+PKD++ERTIG
Sbjct  71   GDEEDSSKIAPPMPPTEGRFEVVIDNDVIRGLDLSPFQVATGITSPLSAEPKDYLERTIG  130

Query  528  FTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMN  349
            F+IN+ RED  DPRELSEFP+IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMN
Sbjct  131  FSINYTREDPGDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMN  190

Query  348  MKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            M++GVVFNPEALELF+M KV +VY+WLK+H   P PRLKT DMARMLGF IGD+LF+LID
Sbjct  191  MRMGVVFNPEALELFIMNKVMVVYTWLKKH-NVPKPRLKTSDMARMLGFGIGDDLFNLID  249

Query  168  KYPLE  154
            ++PL+
Sbjct  250  QHPLD  254



>ref|XP_009358528.1| PREDICTED: uncharacterized protein LOC103949152 [Pyrus x bretschneideri]
Length=254

 Score =   337 bits (863),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 197/255 (77%), Gaps = 12/255 (5%)
 Frame = -3

Query  915  FPMASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
             P+ S R T+ SSP     P   P    S     S + +  +  +       + SVAFNP
Sbjct  9    LPLCSSRQTILSSP-----PPWIPLKPISD----SMASMAISQFN-RQQGQVAVSVAFNP  58

Query  735  SGNFDLSLYDDENNIE-RAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            SGNFD+SLYD+E +   +  PPMPP+EGR+E+VI+ DVIR LDLSPF  ATGIT PS AK
Sbjct  59   SGNFDISLYDEEEDTSSKVEPPMPPSEGRFEIVIDNDVIRGLDLSPFHTATGITIPSSAK  118

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWF+RLDA YPWLPVLLDWRAGELARY
Sbjct  119  PKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFLRLDAAYPWLPVLLDWRAGELARY  178

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQMNM++GVVFNPEALELFVM+KVF+VYSWLK+H   P PRLKT DMARMLGF 
Sbjct  179  AAMLVPHQMNMRMGVVFNPEALELFVMQKVFVVYSWLKEH-DIPKPRLKTSDMARMLGFG  237

Query  198  IGDELFDLIDKYPLE  154
            IGDEL+DLIDK+PL+
Sbjct  238  IGDELYDLIDKHPLK  252



>ref|XP_008367772.1| PREDICTED: uncharacterized protein LOC103431396 [Malus domestica]
Length=254

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 195/254 (77%), Gaps = 12/254 (5%)
 Frame = -3

Query  915  FPMASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
             P+ S R T  SSP    IP L P + +      S +               + SVAFNP
Sbjct  9    LPVCSSRQTXLSSP-PPWIP-LKPISDSMASLAISQAN--------RQQGQVAVSVAFNP  58

Query  735  SGNFDLSLYDDENNIE-RAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            SGNFD+SLYD+E +   +  PPMPP+EGR+E+VI+ DVIR LDLSPF  ATGIT PS AK
Sbjct  59   SGNFDISLYDEEEDTSXKVEPPMPPSEGRFEIVIDNDVIRRLDLSPFHXATGITIPSSAK  118

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWF+RLDA YPWLPVLLDWRAGELARY
Sbjct  119  PKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFLRLDAAYPWLPVLLDWRAGELARY  178

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQMNM++GVVFNPEALELFVM+KVF+VYSWLK+H   P PRLKT DMARMLGF 
Sbjct  179  AAMLVPHQMNMRMGVVFNPEALELFVMQKVFVVYSWLKEH-DIPKPRLKTSDMARMLGFG  237

Query  198  IGDELFDLIDKYPL  157
            IGDEL+DLIDK+PL
Sbjct  238  IGDELYDLIDKHPL  251



>gb|KDP30194.1| hypothetical protein JCGZ_16976 [Jatropha curcas]
Length=256

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 189/238 (79%), Gaps = 2/238 (1%)
 Frame = -3

Query  870  KQHIPSLTPYTTTSCK-HNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENN  694
            KQ   S +P    SCK  + S + L  +          + SVAF+PS NFDLS++DDE++
Sbjct  16   KQTTISTSPIPWISCKPFSDSMANLSVSRFLGRQQGQVAVSVAFDPSRNFDLSIFDDEDD  75

Query  693  IERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINF  514
              + APPMPPTEGR++V I++D+I  LDLSPFQ ATGIT P   +PK+F+ERTIGF+IN+
Sbjct  76   SSKVAPPMPPTEGRFDVAIDDDIIHRLDLSPFQTATGITCPLSVEPKEFLERTIGFSINY  135

Query  513  KREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGV  334
             RED  DPRELSEFP+IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMK+GV
Sbjct  136  TREDPLDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKMGV  195

Query  333  VFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            VFNPEALELF+M KVFIVYSWLKQH   P PRLKT DMARMLGF +GDELFDLID+ P
Sbjct  196  VFNPEALELFIMNKVFIVYSWLKQH-NVPKPRLKTSDMARMLGFGVGDELFDLIDQTP  252



>ref|XP_007155102.1| hypothetical protein PHAVU_003G173400g [Phaseolus vulgaris]
 gb|ESW27096.1| hypothetical protein PHAVU_003G173400g [Phaseolus vulgaris]
Length=249

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 189/234 (81%), Gaps = 2/234 (1%)
 Frame = -3

Query  855  SLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAP  676
            S  P  +TSC  +   S   P    LH   P + SVA+NP GNFDLSL+ D++   + AP
Sbjct  16   SSLPKPSTSCFSSKPISLTSPIPPPLHQRGPAAVSVAYNPQGNFDLSLFPDDDE-PKVAP  74

Query  675  PMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEY  496
            P+PP+EGR+EVVI+ D+I  LDLSPFQ ATG+ SP   KPKDF+ER+IGFTIN+ RED +
Sbjct  75   PLPPSEGRFEVVIDNDIITRLDLSPFQAATGMKSPLSVKPKDFLERSIGFTINYTREDPH  134

Query  495  DPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEA  316
            DPRELSE+P+IR+WFVRLDATYPWLPVLLDWRAGELARYAAM+VPHQMN+K+G+VFNPEA
Sbjct  135  DPRELSEYPDIRVWFVRLDATYPWLPVLLDWRAGELARYAAMMVPHQMNLKMGIVFNPEA  194

Query  315  LELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            LELFVMKKVFIVYSWLK H+  P P+LK  DMARMLGF IGDEL+D +DK+PL+
Sbjct  195  LELFVMKKVFIVYSWLK-HHNIPKPKLKANDMARMLGFRIGDELYDFVDKHPLD  247



>ref|XP_002532510.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29886.1| conserved hypothetical protein [Ricinus communis]
Length=254

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 187/235 (80%), Gaps = 3/235 (1%)
 Frame = -3

Query  870  KQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENNI  691
            KQ +PS +P+ ++    + S   L P    +      + SV+FNPSGNFDLSL++D+ + 
Sbjct  17   KQIVPSTSPWLSSKPITD-SLPNL-PVSCLVRQQGQVAVSVSFNPSGNFDLSLFEDDEDS  74

Query  690  ERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK  511
                P MPPTE R++V I+   I+SLDLSPF NATGIT+P   +PK+F+ERTIGFTIN+ 
Sbjct  75   PNVEPSMPPTEDRFDVAIDNVAIQSLDLSPFNNATGITAPLSVEPKEFLERTIGFTINYT  134

Query  510  REDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVV  331
            RED  DPRELSEFP+IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMK+GVV
Sbjct  135  REDPRDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKMGVV  194

Query  330  FNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FNPEALELFVMKKVFIVYSWLKQH   P PRLKT DMARMLGF IGDELFDLID+
Sbjct  195  FNPEALELFVMKKVFIVYSWLKQH-NIPKPRLKTSDMARMLGFGIGDELFDLIDQ  248



>emb|CDY55524.1| BnaA04g29490D [Brassica napus]
Length=252

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = -3

Query  861  IPSLTPYTTTSCKHNFSYSKLCPAHLSLH---AHAPFSCSVAFNPSGNFDLSLYDDENNI  691
            +P L P ++ +    FS +   P    +    A    S SVAFNPSGNFD+S +D  ++ 
Sbjct  9    LPWLIPSSSATSSPLFSAAVKLPGVWRVRGRKAEKDVSVSVAFNPSGNFDISAFDSHDDT  68

Query  690  ERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK  511
            ++  PPMPPT GRYEVVI+ D I+ LDLSPFQ ATGITSPS A P+++++R+IGFTIN++
Sbjct  69   DKVEPPMPPTSGRYEVVIDNDSIQRLDLSPFQTATGITSPSSADPREYLDRSIGFTINYR  128

Query  510  REDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVV  331
            RED  DPRELSE+P+IRLWFVRLDA YPWLP+LLDWRAGELARYAAMLVPHQM++++GVV
Sbjct  129  REDAGDPRELSEYPDIRLWFVRLDAMYPWLPLLLDWRAGELARYAAMLVPHQMSLRMGVV  188

Query  330  FNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            FNPEALELFVM KVF+VY WLK+H   P PRLKT DMARMLGF IGD+LFDLID+Y L+
Sbjct  189  FNPEALELFVMSKVFVVYPWLKRH-AVPKPRLKTSDMARMLGFGIGDQLFDLIDQYDLQ  246



>ref|XP_009118176.1| PREDICTED: uncharacterized protein LOC103843223 isoform X1 [Brassica 
rapa]
Length=252

 Score =   326 bits (836),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = -3

Query  861  IPSLTPYTTTSCKHNFSYSKLCPAHLSLH---AHAPFSCSVAFNPSGNFDLSLYDDENNI  691
            +P L P ++ +    FS +   P    +    A    S SVAFNPSGNFD+S +D  ++ 
Sbjct  9    LPWLIPSSSATSSPLFSAAVKLPGVWRVKGRKAEKDVSVSVAFNPSGNFDISAFDSHDDT  68

Query  690  ERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK  511
            ++  PPMPPT GRYEVVI+ D I+ LDLSPFQ ATGITSPS A P+++++R+IGFTIN++
Sbjct  69   DKVEPPMPPTSGRYEVVIDNDSIQRLDLSPFQTATGITSPSSADPREYLDRSIGFTINYR  128

Query  510  REDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVV  331
            RED  DPRELSE+P+IRLWFVRLDA YPWLP+LLDWRAGELARYAAMLVPHQM++++GVV
Sbjct  129  REDAGDPRELSEYPDIRLWFVRLDAMYPWLPLLLDWRAGELARYAAMLVPHQMSLRMGVV  188

Query  330  FNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            FNPEALELFVM KVF+VY WLK+H   P PRLKT DMARMLGF IGD+LFDLID+Y L+
Sbjct  189  FNPEALELFVMSKVFVVYPWLKRH-AVPKPRLKTSDMARMLGFGIGDQLFDLIDQYDLQ  246



>gb|EYU25282.1| hypothetical protein MIMGU_mgv1a012629mg [Erythranthe guttata]
Length=245

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 192/239 (80%), Gaps = 6/239 (3%)
 Frame = -3

Query  882  SSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDD  703
            S PLKQ+    TP + +  + +FS S+   +  SL   A    SV+FNPSGN DLSLYD 
Sbjct  12   SCPLKQYCSFQTPKSYS--EFHFSSSEFFHSKQSLRQVA---VSVSFNPSGNLDLSLYDQ  66

Query  702  ENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFT  523
            + +  + APPMPP EGRYEVVI+ D+I  LDLSPF +ATGITS +  KPK+ +ERTIGFT
Sbjct  67   DQDAGKPAPPMPPKEGRYEVVIDNDIIARLDLSPFHSATGITSSNSVKPKELLERTIGFT  126

Query  522  INFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMK  343
            IN++REDE DPRELSE+P+IRLWFVR+DA YPWLPV+LDWRAGELARYAAMLVPHQM+M+
Sbjct  127  INYRREDENDPRELSEYPDIRLWFVRVDAMYPWLPVVLDWRAGELARYAAMLVPHQMSMR  186

Query  342  LGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            +GVVFNPEALELFV++KVF+VY WLK++   P PRLK KDMARMLGF IGD+LFDLIDK
Sbjct  187  MGVVFNPEALELFVVQKVFVVYKWLKEN-DIPMPRLKAKDMARMLGFGIGDDLFDLIDK  244



>ref|XP_010545053.1| PREDICTED: uncharacterized protein LOC104817530 [Tarenaya hassleriana]
Length=248

 Score =   324 bits (831),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 188/242 (78%), Gaps = 10/242 (4%)
 Frame = -3

Query  885  SSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYD  706
            S  P  +H+P L P T        +  K             F+ SVAFNPSGNF+LS +D
Sbjct  13   SLRPSPKHVP-LFPLTGPGSSLRLARRK--------EKRQDFALSVAFNPSGNFNLSPFD  63

Query  705  DENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGF  526
             E++  R APPMPP EGR+EV+I+ + ++ LDLSPFQ ATGIT PS AKPK+F+ERTIGF
Sbjct  64   YEDDSNRVAPPMPPVEGRFEVIIDNNSVQRLDLSPFQTATGITLPSSAKPKEFLERTIGF  123

Query  525  TINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNM  346
            TIN++R +  DPRELSEFPEIRLWFVRLDA YPWLPVLLDWRAGELARYAAMLVPHQM++
Sbjct  124  TINYERGEAEDPRELSEFPEIRLWFVRLDALYPWLPVLLDWRAGELARYAAMLVPHQMSL  183

Query  345  KLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            ++GVVFNPEALELFVMKKVF+VYSWLKQH   P PRLKT DMARMLGF +GDELFDLID+
Sbjct  184  RMGVVFNPEALELFVMKKVFVVYSWLKQH-DVPKPRLKTGDMARMLGFGVGDELFDLIDQ  242

Query  165  YP  160
             P
Sbjct  243  DP  244



>ref|XP_010098973.1| hypothetical protein L484_025633 [Morus notabilis]
 gb|EXB76275.1| hypothetical protein L484_025633 [Morus notabilis]
Length=256

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 186/239 (78%), Gaps = 8/239 (3%)
 Frame = -3

Query  858  PSLTPYTTT------SCKHNF-SYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDE  700
            PSL   T++      SCK +  S   L    LS         SVAFNPSGN+DLSL+DDE
Sbjct  14   PSLNKVTSSPTISWISCKTSSDSMPSLDINSLSKRQRGEVLVSVAFNPSGNYDLSLFDDE  73

Query  699  NNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTI  520
            ++  +  PP+PPTEGR+E+VIN ++I  LDLSPFQ  TGITSPS   PK+F+ERTIGFTI
Sbjct  74   DDSPKVEPPLPPTEGRFEIVINNNIISRLDLSPFQTVTGITSPSSVDPKEFLERTIGFTI  133

Query  519  NFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKL  340
            N+ RED  D RELSE P+IRLWF+RLDA YPWLPV+LDWRAGELARYAAMLVPHQM+MK+
Sbjct  134  NYIREDPNDIRELSEIPDIRLWFLRLDAAYPWLPVVLDWRAGELARYAAMLVPHQMSMKM  193

Query  339  GVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKY  163
            GVVFNPEALELF++ KVFIVYSWLK+H   P PRLKT DMARMLGF IGDELFDLIDK+
Sbjct  194  GVVFNPEALELFILHKVFIVYSWLKEHE-IPRPRLKTGDMARMLGFGIGDELFDLIDKH  251



>ref|XP_006473934.1| PREDICTED: uncharacterized protein LOC102614430 [Citrus sinensis]
Length=258

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 176/208 (85%), Gaps = 4/208 (2%)
 Frame = -3

Query  780  LHAHAP---FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLD  610
            LH++ P    S SVAFNP GNFD+S+++DE N  +  PPMPPTEGR++VV+  D IRSLD
Sbjct  49   LHSNRPRGQISVSVAFNPQGNFDISMFEDEGNSSKLEPPMPPTEGRFDVVLENDAIRSLD  108

Query  609  LSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATY  430
            LSPF +ATGITSP+ A+PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWFVRLDA Y
Sbjct  109  LSPFHSATGITSPTLAEPKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFVRLDAAY  168

Query  429  PWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGT  250
            PWLPVLLDWRAGELARYAAMLVPHQM+MK+G+VFNPEALELF+M KVF+VY+W KQH   
Sbjct  169  PWLPVLLDWRAGELARYAAMLVPHQMSMKMGIVFNPEALELFIMNKVFVVYTWFKQH-NV  227

Query  249  PFPRLKTKDMARMLGFAIGDELFDLIDK  166
              PRLKT DMARMLGF I D LFDL+D+
Sbjct  228  QKPRLKTSDMARMLGFGIEDRLFDLVDR  255



>ref|XP_009118183.1| PREDICTED: uncharacterized protein LOC103843223 isoform X2 [Brassica 
rapa]
Length=250

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 188/239 (79%), Gaps = 6/239 (3%)
 Frame = -3

Query  861  IPSLTPYTTTSCKHNFSYSKLCPAHLSLH---AHAPFSCSVAFNPSGNFDLSLYDDENNI  691
            +P L P ++ +    FS +   P    +    A    S SVAFNPSGNFD+S +D  ++ 
Sbjct  9    LPWLIPSSSATSSPLFSAAVKLPGVWRVKGRKAEKDVSVSVAFNPSGNFDISAFDSHDD-  67

Query  690  ERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK  511
             +  PPMPPT GRYEVVI+ D I+ LDLSPFQ ATGITSPS A P+++++R+IGFTIN++
Sbjct  68   -KVEPPMPPTSGRYEVVIDNDSIQRLDLSPFQTATGITSPSSADPREYLDRSIGFTINYR  126

Query  510  REDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVV  331
            RED  DPRELSE+P+IRLWFVRLDA YPWLP+LLDWRAGELARYAAMLVPHQM++++GVV
Sbjct  127  REDAGDPRELSEYPDIRLWFVRLDAMYPWLPLLLDWRAGELARYAAMLVPHQMSLRMGVV  186

Query  330  FNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            FNPEALELFVM KVF+VY WLK+H   P PRLKT DMARMLGF IGD+LFDLID+Y L+
Sbjct  187  FNPEALELFVMSKVFVVYPWLKRH-AVPKPRLKTSDMARMLGFGIGDQLFDLIDQYDLQ  244



>ref|XP_011020255.1| PREDICTED: uncharacterized protein LOC105122694 [Populus euphratica]
Length=252

 Score =   320 bits (819),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 182/225 (81%), Gaps = 5/225 (2%)
 Frame = -3

Query  831  SCKH-NFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYD-DENNIERAAPPMPPTE  658
            SCK  + S + L  +H        F+ SVAFNPSGNFDL +YD +E++ E   PPMPPTE
Sbjct  27   SCKPISDSVTSLPVSHFRQQGQ--FAASVAFNPSGNFDLPIYDGEEDSTEVKPPPMPPTE  84

Query  657  GRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELS  478
            GR+E+VI+ D++R LDLSPF   TG  SPS  +PK+F+ERTIGFTIN+ RED  DPRELS
Sbjct  85   GRFEIVIDNDIVRRLDLSPFHKVTGFVSPSRVEPKEFLERTIGFTINYTREDPMDPRELS  144

Query  477  EFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVM  298
            EFP+IRLWF+RLDA YPWLPVLLDWRAGELARYAAMLVPHQ+NMKLGVVFNPEALELFVM
Sbjct  145  EFPDIRLWFLRLDAAYPWLPVLLDWRAGELARYAAMLVPHQVNMKLGVVFNPEALELFVM  204

Query  297  KKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKY  163
            KKVF+VY WL+Q    P PRLKT DMARMLGF IG+ELFDLID++
Sbjct  205  KKVFVVYFWLQQQ-NVPKPRLKTSDMARMLGFGIGNELFDLIDQH  248



>gb|KDO59318.1| hypothetical protein CISIN_1g025198mg [Citrus sinensis]
Length=256

 Score =   319 bits (818),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 175/208 (84%), Gaps = 4/208 (2%)
 Frame = -3

Query  780  LHAHAP---FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLD  610
            LH++ P    S SVAFNP GNFD+ +++DE N  +  PPMPPTEGR++VV+  D IRSLD
Sbjct  47   LHSNRPRGQISVSVAFNPQGNFDIPMFEDEGNSSKLEPPMPPTEGRFDVVLENDAIRSLD  106

Query  609  LSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATY  430
            LSPF +ATGITSP+ A+PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWFVRLDA Y
Sbjct  107  LSPFHSATGITSPTLAEPKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFVRLDAAY  166

Query  429  PWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGT  250
            PW+PVLLDWRAGELARYAAMLVPHQM+MK+G+VFNPEALELF+M KVF+VY+W KQH   
Sbjct  167  PWIPVLLDWRAGELARYAAMLVPHQMSMKMGIVFNPEALELFIMNKVFVVYTWFKQH-NV  225

Query  249  PFPRLKTKDMARMLGFAIGDELFDLIDK  166
              PRLKT DMARMLGF I D LFDL+D+
Sbjct  226  QKPRLKTSDMARMLGFGIEDRLFDLVDR  253



>emb|CDY27466.1| BnaC04g51070D [Brassica napus]
Length=251

 Score =   319 bits (817),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 176/205 (86%), Gaps = 2/205 (1%)
 Frame = -3

Query  774  AHAPFSCSVAFNPSGNFDLSLYDDEN-NIERAAPPMPPTEGRYEVVINEDVIRSLDLSPF  598
            A    S SVAFNPSGNFD+S +D  + + ++  PPMPPT GRYEVVI+ D I+ LDLSPF
Sbjct  38   AEKDVSVSVAFNPSGNFDISAFDSHDADTDKVEPPMPPTSGRYEVVIDNDSIQRLDLSPF  97

Query  597  QNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLP  418
            Q ATGITSPS A P+++++R+IGFTIN++RED  DPRELSE+P+IRLWFVRLDATYPWLP
Sbjct  98   QTATGITSPSSADPREYLDRSIGFTINYRREDAGDPRELSEYPDIRLWFVRLDATYPWLP  157

Query  417  VLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPR  238
            +LLDWRAGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H   P PR
Sbjct  158  LLLDWRAGELARYAAMLVPHQMSLRMGVVFNPEALELFVMSKVFVVYPWLKRH-AVPKPR  216

Query  237  LKTKDMARMLGFAIGDELFDLIDKY  163
            LKT DMARMLGF IGD+LFDLID+Y
Sbjct  217  LKTSDMARMLGFGIGDQLFDLIDQY  241



>ref|XP_010244869.1| PREDICTED: uncharacterized protein LOC104588577 [Nelumbo nucifera]
Length=250

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  873  LKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENN  694
            LKQ +PSL P+   SCKH  S S    +  +L+     + SVAFNPSGN+DLSLYDDE++
Sbjct  14   LKQSVPSLNPWN--SCKH-ISSSVTFHSISNLNQRHDVAVSVAFNPSGNYDLSLYDDEDD  70

Query  693  IERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINF  514
              +  PPMPPTEGR++VVI+ D+I+ LD+SP  ++   +    A+PK+ +ER +GFTIN+
Sbjct  71   TPKVEPPMPPTEGRFDVVIDNDIIQRLDISPVISSLS-SDGVFAEPKELLERKVGFTINY  129

Query  513  KREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGV  334
             RED YDPRELSEFP++RLWFVRLDA+YPWLPV+LDWRAGELARYAAMLVPHQM+M++GV
Sbjct  130  TREDPYDPRELSEFPDLRLWFVRLDASYPWLPVVLDWRAGELARYAAMLVPHQMSMRMGV  189

Query  333  VFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPL  157
            VFNPEALELF MKK FIVYSWLKQH   P  +LKT+DMARMLGF IGDELFDLID +P+
Sbjct  190  VFNPEALELFAMKKAFIVYSWLKQH-KIPKSKLKTRDMARMLGFGIGDELFDLIDAHPI  247



>emb|CDP10504.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 179/238 (75%), Gaps = 37/238 (16%)
 Frame = -3

Query  771  HAPFSCSVAFNPSGNFDLSLYDDE----------------NNIERAA-------------  679
              P S SVAFNPSGN+DLSLYDD+                +N  R               
Sbjct  51   QGPCSISVAFNPSGNYDLSLYDDDEQAISIFALALLRVLTDNCRRGKGTEQSCSVYLSTI  110

Query  678  -------PPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTI  520
                   PP+PPTEGRYEVVI+ D+IR LDL PFQ+ATGITSPS AKPK+ +ERTIGFT+
Sbjct  111  REQADLPPPIPPTEGRYEVVIDNDIIRRLDLVPFQSATGITSPSDAKPKELLERTIGFTV  170

Query  519  NFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKL  340
            N+ RED+ DPRELSEFP+IRLWFVRLDA YPWLPVLLDWRAGELARYAAMLVPHQM+MK 
Sbjct  171  NYTREDQNDPRELSEFPDIRLWFVRLDAAYPWLPVLLDWRAGELARYAAMLVPHQMSMKK  230

Query  339  GVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            GVVFNPEAL LFVMKKVFIVYSWLK++   P PRLKTKDMARMLGF IG+ELFDLID+
Sbjct  231  GVVFNPEALALFVMKKVFIVYSWLKEN-DIPMPRLKTKDMARMLGFGIGEELFDLIDE  287



>ref|XP_006381064.1| hypothetical protein POPTR_0006s05910g [Populus trichocarpa]
 gb|ERP58861.1| hypothetical protein POPTR_0006s05910g [Populus trichocarpa]
Length=251

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 194/249 (78%), Gaps = 9/249 (4%)
 Frame = -3

Query  900  IRHTLSSSPL-KQHIPSLTPYTTTSCKH-NFSYSKLCPAHLSLHAHAPFSCSVAFNPSGN  727
            I+  L + PL KQ +P  + +   SCK  + S + L  +H        F+ +VAFNPSGN
Sbjct  5    IKPFLPNFPLQKQTLPLNSQWI--SCKPISDSVTTLPVSHFRQQGQ--FAAAVAFNPSGN  60

Query  726  FDLSLYD-DENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKD  550
            FDL +YD +E++ E   PPMPPTEGR+E+VI+ D++R LDLSPF N TG  SPS  K   
Sbjct  61   FDLPIYDGEEDSTEVKPPPMPPTEGRFEIVIDNDIVRRLDLSPFHNVTGFVSPSRGK-HQ  119

Query  549  FVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAM  370
            F+ERTIGFTIN+ RED  DPRELSEFP+IRLWF+RLDATYPWLPVLLDWRAGELARYAAM
Sbjct  120  FLERTIGFTINYTREDPMDPRELSEFPDIRLWFLRLDATYPWLPVLLDWRAGELARYAAM  179

Query  369  LVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGD  190
            LVPHQ+NMKLGVVFNPEALELFVMKKVF+VYSWL+Q    P PRLKT DMARMLGF IG+
Sbjct  180  LVPHQVNMKLGVVFNPEALELFVMKKVFVVYSWLQQQ-NVPKPRLKTSDMARMLGFGIGN  238

Query  189  ELFDLIDKY  163
            ELFDLID++
Sbjct  239  ELFDLIDQH  247



>ref|XP_011084059.1| PREDICTED: uncharacterized protein LOC105166415 [Sesamum indicum]
Length=242

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 194/250 (78%), Gaps = 10/250 (4%)
 Frame = -3

Query  909  MASIRHTLS-SSPLKQ-HIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
            MASIR     S PLKQ   PS +P+      H F  ++L     S+ +  P +  V+FNP
Sbjct  1    MASIRPLYPLSCPLKQPTTPSSSPWLHPKSSH-FPSTQLH----SIQSQRPVAVPVSFNP  55

Query  735  SGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKP  556
            SGN DLSLYD++        P   TEGR EVVI+ D+I  LDLSPF+NATGITSP  AKP
Sbjct  56   SGNLDLSLYDEDAPEAPPPMPP--TEGRCEVVIDNDIITRLDLSPFRNATGITSPDSAKP  113

Query  555  KDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYA  376
            ++F++RTIGFTIN+ REDE+DPRELSEFP+IRLWFVRLDA YPWLPVLLDWRAGELARYA
Sbjct  114  QEFLDRTIGFTINYTREDEHDPRELSEFPDIRLWFVRLDAAYPWLPVLLDWRAGELARYA  173

Query  375  AMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAI  196
            AMLVPHQM+M++GVVFNPEALELFV++KVF+VYSWLK+H   P PRLK KDMARMLGF I
Sbjct  174  AMLVPHQMSMRMGVVFNPEALELFVVQKVFVVYSWLKKH-DVPMPRLKAKDMARMLGFGI  232

Query  195  GDELFDLIDK  166
            GD+LFDL+DK
Sbjct  233  GDDLFDLVDK  242



>ref|XP_004508406.1| PREDICTED: uncharacterized protein LOC101508703 [Cicer arietinum]
Length=248

 Score =   317 bits (811),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 184/227 (81%), Gaps = 5/227 (2%)
 Frame = -3

Query  834  TSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEG  655
            TSC   FS   +    +  H     S  VAFNP GNFD+SL+DD++   +  PPMPPTEG
Sbjct  25   TSC---FSCKPIFDPRVLFHHRPNVSVYVAFNPQGNFDVSLFDDDDE-SKVEPPMPPTEG  80

Query  654  RYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSE  475
            R++V+I+ DVI  LDLS FQ+ATG+ +P   KP++F++R+IGFTIN+ R+D  DPRELSE
Sbjct  81   RFDVLIDNDVIARLDLSSFQSATGMKNPLSVKPQEFLDRSIGFTINYTRQDPRDPRELSE  140

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
            FP+IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMK+GVVFNPEALELFVMK
Sbjct  141  FPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKMGVVFNPEALELFVMK  200

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            KVFIVYSWLK H+  P P+LKT DMARMLGF IGDEL+DL++ +PL+
Sbjct  201  KVFIVYSWLK-HHNIPKPKLKTNDMARMLGFGIGDELYDLLENHPLD  246



>ref|XP_010507833.1| PREDICTED: uncharacterized protein LOC104784504 [Camelina sativa]
Length=247

 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYD-DENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            + SVAFNPSGNFD+S ++ D++ +++  PPMPPT GRYEVVI+ D I  LDLSPFQ ATG
Sbjct  43   AVSVAFNPSGNFDISAFNNDDDTLDKVEPPMPPTTGRYEVVIDNDSIGRLDLSPFQTATG  102

Query  582  ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDW  403
            ITSPS A+PK ++ER+IGF+I +KRED  DPRELSE+PEIRLWFVRLDA YPWLPVLLDW
Sbjct  103  ITSPSSAEPKRYMERSIGFSIKYKREDPRDPRELSEYPEIRLWFVRLDAMYPWLPVLLDW  162

Query  402  RAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKD  223
            RAGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT D
Sbjct  163  RAGELARYAAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKTTD  221

Query  222  MARMLGFAIGDELFDLIDK  166
            MARMLGF IGD+LFDLID+
Sbjct  222  MARMLGFGIGDQLFDLIDQ  240



>ref|XP_006453726.1| hypothetical protein CICLE_v10009248mg [Citrus clementina]
 gb|ESR66966.1| hypothetical protein CICLE_v10009248mg [Citrus clementina]
Length=258

 Score =   317 bits (811),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 175/208 (84%), Gaps = 4/208 (2%)
 Frame = -3

Query  780  LHAHAP---FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLD  610
            LH++ P    S SVAFNP GNFD+ +++DE N  +  PPMPPTEGR++VV++ D IRSLD
Sbjct  49   LHSNRPRGQISVSVAFNPQGNFDIPMFEDEGNSSKLEPPMPPTEGRFDVVLDNDAIRSLD  108

Query  609  LSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATY  430
            LSPF +ATGITSP+ A+PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWFVRLDA Y
Sbjct  109  LSPFHSATGITSPTLAEPKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFVRLDAAY  168

Query  429  PWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGT  250
            PW+PVLLDWRAGELARYAAMLVPHQM+MK+ +VFNPEALELF+M KVF+VY+W KQH   
Sbjct  169  PWIPVLLDWRAGELARYAAMLVPHQMSMKMRIVFNPEALELFIMNKVFVVYTWFKQH-NV  227

Query  249  PFPRLKTKDMARMLGFAIGDELFDLIDK  166
              PRLKT DMARMLGF I D LFDL+D+
Sbjct  228  QKPRLKTSDMARMLGFGIEDRLFDLVDR  255



>ref|XP_010506840.1| PREDICTED: uncharacterized protein LOC104783380 [Camelina sativa]
Length=251

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 174/197 (88%), Gaps = 2/197 (1%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYD-DENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            + SVAFNPSGNFD+S ++ D++++++  PPMPPT GRYEVVI+ D I  LDLSPFQ ATG
Sbjct  43   AVSVAFNPSGNFDISAFNNDDDSVDKVEPPMPPTTGRYEVVIDNDSIGRLDLSPFQTATG  102

Query  582  ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDW  403
            ITSPS A+PK ++ER+IGF+IN+KRED  DPRELSE+PEIRLWFVRLDA YPWLPVLLDW
Sbjct  103  ITSPSSAEPKRYMERSIGFSINYKREDPRDPRELSEYPEIRLWFVRLDAMYPWLPVLLDW  162

Query  402  RAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKD  223
            RAGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT D
Sbjct  163  RAGELARYAAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKTTD  221

Query  222  MARMLGFAIGDELFDLI  172
            MARMLGF IGD+LFDLI
Sbjct  222  MARMLGFGIGDQLFDLI  238



>ref|XP_006397987.1| hypothetical protein EUTSA_v10001598mg [Eutrema salsugineum]
 gb|ESQ39440.1| hypothetical protein EUTSA_v10001598mg [Eutrema salsugineum]
Length=253

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGI  580
            S SV+FNPSGNFD+S ++  ++ E+  PPMPPT GRYEVVI+ + IR LDLSPFQ  TGI
Sbjct  52   SVSVSFNPSGNFDISAFESHDDTEKVEPPMPPTSGRYEVVIDNESIRRLDLSPFQTGTGI  111

Query  579  TSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWR  400
            TSPS A+P++++ERTIGFTIN+KRE+  DPRELSE+P+IRLWFVRLDA YPWLP+LLDWR
Sbjct  112  TSPSRAEPREYLERTIGFTINYKREEAGDPRELSEYPDIRLWFVRLDAMYPWLPLLLDWR  171

Query  399  AGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDM  220
            AGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK H G P PRLKT  M
Sbjct  172  AGELARYAAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKLH-GVPKPRLKTSHM  230

Query  219  ARMLGFAIGDELFDLIDKYP  160
            ARMLGF +GDELFDLID  P
Sbjct  231  ARMLGFGLGDELFDLIDHPP  250



>gb|KFK37544.1| hypothetical protein AALP_AA4G270700 [Arabis alpina]
Length=249

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGI  580
            S SVAFNPSGNFD+S ++ +++ ++  PPMPPT GR+EVVI+ D I  LDLSPFQ ATGI
Sbjct  50   SVSVAFNPSGNFDISAFEADDDRDKVEPPMPPTTGRFEVVIDNDSIGQLDLSPFQTATGI  109

Query  579  TSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWR  400
            TSPS A+PK +++R IGFTIN+ RED  DPRELSE+P+IRLWFVRLDA YPWLPVLLDWR
Sbjct  110  TSPSSAEPKAYLDRIIGFTINYAREDPGDPRELSEYPDIRLWFVRLDAMYPWLPVLLDWR  169

Query  399  AGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDM  220
            AGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT DM
Sbjct  170  AGELARYAAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKTSDM  228

Query  219  ARMLGFAIGDELFDLIDK  166
            ARMLGF IGD+LFDLID+
Sbjct  229  ARMLGFGIGDQLFDLIDQ  246



>ref|XP_010518510.1| PREDICTED: uncharacterized protein LOC104793780 [Camelina sativa]
Length=253

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYD-DENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            + SVAFNPSGNFD+S ++ D++ +++  PPMPPT GRYEVVI+ D I  LDLSPFQ ATG
Sbjct  48   AVSVAFNPSGNFDISAFNNDDDTLDKVEPPMPPTTGRYEVVIDNDSIGRLDLSPFQTATG  107

Query  582  ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDW  403
            ITSPS A+PK ++ER+IGF+I +KRED  DPRELSE+PEIRLWFVRLDA YPWLPVLLDW
Sbjct  108  ITSPSSAEPKRYMERSIGFSIKYKREDPRDPRELSEYPEIRLWFVRLDAMYPWLPVLLDW  167

Query  402  RAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKD  223
            RAGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT D
Sbjct  168  RAGELARYAAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKTTD  226

Query  222  MARMLGFAIGDELFDLIDK  166
            MARMLGF IGD+LFDLID+
Sbjct  227  MARMLGFGIGDQLFDLIDQ  245



>gb|KGN65205.1| hypothetical protein Csa_1G264560 [Cucumis sativus]
Length=254

 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
             S SV+FNPSGNFDLS  DD+++  + APPMPPTEGR++VVI+ D IR LDLS FQ  TG
Sbjct  51   LSASVSFNPSGNFDLSFQDDDDDSSKVAPPMPPTEGRFDVVIDNDAIRCLDLSSFQTTTG  110

Query  582  ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDW  403
            I SP   +PK F+ERTIGFTIN+ RED YD RELSE+P+IRLWFVRLD+ YPWLPVLLDW
Sbjct  111  IVSPLATEPKQFLERTIGFTINYTREDPYDRRELSEYPDIRLWFVRLDSVYPWLPVLLDW  170

Query  402  RAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKD  223
            RAGELARYAAMLVPHQ++M++G+VFNPEALELFVMKKVFIVYSWLKQH   P PRLK  +
Sbjct  171  RAGELARYAAMLVPHQISMRMGIVFNPEALELFVMKKVFIVYSWLKQH-DIPKPRLKAAN  229

Query  222  MARMLGFAIGDELFDLIDKYPL  157
            MARMLGF IGDELFDLID++P+
Sbjct  230  MARMLGFGIGDELFDLIDQHPV  251



>ref|XP_008443914.1| PREDICTED: uncharacterized protein LOC103487393 [Cucumis melo]
Length=251

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -3

Query  771  HAP-FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQ  595
            H P  S SVAFNPSGNFDLS  DD+++  + APPMPPTEGR++VVI+ D IR LDLS FQ
Sbjct  44   HRPQLSASVAFNPSGNFDLSFQDDDDDSPKVAPPMPPTEGRFDVVIDNDAIRCLDLSSFQ  103

Query  594  NATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPV  415
              TGI SP   +PK F+ERTIGFTIN+ RED YD RELSE+P+IRLWFVRLD+ YPWLPV
Sbjct  104  KTTGIISPLATEPKQFLERTIGFTINYTREDPYDRRELSEYPDIRLWFVRLDSVYPWLPV  163

Query  414  LLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRL  235
            LLDWRAGELARYAAMLVPHQ++M++G+VFNPEALELFVMKKVFIVYSWLKQH   P PRL
Sbjct  164  LLDWRAGELARYAAMLVPHQISMRMGIVFNPEALELFVMKKVFIVYSWLKQH-DIPKPRL  222

Query  234  KTKDMARMLGFAIGDELFDLIDKYPL  157
            K  +MARMLGF IGDELFDLID++P+
Sbjct  223  KAANMARMLGFGIGDELFDLIDQHPV  248



>ref|XP_006294881.1| hypothetical protein CARUB_v10023930mg [Capsella rubella]
 gb|EOA27779.1| hypothetical protein CARUB_v10023930mg [Capsella rubella]
Length=246

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 187/250 (75%), Gaps = 23/250 (9%)
 Frame = -3

Query  915  FPMASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNP  736
            FP AS RH  S  P    + +L P+ T   +                     + SVAFNP
Sbjct  13   FPSASPRHVSSLLP----VVALVPFETKKRRAQ-----------------DLAVSVAFNP  51

Query  735  SGNFDLSLYD-DENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAK  559
            SGNF++S +D D++  ++  PPMPP  GRYEVVI+ D I  LDLSPFQ ATGITSPS A+
Sbjct  52   SGNFNISAFDHDDDPSDKVEPPMPPKTGRYEVVIDNDSIARLDLSPFQTATGITSPSLAE  111

Query  558  PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            PK++++R+IGFTI +KRED  DPRELSE+P+IRLWFVRLDA YPWLP+LLDWRAGELARY
Sbjct  112  PKEYLDRSIGFTIKYKREDPGDPRELSEYPDIRLWFVRLDAMYPWLPLLLDWRAGELARY  171

Query  378  AAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFA  199
            AAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT DMARMLGF 
Sbjct  172  AAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKTSDMARMLGFG  230

Query  198  IGDELFDLID  169
            IGD+LFDLID
Sbjct  231  IGDQLFDLID  240



>gb|AFK47429.1| unknown [Lotus japonicus]
Length=252

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 175/211 (83%), Gaps = 4/211 (2%)
 Frame = -3

Query  786  LSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDL  607
            LS   H   + SVAFNP GNFDLSL D ++  E   PPMPP+EGR++V I+ D I  LDL
Sbjct  44   LSQRGHV--AVSVAFNPQGNFDLSLSDYDDAPE-VTPPMPPSEGRFDVFIDNDAITRLDL  100

Query  606  SPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYP  427
            SPFQ+ATG+  P   KPK+F++RTIGFTIN+K+ED  DPRELSEFP+IRLWFVRLDATYP
Sbjct  101  SPFQSATGMKDPLSVKPKEFIDRTIGFTINYKKEDPRDPRELSEFPDIRLWFVRLDATYP  160

Query  426  WLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTP  247
            WLPVLLDWRAGELARYAAMLVPHQMNMK+GVVFNPEALELFVMKKVF+VYSWLK H+  P
Sbjct  161  WLPVLLDWRAGELARYAAMLVPHQMNMKMGVVFNPEALELFVMKKVFVVYSWLK-HHNIP  219

Query  246  FPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
             P LK  +MARMLGF IG+EL+DL++ +PL+
Sbjct  220  KPELKANNMARMLGFGIGNELYDLVENHPLD  250



>ref|XP_003609496.1| hypothetical protein MTR_4g116350 [Medicago truncatula]
 gb|AES91693.1| chlororespiratory reduction protein [Medicago truncatula]
Length=245

 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 174/211 (82%), Gaps = 2/211 (1%)
 Frame = -3

Query  786  LSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDL  607
            +S H     + SVAFNP GNFD+SL+D E++  + +PPMPPTEGR+EVVI+ D I  LDL
Sbjct  35   ISHHQRGNVAVSVAFNPQGNFDVSLFD-EDDESKVSPPMPPTEGRFEVVIDNDAISRLDL  93

Query  606  SPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYP  427
            +PFQ ATG+ +P   +P++F+ER+IGFTIN+ R D  DPRELSE+P+IRLWFVRLDA YP
Sbjct  94   TPFQAATGMKNPLSVRPQEFLERSIGFTINYTRPDPRDPRELSEYPDIRLWFVRLDAAYP  153

Query  426  WLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTP  247
            WLPVLLDWRAGELARYAAMLVPHQMNMK+GVVFNPEALELFVM KVFIVYSWLK H+  P
Sbjct  154  WLPVLLDWRAGELARYAAMLVPHQMNMKMGVVFNPEALELFVMNKVFIVYSWLK-HHNIP  212

Query  246  FPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
             P LK  +MARMLGF IG EL+DL++ +PL+
Sbjct  213  KPELKANNMARMLGFGIGSELYDLVENHPLD  243



>ref|XP_002880333.1| hypothetical protein ARALYDRAFT_483982 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56592.1| hypothetical protein ARALYDRAFT_483982 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   306 bits (785),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 184/234 (79%), Gaps = 10/234 (4%)
 Frame = -3

Query  855  SLTPYTTTSCKHNFSYSKL-CPAH--LSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIER  685
             L P+   S +H   +  +  PA   +S    A  + SVAFNPSGNFD+S   DE+ +E 
Sbjct  6    GLLPWLIPSPRHVSLFPVVQLPAGWCVSKRRAADVAVSVAFNPSGNFDIS---DEDKVE-  61

Query  684  AAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKRE  505
              PPMPPT GRYEVVI+ D I  LDLSPFQ ATGI+SPS A+PK +++RTIGFTI ++RE
Sbjct  62   --PPMPPTTGRYEVVIDNDSIGRLDLSPFQRATGISSPSSAEPKRYLDRTIGFTIKYRRE  119

Query  504  DEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFN  325
            D  DPRELSE+P+IRLWFVRLDA YPWLP+LLDWRAGELARYAAMLVPHQM++++GVVFN
Sbjct  120  DPGDPRELSEYPDIRLWFVRLDAMYPWLPLLLDWRAGELARYAAMLVPHQMSLRMGVVFN  179

Query  324  PEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKY  163
            PEALELFVM KVF+VY WLK+H G P PRLKT DMARMLGF IGDELFDLID +
Sbjct  180  PEALELFVMNKVFVVYPWLKRH-GVPKPRLKTSDMARMLGFGIGDELFDLIDHH  232



>ref|XP_004146707.1| PREDICTED: uncharacterized protein LOC101216098 [Cucumis sativus]
 ref|XP_004162457.1| PREDICTED: uncharacterized protein LOC101227212 [Cucumis sativus]
Length=259

 Score =   306 bits (785),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 174/207 (84%), Gaps = 6/207 (3%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
             S SV+FNPSGNFDLS  DD+++  + APPMPPTEGR++VVI+ D IR LDLS FQ  TG
Sbjct  51   LSASVSFNPSGNFDLSFQDDDDDSSKVAPPMPPTEGRFDVVIDNDAIRCLDLSSFQTTTG  110

Query  582  ITSPSHAK-----PKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLP  418
            I SP  +K     PK F+ERTIGFTIN+ RED YD RELSE+P+IRLWFVRLD+ YPWLP
Sbjct  111  IVSPLASKFWVAEPKQFLERTIGFTINYTREDPYDRRELSEYPDIRLWFVRLDSVYPWLP  170

Query  417  VLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPR  238
            VLLDWRAGELARYAAMLVPHQ++M++G+VFNPEALELFVMKKVFIVYSWLKQH   P PR
Sbjct  171  VLLDWRAGELARYAAMLVPHQISMRMGIVFNPEALELFVMKKVFIVYSWLKQH-DIPKPR  229

Query  237  LKTKDMARMLGFAIGDELFDLIDKYPL  157
            LK  +MARMLGF IGDELFDLID++P+
Sbjct  230  LKAANMARMLGFGIGDELFDLIDQHPV  256



>ref|NP_566113.1| chlororespiratory reduction 6 [Arabidopsis thaliana]
 gb|AAG40058.1|AF324707_1 At2g47910 [Arabidopsis thaliana]
 gb|AAK00386.1|AF339704_1 unknown protein [Arabidopsis thaliana]
 gb|AAC63645.1| expressed protein [Arabidopsis thaliana]
 gb|AAK74050.1| T9J23.7/T9J23.7 [Arabidopsis thaliana]
 gb|AAL06807.1| At2g47910/T9J23.7 [Arabidopsis thaliana]
 gb|AAM15131.1| expressed protein [Arabidopsis thaliana]
 gb|AAM60898.1| unknown [Arabidopsis thaliana]
 gb|AEC10910.1| chlororespiratory reduction 6 [Arabidopsis thaliana]
Length=246

 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 171/200 (86%), Gaps = 4/200 (2%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGI  580
            + SVAFNPSGNFD+S ++++ + ++  PPMPPT GRYEVVI+ D I  LDLSPFQ A GI
Sbjct  45   AVSVAFNPSGNFDISAFENDQDSDKVEPPMPPTTGRYEVVIDNDSIGRLDLSPFQRAIGI  104

Query  579  TSPSH---AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLL  409
            TSP     A+PK +++RTIGFTIN+KRED  DPRELSE+P++RLWFVRLDA YPWLP+LL
Sbjct  105  TSPDDFGVAEPKRYLDRTIGFTINYKREDPGDPRELSEYPDVRLWFVRLDAMYPWLPLLL  164

Query  408  DWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKT  229
            DWRAGELARYAAMLVPHQM++++GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT
Sbjct  165  DWRAGELARYAAMLVPHQMSLRMGVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKT  223

Query  228  KDMARMLGFAIGDELFDLID  169
             DMARMLGF IGDELFDLID
Sbjct  224  SDMARMLGFGIGDELFDLID  243



>ref|XP_003541494.1| PREDICTED: uncharacterized protein LOC100810072 [Glycine max]
Length=248

 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 186/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  855  SLTPYTTTSCKHNFSYSKLCPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAP  676
            S  P  TTS       S   P    ++     + SV++NP GNFDLSL+DD++   +AAP
Sbjct  15   SSLPKPTTSWLFGKPISHPFPNSRPVYQRGNVAISVSYNPQGNFDLSLFDDDDET-KAAP  73

Query  675  PMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEY  496
            P+PPTEGR+EV I+ DVI  LDLSPFQ ATG+ SP   KPK+F+ERTIGFTIN+ RED  
Sbjct  74   PLPPTEGRFEVAIDNDVISRLDLSPFQAATGMKSPLSVKPKEFLERTIGFTINYTREDPR  133

Query  495  DPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEA  316
            DPRELSE+P+IR+WFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMN+K+GVVFNPEA
Sbjct  134  DPRELSEYPDIRVWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNIKMGVVFNPEA  193

Query  315  LELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            LELFVMKKVFIVYSWLK H+  P P+LK  DMARMLGF IGDEL+D IDK+PL+
Sbjct  194  LELFVMKKVFIVYSWLK-HHNIPKPKLKANDMARMLGFTIGDELYDFIDKHPLD  246



>ref|NP_001236201.1| uncharacterized protein LOC100526934 [Glycine max]
 gb|ACU15956.1| unknown [Glycine max]
 gb|KHN18606.1| hypothetical protein glysoja_007019 [Glycine soja]
Length=246

 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = -3

Query  759  SCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGI  580
            + SV++NP GNFDLSL+DD++   +AAPP+PPTEGR+EVVI+ DVI  LDLSPFQ ATG+
Sbjct  45   AVSVSYNPQGNFDLSLFDDDDET-KAAPPLPPTEGRFEVVIDNDVISRLDLSPFQAATGM  103

Query  579  TSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWR  400
             SP   KPK+F++RTIGFTIN+ RED  DPRELSE+P+IR+WFVRLDATYPWLPVLLDWR
Sbjct  104  KSPLSVKPKEFLDRTIGFTINYTREDPRDPRELSEYPDIRVWFVRLDATYPWLPVLLDWR  163

Query  399  AGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDM  220
            AGELARYAAMLVPHQMN+K+GVVFNPEALELFVMKKVFIVYSWLK H+  P P+LK  DM
Sbjct  164  AGELARYAAMLVPHQMNIKMGVVFNPEALELFVMKKVFIVYSWLK-HHNVPKPKLKANDM  222

Query  219  ARMLGFAIGDELFDLIDKYPLE  154
            ARMLGF IGDEL+D IDK+PL+
Sbjct  223  ARMLGFTIGDELYDFIDKHPLD  244



>gb|AFK45942.1| unknown [Medicago truncatula]
Length=243

 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = -3

Query  786  LSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDL  607
            +S H     + SVAFNP GNFD+SL+D E++  + +PPMPPTEGR+EVVI+ D I  LDL
Sbjct  35   ISHHQRGNVAVSVAFNPQGNFDVSLFD-EDDESKVSPPMPPTEGRFEVVIDNDAISRLDL  93

Query  606  SPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYP  427
            +PFQ ATG+ +P   +P++F+ER+IGFTIN+ R D  DPRELSE+P+IRLWFVRLDA YP
Sbjct  94   TPFQAATGMKNPLSVRPQEFLERSIGFTINYTRPDPRDPRELSEYPDIRLWFVRLDAAYP  153

Query  426  WLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTP  247
            WLPVLLDWRAGELARYAAMLVPHQMNMK+GVVFNPEALELFVM KVFIVYSWLK H+  P
Sbjct  154  WLPVLLDWRAGELARYAAMLVPHQMNMKMGVVFNPEALELFVMNKVFIVYSWLK-HHNIP  212

Query  246  FPRLKTKDMARMLGFAIGDELFDLID  169
             P LK  +MARMLGF IG EL+DL++
Sbjct  213  KPELKANNMARMLGFGIGSELYDLVE  238



>gb|KHN47131.1| hypothetical protein glysoja_022432 [Glycine soja]
Length=208

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR  508
            +AAPP+PPTEGR+EV I+ DVI  LDLSPFQ ATG+ SP   KPK+F+ERTIGFTIN+ R
Sbjct  30   KAAPPLPPTEGRFEVAIDNDVISRLDLSPFQAATGMKSPLSVKPKEFLERTIGFTINYTR  89

Query  507  EDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVF  328
            ED  DPRELSE+P+IR+WFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMN+K+GVVF
Sbjct  90   EDPRDPRELSEYPDIRVWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNIKMGVVF  149

Query  327  NPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLE  154
            NPEALELFVMKKVFIVYSWLK H+  P P+LK  DMARMLGF IGDEL+D IDK+PL+
Sbjct  150  NPEALELFVMKKVFIVYSWLK-HHNIPKPKLKANDMARMLGFTIGDELYDFIDKHPLD  206



>ref|XP_004972750.1| PREDICTED: uncharacterized protein LOC101779386 [Setaria italica]
Length=262

 Score =   296 bits (757),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 190/256 (74%), Gaps = 11/256 (4%)
 Frame = -3

Query  918  PFPMASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYS-KLCPAHLSLHAHAPFSCSVAF  742
            P  +A IRH  S SPL      L P +  S         +  PA       A F+  VAF
Sbjct  13   PHRLAPIRHNSSCSPL------LHPASRCSVTGRPPVQLQATPARA--ERAAKFAARVAF  64

Query  741  NPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG-ITSPSH  565
            NPSGNFDLSL  ++++  +  PP PPTEGR+E+VIN+D+IR+LDLSP Q A G ++S + 
Sbjct  65   NPSGNFDLSLSMEQDDTPQVQPPPPPTEGRFEIVINKDIIRALDLSPVQEALGDLSSLTA  124

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            A  ++ ++RT+GFTIN++REDEYD RELSEFP+IRLWFVRLDA YPW PV+LDWRAGELA
Sbjct  125  ADARNLLDRTVGFTINYEREDEYDTRELSEFPDIRLWFVRLDAAYPWFPVVLDWRAGELA  184

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQM+M+LGVVFNPEALELFVMKKVF V +WLKQ    P PRLKT DM RMLG
Sbjct  185  RYAAMLVPHQMSMRLGVVFNPEALELFVMKKVFAVDAWLKQQ-NHPKPRLKTADMGRMLG  243

Query  204  FAIGDELFDLIDKYPL  157
            + IGDELFDLI+KYP+
Sbjct  244  YGIGDELFDLIEKYPV  259



>ref|XP_010927346.1| PREDICTED: uncharacterized protein LOC105049414 [Elaeis guineensis]
Length=221

 Score =   292 bits (747),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 172/218 (79%), Gaps = 6/218 (3%)
 Frame = -3

Query  798  CPAHLSLHAHAPFSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIR  619
             P   ++ A    S SV+FNPSG+FDLSL  D+  + + APP+PPTEGR+E++IN DVIR
Sbjct  3    SPPSPNIRARVDVSPSVSFNPSGSFDLSLTGDDE-VPQVAPPLPPTEGRFEIIINNDVIR  61

Query  618  SLDLSPFQNATG----ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWF  451
             LDL P Q   G     T  S  +P++ +E T+GFTIN++RED YD RELSE P+IRLWF
Sbjct  62   RLDLLPIQALAGNNFHTTGDSPPEPRELLEHTVGFTINYEREDPYDTRELSEIPDIRLWF  121

Query  450  VRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSW  271
            VRLDA+YPW PV+LDWRAGELARYAAMLVPHQ++MKLG+VFNPEALELFVMKK FIVYSW
Sbjct  122  VRLDASYPWFPVVLDWRAGELARYAAMLVPHQISMKLGIVFNPEALELFVMKKAFIVYSW  181

Query  270  LKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPL  157
            LKQ    P P+LKT DMARMLGF +GDELFDLID++PL
Sbjct  182  LKQQ-NIPKPKLKTCDMARMLGFGLGDELFDLIDRHPL  218



>ref|XP_009407363.1| PREDICTED: uncharacterized protein LOC103990061 [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 182/250 (73%), Gaps = 10/250 (4%)
 Frame = -3

Query  903  SIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAH-APFSCSVAFNPSGN  727
            +IRH  S  PL+    S       SCK   +     PA     A     S SVAFNPSGN
Sbjct  4    TIRHLFS--PLRHCALSSNASPFPSCKPIAT-----PALTGCRARRGDVSLSVAFNPSGN  56

Query  726  FDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDF  547
            FDLSL   E+  ++ AP +PPTEGRYE+VIN+D+IR LDLSP +   G  S   A+P+  
Sbjct  57   FDLSL-TGEDEAQQVAPSLPPTEGRYEIVINKDIIRRLDLSPVEAIAGKISSLCAEPRKL  115

Query  546  VERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAML  367
            +++T+GFTIN++R+D YD RELSEFP++RLWFVRLDA YPW PV+LDWRAGELARYAAML
Sbjct  116  LDQTVGFTINYERDDPYDTRELSEFPDVRLWFVRLDAAYPWFPVVLDWRAGELARYAAML  175

Query  366  VPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDE  187
            VPHQ++M+LG+VFNPEALELFV+ K F VYSWLKQ    P P+LKT+DMARMLGF + D 
Sbjct  176  VPHQISMRLGIVFNPEALELFVLNKAFTVYSWLKQQ-KFPKPKLKTRDMARMLGFGLEDS  234

Query  186  LFDLIDKYPL  157
            LFDLID++PL
Sbjct  235  LFDLIDQHPL  244



>ref|XP_010687776.1| PREDICTED: uncharacterized protein LOC104901846 [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score =   289 bits (739),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 175/207 (85%), Gaps = 6/207 (3%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIE---RAAPPMPPTEGRYEVVINEDVIRSLDLSPFQN  592
            F+  VAFNP GN+DLSL DD+N+++   +A  P+PP EGR+EVVIN D IR LDLSPFQ+
Sbjct  64   FTPKVAFNPQGNYDLSLLDDDNDLQGSTKAPEPLPPKEGRFEVVINNDAIRCLDLSPFQS  123

Query  591  ATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVL  412
            AT I+S S    ++++ER+IGFTIN+KRED YD RELSE P++RLWFVRLDA YPWLPVL
Sbjct  124  ATAISSSSFVDLEEYMERSIGFTINYKREDPYDHRELSELPDVRLWFVRLDAMYPWLPVL  183

Query  411  LDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFP--R  238
            LDWRAGELARYAAMLVPHQM+M++GVVFNPEALELF+MKKVFI+YSWLKQ  G P P  R
Sbjct  184  LDWRAGELARYAAMLVPHQMSMRMGVVFNPEALELFIMKKVFIIYSWLKQQ-GIPTPKAR  242

Query  237  LKTKDMARMLGFAIGDELFDLIDKYPL  157
            LKT DMARMLGF IGDELFDLID++ L
Sbjct  243  LKTGDMARMLGFGIGDELFDLIDQHSL  269



>ref|XP_006843798.1| hypothetical protein AMTR_s00007p00251190 [Amborella trichopoda]
 gb|ERN05473.1| hypothetical protein AMTR_s00007p00251190 [Amborella trichopoda]
Length=230

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 164/199 (82%), Gaps = 3/199 (2%)
 Frame = -3

Query  756  CSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGIT  577
             SV+FNP+GNFDLS Y+ + +  +  PP+PPT+GR E+V++ D++R LDLSP  +  G  
Sbjct  31   LSVSFNPTGNFDLS-YNTDQDASQVGPPLPPTDGRLEIVLDNDILRRLDLSPVCSLMG-E  88

Query  576  SPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRA  397
            S     PK+ ++RT+GFTIN++RED  DPRELSEFPEIRLWFVRLDA+ PWLPV+LDWRA
Sbjct  89   STQAIDPKELLQRTVGFTINYEREDSSDPRELSEFPEIRLWFVRLDASLPWLPVVLDWRA  148

Query  396  GELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMA  217
            GELARY AMLVPHQM+++LGVVFNPEALELFVMKKVFIVYSWLK H+  P P+LKT DMA
Sbjct  149  GELARYTAMLVPHQMSLRLGVVFNPEALELFVMKKVFIVYSWLK-HHNIPKPKLKTSDMA  207

Query  216  RMLGFAIGDELFDLIDKYP  160
            RMLGF IGDEL+DLID  P
Sbjct  208  RMLGFGIGDELYDLIDSNP  226



>ref|NP_001061079.1| Os08g0167500 [Oryza sativa Japonica Group]
 dbj|BAC99541.1| putative ubiquinone oxidoreductase subunit 1 [Oryza sativa Japonica 
Group]
 dbj|BAF22993.1| Os08g0167500 [Oryza sativa Japonica Group]
 gb|EAZ05726.1| hypothetical protein OsI_27953 [Oryza sativa Indica Group]
 gb|EAZ41644.1| hypothetical protein OsJ_26178 [Oryza sativa Japonica Group]
 dbj|BAG87704.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 167/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            F   VAFNPSGNFDLSL  D+++  +  PP PPTEGR+E+VIN D+IR+LDLSP     G
Sbjct  49   FRLRVAFNPSGNFDLSLSTDQDDAPQVEPPPPPTEGRFEIVINTDIIRTLDLSPVHEVLG  108

Query  582  -ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLD  406
             + S + A+ ++ ++RT+GFTIN++RED YD RELSEFP+IRLWFVRLDA YPW PV+LD
Sbjct  109  DLNSLTPAQTRNLLDRTVGFTINYEREDPYDVRELSEFPDIRLWFVRLDACYPWFPVVLD  168

Query  405  WRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTK  226
            WRAGELARYAAML PHQM+M+LGVVFNPEALELFVMKKVFIVYSWLKQ    P P LKT 
Sbjct  169  WRAGELARYAAMLAPHQMSMRLGVVFNPEALELFVMKKVFIVYSWLKQQE-HPKPGLKTA  227

Query  225  DMARMLGFAIGDELFDLIDKYP  160
            DMARMLGF IGDELFDLI+KYP
Sbjct  228  DMARMLGFGIGDELFDLIEKYP  249



>ref|XP_006659871.1| PREDICTED: uncharacterized protein LOC102706590 [Oryza brachyantha]
Length=246

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            F   V+FNPSGNFDLSL  D+++  +  PP PPTEGR+E+VIN D+IR+LDLSP Q   G
Sbjct  42   FCLRVSFNPSGNFDLSLSTDQDDAPQVEPPPPPTEGRFEIVINNDIIRTLDLSPVQEVLG  101

Query  582  IT-SPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLD  406
             + S + A+ K+ ++RT+GFTIN++RED YD RELSE P+IRLWFVRLDA YPW PV+LD
Sbjct  102  DSDSLTPAQAKNLLDRTVGFTINYEREDPYDVRELSELPDIRLWFVRLDACYPWFPVVLD  161

Query  405  WRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTK  226
            WRAGELARYAAML PHQM+M+LGVVFNPEALELFVMKKVFIV+SWLKQ    P P LKT 
Sbjct  162  WRAGELARYAAMLAPHQMSMRLGVVFNPEALELFVMKKVFIVHSWLKQQ-NHPKPALKTA  220

Query  225  DMARMLGFAIGDELFDLIDKYPL  157
            DMARMLGF IGDELFDLI+KYP+
Sbjct  221  DMARMLGFGIGDELFDLIEKYPV  243



>ref|XP_002462363.1| hypothetical protein SORBIDRAFT_02g024420 [Sorghum bicolor]
 gb|EER98884.1| hypothetical protein SORBIDRAFT_02g024420 [Sorghum bicolor]
Length=264

 Score =   283 bits (724),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            F+  VAFNPSGN+DLSL   ++   +  PP PPTEGR+E++IN + IR+LDLSP Q A G
Sbjct  60   FAARVAFNPSGNYDLSLSMGQDETPQVQPPPPPTEGRFEIIINNNTIRTLDLSPVQEALG  119

Query  582  -ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLD  406
             ++S + A  K  +++T+GFTIN++REDEYD RELSEFP+IRLWFVRLDA YPW PV+LD
Sbjct  120  DLSSLTAADSKTLLDQTVGFTINYEREDEYDTRELSEFPDIRLWFVRLDAAYPWFPVVLD  179

Query  405  WRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTK  226
            WRAGELARY AMLVPHQM+M+LGVVFNPEALELFVMKKVF V +WLKQ    P PRLKT 
Sbjct  180  WRAGELARYTAMLVPHQMSMRLGVVFNPEALELFVMKKVFAVETWLKQQ-NHPKPRLKTA  238

Query  225  DMARMLGFAIGDELFDLIDKYPL  157
            DMARMLGF +GDELF+LI+KYP+
Sbjct  239  DMARMLGFGVGDELFELIEKYPV  261



>dbj|BAJ85020.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00983.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 171/202 (85%), Gaps = 3/202 (1%)
 Frame = -3

Query  750  VAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG-ITS  574
            VAFNPSGNFDLSL  D+++  +  PP PPTEGR E+VIN+D+IR+LDLSP Q A G + S
Sbjct  60   VAFNPSGNFDLSL-SDQDDAPQVEPPPPPTEGRIEIVINKDIIRTLDLSPVQEALGNLNS  118

Query  573  PSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAG  394
             + A+ ++ ++RT+GFTIN++RED YD RELSEFP++RLWFVRLDA+YPW PV+LDWRAG
Sbjct  119  LTTAQSRNLLDRTVGFTINYEREDPYDTRELSEFPDVRLWFVRLDASYPWFPVVLDWRAG  178

Query  393  ELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMAR  214
            ELARYAAMLVPHQM+M+ GVVFNPEALELF MKKVF+VYSWLKQ      PRLKT DMA+
Sbjct  179  ELARYAAMLVPHQMSMRHGVVFNPEALELFGMKKVFVVYSWLKQQNHAK-PRLKTGDMAK  237

Query  213  MLGFAIGDELFDLIDKYPLEDF  148
            MLGF IGDELFDLI+KYP+++ 
Sbjct  238  MLGFGIGDELFDLIEKYPVDEL  259



>ref|NP_001143060.1| uncharacterized protein LOC100275531 [Zea mays]
 gb|ACG28660.1| hypothetical protein [Zea mays]
Length=259

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 187/261 (72%), Gaps = 21/261 (8%)
 Frame = -3

Query  927  PSQPFPMASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKLCPAHLSLHAH----APF  760
            P  P  +  +RHT SS P         P+ T  C      S      + LHA     + F
Sbjct  11   PVVPHRLVPVRHTSSSPP---------PHPTARC------SAAGKPPVQLHAAQARASGF  55

Query  759  SCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG-  583
            +  VAFNPSGN+DLSL   E+   +  PP PPT+GR+E+VIN D IR+LDLSP + A G 
Sbjct  56   AARVAFNPSGNYDLSLSMGEDETPQVQPPPPPTQGRFEIVINNDNIRTLDLSPVEAALGD  115

Query  582  ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDW  403
            ++S + A  +  +++T+GFTI+++REDEYD RELSEFP+IRLWFVRLDA YPW PV+LDW
Sbjct  116  LSSLTPAASRTLLDQTVGFTISYEREDEYDTRELSEFPDIRLWFVRLDAAYPWFPVVLDW  175

Query  402  RAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKD  223
            RAGELARYAAMLVPHQM+M++GVVFNPEALELFVMKKVF V +WLKQ    P PRLKT D
Sbjct  176  RAGELARYAAMLVPHQMSMRMGVVFNPEALELFVMKKVFAVDAWLKQQ-SHPKPRLKTAD  234

Query  222  MARMLGFAIGDELFDLIDKYP  160
            MARMLGF +GDELFDLI+KYP
Sbjct  235  MARMLGFGVGDELFDLIEKYP  255



>ref|NP_973713.1| chlororespiratory reduction 6 [Arabidopsis thaliana]
 gb|AEC10911.1| chlororespiratory reduction 6 [Arabidopsis thaliana]
Length=198

 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 4/177 (2%)
 Frame = -3

Query  690  ERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSH---AKPKDFVERTIGFTI  520
            ++  PPMPPT GRYEVVI+ D I  LDLSPFQ A GITSP     A+PK +++RTIGFTI
Sbjct  20   DKVEPPMPPTTGRYEVVIDNDSIGRLDLSPFQRAIGITSPDDFGVAEPKRYLDRTIGFTI  79

Query  519  NFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKL  340
            N+KRED  DPRELSE+P++RLWFVRLDA YPWLP+LLDWRAGELARYAAMLVPHQM++++
Sbjct  80   NYKREDPGDPRELSEYPDVRLWFVRLDAMYPWLPLLLDWRAGELARYAAMLVPHQMSLRM  139

Query  339  GVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            GVVFNPEALELFVM KVF+VY WLK+H G P PRLKT DMARMLGF IGDELFDLID
Sbjct  140  GVVFNPEALELFVMNKVFVVYPWLKRH-GVPKPRLKTSDMARMLGFGIGDELFDLID  195



>ref|XP_003609497.1| hypothetical protein MTR_4g116350 [Medicago truncatula]
Length=193

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  714  LYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERT  535
            L +D  +  + +PPMPPTEGR+EVVI+ D I  LDL+PFQ ATG+ +P   +P++F+ER+
Sbjct  6    LNNDFADESKVSPPMPPTEGRFEVVIDNDAISRLDLTPFQAATGMKNPLSVRPQEFLERS  65

Query  534  IGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQ  355
            IGFTIN+ R D  DPRELSE+P+IRLWFVRLDA YPWLPVLLDWRAGELARYAAMLVPHQ
Sbjct  66   IGFTINYTRPDPRDPRELSEYPDIRLWFVRLDAAYPWLPVLLDWRAGELARYAAMLVPHQ  125

Query  354  MNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            MNMK+GVVFNPEALELFVM KVFIVYSWLK H+  P P LK  +MARMLGF IG EL+DL
Sbjct  126  MNMKMGVVFNPEALELFVMNKVFIVYSWLK-HHNIPKPELKANNMARMLGFGIGSELYDL  184

Query  174  IDKYPLE  154
            ++ +PL+
Sbjct  185  VENHPLD  191



>ref|XP_003573432.1| PREDICTED: uncharacterized protein LOC100826985 [Brachypodium 
distachyon]
Length=263

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 170/204 (83%), Gaps = 3/204 (1%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            FS  VAFNPSGNFDLSL  D++++ +  PP PPTEGR E+ IN+D+I++L+LSP   A G
Sbjct  60   FSLRVAFNPSGNFDLSL-SDQDDVPQVEPPPPPTEGRIEIFINKDIIQTLNLSPVHEALG  118

Query  582  -ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLD  406
             + S + A+ K+ ++RT+GFTIN++RED YD RELSEFP+IRLWFVRLDA+YPW PV+LD
Sbjct  119  NLNSLTTAQSKNLLDRTVGFTINYEREDPYDTRELSEFPDIRLWFVRLDASYPWFPVVLD  178

Query  405  WRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTK  226
            WRAGELARYAAML PHQM+M+ GVVFNPEALELF MKKVFIVYSWLKQ      PRLKT 
Sbjct  179  WRAGELARYAAMLAPHQMSMRHGVVFNPEALELFGMKKVFIVYSWLKQQNHAK-PRLKTG  237

Query  225  DMARMLGFAIGDELFDLIDKYPLE  154
            DMA+MLGF IGDELFDLI+KYP++
Sbjct  238  DMAKMLGFGIGDELFDLIEKYPVD  261



>ref|NP_001141945.1| uncharacterized protein LOC100274094 [Zea mays]
 gb|ACF87357.1| unknown [Zea mays]
 gb|AFW61123.1| hypothetical protein ZEAMMB73_152027 [Zea mays]
Length=259

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -3

Query  762  FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG  583
            F+  VAFNPSGN+DLSL   E+   +  PP PPT+GR+E+VIN D IR+LDLSP + A G
Sbjct  55   FAARVAFNPSGNYDLSLSMGEDETPQVQPPPPPTQGRFEIVINNDNIRTLDLSPVEAALG  114

Query  582  -ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLD  406
             ++S + A  +  +++T+GFTI+++REDEYD RELSEFP+IRLWFVRLDA YPW PV+LD
Sbjct  115  DLSSLTPAASRTLLDQTVGFTISYEREDEYDTRELSEFPDIRLWFVRLDAAYPWFPVVLD  174

Query  405  WRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTK  226
            WRAGELARYAAMLVPHQM+M++GVVFNPEALELFVMKKVF V +WLKQ    P PRLKT 
Sbjct  175  WRAGELARYAAMLVPHQMSMRMGVVFNPEALELFVMKKVFAVDAWLKQQ-SHPKPRLKTA  233

Query  225  DMARMLGFAIGDELFDLIDKYPL  157
            DMARMLGF +GDELFDLI+KYP+
Sbjct  234  DMARMLGFGVGDELFDLIEKYPV  256



>ref|XP_008813148.1| PREDICTED: uncharacterized protein LOC103723854 [Phoenix dactylifera]
Length=254

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 185/257 (72%), Gaps = 10/257 (4%)
 Frame = -3

Query  909  MASIRHTLSSSPLKQHIPSLTPYTTTSCKHNFSYSKL-CPAHLSLHAHAPFSCSVAFNPS  733
            MA    T S+ PL   +P+L    +++     S+  +  P   +  A    S SV+FNPS
Sbjct  1    MALASPTTSNYPL---LPALRNNPSSNTHPFLSFRPINSPPSPNFRARGDVSPSVSFNPS  57

Query  732  GNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATG----ITSPSH  565
            GNFDLSL  D++   + APP PPTEGR+E+VI+ DVIR LDLSP +   G     T  S 
Sbjct  58   GNFDLSLTGDDD-APQVAPPPPPTEGRFEIVIDNDVIRRLDLSPVRALAGNNFHTTGDSP  116

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
             + +  ++ T+GFTIN++RED YD RELSE P+IRLWFVRLDA+YPW PV+LDWRAGELA
Sbjct  117  PEARKLLDHTVGFTINYEREDPYDTRELSEIPDIRLWFVRLDASYPWFPVVLDWRAGELA  176

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQ++ +LG+VFNPEALELFVMKK FIVYSWLKQ    P P+LKT DMARMLG
Sbjct  177  RYAAMLVPHQISTRLGIVFNPEALELFVMKKAFIVYSWLKQQ-NIPKPKLKTCDMARMLG  235

Query  204  FAIGDELFDLIDKYPLE  154
            F +GD+LFDLID++PL 
Sbjct  236  FGLGDQLFDLIDRHPLR  252



>gb|EMT06357.1| hypothetical protein F775_08951 [Aegilops tauschii]
Length=290

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 173/232 (75%), Gaps = 32/232 (14%)
 Frame = -3

Query  750  VAFNPSGNFDLSLYDDE--------------------------NNIERAAPPM----PPT  661
            VAFNPSGNFDLSL D +                          ++I   AP +    PPT
Sbjct  60   VAFNPSGNFDLSLSDQDVPTTASHVWHPVMPCSATLMASSRVKDSIVVYAPQVEPPPPPT  119

Query  660  EGRYEVVINEDVIRSLDLSPFQNATG-ITSPSHAKPKDFVERTIGFTINFKREDEYDPRE  484
            EGR E+VIN+D+IR+LDLSP Q+A G + S + A+ ++ ++RT+GFTIN++RED YD RE
Sbjct  120  EGRIEIVINKDIIRALDLSPVQDALGNLNSLTTAQSRNLLDRTVGFTINYEREDPYDTRE  179

Query  483  LSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELF  304
            LSEFP++RLWFVRLDA+YPW PV+LDWRAGELARYAAMLVPHQM+M+ GVVFNPEALELF
Sbjct  180  LSEFPDVRLWFVRLDASYPWFPVVLDWRAGELARYAAMLVPHQMSMRHGVVFNPEALELF  239

Query  303  VMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLEDF  148
             MKKVF+VYSWLKQ      PRLKT DMA+MLGF IGDELFDLI+KYP+++ 
Sbjct  240  GMKKVFLVYSWLKQQKHAK-PRLKTGDMAKMLGFGIGDELFDLIEKYPVDEL  290



>gb|EMS53871.1| hypothetical protein TRIUR3_09163 [Triticum urartu]
Length=280

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = -3

Query  663  TEGRYEVVINEDVIRSLDLSPFQNATG-ITSPSHAKPKDFVERTIGFTINFKREDEYDPR  487
            TEGR E+VIN+D+IR+LDLSP Q A G + S + A+ ++ ++RT+GFTIN++RED YD R
Sbjct  109  TEGRIEIVINKDIIRTLDLSPVQEALGNLNSLTTAQSRNLLDRTVGFTINYEREDPYDTR  168

Query  486  ELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALEL  307
            ELSEFP++RLWFVRLDA+ PW PV+LDWRAGELARYAAMLVPHQM+M+ GVVFNPEALEL
Sbjct  169  ELSEFPDVRLWFVRLDASCPWFPVVLDWRAGELARYAAMLVPHQMSMRHGVVFNPEALEL  228

Query  306  FVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYPLEDF  148
            F MKKVF+VYSWLKQ      PRLKT DMA+MLGF IGDELFDLI+KYP+++ 
Sbjct  229  FGMKKVFLVYSWLKQQNHAK-PRLKTGDMAKMLGFGIGDELFDLIEKYPVDEL  280



>gb|KHG21346.1| Endonuclease V [Gossypium arboreum]
Length=139

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 128/137 (93%), Gaps = 1/137 (1%)
 Frame = -3

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            A+PK+++E+TIGFTIN+ R+D +DPRELSEFP+IRLWFVRLDA YPWLPVLLDWRAGELA
Sbjct  4    AEPKEYLEKTIGFTINYTRDDPHDPRELSEFPDIRLWFVRLDAVYPWLPVLLDWRAGELA  63

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQM+M++GVVFNPEALELF+MKKVFIVYSWLKQH G P PRLKT DMARMLG
Sbjct  64   RYAAMLVPHQMSMRMGVVFNPEALELFIMKKVFIVYSWLKQH-GIPKPRLKTSDMARMLG  122

Query  204  FAIGDELFDLIDKYPLE  154
            F IGDELFDLID+ PL+
Sbjct  123  FGIGDELFDLIDQQPLD  139



>gb|AFW61122.1| hypothetical protein ZEAMMB73_152027 [Zea mays]
Length=159

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -3

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            A  +  +++T+GFTI+++REDEYD RELSEFP+IRLWFVRLDA YPW PV+LDWRAGELA
Sbjct  22   AASRTLLDQTVGFTISYEREDEYDTRELSEFPDIRLWFVRLDAAYPWFPVVLDWRAGELA  81

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQM+M++GVVFNPEALELFVMKKVF V +WLKQ    P PRLKT DMARMLG
Sbjct  82   RYAAMLVPHQMSMRMGVVFNPEALELFVMKKVFAVDAWLKQQ-SHPKPRLKTADMARMLG  140

Query  204  FAIGDELFDLIDKYPL  157
            F +GDELFDLI+KYP+
Sbjct  141  FGVGDELFDLIEKYPV  156



>ref|XP_010241962.1| PREDICTED: uncharacterized protein LOC104586427 isoform X2 [Nelumbo 
nucifera]
Length=156

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -3

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            A+PK+ +E  +GFTIN+ RED YDPRELSEF +I+LWFVRLDA+YPWLPV+LDWRAGELA
Sbjct  19   AEPKELLEWKVGFTINYTREDPYDPRELSEFLDIKLWFVRLDASYPWLPVVLDWRAGELA  78

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQM+M++GVVFNPEALELF M+K FIVYSWLKQH   P  +LKT+DMARMLG
Sbjct  79   RYAAMLVPHQMSMRMGVVFNPEALELFAMRKAFIVYSWLKQH-KIPKSKLKTRDMARMLG  137

Query  204  FAIGDELFDLIDKYPL  157
            F  GDELFDLID +P+
Sbjct  138  FVAGDELFDLIDAHPI  153



>ref|XP_010241960.1| PREDICTED: uncharacterized protein LOC104586427 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241961.1| PREDICTED: uncharacterized protein LOC104586427 isoform X1 [Nelumbo 
nucifera]
Length=161

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -3

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            A+PK+ +E  +GFTIN+ RED YDPRELSEF +I+LWFVRLDA+YPWLPV+LDWRAGELA
Sbjct  24   AEPKELLEWKVGFTINYTREDPYDPRELSEFLDIKLWFVRLDASYPWLPVVLDWRAGELA  83

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQM+M++GVVFNPEALELF M+K FIVYSWLKQH   P  +LKT+DMARMLG
Sbjct  84   RYAAMLVPHQMSMRMGVVFNPEALELFAMRKAFIVYSWLKQH-KIPKSKLKTRDMARMLG  142

Query  204  FAIGDELFDLIDKYPL  157
            F  GDELFDLID +P+
Sbjct  143  FVAGDELFDLIDAHPI  158



>gb|ACF87295.1| unknown [Zea mays]
Length=159

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -3

Query  564  AKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            A  +  +++T+GFTI+++REDEYD RELSEFP+IRLWFVRLDA YPW PV+LDWRAGELA
Sbjct  22   AASRTLLDQTVGFTISYEREDEYDTRELSEFPDIRLWFVRLDAAYPWFPVVLDWRAGELA  81

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            RYAAMLVPHQM+M++GVV NPEALELFVMKKVF V +WLKQ    P PRLKT DMARMLG
Sbjct  82   RYAAMLVPHQMSMRMGVVLNPEALELFVMKKVFAVDAWLKQQ-SHPKPRLKTADMARMLG  140

Query  204  FAIGDELFDLIDKYPL  157
            F +GDELFDLI+KYP+
Sbjct  141  FGVGDELFDLIEKYPV  156



>ref|XP_006453725.1| hypothetical protein CICLE_v10009248mg [Citrus clementina]
 gb|ESR66965.1| hypothetical protein CICLE_v10009248mg [Citrus clementina]
Length=188

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -3

Query  780  LHAHAP---FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLD  610
            LH++ P    S SVAFNP GNFD+ +++DE N  +  PPMPPTEGR++VV++ D IRSLD
Sbjct  49   LHSNRPRGQISVSVAFNPQGNFDIPMFEDEGNSSKLEPPMPPTEGRFDVVLDNDAIRSLD  108

Query  609  LSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATY  430
            LSPF +ATGITSP+ A+PK+F+ERTIGFTIN+ RED  DPRELSEFP+IRLWFVRLDA Y
Sbjct  109  LSPFHSATGITSPTLAEPKEFLERTIGFTINYTREDPRDPRELSEFPDIRLWFVRLDAAY  168

Query  429  PWLPVLLDWRAGELARYAAM  370
            PW+PVLLDWRAGELARYAA+
Sbjct  169  PWIPVLLDWRAGELARYAAI  188



>ref|XP_002968466.1| hypothetical protein SELMODRAFT_89955, partial [Selaginella moellendorffii]
 gb|EFJ30720.1| hypothetical protein SELMODRAFT_89955, partial [Selaginella moellendorffii]
Length=170

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 128/177 (72%), Gaps = 15/177 (8%)
 Frame = -3

Query  678  PPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHA----KPKDFVERTIGFTINFK  511
            P  PPT GR+E+ I+++ +R LDLSP          +HA     P + +++T+GF IN++
Sbjct  3    PAPPPTPGRFEITIDKETVRRLDLSP----------AHALLRNDPNELLQKTVGFVINYE  52

Query  510  REDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVV  331
            R+D  DPRELSE P++RLWF+RLDA YPWLPV+LDWR+GELARY AMLVPHQM+ +LG+V
Sbjct  53   RDDPVDPRELSELPDLRLWFLRLDAAYPWLPVVLDWRSGELARYTAMLVPHQMSQRLGIV  112

Query  330  FNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            +NPEA ELF M K+F VYSWLK   G   P+ KT  M +++GF I DELF L++  P
Sbjct  113  YNPEAQELFAMSKLFTVYSWLKAR-GVANPQAKTNAMMQVIGFGISDELFKLVEANP  168



>ref|XP_002970640.1| hypothetical protein SELMODRAFT_93194, partial [Selaginella moellendorffii]
 gb|EFJ28770.1| hypothetical protein SELMODRAFT_93194, partial [Selaginella moellendorffii]
Length=170

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 125/173 (72%), Gaps = 7/173 (4%)
 Frame = -3

Query  678  PPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDE  499
            P  PPT GR+E+ I+++ +R LDLSP              P + +++T+GF IN++R+D 
Sbjct  3    PAPPPTPGRFEITIDKETVRRLDLSPAHVLL------RNDPNELLQKTVGFVINYERDDP  56

Query  498  YDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPE  319
             DPRELSE P++RLWF+RLDA YPWLPV+LDWR+GELARY AMLVPHQM+ +LGVV+NPE
Sbjct  57   VDPRELSELPDLRLWFLRLDAAYPWLPVVLDWRSGELARYTAMLVPHQMSQRLGVVYNPE  116

Query  318  ALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            A ELF M K+F VYSWLK   G   P+ KT  M +++GF I DELF L++  P
Sbjct  117  AQELFAMSKLFTVYSWLKAR-GVANPQAKTNAMMQVIGFGISDELFKLVEANP  168



>ref|XP_001773409.1| predicted protein [Physcomitrella patens]
 gb|EDQ61782.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 131/180 (73%), Gaps = 6/180 (3%)
 Frame = -3

Query  684  AAPPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKP-----KDFVERTIGFTI  520
              P  PPT GR ++V+ ++ IR LDLSP    T   +  +A       ++  ERT+GF +
Sbjct  1    VVPAPPPTPGRIDIVVTKEQIRELDLSPAHAETFWLAGDNATDPGVDLQEVFERTVGFVL  60

Query  519  NFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKL  340
             ++ +D  DPRELSE P+IRLWFVRLDA YPWLP+++DWRAGEL+RYAAMLVPHQM+ +L
Sbjct  61   QYEVDDPLDPRELSELPDIRLWFVRLDAAYPWLPIVVDWRAGELSRYAAMLVPHQMSKRL  120

Query  339  GVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            G+V+NPEALEL+ M K+F+++ +LK    T  P +K  +M RMLGF+I ++L+DLI+KYP
Sbjct  121  GLVYNPEALELWAMNKLFLIHEFLKARNVTK-PDVKLNNMLRMLGFSISNQLYDLIEKYP  179



>ref|XP_002443922.1| hypothetical protein SORBIDRAFT_07g004440 [Sorghum bicolor]
 gb|EES13417.1| hypothetical protein SORBIDRAFT_07g004440 [Sorghum bicolor]
Length=204

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 12/142 (8%)
 Frame = -3

Query  549  FVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAM  370
             +++T+GFTI +KRED YD RELSEF +I LWFVRLDA YPW PV+LDWRAG L RYAAM
Sbjct  61   LLDQTVGFTITYKREDAYDTRELSEFLDIWLWFVRLDAAYPWFPVVLDWRAGRLTRYAAM  120

Query  369  LVPH-----------QMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKD  223
            LVP            QM+M++G VF+PE LELFVMKKVF V +WLKQ      PRLKT D
Sbjct  121  LVPSPVYKTLLMDELQMSMRMGEVFHPEVLELFVMKKVFAVETWLKQQNHLK-PRLKTTD  179

Query  222  MARMLGFAIGDELFDLIDKYPL  157
            MAR+LGF +GD+LFDLIDKYPL
Sbjct  180  MARILGFGVGDKLFDLIDKYPL  201



>ref|WP_015194536.1| protein of unknown function DUF1817 [Stanieria cyanosphaera]
 ref|YP_007133840.1| protein of unknown function DUF1817 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36874.1| protein of unknown function DUF1817 [Stanieria cyanosphaera PCC 
7437]
Length=158

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + I SLDL+P  N    + P   K  D+ E+ + F IN++RE E DPRE SE PE
Sbjct  5    IELNNNSIDSLDLTP-ANKIINSLPEDQKITDY-EQKLQFKINYQRE-ESDPREFSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLD  YPWLP LLDW+ GELARY+AMLVPHQ +   G+++NPEALE+FVM+K+F
Sbjct  62   IRLWFIRLDTAYPWLPYLLDWKTGELARYSAMLVPHQFSRGEGIIYNPEALEIFVMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
             +  WLKQ   +   R + K MA++LG+ + D  FD+++
Sbjct  122  AIAEWLKQRGIS--SRFRLKSMAQILGYDLDDSFFDMLE  158



>ref|WP_016950237.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=161

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 7/161 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP    T I S    K     E+ + F IN+ RE + DPRELSE PE
Sbjct  5    ITLNNDSINNLDLSP--ALTVIESLLQDKAITSNEQLLSFEINYTRE-QNDPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWL  LLDW+ GELARYAAMLVPHQ N K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDAKYPWLLFLLDWKEGELARYAAMLVPHQFNSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFP-RLKTKDMARMLGFAIGDELFDLIDK  166
            I+  WLK   G   P + + K +A++LG+ + D  F++I+K
Sbjct  122  ILSDWLK---GQSIPTQFRLKSLAQILGYELDDAFFEMIEK  159



>ref|WP_015180582.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007119824.1| hypothetical protein Mic7113_0500 [Microcoleus sp. PCC 7113]
 gb|AFZ16418.1| hypothetical protein Mic7113_0500 [Microcoleus sp. PCC 7113]
Length=159

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 109/159 (69%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I  LDLSP Q  T I    +       E+ + F I++ R D  DPRELSE PE
Sbjct  6    IALNSDCINHLDLSPAQ--TVIEKLLNDGAIAAYEQQLRFDIDYPR-DPTDPRELSEIPE  62

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA YPW+P LLDW+AGELARY AMLVPHQ N   G+ +NPEALE+FVM+K+F
Sbjct  63   VRLWFIRLDACYPWMPFLLDWKAGELARYVAMLVPHQFNRTEGIQYNPEALEIFVMQKIF  122

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            ++ +WLKQ  G P  + + + MA++LG+ +    FDLID
Sbjct  123  VLTNWLKQQ-GIP-GQSRAQSMAKLLGYELDSAFFDLID  159



>ref|WP_026099104.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=158

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + I+ + +R+LDLSP Q+A  I    H+ PK   E+ + F I+   E + DPRELSE PE
Sbjct  5    IAIDSECLRNLDLSPAQSA--IDQLLHSHPKAAPEQLLRFEIDCPTEPD-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLPVLLDW+AGELARYAAMLVPHQ +   G+ FNPEALE+F+M KVF
Sbjct  62   VRLWFIRLDSCYPWLPVLLDWQAGELARYAAMLVPHQFHRTEGIQFNPEALEIFLMHKVF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
             +  WL +  G P  + K   MA+MLG+ + D  F LI
Sbjct  122  TIADWLGRQ-GLP-SQSKLLSMAKMLGYDLDDSFFQLI  157



>ref|WP_013189916.1| hypothetical protein [Trichormus azollae]
 ref|YP_003720019.1| hypothetical protein Aazo_0313 ['Nostoc azollae' 0708]
 gb|ADI62896.1| Domain of unknown function DUF1817 ['Nostoc azollae' 0708]
Length=164

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 111/160 (69%), Gaps = 5/160 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +  D I +LDLSP    T I    H +     E+ + F I++ RE   DPRELSE PE
Sbjct  7    INLKNDSINNLDLSP--ALTVIEPLLHEESITSYEQQLCFEISYAREAN-DPRELSEIPE  63

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+AGELARY+AMLVPHQ + K G+ +NPEALE+F+M+K+F
Sbjct  64   VRLWFVRLDAKYPWLPFLLDWKAGELARYSAMLVPHQFSSKEGIQYNPEALEIFLMQKIF  123

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            I+  WLKQ    P  + + K +A++LG+ + D  F++I+K
Sbjct  124  ILSDWLKQQ-SIP-TQFRLKSLAQILGYELEDAFFEMIEK  161



>ref|WP_015214173.1| protein of unknown function DUF1817 [Anabaena cylindrica]
 ref|YP_007156437.1| protein of unknown function DUF1817 [Anabaena cylindrica PCC 
7122]
 gb|AFZ57527.1| protein of unknown function DUF1817 [Anabaena cylindrica PCC 
7122]
Length=162

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP    T I      +     E+ + F IN+ R D  DPRELSE PE
Sbjct  5    IALNNDFINNLDLSP--ALTVIEPLLQEESITSHEQQLCFEINYTR-DANDPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+AGE  RY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDAKYPWLPFLLDWKAGEFVRYTAMLVPHQFSSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            I+  WLKQ    P  + + K +A++LG+ + D  FD+I+K
Sbjct  122  ILSDWLKQQ-SIP-TQFRLKSLAQILGYELEDTFFDMIEK  159



>ref|WP_017714124.1| hypothetical protein [Prochlorothrix hollandica]
Length=159

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDF-VERTIGFTINFKREDEYDPRELSEFP  469
            + ++  ++ SLDL+P Q    +  P  A+      E+ I FTIN+ RED  DPRELSE P
Sbjct  5    ISLDLSILESLDLTPAQQ---LLDPLVAQGTVLHQEQQISFTINYPREDG-DPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            EIRLWFVRLDA YPWLP+LLDW+AGELARY AM+VPHQ +   G+ +NPEALE+FVM K 
Sbjct  61   EIRLWFVRLDARYPWLPLLLDWKAGELARYMAMVVPHQFHPMEGIQYNPEALEIFVMAKT  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            F++  WL+Q       R++   M +MLG+ + DE F LI+
Sbjct  121  FVIMDWLRQQGVEGKSRVQA--MTQMLGYELADEFFALIN  158



>ref|WP_015209649.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007149087.1| hypothetical protein Cylst_4314 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ26407.1| hypothetical protein Cylst_4314 [Cylindrospermum stagnale PCC 
7417]
Length=186

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV-ERTIGFTINFKREDEYDPRELSEFP  469
            + +N D I +LDLSP   A+ +  P          E+ + F +N++ E   DPRELSE P
Sbjct  29   IALNNDSIHNLDLSP---ASKVIEPLLQDEAIATHEQQLRFEVNYELEPG-DPRELSEIP  84

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP LLDW+AGELARYAAMLVPHQ + K G+ +NPEALE+F+M K+
Sbjct  85   EVRLWFVRLDAKYPWLPFLLDWKAGELARYAAMLVPHQFSSKEGIQYNPEALEIFLMHKI  144

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FI+  WLKQ  G P  + + K +A+MLG+ + D  F++I++
Sbjct  145  FILSVWLKQQ-GMP-SQSRLKSLAQMLGYELDDAFFEMIEE  183



>ref|WP_028083988.1| hypothetical protein [Dolichospermum circinale]
Length=162

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 115/162 (71%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPK-DFVERTIGFTINFKREDEYDPRELSEFP  469
            +++N D I +LDLSP   A  +  P   + K    E+ +   IN+KR    DPRELSE P
Sbjct  5    IILNNDSIYNLDLSP---ALMVIEPLLQEGKISSHEQQLRLDINYKRVAN-DPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP LLDW+AGELARYAAMLVPHQ + K G+ +NPEALE+F+M+K+
Sbjct  61   EVRLWFVRLDAKYPWLPFLLDWKAGELARYAAMLVPHQFSSKEGIQYNPEALEIFLMQKI  120

Query  288  FIVYSWL-KQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FI+  WL KQ   TP  RL++  +A++LG+ + D  F++I+K
Sbjct  121  FILSDWLHKQDIVTP-SRLRS--LAQILGYELDDAFFEMIEK  159



>ref|WP_039201350.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG41737.1| hypothetical protein OA07_09535 [Aphanizomenon flos-aquae 2012/KM/D3]
Length=161

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPS-HAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N D I SLD+SP   A  +  P   A      E+ +   IN+++E E DPRELSE P
Sbjct  5    ITLNNDSIYSLDVSP---ALMVIEPLLQAGSISSYEQQLRLEINYEQE-ENDPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP LLDW+AGEL+RYAAMLVPHQ + K G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFVRLDAKYPWLPFLLDWKAGELSRYAAMLVPHQFSSKEGIQYNPEALEIFLMHKI  120

Query  288  FIVYSWL-KQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FI+  WL KQ   +P  RLK+  +A++LG+ + D  F++I+K
Sbjct  121  FILSDWLYKQDIVSP-SRLKS--LAQILGYELDDAFFEMIEK  159



>ref|WP_027401722.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=161

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPS-HAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N D I SLD+SP   A  +  P   A      E+ +   IN+++E E DPRELSE P
Sbjct  5    ITLNNDSIYSLDVSP---ALMVIEPLLQAGNISSYEQQLRLEINYEQE-ENDPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP LLDW+AGEL+RYAAMLVPHQ + K G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFVRLDAKYPWLPFLLDWKAGELSRYAAMLVPHQFSSKEGIQYNPEALEIFLMHKI  120

Query  288  FIVYSWL-KQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FI+  WL KQ   +P  RLK+  +A++LG+ + D  F++I+K
Sbjct  121  FILSDWLYKQDIVSP-SRLKS--LAQILGYELDDAFFEMIEK  159



>ref|WP_029636387.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=157

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP   +T I+           E+ + F IN+ +E + DPRELSE PE
Sbjct  5    IALNTDCINNLDLSP--ASTVISQLLEDGAIASHEQQLHFEINYSQE-KSDPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA YPWLP LLDW+AGEL RY AMLVPHQ + K G+ +NPEALE+F+M+++F
Sbjct  62   VRLWFLRLDARYPWLPFLLDWKAGELVRYVAMLVPHQFSQKEGIQYNPEALEIFLMQRIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I+  WLKQ  G P  + + K MA++LG+ + D LF +
Sbjct  122  ILSDWLKQQ-GIP-NQFRLKSMAQLLGYDLDDTLFGM  156



>ref|WP_026719968.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=157

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTIN-FKREDEYDPRELSEFP  469
            + +N D I +LDLSP    T I            E+ + F IN F++ED  DPRELSE P
Sbjct  5    IAVNSDFIHNLDLSPV--TTVIEKLLQEGAIASHEQQLHFDINYFQQED--DPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPW P LLDW+ GE ARY AMLVPHQ N K G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFVRLDARYPWFPFLLDWKTGEFARYTAMLVPHQFNSKEGIQYNPEALEIFLMHKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            F++  WLKQH      RL++  MA+MLG+ + D+ F
Sbjct  121  FVLSDWLKQHNIPSQSRLQS--MAQMLGYELDDDFF  154



>ref|WP_019507614.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=158

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSP--SHAKPKDFVERTIGFTINFKREDEYDPRELSE  475
            ++V+    +  L+LS  + A    SP     K  D+ E+ + F I+++RE + DPRELSE
Sbjct  4    KLVLETQALHDLNLSVVKEAL---SPLLQDNKIADY-EQQLQFAIDYQREAD-DPRELSE  58

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PEIRLWFVRLD+ YPWLP LLDW+AGELARY AMLVPHQ N   G++FNPEALELFVM 
Sbjct  59   IPEIRLWFVRLDSVYPWLPFLLDWKAGELARYVAMLVPHQFNRSEGIIFNPEALELFVMN  118

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            K+F++  WL+Q       RLK+  MA++ G+ + D  F++I
Sbjct  119  KIFVLSDWLQQQNIPARSRLKS--MAQLFGYELDDAFFEMI  157



>ref|WP_009630909.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=157

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 109/161 (68%), Gaps = 17/161 (11%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNA------TGITSPSHAKPKDFVERTIGFTINFKREDEYDPRE  484
            + +N ++I SLDL+P Q        TG+ +          E+ + FTI++ +E E DPRE
Sbjct  5    IALNSEIINSLDLAPVQTVIDNLLTTGVIAA--------YEQQLSFTIDYPQEPE-DPRE  55

Query  483  LSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELF  304
            L E PEIRLWF+RLD+ YPWLP LLDW+AGELARY AMLVPHQ +   G+ FNPEALE+F
Sbjct  56   LPEIPEIRLWFIRLDSRYPWLPFLLDWKAGELARYTAMLVPHQFSASEGLQFNPEALEIF  115

Query  303  VMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            +M K+F++  WL Q+      RLK+  MA+MLG+ + DELF
Sbjct  116  LMHKLFVLGDWLPQYSINSPSRLKS--MAQMLGYDLEDELF  154



>ref|WP_008186432.1| hypothetical protein [Moorea producens]
 gb|EGJ31621.1| hypothetical protein LYNGBM3L_35870 [Moorea producens 3L]
Length=167

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N +  ++LDLSP Q          A      E+ +GF I+F  + E DPRE SE PE
Sbjct  5    ISLNTNHFQTLDLSPAQTVVEGWLQDGAIAN--YEQQLGFKIDFDCDPE-DPREFSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDATYPWLP LLDW++GE  RY AMLVPHQ N   G+ +N EALE+FVM+K+F
Sbjct  62   VRLWFVRLDATYPWLPFLLDWKSGEFVRYTAMLVPHQFNRTEGIQYNSEALEIFVMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            ++  WLKQ       RLK+  MA++LG+ + D LFDLI+
Sbjct  122  VLSQWLKQWGIQSQSRLKS--MAQLLGYELDDTLFDLIE  158



>ref|WP_016872678.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=157

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 105/157 (67%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLDLSP    T I            E+ + F IN+  E   DPRELSE PE
Sbjct  5    ITLNSDSINSLDLSP--ATTVIEQLLQEGAIATYEQQLRFDINYALEPN-DPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD  YPWLP LLDW+AGELARYAAMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   LRLWFIRLDTRYPWLPFLLDWKAGELARYAAMLVPHQFSSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++  WLKQ       RL++  MA+MLG+ + D LF++
Sbjct  122  MLSDWLKQQNIPGKSRLQS--MAQMLGYELDDALFEI  156



>ref|WP_015083114.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_007000615.1| hypothetical protein ANA_C20099 [Anabaena sp. 90]
 gb|AFW96558.1| hypothetical protein ANA_C20099 [Anabaena sp. 90]
Length=162

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV-ERTIGFTINFKREDEYDPRELSEFP  469
            + +N + I SLD+SP   A  +  P   +      E+ +   I F+RE   DPRELSE P
Sbjct  5    ITLNNNSIYSLDVSP---ALTVIEPLLQQGSISTHEQQLRLEIQFEREAN-DPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP LLDW+AGELARYAAMLVPHQ + K G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFVRLDAKYPWLPFLLDWKAGELARYAAMLVPHQFSSKEGIQYNPEALEIFLMHKI  120

Query  288  FIVYSWL-KQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FI+  WL KQ   +P  RLK+  +A++LG+ + D  F++I+K
Sbjct  121  FILSDWLHKQDIASP-SRLKS--LAQILGYELDDAFFEMIEK  159



>ref|WP_037216183.1| hypothetical protein [Richelia intracellularis]
 emb|CDN10005.1| expressed protein [Richelia intracellularis]
Length=159

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + I SLDLSP            A      E+ I F  N++RE E DPRELSE PE
Sbjct  5    IALNNECINSLDLSPATKVIENILQQEAIASS--EQEIQFVFNYEREPE-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLP LLDW +GE  RY  MLVPHQ + + G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFIRLDSLYPWLPFLLDWTSGEFIRYTTMLVPHQFSSQEGIQYNPEALEIFLMHKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            ++ +WL +  G PF R + + MA++LG+ + D LFDL D 
Sbjct  122  VLTNWLGEQ-GIPF-RSRIQSMAKLLGYELDDALFDLFDN  159



>ref|WP_006631999.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK89314.1| Domain of unknown function DUF1817 [Microcoleus vaginatus FGP-2]
Length=161

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + I+ D I SLDLSP +          A  ++  E+ + F I + RE E DPRE+SE PE
Sbjct  5    IAIDADRINSLDLSPVRTVIEKWLAEGAIAQN--EQQLQFEIEYPRE-ELDPREISEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA YPWLP LLDW+AGELARYAAMLVPHQ +   G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFIRLDACYPWLPFLLDWKAGELARYAAMLVPHQFHRTQGIQYNPEALEMFLMNKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++  WL Q  G P  + K   M++M G+ + D  FD+I
Sbjct  122  VLTDWLNQQ-GIP-SKSKLMAMSQMFGYDLEDAFFDVI  157



>ref|WP_015179478.1| protein of unknown function DUF1817 [Oscillatoria nigro-viridis]
 ref|YP_007118694.1| protein of unknown function DUF1817 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ10278.1| protein of unknown function DUF1817 [Oscillatoria nigro-viridis 
PCC 7112]
Length=161

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + I+ D I SLDLSP + A        A  ++  E+ + F I + RE E DPRE+SE PE
Sbjct  5    ISIDADRINSLDLSPVRTAIEKWLAEGAIAQN--EQQLKFEIEYPRE-ELDPREISEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA YPWLP LLDW+AGELARYAAMLVPHQ +   G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFIRLDACYPWLPFLLDWKAGELARYAAMLVPHQFHPTQGIQYNPEALEMFLMNKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++  WL Q  G P  + K   M++M G+ + D  FD+I
Sbjct  122  VLTDWLNQQ-GIP-SKSKLMAMSQMFGYDLEDAFFDVI  157



>ref|WP_017296008.1| hypothetical protein [Geminocystis herdmanii]
Length=158

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN++ I +LDLSP +  T I      +    +E+ + F I++ RED  DPRELSE PE
Sbjct  5    ISINKNHINNLDLSPVK--TIIEDVEKCQEILTLEQQLIFKIDYLREDN-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+ LD+ YPWLP  L+WR GELARY AMLVPHQ N   G+ +N EAL++FVM+K F
Sbjct  62   IRLWFIALDSLYPWLPFALNWREGELARYTAMLVPHQFNRSEGIQYNQEALDIFVMQKTF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I++SWL+Q+  T   RLK   M ++ G+ + DE FDL+
Sbjct  122  ILHSWLRQNNLTGNSRLKA--MTQIFGYDLDDEFFDLL  157



>ref|WP_006277118.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA69931.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=159

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++ D I +LDLSP      I S    +     E+ + F I++ R+D+ DPRE+SE PE
Sbjct  5    IQVSRDSINNLDLSPALKV--IESILQKESIISQEQQLRFDIDYPRQDD-DPREISEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPWLP LLDW++GEL RY AMLVPH+ + K G+ +NPE+LE+F+M K+F
Sbjct  62   IRLWFVRLDAQYPWLPFLLDWKSGELGRYTAMLVPHEFHKKEGIQYNPESLEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            I+ +WLKQ+   P  R + K +A+MLG+ + D  F++ID
Sbjct  122  ILSNWLKQN-QIP-ARFRLKSLAQMLGYELEDGFFEMID  158



>ref|WP_039748768.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF33073.1| hypothetical protein PI95_33645 [Hassallia byssoidea VB512170]
Length=157

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP   +T I+           E+ + F IN+ +E   DPRELSE PE
Sbjct  5    IALNTDCINNLDLSP--ASTVISQLLEDGAIASHEQQLHFEINYSQEPG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA YPWLP LLDW+AGEL RY AMLVPHQ + K G+ +NPEALE+F+M+++F
Sbjct  62   VRLWFLRLDARYPWLPFLLDWKAGELVRYVAMLVPHQFSEKEGIQYNPEALEIFLMQRIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I+  W KQ  G P  + + K MA++LG+ + D LF++
Sbjct  122  ILSDWFKQQ-GIP-NQFRLKSMAQLLGYDLDDALFEM  156



>gb|EKQ69676.1| hypothetical protein OsccyDRAFT_2317 [Oscillatoriales cyanobacterium 
JSC-12]
Length=180

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +  D I +LDLSP Q          A      E+ I F IN  RE + DPRE+SE PE
Sbjct  5    IALTADHINTLDLSPVQTVVEPLLRQAAIATS--EQQIQFQINIPREPD-DPREVSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPW P LLDW+AGELARYAAMLVPHQ + + G+ +NPEALE+FVM K+F
Sbjct  62   IRLWFVRLDAFYPWFPFLLDWKAGELARYAAMLVPHQFHPREGIQYNPEALEIFVMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WL+Q       RLK+  M +MLG+ + ++ F+L+
Sbjct  122  ILAEWLRQQGIEGTSRLKS--MTQMLGYDLDNDFFNLL  157



>ref|WP_015111941.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007048857.1| hypothetical protein Nos7107_1050 [Nostoc sp. PCC 7107]
 gb|AFY41707.1| protein of unknown function DUF1817 [Nostoc sp. PCC 7107]
Length=156

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 6/157 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP   A  +  P   +     E+ + F I++  E   DPRELSE PE
Sbjct  5    IALNTDSINTLDLSP---ALTVIEPLLQEGVAAYEQQLSFDIDYPLEAG-DPRELSEIPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA YPWLP LLDW+AGELARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  61   LRLWFIRLDAKYPWLPFLLDWKAGELARYTAMLVPHQFSTKEGIQYNPEALEIFLMHKIF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++ +WLKQ       RLK+  MA+ LG+ + D  F++
Sbjct  121  VLTNWLKQQEIPSSARLKS--MAQTLGYELDDGFFEM  155



>ref|WP_036530487.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF73888.1| hypothetical protein DO97_05890 [Neosynechococcus sphagnicola 
sy1]
Length=159

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 112/160 (70%), Gaps = 9/160 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSP-SHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + ++ + I+ LDLSP   A GI  P S  +  D   + +   I++ R D  DPRELSE P
Sbjct  5    ITVDTEAIQRLDLSP---AEGILKPLSTLEAPD--SQLLQLQIDYVR-DADDPRELSEIP  58

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLD+ YPWLP+ LDW+AGEL RY AMLVPHQ + + G+ FNPEALE+F+M+K+
Sbjct  59   EVRLWFIRLDSRYPWLPLYLDWQAGELGRYTAMLVPHQFSAREGIQFNPEALEIFLMQKI  118

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            F++  WLKQ  G+P  R + K MA++LG+ + D  F++ID
Sbjct  119  FVLTDWLKQQ-GSP-RRARLKAMAQILGYELDDGFFEVID  156



>ref|WP_036616572.1| hypothetical protein, partial [Oscillatoriales cyanobacterium 
JSC-12]
Length=156

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 104/157 (66%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +  D I +LDLSP Q          A      E+ I F IN  RE + DPRE+SE PE
Sbjct  5    IALTADHINTLDLSPVQTVVEPLLRQAAIATS--EQQIQFQINIPREPD-DPREVSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPW P LLDW+AGELARYAAMLVPHQ + + G+ +NPEALE+FVM K+F
Sbjct  62   IRLWFVRLDAFYPWFPFLLDWKAGELARYAAMLVPHQFHPREGIQYNPEALEIFVMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I+  WL+Q       RLK+  M +MLG+ + ++ F+L
Sbjct  122  ILAEWLRQQGIEGTSRLKS--MTQMLGYDLDNDFFNL  156



>ref|WP_009459438.1| hypothetical protein [Fischerella sp. JSC-11]
 gb|EHC09394.1| protein of unknown function DUF1817 [Fischerella sp. JSC-11]
Length=157

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLDLSP   AT I            E+ + F IN+ ++++ DPRE  E PE
Sbjct  5    IALNSDSINSLDLSPV--ATVIEQLLQQGAIASYEQQLRFDINYSQQED-DPREFPEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+ GE ARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDARYPWLPFLLDWKTGEFARYTAMLVPHQFSSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            I+  WLKQH      RL++  MA+MLG+ + DE F
Sbjct  122  ILSDWLKQHNIPSKSRLQS--MAQMLGYEL-DESF  153



>ref|WP_015145884.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007083146.1| hypothetical protein Ple7327_4488 [Pleurocapsa sp. PCC 7327]
 gb|AFY79589.1| hypothetical protein Ple7327_4488 [Pleurocapsa sp. PCC 7327]
Length=156

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++ + +  LDLSP +          A      E+ I F  N+ R D  DPRELSE PE
Sbjct  4    ITLDRECLHGLDLSPVREVVNRLFKQGAIATS--EQQISFDFNYPR-DPADPRELSEIPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPW+P LLDW+AGELARYAAMLVPHQ N   G+ +NPEALE+FVM KVF
Sbjct  61   IRLWFVRLDAAYPWMPFLLDWKAGELARYAAMLVPHQFNRSEGIRYNPEALEIFVMHKVF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WLKQ  G P  + + + MA+M G+ + +    L+
Sbjct  121  ILADWLKQQ-GIP-SQSRLQSMAQMFGYELDESFLKLL  156



>ref|WP_028090849.1| hypothetical protein [Dolichospermum circinale]
Length=162

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 114/162 (70%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPK-DFVERTIGFTINFKREDEYDPRELSEFP  469
            +++N D I +LDLS   +A  +  P   +      E+ +   IN++R    DPRELSE P
Sbjct  5    IILNNDSIYNLDLS---SALMVIEPLLQEGNISSYEQQLRLDINYERVAN-DPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP LLDW+AGELARYAAMLVPHQ + K G+ +NPEALE+F+M+K+
Sbjct  61   EVRLWFVRLDAKYPWLPFLLDWKAGELARYAAMLVPHQFSSKEGIQYNPEALEIFLMQKI  120

Query  288  FIVYSWL-KQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            FI+  WL KQ   +P  RLK+  +A++LG+ + D  F++I+K
Sbjct  121  FILSDWLHKQDIVSP-SRLKS--LAQVLGYELDDAFFEMIEK  159



>ref|WP_015954406.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002377670.1| hypothetical protein PCC7424_2381 [Cyanothece sp. PCC 7424]
 gb|ACK70802.1| Domain of unknown function DUF1817 [Cyanothece sp. PCC 7424]
Length=157

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N++ ++ LD+SP    T + +          E+ I F IN++R DE DPRELSE PE
Sbjct  4    IELNQNSLQKLDISPV--TTIVETLLEEGTITSQEQKITFKINYER-DETDPRELSEIPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLD+ YPW P LLDW+AGELARY AMLVPHQ +   G+ +N EALE+FVM KVF
Sbjct  61   IRLWFVRLDSIYPWFPFLLDWKAGELARYTAMLVPHQFHRTEGIQYNLEALEIFVMNKVF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WLK+       RLK+  MA++ G+ + D+ F+L+
Sbjct  121  ILNDWLKKQNIPSHYRLKS--MAQIFGYELDDQFFELL  156



>ref|WP_012411315.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001868304.1| hypothetical protein Npun_F5018 [Nostoc punctiforme PCC 73102]
 gb|ACC83361.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=161

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP   A+ +            E+ + F IN+  E   DPRELSE PE
Sbjct  10   IALNNDFINNLDLSP---ASTVIEQLLRDGAASHEQQLRFDINYDLEPG-DPRELSEIPE  65

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPWL  LLDW+AGE ARYAAMLVPHQ + + G+ +NPEALE+F+M K+F
Sbjct  66   IRLWFVRLDAKYPWLAFLLDWKAGEFARYAAMLVPHQFSSQDGIQYNPEALEIFLMHKIF  125

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I+  WLKQ       RLK+  MA+MLG+ + D  F++
Sbjct  126  ILGDWLKQQDIPSLSRLKS--MAQMLGYELDDAFFEI  160



>ref|WP_015128076.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007065093.1| hypothetical protein Cal7507_1804 [Calothrix sp. PCC 7507]
 gb|AFY32259.1| protein of unknown function DUF1817 [Calothrix sp. PCC 7507]
Length=157

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 5/159 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ IN D I +LDLSP            A      E+ + F IN+  E   DPRELSE P
Sbjct  4    KIAINTDSINNLDLSPASTVMEKLQQDGAIASH--EQHLQFEINYALEPG-DPRELSEVP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWLP LLDW+ GE ARY AMLVPHQ N K G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFLRLDARYPWLPFLLDWKVGEFARYTAMLVPHQFNPKEGIQYNPEALEIFLMHKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            FI+  WLKQ       RLK+  MA+MLG+ + D+ F ++
Sbjct  121  FILSDWLKQQSIPSQSRLKS--MAQMLGYELEDDFFAIL  157



>ref|WP_015196559.1| hypothetical protein [Calothrix parietina]
 ref|YP_007135877.1| hypothetical protein Cal6303_0839 [Calothrix sp. PCC 6303]
 gb|AFY99904.1| protein of unknown function DUF1817 [Calothrix sp. PCC 6303]
Length=159

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 106/160 (66%), Gaps = 11/160 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV---ERTIGFTINFKREDEYDPRELSE  475
            + +  D I +LDLSP      IT        D +   E+ +   +N+  E   DPRELSE
Sbjct  5    IALTTDDINTLDLSP-----AITIIERLLATDAIASSEQQLSIQVNYALEPN-DPRELSE  58

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PEIRLWFVRLD+ YPWLP LLDW+AGELARYAAMLVPHQ + K G+ +NPEALE+F+M 
Sbjct  59   IPEIRLWFVRLDSRYPWLPFLLDWKAGELARYAAMLVPHQFSSKEGIQYNPEALEIFLMH  118

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            K+F++  WLKQ       RLK+  MA++LG+ + D LF++
Sbjct  119  KIFVLTDWLKQQNIPHQSRLKS--MAQLLGYELDDTLFEI  156



>ref|WP_016867022.1| hypothetical protein [Fischerella muscicola]
Length=157

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLDLSP   AT I            E+ + F IN+ ++ E DPREL E PE
Sbjct  5    IALNSDSINSLDLSPV--ATVIEQLLQEGAIASHEQQLRFDINYSQQ-EGDPRELPEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+ GELARY AMLVPHQ + K G+ +N EALE+F+M K+F
Sbjct  62   VRLWFVRLDARYPWLPFLLDWKTGELARYTAMLVPHQFSSKEGIQYNHEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I+  WLKQH      RL +  MA+MLG+ + +  F +
Sbjct  122  ILSDWLKQHNIPSQSRLHS--MAQMLGYELDESFFAM  156



>ref|WP_016871401.1| hypothetical protein [Fischerella thermalis]
Length=157

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLDLSP   AT I            E+ + F IN+ ++++ DPRE  E PE
Sbjct  5    IALNSDSINSLDLSPV--ATVIEQLLQQGVIASYEQQLRFDINYSQQED-DPREFPEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+ GE ARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDARYPWLPFLLDWKTGEFARYTAMLVPHQFSSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            I+  WLKQH      RL++  MA+MLG+ + DE F
Sbjct  122  ILSDWLKQHNIPSKSRLQS--MAQMLGYEL-DESF  153



>ref|WP_009342725.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA73324.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=159

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +  D I +LDLSP         P  +      E+ + F I++ R+D  DPRE+SE PE
Sbjct  5    IQVGRDSINNLDLSPALKVIESILPKESIISQ--EQQLRFDIDYPRQDN-DPREISEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPWLP LLDW++GEL  Y AMLVPH+ + K G+ +NPEALE+F+M K+F
Sbjct  62   IRLWFVRLDAQYPWLPFLLDWKSGELGLYTAMLVPHEFHKKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            I+ +WLKQ+   P  R + K +A+MLG+ + D  F++ID
Sbjct  122  ILSNWLKQN-QIP-ARFRLKSLAQMLGYELEDGFFEMID  158



>ref|WP_023065290.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT08466.1| hypothetical protein M595_1506 [Lyngbya aestuarii BL J]
Length=162

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N   I  LDLSP Q  T I            E+ I F +++ R D  DPRELSE PE
Sbjct  5    IQLNSKFIDHLDLSPAQ--TTIEKLLEQGQIAQSEQQICFEVDYPR-DPQDPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPWLP LLDW+AGELARY AM VPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   IRLWFVRLDARYPWLPFLLDWKAGELARYVAMHVPHQFHRTEGIQYNPEALEIFLMRKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WL Q   +   RLK+  M++MLG+ + + LF+LI
Sbjct  122  ILADWLPQQGISSISRLKS--MSQMLGYDLDEGLFELI  157



>ref|WP_017322417.1| hypothetical protein [cyanobacterium PCC 7702]
Length=157

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLDLSP      I      +     E+ + F I ++ E   DPRE SE PE
Sbjct  5    ITLNSDFINSLDLSPV--TAVIEKWLQQEAIASYEQQLRFEIKYELEAG-DPREFSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLD  YPWLP LLDW+ GELARYAAMLVPHQ   + G+ +NPEALE+F+M K+F
Sbjct  62   IRLWFVRLDTRYPWLPFLLDWKVGELARYAAMLVPHQFTSQQGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WLKQH   P  R + + MA++LG+ + D  F+++
Sbjct  122  ILSDWLKQH-NIP-SRSRLQAMAKLLGYELEDAFFEML  157



>ref|WP_015173061.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007110549.1| hypothetical protein GEI7407_3027 [Geitlerinema sp. PCC 7407]
 gb|AFY67497.1| protein of unknown function DUF1817 [Geitlerinema sp. PCC 7407]
Length=158

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +  D + SLDLSP   A  +  P  A+     E+ + F+I+F R D  DPRELSE P
Sbjct  4    KIHLTSDALYSLDLSP---AEAVLQPLLAEGISAYEQQLQFSIDFPR-DSADPRELSEIP  59

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLD+ YPWLP LLDW+AGEL RY+AMLVPHQ +   G+ +NPEALE+F+M K+
Sbjct  60   EVRLWFVRLDSRYPWLPYLLDWKAGELGRYSAMLVPHQFSPTEGIQYNPEALEIFLMHKI  119

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            F++  W+     +  PRL+    A+MLG+ + + LF L+
Sbjct  120  FVLADWMASQGISAQPRLQG--FAQMLGYDLDEGLFSLV  156



>ref|WP_006105681.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX71519.1| conserved domain protein [Coleofasciculus chthonoplastes PCC 
7420]
Length=163

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 105/160 (66%), Gaps = 9/160 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATG--ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
            + +N   I  LDLSP Q      +T  + A      E+ + F  N+ RE   DPRE SE 
Sbjct  5    IKLNSHSINDLDLSPVQTVIDKWLTEGAIAN----YEQQLRFEFNYPREPN-DPREWSEI  59

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PEIRLWF+RLD  YPWLP LLDW+AGELARY AMLVPHQ N   G+ +NPEALE+F+M+K
Sbjct  60   PEIRLWFIRLDVQYPWLPFLLDWKAGELARYTAMLVPHQFNRTEGIQYNPEALEIFMMQK  119

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            VF+V +WL+Q       RLK+  MA+MLG+ + D LF L+
Sbjct  120  VFVVNNWLQQIDLPNQSRLKS--MAQMLGYELDDTLFQLM  157



>ref|WP_041035946.1| hypothetical protein [Tolypothrix campylonemoides]
 gb|KIJ75743.1| hypothetical protein SD81_14485 [Tolypothrix campylonemoides 
VB511288]
Length=157

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN D I SLDLSP    T I            E+ + F IN+  E   DPRELSE PE
Sbjct  5    IAINTDHINSLDLSPV--VTDIEKLLQEGAIASEEQQLRFDINYSLEPG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +R+WF+RLD  YPWLP LLDW+AGE ARYAAMLVPHQ + + G+ +NPEALE+F+M K+F
Sbjct  62   VRMWFIRLDTRYPWLPFLLDWKAGEFARYAAMLVPHQFSTREGIQYNPEALEIFLMHKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++  WL+Q  G P  + + + MA++LG+ + D LF++
Sbjct  122  VLNDWLQQQ-GIP-SKSRLQSMAQLLGYELDDALFEM  156



>ref|WP_015140048.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007077223.1| hypothetical protein Nos7524_3852 [Nostoc sp. PCC 7524]
 gb|AFY49626.1| hypothetical protein Nos7524_3852 [Nostoc sp. PCC 7524]
Length=157

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 102/157 (65%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN D + SLDLSP            A      E+ + F I++  E   DPRELSE PE
Sbjct  5    IAINTDSVNSLDLSPVNTVIHQLLQEGAVATQ--EQQLQFDIDYPLEPG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPW P LLDW+AGELARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   LRLWFVRLDAKYPWFPFLLDWKAGELARYTAMLVPHQFSAKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
             +  WLKQ       RLK+  MA+MLG+ + D LF++
Sbjct  122  TLSDWLKQQDIPWQSRLKS--MAQMLGYELDDALFEI  156



>ref|WP_017298125.1| hypothetical protein [Nodosilinea nodulosa]
Length=159

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 7/161 (4%)
 Frame = -3

Query  651  YEVVINEDVIRSLDLSPFQNATGITSPSHAKPK-DFVERTIGFTINFKREDEYDPRELSE  475
            + + ++E  +++LDL+P   A  +  P  A+ K    E  + F ++  R D  DPRELSE
Sbjct  3    HTITLHESHLQTLDLAP---AQAVIEPLLAEGKLPHGEIGLRFVVDISR-DPTDPRELSE  58

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE+RLWF+RLD  YPWLP++LDW AGEL RYAAMLVPHQ +   G+ +NPEALE+F+M 
Sbjct  59   LPEVRLWFIRLDTCYPWLPLVLDWEAGELGRYAAMLVPHQFSPTEGIRYNPEALEIFMMA  118

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            K+F++ +WL+    T + RLK   M +MLG+ I D LFDL+
Sbjct  119  KIFVIAAWLQSQGITQYTRLKF--MTQMLGYEIDDGLFDLL  157



>ref|WP_036477050.1| hypothetical protein [Myxosarcina sp. GI1]
Length=158

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = -3

Query  651  YEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
            + + ++   I  LDL+   N T +    + +   + E+ +   I+++R D  DPRELSE 
Sbjct  3    FNIALDNQKIDRLDLTDVHN-TIVPLLENNRIASY-EQQLRLKIDYQR-DATDPRELSEI  59

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            P IRLW VRLDA YPWLP LLDW+AGELARY AMLVPHQ N   G++FNPEALE+FVM K
Sbjct  60   PTIRLWHVRLDAAYPWLPFLLDWKAGELARYGAMLVPHQFNRSEGIIFNPEALEIFVMNK  119

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +F++  WL+Q   T  P+L+ K +A+  G+ I D  F++I
Sbjct  120  IFVLSDWLRQQEIT--PQLRLKSLAQSFGYDIDDAFFEMI  157



>ref|WP_027842981.1| hypothetical protein [Mastigocoleus testarum]
Length=166

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 107/164 (65%), Gaps = 9/164 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSH---AKPKDFV---ERTIGFTINFKREDEYDPRE  484
            ++IN   I SLDLSP +         H   A  K+ +   E+ + F I +  E   DPRE
Sbjct  4    ILINSQSINSLDLSPAKKIIDPILKQHGDEAIAKEAIQSLEQQLSFKIEYPLEPG-DPRE  62

Query  483  LSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELF  304
            +SE PEIRLWFVRLDA YPWLP  LDW++GE  RYAAMLVPHQ N K G+ +NPEALE+F
Sbjct  63   ISEIPEIRLWFVRLDACYPWLPWFLDWQSGEFVRYAAMLVPHQFNSKEGIQYNPEALEIF  122

Query  303  VMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +M+K+FI+  WL Q Y  P    + K MA++LG+ + D LF+++
Sbjct  123  LMQKIFILSDWL-QTYSIPSSS-RLKSMAQLLGYDLDDALFEML  164



>ref|WP_009784176.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW37196.1| hypothetical protein L8106_10987 [Lyngbya sp. PCC 8106]
Length=162

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N   I  LDL P Q  T I            E+ I F +++ R D  DPRELSE PE
Sbjct  5    IQLNSKSIDQLDLLPAQ--TTIEKLLKQGQIAQSEQQIRFEVDYPR-DPQDPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLDA YPW P LLDW+AGELARY AM VPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   IRLWFVRLDARYPWFPFLLDWKAGELARYVAMHVPHQFHRTEGIQYNPEALEIFLMRKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WL Q   +   RLK+  M++MLG+ + D LF+LI
Sbjct  122  ILADWLPQQGISSISRLKS--MSQMLGYDLDDGLFELI  157



>ref|WP_007357170.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN57980.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=161

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + I +LDLS  Q          A      E+ + F I++ R D  DPRELSE PE
Sbjct  5    ISLNSECINNLDLSSVQTVIEKWLEEGAIASS--EQQLKFEIDYPR-DPLDPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLDA+YPWLP LLDW+ GELARYAAMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFIRLDASYPWLPFLLDWKGGELARYAAMLVPHQFHKKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++  WL Q       +L +  M++M G+ + D  FDLI
Sbjct  122  VLTDWLNQQGIAGKSKLMS--MSQMFGYDLDDGFFDLI  157



>ref|WP_011610449.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_720528.1| hypothetical protein Tery_0611 [Trichodesmium erythraeum IMS101]
 gb|ABG50055.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=159

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPS-HAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N + I +LDLSPF+   G+  P  +       E+ + F IN+ +E + DPRELSE P
Sbjct  5    ITVNTEQIHNLDLSPFE---GVIYPILNEGTIASSEQQLNFAINYYQEPQ-DPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLD+ YPWLP LL+W+ GEL+RY AMLVPHQ +   G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFIRLDSCYPWLPFLLNWKMGELSRYTAMLVPHQFHRTEGIQYNPEALEIFLMHKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+ +WL +H+ +   RL +  M++MLG+ + +E F
Sbjct  121  FILRNWLNKHHISSKSRLMS--MSQMLGYDLTEEFF  154



>ref|WP_006511925.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS00964.1| hypothetical protein Xen7305DRAFT_00006650 [Xenococcus sp. PCC 
7305]
Length=158

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 105/156 (67%), Gaps = 5/156 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++ ++I SLDLS  +       PS     ++ E+ + FTIN++   E DPRELSE PE
Sbjct  5    INLDTNIIDSLDLSSIKKMIA-ELPSDKAIAEY-EQKLKFTINYQLS-ETDPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLD  YPWLP LLDW+ GELARY+AMLVPHQ +   G+++NPEALE+FVM+K+F
Sbjct  62   IRLWFVRLDGMYPWLPFLLDWKTGELARYSAMLVPHQFSRSEGIIYNPEALEIFVMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            I+  WL +       RLK+   A++ G+ I D  FD
Sbjct  122  ILSDWLGERDIPSNFRLKS--FAKLFGYEIDDTFFD  155



>ref|WP_011319198.1| hypothetical protein [Anabaena variabilis]
 ref|YP_322928.1| hypothetical protein Ava_2416 [Anabaena variabilis ATCC 29413]
 gb|ABA22033.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=157

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 100/157 (64%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D + +LDLSP      I            E+ + F I +  E   DPRELSE PE
Sbjct  5    IALNTDTVNTLDLSPAHQV--INQLLQEGNIASHEQQLSFAIEYTLEPG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+ GEL RY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   LRLWFVRLDAKYPWLPFLLDWKTGELGRYTAMLVPHQFSAKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++  WLKQ       RLK+  MA+MLG+ + D  F++
Sbjct  122  VLSDWLKQQQIPSQSRLKS--MAQMLGYELEDAFFEM  156



>ref|WP_026796843.1| hypothetical protein [Planktothrix prolifica]
Length=161

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + +  LDLSP Q  T I S S        E+ I F I++ R+ E DPRE+SE PE
Sbjct  5    IKLNSEQVNRLDLSPVQ--TVIDSLSKNNDITAYEQQISFEIDYPRDPE-DPREISEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLDA YPWLP+ LDW++GELARY AMLVPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   IRLWFIRLDAQYPWLPLFLDWKSGELARYVAMLVPHQFHRTEGIQYNPEALEIFLMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            I+  W  Q+      RL    MA+MLG+ + D  F+
Sbjct  122  ILDHWFTQNNLPSKSRLMA--MAQMLGYDLDDTFFE  155



>ref|WP_010999293.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_489209.1| hypothetical protein all5169 [Nostoc sp. PCC 7120]
 dbj|BAB76868.1| all5169 [Nostoc sp. PCC 7120]
Length=157

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D + +LDLSP      I            E+ + F I +  E   DPRELSE PE
Sbjct  5    IALNTDTVNNLDLSPAHQV--INQLLQEGNIASHEQQLSFAIEYTLEPG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+AGEL RY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   LRLWFVRLDAKYPWLPFLLDWKAGELGRYTAMLVPHQFSAKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++  WLK+       RLK+  MA+MLG+ + D  F++
Sbjct  122  VLSDWLKEQKIPSQSRLKS--MAQMLGYELEDGFFEM  156



>ref|WP_035999280.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=158

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 107/161 (66%), Gaps = 10/161 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATG--ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
            + +N D I +LDL+P Q      I   S A      E+ I F I+F +E E DPRELSE 
Sbjct  5    ITLNADAIHTLDLAPAQAVIEPWIKDGSVANH----EQEIRFVIDFPQEPE-DPRELSEI  59

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE+RLWFVRLDA YPWLP LLDW A EL RY AMLVPHQ +   G+ FNPEALE+F+M+K
Sbjct  60   PEVRLWFVRLDANYPWLPFLLDWEAQELGRYTAMLVPHQFSSS-GIEFNPEALEIFLMQK  118

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            +F++ +W+ Q  G    R K K MA+ML + + D+ FDL++
Sbjct  119  IFVLANWM-QEQGIA-SRTKLKFMAQMLSYELDDDFFDLLN  157



>gb|KEI67783.1| hypothetical protein A19Y_2933 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=161

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 103/156 (66%), Gaps = 5/156 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + +  LDLSP Q  T I S S        E+ I F I++ R+ E DPRE+SE PE
Sbjct  5    IKLNSEQVNRLDLSPVQ--TVIDSLSKNNDITAYEQQISFEIDYPRDPE-DPREISEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLDA YPWLP  LDW++GELARY AMLVPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   IRLWFIRLDAQYPWLPFFLDWKSGELARYVAMLVPHQFHRTEGIQYNPEALEIFLMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            I+  W  Q+      RL    MA+MLG+ + D  F+
Sbjct  122  ILDHWFTQNNLPSKSRLMA--MAQMLGYDLDDTFFE  155



>ref|WP_016859816.1| hypothetical protein [Fischerella muscicola]
Length=158

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 101/159 (64%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP    T I            E+ + F IN+ ++ E DPREL E PE
Sbjct  5    IALNSDSIHNLDLSPV--TTVIEQLLQEGAIASHEQQLHFDINYSQQ-EGDPRELPEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPW P LLDW+ GE ARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDARYPWFPFLLDWKMGEFARYTAMLVPHQFSSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
             +  W KQH      RL++  MA+MLG+ + D  F + +
Sbjct  122  TLSDWFKQHNIPSQSRLQS--MAQMLGYELDDAFFAIFE  158



>ref|WP_026736512.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=157

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLSP   AT I            E+ + F I++  E   DPREL E PE
Sbjct  5    IALNSDSINALDLSP--AATVIEQLLQEGAIASHEQQLRFEIDYPLEPG-DPRELPEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+AGE ARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDARYPWLPFLLDWKAGEFARYTAMLVPHQFSSKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++  WLKQ       RL++  MA+MLG+ + D  F++
Sbjct  122  LLSDWLKQQSIPSRSRLQS--MAQMLGYELEDAFFEM  156



>ref|WP_015203012.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007142406.1| hypothetical protein Cri9333_2017 [Crinalium epipsammum PCC 9333]
 gb|AFZ12896.1| protein of unknown function DUF1817 [Crinalium epipsammum PCC 
9333]
Length=165

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATG--ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
            + +  + ++ LDLS  +      + +  +      +E+ I F I + RE E DPRELSE 
Sbjct  5    ITLTSECLQKLDLSSVKTIINPLLQATDNKSAFTSLEQQITFNIEYAREPE-DPRELSEI  63

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE+RLWF+RLDA+YPW P+LLDW++GELARYA MLVPHQ N K G+ +NPEALE+FVM+K
Sbjct  64   PEVRLWFIRLDASYPWFPLLLDWKSGELARYAGMLVPHQFNRKEGIQYNPEALEIFVMQK  123

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            +F++  W+         R+ +  M +M G+ + D  F+
Sbjct  124  IFVLMDWMNSQGIESNSRINS--MIQMFGYELDDAFFE  159



>ref|WP_014274929.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005068078.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI89540.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=161

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++   I  LDLSP  N         +KP    E  I F I++  +D+ DPRELSE PE
Sbjct  5    ITLDSHCINHLDLSPVDNVVK-QLIQESKPM-IAEPEISFEIDYPLDDQ-DPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+ +D+ YPWLP +LDWR+GEL RY AMLVPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   VRLWFICVDSQYPWLPYVLDWRSGELPRYVAMLVPHQFHASEGIQYNPEALEIFLMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            ++  WL Q  G P  R + + MA+MLG+ + + LFDLI++
Sbjct  122  VITRWL-QDMGLP-SRSRLQSMAQMLGYDLDEGLFDLIEQ  159



>ref|WP_039729456.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF16661.1| hypothetical protein QP59_24935 [Aphanocapsa montana BDHKU210001]
 gb|KIF39055.1| hypothetical protein QQ91_17890 [Lyngbya confervoides BDU141951]
Length=159

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 102/157 (65%), Gaps = 7/157 (4%)
 Frame = -3

Query  639  INEDVIRSLDLSPFQNATGITSPSHAKPKDFV-ERTIGFTINFKREDEYDPRELSEFPEI  463
            +  D + +LDLS    A     P   K      E  I F I+F RE   DPRELSE PE+
Sbjct  7    LTADTLYTLDLS---GAQAYIEPLIEKGNLLDPEVRIQFEIDFPREPT-DPRELSEIPEV  62

Query  462  RLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFI  283
            RLWF+RLDA YPWLP +LDW AGEL RYAAMLVPHQ + K G+ +NPEALE+FVM+K+F+
Sbjct  63   RLWFIRLDALYPWLPYVLDWEAGELGRYAAMLVPHQFSPKDGIRYNPEALEIFVMQKIFV  122

Query  282  VYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            V +WL+        RLK   M +MLG+ I D LF+L+
Sbjct  123  VSNWLRSQNNAQTTRLKF--MTQMLGYEIEDGLFELL  157



>gb|KIJ82873.1| hypothetical protein SD80_14430 [Scytonema tolypothrichoides 
VB-61278]
Length=157

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLD+SP    T I            E+ + F I++  E   DPRELSE PE
Sbjct  5    ITLNTDCINSLDVSPV--VTEIEKLLQEGAIASYEQQLHFDIDYTLEPG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD  YPWLP LLDW+ GE ARYAAMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFIRLDTRYPWLPFLLDWKTGEFARYAAMLVPHQFSTKEGIQYNPEALEIFLMHKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
             +  WL+Q  G P  + + + MA++LG+ + D LF++
Sbjct  122  ALNDWLQQQ-GIP-SKSRLQSMAQLLGYELDDALFEM  156



>ref|WP_038331117.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=156

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 104/160 (65%), Gaps = 11/160 (7%)
 Frame = -3

Query  645  VVINEDV--IRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
            V+I+ D   I+SLDLSP Q A    SP        +E+ + F IN+ RE   DPRELSE 
Sbjct  6    VIISLDAKQIQSLDLSPVQGAIASASPVS------LEKQVSFEINYPREPN-DPRELSEI  58

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PEIRLWFVRLDA YPW   LLD +AGEL RY AMLVPHQ +   G+ +NPEALE+FVM+K
Sbjct  59   PEIRLWFVRLDAAYPWFLFLLDGQAGELYRYVAMLVPHQFSRTEGIQYNPEALEIFVMQK  118

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +FI+  WLKQ    P P  K + +A+ LG+ +    F ++
Sbjct  119  MFILSDWLKQQ-NIPSPA-KLQALAQALGYELDRSFFAVL  156



>gb|KIE13309.1| hypothetical protein DA73_0208105 [Tolypothrix bouteillei VB521301]
Length=157

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 107/158 (68%), Gaps = 7/158 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNAT-GITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N + I SLDLSP  +    +       P+   E+ + F I++  E + DPRELSE P
Sbjct  5    IALNTEHINSLDLSPAVSVIEKLVQEGAIAPQ---EQQLCFEIDYPLE-QGDPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWLP LLDW+AGEL RY AMLVPHQ + + G+ +NPEALE+F+M K+
Sbjct  61   ELRLWFIRLDARYPWLPFLLDWKAGELVRYTAMLVPHQFSRREGIQYNPEALEIFLMHKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            F +  WL+Q  G P  + + + MA++LG+ + D LF+L
Sbjct  121  FFLTDWLRQQ-GIP-SKARLQSMAQLLGYELDDALFEL  156



>ref|WP_015189115.1| protein of unknown function DUF1817 [Gloeocapsa sp. PCC 7428]
 ref|YP_007128403.1| protein of unknown function DUF1817 [Gloeocapsa sp. PCC 7428]
 gb|AFZ31243.1| protein of unknown function DUF1817 [Gloeocapsa sp. PCC 7428]
Length=156

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 6/157 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++ + I +LDLSP Q  T I +   A      E+ + F I++ RE + DPRELSE PE
Sbjct  5    IALHFEQINTLDLSPAQ--TAIENLLQAGTIATHEQQLRFEIDYPREPD-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLDA YPWLP LLDW  GELARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   IRLWFIRLDAQYPWLPFLLDW-TGELARYTAMLVPHQFSAKEGIQYNPEALEIFLMHKIF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I++ W++Q  G P  R + K + +M G+ + D  F++
Sbjct  121  ILHDWMQQQ-GIP-SRSRLKSIGQMFGYDLEDTFFEM  155



>ref|WP_035736296.1| hypothetical protein [Arthrospira platensis]
 gb|KDR57719.1| hypothetical protein APPUASWS_009260 [Arthrospira platensis str. 
Paraca]
Length=161

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++   I  LDLSP  N         +KP    E  I F I++  +D+ DPRELSE PE
Sbjct  5    ITLDSHCINHLDLSPVDNVVK-QLIQESKPM-IAEPEISFEIDYPLDDQ-DPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+ +D+ YPWLP  LDWR+GEL RY AMLVPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   VRLWFICVDSQYPWLPYALDWRSGELPRYVAMLVPHQFHASEGIQYNPEALEIFLMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            ++  WL Q  G P  R + + MA+MLG+ + + LFDLI++
Sbjct  122  VITRWL-QDMGLP-SRSRLQSMAQMLGYDLDEGLFDLIEQ  159



>ref|WP_026788341.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=161

 Score =   149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + +  LDLSP Q       P +     + E+ I F I++ R+ E DPRE+SE PE
Sbjct  5    IKLNSEQVNRLDLSPVQRVID-PIPENTDITAY-EQQISFEIDYSRDPE-DPREISEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLDA YPWLP+ LDW++GELARY AMLVPHQ +   G+ +NPEALE+F+M+K+F
Sbjct  62   IRLWFIRLDAQYPWLPLFLDWKSGELARYVAMLVPHQFHRTEGIQYNPEALEIFLMQKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            I+  WL Q+      RL    MA+MLG+ + D  F+
Sbjct  122  ILDHWLTQNNLPSKSRLMA--MAQMLGYDLDDTFFE  155



>ref|WP_006195352.1| hypothetical protein [Nodularia spumigena]
 gb|EAW46248.1| hypothetical protein N9414_20310 [Nodularia spumigena CCY9414]
 gb|AHJ28323.1| hypothetical protein NSP_19900 [Nodularia spumigena CCY9414]
Length=158

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 106/165 (64%), Gaps = 21/165 (13%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSP--------SHAKPKDFVERTIGFTINFKREDEYDP  490
            + ++ D + +LD+SP   A  + SP        SH       E+ + F I +  E   DP
Sbjct  5    ITLDTDYVNNLDISP---ALTVISPLLEEGAIASH-------EQQLSFEIKYALEPG-DP  53

Query  489  RELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALE  310
            RE SE PE+RLWFVRLDA YPWLP LLDW++GE ARY AMLVPHQ + K G+ +NPEALE
Sbjct  54   REFSEIPELRLWFVRLDAKYPWLPFLLDWKSGEFARYTAMLVPHQFSAKEGIQYNPEALE  113

Query  309  LFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            +F+M K+FI+  WLKQ  G P  + + K MA+MLG+ + D  F++
Sbjct  114  IFLMHKIFILGDWLKQQ-GIP-SQSRLKSMAQMLGYDLDDAFFEI  156



>ref|WP_015153493.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007090814.1| hypothetical protein Chro_1419 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY86945.1| protein of unknown function DUF1817 [Chroococcidiopsis thermalis 
PCC 7203]
Length=158

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 108/159 (68%), Gaps = 6/159 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV-ERTIGFTINFKREDEYDPRELSEFP  469
            + +  D   SLD+ P   A  I + S  K      E+ + F I++ R  + DPRELSE P
Sbjct  5    ISLKADNFNSLDVLP--AAKTIENISQEKSAIATYEQQLRFEIDYPRPSD-DPRELSEIP  61

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+R+WF+RLD+ YPWLP LLDW+AGEL+RY AMLVPHQ + + G+ FNPEALE+F+M+KV
Sbjct  62   EVRMWFIRLDSRYPWLPFLLDWKAGELSRYTAMLVPHQFHRQEGIQFNPEALEIFLMQKV  121

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            F+++ WL+Q       RLK+  M +MLG+ + D+LF ++
Sbjct  122  FVLHDWLQQMGIPSTARLKS--MGQMLGYDLDDDLFGML  158



>ref|WP_039715757.1| hypothetical protein [Scytonema millei]
 gb|KIF18219.1| hypothetical protein QH73_33845 [Scytonema millei VB511283]
Length=158

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 108/159 (68%), Gaps = 6/159 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV-ERTIGFTINFKREDEYDPRELSEFP  469
            + +  D   SLD+ P   A  I + S  K      E+ + F I++ R  + DPRELSE P
Sbjct  5    ISLKADNFSSLDVLP--AAKTIENISQEKSAIATYEQQLRFEIDYPRPSD-DPRELSEIP  61

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+R+WF+RLD+ YPWLP LLDW+AGEL+RY AMLVPHQ + + G+ FNPEALE+F+M+KV
Sbjct  62   EVRMWFIRLDSRYPWLPFLLDWKAGELSRYTAMLVPHQFHRQEGIQFNPEALEIFLMQKV  121

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            F+++ WL+Q  G P    + K M +MLG+ + D+LF ++
Sbjct  122  FVLHDWLQQ-MGIP-STARLKSMGQMLGYDLEDDLFGML  158



>ref|WP_015118041.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007055012.1| hypothetical protein Riv7116_1925 [Rivularia sp. PCC 7116]
 gb|AFY54465.1| hypothetical protein Riv7116_1925 [Rivularia sp. PCC 7116]
Length=157

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = -3

Query  624  IRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVR  445
            I SLDLSP   A       +    +  E+ +   + ++ E E DPRELSE PE+RLWF+R
Sbjct  12   INSLDLSPAVTAIDKILAENNIASN--EQQLRLDLQYELE-EGDPRELSEIPEVRLWFIR  68

Query  444  LDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLK  265
            LDA YPWLP LLDW++GE  RYAAML+PHQ + K G+ +NPEALE+F+M+K F++  WL+
Sbjct  69   LDAKYPWLPFLLDWQSGEFVRYAAMLIPHQFSSKEGIQYNPEALEIFLMQKTFVLKDWLE  128

Query  264  QHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +H      R+K+  MA++LG+ + DELF ++
Sbjct  129  KHNIPSQSRIKS--MAKLLGYDLDDELFAML  157



>ref|WP_006668044.1| hypothetical protein [Arthrospira maxima]
 gb|EDZ96827.1| Domain of unknown function DUF1817 [Arthrospira maxima CS-328]
Length=161

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNAT-GITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + ++   I  LD+SP       +   S  +     E  I F I++  +D+ DPRELSE P
Sbjct  5    ITLDSHCINHLDISPVDKVVEQLIQESKLRS---AEPEISFEIDYPLDDQ-DPRELSEVP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+ LD+ YPWLP +LDWR+GELARY AMLVPHQ + + G+ +NPEALE+F+M+K+
Sbjct  61   EVRLWFICLDSQYPWLPYVLDWRSGELARYVAMLVPHQFHGREGIQYNPEALEIFLMQKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            F++  WL Q  G P  R + + MA+MLG+ + + LFD+I++
Sbjct  121  FVITRWL-QEMGLP-SRSRLQSMAQMLGYDLDEGLFDVIEQ  159



>ref|WP_006620786.1| MULTISPECIES: hypothetical protein [Arthrospira]
 emb|CCE15406.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD11405.1| protein of unknown function DUF1817 [Arthrospira platensis C1]
 emb|CDM93969.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=161

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNAT-GITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + ++   I  LD+SP       +   S  +     E  I F I++  +D+ DPRELSE P
Sbjct  5    ITLDSHCINHLDISPVDKVVEQLIQESQLRS---AEPEISFEIDYPLDDQ-DPRELSEVP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+ LD+ YPWLP  LDWR+GELARY AMLVPHQ + + G+ +NPEALE+F+M+K+
Sbjct  61   EVRLWFICLDSQYPWLPYALDWRSGELARYVAMLVPHQFHGREGIQYNPEALEIFLMQKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            F++  WL Q  G P  R + + MA+MLG+ + + LFD+I++
Sbjct  121  FVITRWL-QEMGLP-SRSRLQSMAQMLGYDLDEGLFDVIEQ  159



>ref|WP_013323654.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003888860.1| hypothetical protein Cyan7822_3647 [Cyanothece sp. PCC 7822]
 gb|ADN15585.1| Domain of unknown function DUF1817 [Cyanothece sp. PCC 7822]
Length=157

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + + +D +  LDLSP    T +            E+ + F IN+ RE   DPRELSE P 
Sbjct  4    IELTQDCLEKLDLSPV--TTVVEKLLQEGTIASQEQQLSFEINYPREAA-DPRELSEIPA  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLD+ YPW+P LL W++GELARY AMLVPHQ +   G+ +NPEALE+FVM K+F
Sbjct  61   IRLWFVRLDSVYPWIPFLLAWKSGELARYTAMLVPHQFSRTEGIQYNPEALEIFVMHKIF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            I++ WL +       RLK+  MA++ G+ + D  F LI 
Sbjct  121  ILHDWLNKQNMPALYRLKS--MAQIFGYELDDNFFQLIQ  157



>ref|WP_012628714.1| hypothetical protein [Cyanothece sp. PCC 7425]
 ref|YP_002484014.1| hypothetical protein Cyan7425_3328 [Cyanothece sp. PCC 7425]
 gb|ACL45653.1| Domain of unknown function DUF1817 [Cyanothece sp. PCC 7425]
Length=162

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 110/165 (67%), Gaps = 13/165 (8%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKP--KDFVERTIGFTINFKREDEYDPRELSEF  472
            + +N ++I +LDLSP   A  +     AK    D+ E+ + F I++ ++DE    E SE 
Sbjct  5    IALNAELINNLDLSP---AVSLIQSWLAKGTIADY-EQQLQFAIDYPQDDEL---EFSEI  57

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE+RLWF+RLD+ YPWLP LLDWR+GELARYAAMLVPHQ + K G+ +NP+AL++F+M+K
Sbjct  58   PEVRLWFIRLDSVYPWLPYLLDWRSGELARYAAMLVPHQFSRKEGIQYNPQALDIFIMQK  117

Query  291  VFIVYSWLK-QHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            VF++  WL  Q   T     K K+MA + G+ +   LF+L+  YP
Sbjct  118  VFVLMDWLATQGLATDH---KLKNMAEIFGYDLNSGLFELLRAYP  159



>ref|WP_017652680.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=157

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN D I +LDLSP            A      E+ + F IN+  E   DPRE +E PE
Sbjct  5    IAINTDSINNLDLSPASEVIDQLLQEGAVTSQ--EQQLRFAINYTLEPG-DPREFAEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RL A YPWLP LLDW+AGE ARY AM VPHQ + K G+ +NPEALE+F+M  VF
Sbjct  62   VRLWFLRLGARYPWLPFLLDWKAGEFARYTAMFVPHQFSAKEGIQYNPEALEIFLMHTVF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WLKQ       RLK+  MA+MLG+ + D  F ++
Sbjct  122  ILSDWLKQQNIPSQSRLKS--MAQMLGYELEDGFFAIL  157



>ref|WP_017313060.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=158

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LDLS     T I            E+ + F I++ ++ E DPREL E PE
Sbjct  5    IALNSDFIHNLDLSAV--TTVIEQLLQEGAIASHEQQLRFDIDYPQQ-ESDPRELPEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLDA YPWLP LLDW+ GE ARY AMLVPHQ + K G+ +NPEALE+F+M K+F
Sbjct  62   VRLWFVRLDARYPWLPFLLDWKMGEFARYTAMLVPHQFSAKEGIQYNPEALEIFLMHKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            I+  W KQ+      RL++  MA+MLG+ + D  F + +
Sbjct  122  ILSDWFKQNNIPSQSRLQS--MAQMLGYELDDTFFAMFE  158



>ref|WP_040929998.1| hypothetical protein [Prochloron didemni]
Length=159

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 104/163 (64%), Gaps = 7/163 (4%)
 Frame = -3

Query  651  YEVVINEDVIRSLDLSPFQNAT-GITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSE  475
            + + +  D I +LDLS  +    G+            E+ I F I+++R D  DPRELSE
Sbjct  3    WTIRVTTDQIENLDLSVTEQVIEGLLEKGEIASS---EKQIQFQIDYER-DPLDPRELSE  58

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE+RLWFVRLD  YPWLP LLDW+ GELARY AMLVPHQ +   G+ +NPEALE+FVM+
Sbjct  59   IPEVRLWFVRLDVRYPWLPFLLDWQTGELARYVAMLVPHQFDRNEGIQYNPEALEIFVMQ  118

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            KVF++  WL++       RL++  + +M G+ + +  FDL+ K
Sbjct  119  KVFLLSYWLEEQDIVSKYRLQS--LTQMFGYELDNSFFDLLVK  159



>ref|WP_017314472.1| hypothetical protein [Mastigocladopsis repens]
Length=157

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 5/157 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I SLDLSP    T I            E+ + F IN+  +   DPRELSE PE
Sbjct  5    ISLNTDCINSLDLSPV--VTEIEKLLQEGAIASHEQQLRFDINYVLQPG-DPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +R+WF+RLD  YPWL  LLDW+AGE ARYAAMLVPHQ + + G+ +NPEALE+F+M K+F
Sbjct  62   VRMWFIRLDTRYPWLLFLLDWQAGEFARYAAMLVPHQFSTREGIQYNPEALEIFLMHKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            ++  WL+Q  G P  + + + MA++LG+ + D LF++
Sbjct  122  VLNDWLQQQ-GIP-NKSRLQSMAQLLGYELDDALFEM  156



>ref|WP_015221066.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007163392.1| hypothetical protein Cyan10605_3303 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ55348.1| protein of unknown function DUF1817 [Cyanobacterium aponinum 
PCC 10605]
Length=157

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN+  I  LDLSP  N   I     +     +E+ I F I++ RE E DPRELSE  E
Sbjct  5    IKINQTQIHQLDLSPVINV--IEKFDKSSEILNLEQEITFQIDYARE-ETDPRELSEISE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+ LD+ YPWLP  L+WR GELARY AMLVPHQ N   G+ +N EAL++++M+K F
Sbjct  62   IRLWFIALDSLYPWLPFCLNWREGELARYVAMLVPHQFNRSEGIQYNQEALDIWIMQKTF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +++ WLKQ       RLK   M ++ G+ + D LF+L+
Sbjct  122  VLHRWLKQQGIKTNSRLKA--MTQIFGYDLDDYLFELL  157



>gb|EYU25277.1| hypothetical protein MIMGU_mgv11b023065mg, partial [Erythranthe 
guttata]
Length=145

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 82/101 (81%), Gaps = 2/101 (2%)
 Frame = -3

Query  681  APPMPPTEGRYEVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKRED  502
            APPMPP EGRYEVVI+ D+I  LDLSPF        P   + K+ +ERTIGFTIN++RED
Sbjct  19   APPMPPKEGRYEVVIDNDIIARLDLSPFIPPP--ELPPQTRSKELLERTIGFTINYRRED  76

Query  501  EYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARY  379
            E DPRELSE+P+IRLWFVR+DA YPWLPV+LDWRAGELARY
Sbjct  77   ENDPRELSEYPDIRLWFVRVDAMYPWLPVVLDWRAGELARY  117



>ref|WP_017746809.1| hypothetical protein [Scytonema hofmanni]
Length=159

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = -3

Query  543  ERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLV  364
            ++ + F IN+  E + DPRELSE PEIRLWF+RLD  YPWLP LLDW+AGEL RY AMLV
Sbjct  37   QQQLCFDINYPLE-QGDPRELSEVPEIRLWFIRLDTRYPWLPFLLDWKAGELVRYTAMLV  95

Query  363  PHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDEL  184
            PHQ + + G+ +NPEALE+F+M K+F +  WLKQ  G P  + + + MA++LG+ + D L
Sbjct  96   PHQFSRREGIQYNPEALEIFLMHKLFFLTDWLKQQ-GIP-SKARLQSMAQLLGYELDDTL  153

Query  183  FDLI  172
            F+L+
Sbjct  154  FELV  157



>ref|WP_017324362.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=159

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 104/162 (64%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            +V+  D I +LDLS       I       PK   ++ +   I++ R ++ DPRELSE  E
Sbjct  5    LVLTADAIANLDLSA---GHAIVETLLTNPKGCAQQ-LQCAIDYPRAED-DPRELSEISE  59

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVR D  YPWLP  LDWR GELARYAAMLVPHQ + + G+ FNPE LE+FVM+K+F
Sbjct  60   VRLWFVRWDVAYPWLPYFLDWRGGELARYAAMLVPHQFSQREGIQFNPEGLEIFVMQKIF  119

Query  285  IVYSWLK-QHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKY  163
            ++  W K + +G+       ++MA++LG+ I  E F L+++Y
Sbjct  120  VLLDWFKDKDFGST---ADVRNMAKVLGYDIAPEFFQLLEQY  158



>ref|WP_015224811.1| hypothetical protein [Halothece sp. PCC 7418]
 ref|YP_007167147.1| hypothetical protein PCC7418_0713 [Halothece sp. PCC 7418]
 gb|AFZ42933.1| protein of unknown function DUF1817 [Halothece sp. PCC 7418]
Length=158

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 99/155 (64%), Gaps = 5/155 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + + +D I  LDLSP Q  T + S   +      E+   F I++ R D  DPRELSE PE
Sbjct  5    IKLTQDSIDRLDLSPVQ--TQLDSILSSGSLTEYEQQFQFEIDYPR-DPTDPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLD  YPW    LDWR GELARY AMLVPHQ +   G+ FNPEALE+FVM+KVF
Sbjct  62   IRLWFLRLDTVYPWFIFFLDWRNGELARYTAMLVPHQFSRAEGIQFNPEALEIFVMRKVF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            ++Y WL+    + + R+ +   ++MLG+ + +  F
Sbjct  122  VLYDWLQAQQISGYGRIIS--FSQMLGYEVDESFF  154



>ref|WP_008272700.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ94359.1| hypothetical protein CY0110_10802 [Cyanothece sp. CCY0110]
Length=160

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 103/160 (64%), Gaps = 5/160 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + I  D + +LD++P +         +A     +E+ + F I + RE   DPRELSE PE
Sbjct  5    ITIQIDHLTALDITPVRKIIDPLLEKNAIAS--LEQGLTFDIQYPREPS-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLD  YPW P LLD + GE+ARYAAMLVPHQ N   G+ +NPEALE+FVM K+F
Sbjct  62   IRLWFVRLDTIYPWFPFLLDAKQGEIARYAAMLVPHQFNRVEGIQYNPEALEIFVMNKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            I+  WL++   + + + + K MA++ G+ I D  F++I K
Sbjct  122  ILSDWLEKQ--SIYSQFRLKSMAQLFGYDIEDSFFEMIKK  159



>ref|WP_008227447.1| expressed protein [Richelia intracellularis]
 emb|CCH65154.1| expressed protein [Richelia intracellularis HM01]
Length=159

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 105/160 (66%), Gaps = 7/160 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPK-DFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N + I SLDLSP   AT +     AK +    E+ + F  ++++E   DPRELS+ P
Sbjct  5    ITLNNECINSLDLSP---ATKVIENILAKGEIASCEQKLKFIFDYEKELG-DPRELSQIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLD+ YPWLP LLDW+ GE  RY AMLVPHQ + K G+ +N EALE+F+M K 
Sbjct  61   EVRLWFIRLDSLYPWLPFLLDWKMGEFIRYTAMLVPHQFSSKEGIEYNAEALEIFLMNKS  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            F++ +WL Q    PF R +   MA++LG+ + D  FD+ D
Sbjct  121  FVLTNWLGQQ-EIPF-RPRIHSMAKLLGYELDDVFFDIFD  158



>ref|WP_017663680.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=160

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            E+ ++   I  LDLS    A    +   A  +   E+++ F I+F R D  DPRELSE P
Sbjct  4    EIHLDATAIAKLDLSAAIAAIEPIANREAIEQ--AEQSLRFAIDFPR-DPSDPRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            EIRLWFVRLDA YPWLP+ LDW+ GELARYAAMLVPH+ +   G+ +NPEALE+F+M K+
Sbjct  61   EIRLWFVRLDARYPWLPIFLDWKHGELARYAAMLVPHEFHRTEGIQYNPEALEIFLMNKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGF  202
            F + +WL Q  G P  R + + MA+MLG+
Sbjct  121  FTIANWLSQQ-GLP-NRARVQSMAQMLGY  147



>ref|WP_015151097.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007088401.1| hypothetical protein Oscil6304_4977 [Oscillatoria acuminata PCC 
6304]
 gb|AFY84481.1| hypothetical protein Oscil6304_4977 [Oscillatoria acuminata PCC 
6304]
Length=161

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N + + +LDLSP + A    SP   +P    + +  F I++ R D  DPRELSE PE
Sbjct  5    IALNAECLLNLDLSPVRGAIAKCSPD--QPFTDPDLSWQFEIDYPR-DPSDPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWF+RLDATYPWLP+LLD ++GELARY AMLVPH+ +   G+ +NPEALE+F+M K+F
Sbjct  62   IRLWFIRLDATYPWLPLLLDRQSGELARYVAMLVPHEFHRTEGIQYNPEALEIFLMNKIF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
             + + L++H G P  + K   +++MLG+ + D  F+L+
Sbjct  122  TLANLLQEH-GLP-SKSKLMSLSQMLGYELDDGFFELL  157



>ref|WP_038015865.1| hypothetical protein [Synechococcus sp. PCC 7335]
Length=158

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = -3

Query  621  RSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRL  442
            ++LDLSP +      +    +  D  E +  F I+F R D  DPRELSE PE+RLWF+RL
Sbjct  13   QTLDLSPAKAVIDAIAADQTRLND-QEASFSFEIDFPR-DPSDPRELSEIPEVRLWFIRL  70

Query  441  DATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQ  262
            D  YPWL + LDW +GEL+RY AMLVPHQ +   G+ +NPEALE+FVM KVF++  WLKQ
Sbjct  71   DTFYPWLALYLDWESGELSRYTAMLVPHQFSPIDGIRYNPEALEIFVMSKVFVLDRWLKQ  130

Query  261  HYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +      RLK   M +MLG+ + D LF+L+
Sbjct  131  NNINGRSRLKF--MTQMLGYELDDALFNLL  158



>gb|EDX87864.1| conserved domain protein [Synechococcus sp. PCC 7335]
Length=162

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = -3

Query  621  RSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVRL  442
            ++LDLSP +      +    +  D  E +  F I+F R D  DPRELSE PE+RLWF+RL
Sbjct  17   QTLDLSPAKAVIDAIAADQTRLND-QEASFSFEIDFPR-DPSDPRELSEIPEVRLWFIRL  74

Query  441  DATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQ  262
            D  YPWL + LDW +GEL+RY AMLVPHQ +   G+ +NPEALE+FVM KVF++  WLKQ
Sbjct  75   DTFYPWLALYLDWESGELSRYTAMLVPHQFSPIDGIRYNPEALEIFVMSKVFVLDRWLKQ  134

Query  261  HYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +      RLK   M +MLG+ + D LF+L+
Sbjct  135  NNINGRSRLKF--MTQMLGYELDDALFNLL  162



>ref|WP_022605158.1| hypothetical protein [Rubidibacter lacunae]
 gb|ERN42414.1| hypothetical protein KR51_00009390 [Rubidibacter lacunae KORDI 
51-2]
Length=162

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 98/153 (64%), Gaps = 9/153 (6%)
 Frame = -3

Query  624  IRSLDLSPFQNATG--ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWF  451
            I  LDLSP +      +T  S AK     E+ + F I+  R D  DPRELSE PE+RLWF
Sbjct  12   IARLDLSPLEAVVEPLLTGGSIAK----CEQQLVFVIDIPR-DPNDPRELSEIPEVRLWF  66

Query  450  VRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSW  271
            VR DA YPWLP  LDWRAGEL RYAAMLVPH+ +   G+ +NPEALELFVM K+F + +W
Sbjct  67   VRADARYPWLPFALDWRAGELGRYAAMLVPHEFHRTEGIQYNPEALELFVMSKIFAIANW  126

Query  270  LKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            L Q       RL++   A+MLG+ + D  F ++
Sbjct  127  LGQQQLPSRSRLQS--FAQMLGYDLDDAFFKML  157



>ref|WP_035985631.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=158

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 106/161 (66%), Gaps = 7/161 (4%)
 Frame = -3

Query  651  YEVVINEDVIRSLDLSPFQNATGITSPSHAKPK-DFVERTIGFTINFKREDEYDPRELSE  475
            + + + +   ++LDL+P   A  +  P  A+ K    E  + F I+  R D  DPRELSE
Sbjct  3    HTITLQDSHFQTLDLTP---ARRVIDPLLAEGKLPHGEGGLRFEIDISR-DPADPRELSE  58

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE+RLWF+RLD  YPWLP++LDW AG+L RYAAMLVPHQ +   G+ +NPEALE+F+M 
Sbjct  59   LPEVRLWFIRLDTCYPWLPLVLDWEAGDLGRYAAMLVPHQFSPTEGIRYNPEALEIFMMA  118

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            K+F + +WL+    T + RLK   M +MLG+ I + LF+L+
Sbjct  119  KIFAIAAWLRSQGVTQYTRLKF--MTQMLGYEIDEGLFELL  157



>ref|WP_010871386.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440076.1| hypothetical protein slr1097 [Synechocystis sp. PCC 6803]
 ref|YP_005381942.1| hypothetical protein SYNGTI_0180 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005385112.1| hypothetical protein SYNPCCP_0180 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005407819.1| hypothetical protein SYNPCCN_0180 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005650133.1| hypothetical protein SYNGTS_0180 [Synechocystis sp. PCC 6803]
 ref|YP_007449959.1| hypothetical protein MYO_11800 [Synechocystis sp. PCC 6803]
 dbj|BAA16756.1| slr1097 [Synechocystis sp. PCC 6803]
 dbj|BAK48928.1| hypothetical protein SYNGTS_0180 [Synechocystis sp. PCC 6803]
 dbj|BAL27927.1| hypothetical protein SYNGTI_0180 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31097.1| hypothetical protein SYNPCCN_0180 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34266.1| hypothetical protein SYNPCCP_0180 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM50461.1| hypothetical protein BEST7613_1530 [Synechocystis sp. PCC 6803]
 gb|AGF50445.1| hypothetical protein MYO_11800 [Synechocystis sp. PCC 6803]
Length=163

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 103/161 (64%), Gaps = 16/161 (10%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQ---------NATGITSPSHAKPKDFVERTIGFTINFKREDEYD  493
            + +  + + SLDLSP Q         N   I   + A     +E+ + F I F RE E D
Sbjct  4    ITVTPEQLSSLDLSPVQSWLERAISLNLNRIDESALAT----IEKQVQFDIQFARE-EGD  58

Query  492  PRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEAL  313
            PRELSE PE+RLWF+RLD+ YPW P+ LDW+AGE  RYAAMLVPH+ +   G+ FNPEAL
Sbjct  59   PRELSEIPEVRLWFIRLDSVYPWFPLCLDWQAGEFTRYAAMLVPHEFHRVDGIQFNPEAL  118

Query  312  ELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGD  190
            +LF+M +VF++  WLK+ Y  P  + + K +A++LG+ + D
Sbjct  119  DLFIMGRVFVLADWLKK-YQLP-AQFRLKSLAQLLGYDLDD  157



>ref|WP_008231398.1| expressed protein [Richelia intracellularis]
 emb|CCH66198.1| expressed protein [Richelia intracellularis HH01]
Length=159

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 105/160 (66%), Gaps = 7/160 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPK-DFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N + I SLDLSP   AT +     AK +    E+ + F  ++++E   DPRELS+ P
Sbjct  5    ITLNNECINSLDLSP---ATKVIENILAKGEIASYEQKLKFIFDYEKELG-DPRELSQIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLD+ YPWLP LLDW+ GE  RY AMLVPHQ + + G+ +N EALE+F+M K 
Sbjct  61   EVRLWFIRLDSLYPWLPFLLDWKMGEFIRYTAMLVPHQFSSQEGIEYNAEALEIFLMNKS  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            F++ +WL Q    PF R +   MA++LG+ + D  FD+ D
Sbjct  121  FVLTNWLGQQ-EIPF-RPRIHSMAKLLGYELDDVFFDIFD  158



>ref|WP_035157715.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB85881.1| hypothetical protein IJ00_25675 [Calothrix sp. 336/3]
Length=157

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 7/158 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNAT-GITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + +N + I SLD+SP  +    +     A  +   E+ + F I++  E   DPRELSE  
Sbjct  5    ITLNPESIHSLDISPVTSIIEAVIQEGTALAQ---EQQLSFQIDYPLEAG-DPRELSEVA  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPWLP  L+W+ GELARY AMLVPHQ   K G+ +NPEALE+F+M K+
Sbjct  61   EVRLWFVRLDARYPWLPFFLNWKEGELARYTAMLVPHQFTKKEGIQYNPEALEIFLMGKI  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            F++ +WLKQ       RL+   MA++LG+ + D  F L
Sbjct  121  FVLSAWLKQQDIPSQSRLQA--MAQLLGYELDDGFFSL  156



>ref|WP_015166679.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007104153.1| hypothetical protein Pse7367_3489 [Pseudanabaena sp. PCC 7367]
 gb|AFY71725.1| protein of unknown function DUF1817 [Pseudanabaena sp. PCC 7367]
Length=164

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 100/161 (62%), Gaps = 8/161 (5%)
 Frame = -3

Query  639  INEDVIRSLDLSPFQNATGITSPSHAKPKDFV-----ERTIGFTINFKREDEYDPRELSE  475
            +N D I  +D++P +        + A     +     ++ I F I F +E   DPRELSE
Sbjct  7    VNADCIAQIDIAPARVVVDKLLATIATTNGAIATLPEDQAIKFNIMFPQEPT-DPRELSE  65

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PEIRLWF+RLDA YPWLP  LDWR GEL RYAAMLVPH+     G+ FN EA+++FVM+
Sbjct  66   IPEIRLWFIRLDAVYPWLPYYLDWREGELTRYAAMLVPHEFKKAEGIEFNVEAIQIFVMQ  125

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            KVF+++ WL Q   +   +L  K M++ LG+ I  E F+L+
Sbjct  126  KVFMIHDWLGQQGSSNTAKL--KQMSQALGYEIDAEFFELL  164



>ref|WP_019500379.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=159

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 103/161 (64%), Gaps = 9/161 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAK-PKDFV--ERTIGFTINFKREDEYDPRELSE  475
            + +N   I ++D++P   A  I     A+ P D    +  I F I F RE + DPRELSE
Sbjct  5    INVNLACIENIDITP---ARLILDKLLAESPHDLTGFDPQIQFEILFPRE-QGDPRELSE  60

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE+RLWF+RLDATYPWLP LL+WRAGEL RY AMLVPHQ +   G+ FN EAL++FVM 
Sbjct  61   IPEVRLWFIRLDATYPWLPYLLNWRAGELTRYTAMLVPHQFSRTEGIEFNAEALQIFVMH  120

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            KVF++  WLKQ       +L  + MA+ LG+ I  E F L+
Sbjct  121  KVFMISQWLKQRGINSNEKL--QHMAQSLGYEIDSEFFTLL  159



>ref|WP_019493241.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=156

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +N D I +LD+SP        S  +A   +  E+ + F I++ RED  DPRELSE PE
Sbjct  5    IKVNIDQINTLDISPAVEVIEQISLGNAILSN--EQQLIFNIDYPREDG-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRLWFVRLD  YPWLP  L+W+  E  RYAAMLVPHQ   K G+ +NPEALE+F+M K+F
Sbjct  62   IRLWFVRLDTRYPWLPFFLNWQEKEFTRYAAMLVPHQFT-KEGIQYNPEALEIFLMSKIF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
            I+  WLK+       RLK   MA++LG+ + D LF +
Sbjct  121  ILTDWLKKQEIPHQSRLKA--MAQLLGYDLEDGLFSM  155



>ref|WP_027268969.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=162

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -3

Query  543  ERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLV  364
            E  + F I+  R D  DPRELSE PE+RLWF+RLD  +PWLP++LDW  GEL RYAAMLV
Sbjct  37   EVKLSFAIDLPR-DPTDPRELSEIPEVRLWFLRLDQRFPWLPLVLDWETGELGRYAAMLV  95

Query  363  PHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDEL  184
            PHQ + K G+ +NPEALE+FVM K+F +  WL+      F RLK   M +MLG+ I D L
Sbjct  96   PHQFSTKDGIRYNPEALEIFVMGKIFAIAPWLQAQGIPQFTRLKF--MTQMLGYEIDDGL  153

Query  183  FDLI  172
            F+L+
Sbjct  154  FELL  157



>ref|WP_028947954.1| hypothetical protein [Synechocystis sp. PCC 6714]
 gb|AIE74563.1| hypothetical protein D082_20350 [Synechocystis sp. PCC 6714]
Length=163

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = -3

Query  546  VERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAML  367
            +E+ + F I F R+D  DPRELSE PE+RLWF+RLD+ YPW P+ LDW+AGE  RYAAML
Sbjct  42   IEKQVQFDIQFIRQDG-DPRELSEIPEVRLWFIRLDSVYPWFPLCLDWQAGEFTRYAAML  100

Query  366  VPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGD  190
            VPH+ +   G+ FNPEAL+LF+M KVF++  WLKQH      RL++  +A++LG+ + D
Sbjct  101  VPHEFHRVDGIQFNPEALDLFIMGKVFVLADWLKQHQLPAQFRLRS--LAQLLGYDLDD  157



>ref|WP_015166888.1| hypothetical protein [Synechococcus sp. PCC 7502]
 ref|YP_007104364.1| hypothetical protein Syn7502_00054 [Synechococcus sp. PCC 7502]
 gb|AFY72229.1| hypothetical protein Syn7502_00054 [Synechococcus sp. PCC 7502]
Length=152

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 100/157 (64%), Gaps = 11/157 (7%)
 Frame = -3

Query  639  INEDVIRSLDLSPFQNATG-ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEI  463
            IN   I +LD++P Q     IT+     P       + F I + R D  DPRELSE PE+
Sbjct  6    INHTAISNLDITPAQLVIAKITNTITDDP-------VQFKIFYDR-DPSDPRELSEIPEV  57

Query  462  RLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFI  283
            RLWF+RLDATYPWLP +LDW+ GEL RYAAMLVPH+ +   G+ +N EA+++F+M+K+FI
Sbjct  58   RLWFIRLDATYPWLPYILDWKDGELGRYAAMLVPHEFHATTGIEYNFEAMQIFIMQKIFI  117

Query  282  VYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            + +WLK        +L  + M ++LG+ I  E FD +
Sbjct  118  ISNWLKTQGIDSTEKL--QQMTQVLGYEIDQEFFDFL  152



>ref|WP_015162687.1| hypothetical protein [Chamaesiphon minutus]
 ref|YP_007100139.1| hypothetical protein Cha6605_5756 [Chamaesiphon minutus PCC 6605]
 gb|AFY96612.1| hypothetical protein Cha6605_5756 [Chamaesiphon minutus PCC 6605]
Length=157

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            V I++  I +LDLSP   AT +      K        I   I++  E + DPRELSE PE
Sbjct  4    VSISQSAILNLDLSPI--ATDLDRWLVDKNPTQFNLDIKLAIDYPLEPQ-DPRELSEIPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+R+DA YP LP++LDW+AGELARY AMLVPHQ + K G+ +NPEALE++VM +VF
Sbjct  61   VRLWFIRVDACYPQLPLILDWQAGELARYVAMLVPHQFSRKDGIQYNPEALEIWVMHRVF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++ +WL         RLK   M +MLG+ + D LFDL+
Sbjct  121  LLTAWLDAQQIKDRSRLKF--MTQMLGYELDDGLFDLL  156



>ref|WP_009544716.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_001804008.1| hypothetical protein cce_2594 [Cyanothece sp. ATCC 51142]
 gb|ACB51942.1| unknown [Cyanothece sp. ATCC 51142]
Length=160

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDF--VERTIGFTINFKREDEYDPRELSEF  472
            + +  D + +LD++P +    I  P   K  D   +E+ + F I + RE   DPRELSE 
Sbjct  5    ITVQFDHLTTLDITPVRK---IIDPLLEK-NDIASLEQKLSFEIQYPREPS-DPRELSEI  59

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE+RLWFVRLD  YPW P LLD + GE+ARYAAMLVPHQ N   G+ +NPEALE+FVM K
Sbjct  60   PEVRLWFVRLDTIYPWFPFLLDAKQGEIARYAAMLVPHQFNRVEGIQYNPEALEIFVMNK  119

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            +F++  WL++     + + + K MA++ G+ I D  F+ I K
Sbjct  120  LFVLSDWLEKQ--GIYSQFRLKSMAQLFGYDIDDSFFERIKK  159



>ref|WP_007304396.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM51757.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 gb|EHJ13958.1| hypothetical protein CWATWH0003_1363 [Crocosphaera watsonii WH 
0003]
 emb|CCQ61922.1| hypothetical protein CWATWH0401_364 [Crocosphaera watsonii WH 
0401]
 emb|CCQ50780.1| FIG00559084: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ53831.1| hypothetical protein CWATWH0005_246 [Crocosphaera watsonii WH 
0005]
Length=161

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 100/158 (63%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +  D I +LD++P +    I      K    +E+T+ F I + RE   DPRELSE PE
Sbjct  5    ITVQLDHIAALDITPVREI--IEPILEKKAIATLEQTLSFEIQYPREPN-DPRELSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLD  YPWLP +LD + GEL RY AMLVPHQ N   G+ +NPEALE+FVM K+F
Sbjct  62   VRLWFVRLDTIYPWLPFVLDAKQGELPRYTAMLVPHQFNRVEGIQYNPEALEIFVMNKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++  WL++     + + + K +A++ G+ I D  F +I
Sbjct  122  VLSDWLQKQ--GLYSQFRLKSLAQLFGYDIDDSFFAMI  157



>ref|WP_031291690.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
Length=153

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            +V++   +++LDL+    A               E  +GF+IN+ R DE DPRELSE PE
Sbjct  5    IVVDATHLQALDLTVAHTALNQVDWQ-------TELKLGFSINYPR-DENDPRELSEIPE  56

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLP+ LD  +GEL RYAAMLVPHQ +   G+ +NPEALE+FVM KVF
Sbjct  57   VRLWFIRLDSHYPWLPLFLDIESGELGRYAAMLVPHQFSPLDGIRYNPEALEIFVMGKVF  116

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
             +  WLK +      +LK   M   LG+ + D LF+L+
Sbjct  117  TIAQWLKDNQIDGIEKLKL--MVCTLGYELDDGLFELL  152



>ref|WP_006527312.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR99873.1| hypothetical protein GLO73106DRAFT_00037260 [Gloeocapsa sp. PCC 
73106]
Length=160

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + I  + +++LDL+P    T I            E++I F I++ RE + DPRE+SE PE
Sbjct  5    IEIKPEHLKNLDLTPV--TTKIEPLLQQGAIATWEQSINFVIDYPREAD-DPREVSEIPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLD+ YPWLP  LDW++GEL RY AMLVPH+ N   G+ +NPEAL +FV  K F
Sbjct  62   VRLWFVRLDSRYPWLPFCLDWKSGELPRYTAMLVPHEFNRNEGIQYNPEALAIFVTHKSF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            I+  WLKQ       R + K MA++ G+ + +   DL++
Sbjct  122  ILSDWLKQQQIK--SRSRVKSMAQLFGYELDEVFLDLLE  158



>ref|WP_012595026.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_002371909.1| hypothetical protein PCC8801_1705 [Cyanothece sp. PCC 8801]
 ref|YP_003137466.1| hypothetical protein Cyan8802_1730 [Cyanothece sp. PCC 8802]
 gb|ACK65753.1| Domain of unknown function DUF1817 [Cyanothece sp. PCC 8801]
 gb|ACV00631.1| Domain of unknown function DUF1817 [Cyanothece sp. PCC 8802]
Length=160

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 98/158 (62%), Gaps = 5/158 (3%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + +  D +  LDLSP            A      E+T+ F I++ R D  DPRELSE  E
Sbjct  5    IALQLDHLTRLDLSPVSQLIDPILTQRAIAD--YEQTLSFEIHYPR-DPTDPRELSEIAE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWFVRLD+ YPW+P +LD + GELARY AMLVPHQ +   G+ +NPEALE+FVM K+F
Sbjct  62   VRLWFVRLDSVYPWIPFILDPKTGELARYVAMLVPHQFSRSEGIQYNPEALEIFVMHKLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            I+  WL+Q       RLK+   A++ G+ I D  F+LI
Sbjct  122  ILSDWLQQQTIPSTFRLKS--FAQLFGYDIDDSFFELI  157



>gb|ESA38266.1| hypothetical protein N836_33090 [Leptolyngbya sp. Heron Island 
J]
Length=214

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            +V++   +++LDL+    A               E  +GF+IN+ R DE DPRELSE PE
Sbjct  66   IVVDATHLQALDLTVAHTALNQVDWQ-------TELKLGFSINYPR-DENDPRELSEIPE  117

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLP+ LD  +GEL RYAAMLVPHQ +   G+ +NPEALE+FVM KVF
Sbjct  118  VRLWFIRLDSHYPWLPLFLDIESGELGRYAAMLVPHQFSPLDGIRYNPEALEIFVMGKVF  177

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
             +  WLK +      +LK   M   LG+ + D LF+L+
Sbjct  178  TIAQWLKDNQIDGIEKLKL--MVCTLGYELDDGLFELL  213



>ref|WP_015223736.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007166071.1| hypothetical protein Cyast_2479 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ48422.1| protein of unknown function DUF1817 [Cyanobacterium stanieri 
PCC 7202]
Length=157

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 19/165 (12%)
 Frame = -3

Query  645  VVINEDVIRSLDLSP-------FQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPR  487
            + +N   I ++DLSP        +   GI S          E+ I F I++    E DPR
Sbjct  4    ITVNHQQIETIDLSPVTMMVEKLETGEGILSA---------EQQIKFKIDYTL-SENDPR  53

Query  486  ELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALEL  307
            ELSE PEIRLWF+ L+A YPW P+LL+WR GELARY AM+VPH+     G+ +N EAL++
Sbjct  54   ELSEIPEIRLWFIALNARYPWFPILLNWREGELARYTAMVVPHEFKRTEGIQYNLEALDI  113

Query  306  FVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            F+M KVF ++ WLK    T   RLK   MA++ G+ + D  F L+
Sbjct  114  FIMGKVFTLHQWLKTQGVTGNSRLKA--MAQIFGYDLDDSFFALL  156



>ref|WP_017305509.1| hypothetical protein [Spirulina subsalsa]
Length=157

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 101/161 (63%), Gaps = 6/161 (4%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ I  + I  LD+SP Q    I + +  K    + +++   I+F RE E DPRELSE P
Sbjct  2    KITITAEHIYRLDISPVQPV--IDALNQGKKGTNLAQSVQLEIDFPRE-ETDPRELSEIP  58

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWFVRLDA YPW P +LDW   + ARY AMLVPHQ +   G+ +NPEALE+FVM KV
Sbjct  59   EVRLWFVRLDAVYPWFPFVLDW-GTQWARYVAMLVPHQFHRAEGIQYNPEALEIFVMYKV  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            F +  WL Q         K +DM ++LG+ + + LF+L+ +
Sbjct  118  FGITHWLNQR--GEGATGKVQDMMQVLGYEVDEGLFNLLGE  156



>ref|WP_006517782.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKV03417.1| hypothetical protein Lepto7375DRAFT_5715 [Leptolyngbya sp. PCC 
7375]
Length=153

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 10/158 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            +VI+   +++LDL+  Q+    T        DF    + F I++ RE   DPRELSE PE
Sbjct  5    IVIDAAHLQTLDLTMAQS----TLSQVDWKTDF---KLSFAIDYPREAN-DPRELSELPE  56

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLP+ LD  +GEL RYAAMLVPHQ +   G+ +NPEALE+FVM KVF
Sbjct  57   VRLWFIRLDSQYPWLPLFLDVESGELGRYAAMLVPHQFSPLDGIRYNPEALEIFVMGKVF  116

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
             +  WLK +      +LK   M R LG+ + D LF+L+
Sbjct  117  TIAQWLKDNQIDGIEKLKL--MVRTLGYELDDGLFELL  152



>ref|WP_011432033.1| hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_476627.1| hypothetical protein CYB_0368 [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01364.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=159

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = -3

Query  624  IRSLDLSPFQN--ATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWF  451
            I++LDL+P      T +  P  A       + +   I++ R  E DPRELSE PE+RLWF
Sbjct  12   IQTLDLTPGHELVKTLMADPVRAA------QQVQCAIDWPRSPE-DPRELSEIPEVRLWF  64

Query  450  VRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSW  271
            +R D  YPW+P  L+WR GELARYAAM+VPHQ N + G+V+NPEALE+FV +K+F++  W
Sbjct  65   IRWDTVYPWMPYFLNWRQGELARYAAMMVPHQFNPREGIVYNPEALEIFVYQKIFVLMRW  124

Query  270  LKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
             KQ        L  +DMA + GF I  E   L +  P
Sbjct  125  FKQQNLGSVSML--RDMALVFGFEIQPEFLALWEAEP  159



>ref|WP_011431052.1| hypothetical protein [Synechococcus sp. JA-3-3Ab]
 ref|YP_475642.1| hypothetical protein CYA_2241 [Synechococcus sp. JA-3-3Ab]
 gb|ABD00379.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=162

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 95/152 (63%), Gaps = 11/152 (7%)
 Frame = -3

Query  624  IRSLDLSPFQN--ATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWF  451
            I++LDL+P      T +  P  A       + +   I++ R  + DPRELSE PE+RLWF
Sbjct  12   IQALDLTPGHELVKTLMADPVGAA------QQVQCAIDWPRSPD-DPRELSEIPEVRLWF  64

Query  450  VRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSW  271
            +R D  YPW+P  LDWR+GELARYAAMLVPHQ N + G+V+NPEALE+FV +K+F++  W
Sbjct  65   IRWDTVYPWMPYFLDWRSGELARYAAMLVPHQFNPREGIVYNPEALEIFVYQKIFVLMRW  124

Query  270  LKQHYGTPFPRLKTKDMARMLGFAIGDELFDL  175
             KQ        L  +DMA + GF +  E   L
Sbjct  125  FKQQKLGSVSML--RDMALVFGFEVQPEFLSL  154



>ref|WP_024124415.1| protein of unknown function DUF1817 [Thermosynechococcus sp. 
NK55a]
 ref|YP_008899518.1| protein of unknown function DUF1817 [Thermosynechococcus sp. 
NK55a]
 gb|AHB88005.1| protein of unknown function DUF1817 [Thermosynechococcus sp. 
NK55a]
Length=158

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 97/152 (64%), Gaps = 7/152 (5%)
 Frame = -3

Query  624  IRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIRLWFVR  445
            I  LDLSP Q    + +P  A+      + + FTI++ R  +    ELSE   +RLWF+R
Sbjct  12   IDRLDLSPLQQ---VLNPLTAEQLLDYHQALRFTIDYPRPVDEPDLELSELAPVRLWFIR  68

Query  444  LDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLK  265
             D +YPWLP LLDW AGEL RY AMLVPH+ + + G++FNP+AL++FVM KVF ++ WL+
Sbjct  69   ADVSYPWLPYLLDWSAGELVRYGAMLVPHEFHPQQGIIFNPQALDIFVMTKVFTLWQWLR  128

Query  264  QHYGTPFPRL-KTKDMARMLGFAIGDELFDLI  172
               G  +P + K K MA M G+ +  ELF L+
Sbjct  129  ---GQGYPAIEKIKGMAAMFGYELDSELFTLL  157



>ref|WP_011057132.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_682082.1| hypothetical protein tll1292 [Thermosynechococcus elongatus BP-1]
 dbj|BAC08844.1| tll1292 [Thermosynechococcus elongatus BP-1]
Length=159

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 6/160 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVE-RTIGFTINFKREDEYDPRELSEFP  469
            + +  D I  LDLSP ++   + +P  A+ +     + + FTIN+ R  +    ELSE  
Sbjct  5    IQLTPDQIDRLDLSPLEH---VLAPLIAQQQLLAHHQALRFTINYPRPVDEPDLELSELA  61

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
             +RLWF+R D  YPWLP LLDW AGEL RY AMLVPH+ + + G++FNP+AL++FVM KV
Sbjct  62   PVRLWFIRADVCYPWLPYLLDWSAGELVRYGAMLVPHEFHPQQGIIFNPQALDIFVMAKV  121

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            F ++ WL Q  G P    K K MA M G+ +  ELF L+ 
Sbjct  122  FTLWQWL-QRQGYPAVE-KIKGMAAMFGYELDSELFTLLQ  159



>ref|WP_010468660.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=161

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 98/162 (60%), Gaps = 6/162 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN   I SLDLSP +        S        E+ + F IN+ +  +   +E SE PE
Sbjct  5    IAINATHIDSLDLSPIRPLLDAWLASDILAH---EQELTFQINYPQPADAQ-QEWSEIPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLP+LLDWR+GEL RY AMLVPHQ + + G++FNP+AL++ +M KVF
Sbjct  61   VRLWFIRLDSLYPWLPLLLDWRSGELVRYVAMLVPHQFSEREGILFNPQALDILIMHKVF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
             +  WL+   G      K   MA M G+ +   +FDLI  +P
Sbjct  121  TITRWLRS-LGQD-SNAKVIQMAEMFGYELDSTIFDLIQAHP  160



>ref|WP_015229224.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171583.1| hypothetical protein Dacsa_1545 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50226.1| hypothetical protein Dacsa_1545 [Dactylococcopsis salina PCC 
8305]
Length=161

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 7/157 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATG-ITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            + + +D I  LDLSP +     I S  +       E+   F  ++ R +  DPRELSE P
Sbjct  5    IKLTQDSIDRLDLSPLKKELDPILSGGNLTE---YEQQFQFEFDYPR-NPTDPRELSEVP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            EIRLWF+RLD  YPW    L WR GELARY AMLVPHQ +   G+ FNPEALELFVM+KV
Sbjct  61   EIRLWFLRLDTVYPWFIFFLHWRNGELARYTAMLVPHQFSRAEGIQFNPEALELFVMRKV  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            F++Y WL +   + + R+ +   ++MLG+ + +  F+
Sbjct  121  FVLYDWLLEKEISGYGRIIS--FSQMLGYEVEESFFE  155



>ref|WP_030006971.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=156

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 5/157 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            E+ I +  I SL+L+P +          A      E+     I+F +E   DPRELSE P
Sbjct  3    EIKIPQRDILSLNLAPLKTLVQSILLDEALADH--EQKFQLKIDFPQEAN-DPRELSEIP  59

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            EIRLWFVRLDA +PW P LLDW+AGELARY AMLVPHQ +   G+ +NPEALE+FVM KV
Sbjct  60   EIRLWFVRLDAIFPWFPFLLDWKAGELARYTAMLVPHQFHRTEGIQYNPEALEIFVMNKV  119

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            F +   L + +G   P+ + K +A++LG+ + D+  +
Sbjct  120  FCLSETLPK-FGIQ-PQSRVKAIAQLLGYELDDDFLN  154



>ref|WP_024545643.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=158

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = -3

Query  543  ERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLV  364
            E+     I+F RE   DPRELSE PE+RLWFVRLDA +PW P LLDW++GEL RYAAMLV
Sbjct  36   EQKFQLIIDFPRESN-DPRELSEIPEVRLWFVRLDAVFPWFPFLLDWKSGELGRYAAMLV  94

Query  363  PHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDEL  184
            PHQ +   G+ +NPEALE+FVM KVF +   L +    P  R+K   +A++LG+ + DE 
Sbjct  95   PHQFHRTEGIQYNPEALEIFVMGKVFCLSEVLPEFDIQPQSRVKA--IAQLLGYDLDDEF  152

Query  183  FDLI  172
             + I
Sbjct  153  LNSI  156



>ref|WP_012166459.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001520602.1| hypothetical protein AM1_6353 [Acaryochloris marina MBIC11017]
 gb|ABW31283.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=161

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN   I SLDLSP +    +     A      E+ + F I++ +  +   +E SE PE
Sbjct  5    IAINATHIDSLDLSPIR---PLLEAWLADDILAHEQELTFQIDYPQPADAQ-QEWSEIPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLWF+RLD+ YPWLP+LLDWR+GEL RY AMLVPHQ + + G++FNP+AL++ +M KVF
Sbjct  61   VRLWFIRLDSLYPWLPLLLDWRSGELVRYVAMLVPHQFSEREGILFNPQALDILIMHKVF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
             +  WL+   G      K   MA M G+ + + +FDLI  +P
Sbjct  121  TITRWLRS-LGQD-SNAKVIQMAEMFGYELDNTIFDLIQAHP  160



>ref|WP_012307260.1| hypothetical protein [Synechococcus sp. PCC 7002]
 ref|YP_001734893.1| hypothetical protein SYNPCC7002_A1647 [Synechococcus sp. PCC 
7002]
 gb|ACA99637.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=157

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 98/157 (62%), Gaps = 5/157 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            E+ I +  I SL+L+P +          A      E+     I+F +E   DPRELSE P
Sbjct  3    EIKIPQRDILSLNLAPLKTLVQSILLDEALADH--EQKFQLKIDFPQEAN-DPRELSEIP  59

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            EIRLWFVRLDA +PW P LLDW+AGEL RY AMLVPHQ +   G+ +NPEALE+FVM KV
Sbjct  60   EIRLWFVRLDAIFPWFPFLLDWKAGELGRYTAMLVPHQFHRTEGIQYNPEALEIFVMSKV  119

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            F +   L + +G   P+ + K +A++LG+ + D+  +
Sbjct  120  FCLSETLPK-FGIQ-PQSRVKAIAQLLGYELDDDFLN  154



>ref|WP_040054310.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41849.1| hypothetical protein ucyna2_00228 [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=158

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 99/156 (63%), Gaps = 7/156 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDF-VERTIGFTINFKREDEYDPRELSEFP  469
            ++I ++ I +LD+S     T I  P   K +   +E+T  F I + +    DPRELSE  
Sbjct  5    ILIKQNDIVNLDISVI---TNIIEPKLKKEEVISLEQTFTFDIEYPQPSS-DPRELSEIS  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            EIRLWF+RLD  YPW+P +LD + GELARY AMLVPHQ N   G+ +N EALE+FVM K+
Sbjct  61   EIRLWFIRLDGIYPWIPFILDPKKGELARYTAMLVPHQFNRVNGIQYNSEALEIFVMHKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK+       RL  K++A++LG+ + +  F
Sbjct  121  FIISDWLKKQNIYSIFRL--KNIAQLLGYDVEENFF  154



>ref|WP_017287899.1| hypothetical protein [Leptolyngbya boryana]
Length=155

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -3

Query  543  ERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLV  364
            E++I F I++   D  DPRE SE PEIRLWF+RLDATYPW+P LL+W   EL RYAAMLV
Sbjct  33   EQSIQFKIDYPL-DPSDPREYSEIPEIRLWFIRLDATYPWMPFLLNWSEKELGRYAAMLV  91

Query  363  PHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDEL  184
            PHQ+  K G+ +NPEALE+FVM+K F++ +WL +       R + K M + LG+ + D  
Sbjct  92   PHQIQ-KDGIEYNPEALEIFVMQKTFVMLNWLTEQQIE--ARSRVKSMTKTLGYELDDAF  148

Query  183  FDLID  169
            F +++
Sbjct  149  FLMLE  153



>dbj|BAP18434.1| hypothetical protein ETSB_1722 [cyanobacterium endosymbiont of 
Epithemia turgida isolate EtSB Lake Yunoko]
Length=167

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 103/168 (61%), Gaps = 16/168 (10%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSP---SHAKPK----DFV--ERTIGFTINFKREDEYD  493
            +V+  D +  LDLS   + T I  P      +PK    + V  E+T+ F I + R    D
Sbjct  5    IVLQLDHLIRLDLS---SVTTIVEPLLIEATQPKASSNEIVSYEQTLSFEIYYPRSST-D  60

Query  492  PRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEAL  313
             RELSE PE+RLWF+RLD+ YPW+P  LDW+ GELARY AMLVPHQ +   G+ +NPEAL
Sbjct  61   LRELSEIPEVRLWFIRLDSVYPWIPFFLDWKGGELARYFAMLVPHQFSRTEGIQYNPEAL  120

Query  312  ELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIG-DELFDLI  172
            E+F+M K+F +  WLK        RL++  MARM G+ +  D L+ L+
Sbjct  121  EIFIMHKLFTLSDWLKLRRIPSIDRLQS--MARMFGYDLDKDFLYSLL  166



>ref|WP_016516710.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF19021.1| hypothetical protein MAESPC_04205 [Microcystis aeruginosa SPC777]
Length=157

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  K  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYQSRAAIAK--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_002738641.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO90212.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH95480.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis aeruginosa PCC 9432]
 emb|CCI08960.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis aeruginosa PCC 7941]
 emb|CCI28329.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis aeruginosa PCC 9808]
 gb|ELP52709.1| hypothetical protein O53_4434 [Microcystis aeruginosa TAIHU98]
 gb|ELS45421.1| hypothetical protein C789_4796 [Microcystis aeruginosa DIANCHI905]
Length=157

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  K  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYQSRAAIAK--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_023172758.1| hypothetical protein [Gloeobacter kilaueensis]
 ref|YP_008711367.1| hypothetical protein GKIL_1414 [Gloeobacter kilaueensis JS1]
 gb|AGY57660.1| hypothetical protein GKIL_1414 [Gloeobacter kilaueensis JS1]
Length=157

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 97/158 (61%), Gaps = 7/158 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            V +++  I  LDL     A G+     A       R + F I++ R  + DPREL E  E
Sbjct  5    VQLDQPAIDRLDL----RAAGVQIERLAADPLANARQLRFEIDYPRAAD-DPRELPEVQE  59

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            IRL+F+RLDA YPWLP LLDWR GEL R+AAMLVPHQ + K G+ F PEA+E+FVM K+F
Sbjct  60   IRLFFIRLDARYPWLPYLLDWRNGELTRFAAMLVPHQFSAKDGITFAPEAMEIFVMHKIF  119

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++  WL     T   R + + +A+ LG+ I  E FDL+
Sbjct  120  VLADWLLAQGIT--NRSELRYLAQALGYDIDAEFFDLL  155



>ref|WP_002786304.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI15291.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis aeruginosa PCC 9807]
Length=157

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  K  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYQSRAAIAK--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_012954294.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 ref|YP_003421988.1| hypothetical protein UCYN_09230 [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95607.1| uncharacterized conserved protein [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=158

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 94/157 (60%), Gaps = 15/157 (10%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEY-----DPREL  481
            ++I  D I +LD+S     T    P   K     E  I F  +   + +Y     DPREL
Sbjct  5    ILIKHDDIINLDISVI---TDFVEPKLKK-----EEIISFEQDLTFDIQYPQPPDDPREL  56

Query  480  SEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFV  301
            SE  EIRLWF+R+D  YPW+P LL+ + GELARY AMLVPHQ N   G+ +N EALE+FV
Sbjct  57   SEISEIRLWFIRIDGIYPWIPFLLNSKKGELARYTAMLVPHQFNRVNGIQYNSEALEIFV  116

Query  300  MKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGD  190
            M K+FI+  WLK+     +   + K+MA++LG+ + D
Sbjct  117  MHKLFIISDWLKKQ--KIYSTFRLKNMAQLLGYDVDD  151



>dbj|GAL94128.1| hypothetical protein N44_02708 [Microcystis aeruginosa NIES-44]
Length=157

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  +  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYQSRSAIAE--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKKGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_011242755.1| MULTISPECIES: hypothetical protein [Synechococcus]
 ref|YP_171153.1| hypothetical protein syc0443_d [Synechococcus elongatus PCC 6301]
 ref|YP_400123.1| hypothetical protein Synpcc7942_1106 [Synechococcus elongatus 
PCC 7942]
 dbj|BAD78633.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB57136.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD58348.1| hypothetical protein M744_11135 [Synechococcus sp. UTEX 2973]
Length=156

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV--ERTIGFTINFKREDEYDPRELSEF  472
            +V+  D I  LDLSP Q A         K  D++  E+ +   I + R ++ DPREL+E 
Sbjct  5    LVLPADAIAQLDLSPVQTAL-----PELKTADWLTLEQQVCLKIQWPRSED-DPRELAEI  58

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PEIRLWF+RLDATYP  P+L++W++GEL RYAAMLVPHQ +   G+ FNPEAL ++V  K
Sbjct  59   PEIRLWFIRLDATYPQFPLLVNWQSGELVRYAAMLVPHQFSRNEGLQFNPEALAIWVNHK  118

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +F     L     +   RL  K+ A++LGF I +  F+L+
Sbjct  119  IFYFAQQLADRGLSGSSRL--KNFAQILGFEIDESFFELL  156



>ref|WP_002800953.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI38541.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=157

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  +  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYRSRSAIAE--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAIYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_011143485.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_926442.1| hypothetical protein gll3496 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91437.1| gll3496 [Gloeobacter violaceus PCC 7421]
Length=157

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 95/156 (61%), Gaps = 7/156 (4%)
 Frame = -3

Query  639  INEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPEIR  460
            I +  +  L+L    NA G+     A       R I F I++    E DPREL E  E+R
Sbjct  7    IEQGAVERLEL----NAVGLQIEQLASDPLANARQIRFEIDYPLA-EADPRELPEVQEVR  61

Query  459  LWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIV  280
            L+F+RLDA YPWLP LLDWR GEL R+AAMLVPHQ + K G+ F PEA+E+FVM K+F++
Sbjct  62   LFFIRLDARYPWLPYLLDWRTGELTRFAAMLVPHQFSAKDGITFAPEAMEIFVMHKIFVM  121

Query  279  YSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              WL    G    R + + +A+ LG+ I  E F+L+
Sbjct  122  ADWLSSK-GIA-NRSELRYLAQALGYDIDAEFFELL  155



>ref|WP_002766360.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI01192.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis aeruginosa PCC 9443]
Length=179

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  K  +E+ +   I++ R  E D RELSE P
Sbjct  26   KISLNPNQIQNLDLSSLETIIQDYQSRSAIAK--LEQALQLEIDYPRA-EGDMRELSEIP  82

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+ LDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  83   EVRLWFLHLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  142

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  143  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  176



>ref|WP_008206060.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI34062.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis sp. T1-4]
Length=157

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +  + I++LDLS  +          A  +  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALKPNQIQNLDLSSLETIIQDYQSRSAIAE--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_002759148.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH96841.1| Similar to tr|Q8YLX7|Q8YLX7 [Microcystis aeruginosa PCC 9717]
Length=157

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDL   +          A  +  +E+ +   I++ R  E D RELSE P
Sbjct  4    KIALNPNQIQNLDLLSLETIIQDYQSRSAIAE--LEQALQLEIDYPRA-EGDMRELSEIP  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_002795611.1| hypothetical protein [Microcystis aeruginosa]
 ref|YP_001656632.1| hypothetical protein MAE_16180 [Microcystis aeruginosa NIES-843]
 dbj|BAG01440.1| hypothetical protein MAE_16180 [Microcystis aeruginosa NIES-843]
 emb|CCI24995.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=157

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  +  +E+ +   I++ R  E D RELSE  
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYRSRSAIAE--LEQALQLEIDYPRA-EGDMRELSEIA  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM+K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMQKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I +E  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEEFL  154



>ref|WP_009626619.1| protein of unknown function DUF1817 [Pseudanabaena biceps]
 gb|ELS33239.1| protein of unknown function DUF1817 [Pseudanabaena biceps PCC 
7429]
Length=159

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 96/161 (60%), Gaps = 8/161 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + IN+  I SLD++P Q A      +H       +R     + + +ED  DPRELSE  E
Sbjct  4    IYINQACIESLDITPAQIAIE-KLLAHWDDTSESDRAFQIELVWDKEDG-DPRELSEISE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKL-GVV--FNPEALELFVMK  295
            +RLWFVRLDATYPW   LLDWR  EL+RYAAMLVPH+   +  G V  +NPEALELFVM+
Sbjct  62   VRLWFVRLDATYPWFSYLLDWRL-ELSRYAAMLVPHEFKREGDGYVLQYNPEALELFVMQ  120

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            KVF +  WLK        +L  + M + LG+ I    F L+
Sbjct  121  KVFTISLWLKSRGIESTAKL--QQMTQSLGYEIDSAFFSLL  159



>ref|WP_002781366.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI15767.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=157

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 5/156 (3%)
 Frame = -3

Query  648  EVVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFP  469
            ++ +N + I++LDLS  +          A  +  +E+ +   I++ R  E D RELSE  
Sbjct  4    KIALNPNQIQNLDLSSLETIIQDYQSRSAIAE--LEQALQLEIDYPRA-EGDMRELSEIA  60

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E+RLWF+RLDA YPWL  +LD + GE+ARYAAMLVPHQ +   G+ +NPEALE+FVM K+
Sbjct  61   EVRLWFLRLDAVYPWLIFILDPKQGEIARYAAMLVPHQFHRGEGIQYNPEALEIFVMHKL  120

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELF  181
            FI+  WLK        RLK    A+  G+ I ++  
Sbjct  121  FILSDWLKSQQIPALSRLKF--FAQQFGYDIDEQFL  154



>ref|WP_015135958.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007073072.1| hypothetical protein Lepto7376_4109 [Leptolyngbya sp. PCC 7376]
 gb|AFY40238.1| protein of unknown function DUF1817 [Leptolyngbya sp. PCC 7376]
Length=157

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = -3

Query  504  DEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFN  325
            DE DPRELSE PE+RLWFVRLDA  PW   LL+W+ GELARY AMLVPHQ +   G+ FN
Sbjct  48   DENDPRELSEIPEVRLWFVRLDALLPWFLFLLNWKEGELARYTAMLVPHQFHRTEGIQFN  107

Query  324  PEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFD  178
            PEALE+FVM KVF +   L  ++G   P+ + K +A+MLG+ + D+  +
Sbjct  108  PEALEIFVMNKVFSLSETLP-NFGIQ-PQSRVKAIAQMLGYELDDDFLN  154



>ref|WP_015123274.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007060273.1| hypothetical protein Syn6312_0503 [Synechococcus sp. PCC 6312]
 gb|AFY59730.1| hypothetical protein Syn6312_0503 [Synechococcus sp. PCC 6312]
Length=170

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 85/134 (63%), Gaps = 3/134 (2%)
 Frame = -3

Query  543  ERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLV  364
            E+ +GF + + R  E    ELSE   +RLWF+ LD  YPWLP  LDWR GEL RYAAML+
Sbjct  37   EQKLGFNVTYPRPPEEPDLELSELAPVRLWFIALDTRYPWLPFFLDWRNGELVRYAAMLI  96

Query  363  PHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDEL  184
            PHQ + + G+ FNP+ L++FVM K   ++ WL++H      R+++  +A M G+ +  + 
Sbjct  97   PHQFSRQQGIQFNPQGLDIFVMHKALTLWDWLERHKLPGEGRIRS--LAEMFGYELDHDF  154

Query  183  FDLI-DKYPLEDFS  145
            F ++ D+ P+E  S
Sbjct  155  FQVLRDRGPVERVS  168



>gb|ABD96319.1| unknown [uncultured marine type-A Synechococcus GOM 3O6]
Length=156

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 83/159 (52%), Gaps = 8/159 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V IN D IR LDL+P Q  +    PS       +E+     + F    D  DPREL+E P
Sbjct  4    VQINADAIRRLDLTPLQPWSSQRLPS------LLEQGPALKLQFDWPRDPSDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA YPWLP+LL+   G L R+ AM+VPH  N   G+ F P+ALEL++  ++
Sbjct  58   EPRLWALRADARYPWLPLLLERDQGSLIRHVAMVVPHSFNRSEGLRFEPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +        G P  R     MA  LG+ +    + L+
Sbjct  118  MQLDDLCTATLGRP-QRGNLSQMAASLGYELDAGFWTLL  155



>gb|ABB92194.1| hypothetical protein [uncultured marine type-A Synechococcus 
4O4]
Length=156

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 83/159 (52%), Gaps = 8/159 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V IN D IR LDL+P Q  +    PS       +E+     + F    D  DPREL+E P
Sbjct  4    VQINADAIRRLDLTPLQPWSSQRLPS------LLEQGPALELQFDWPRDPSDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA YPWLP+LL+   G L R+ AM+VPH  N   G+ F P+ALEL++  ++
Sbjct  58   EPRLWALRADARYPWLPLLLERDQGSLIRHVAMVVPHSFNRSEGLRFEPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +        G P  R     MA  LG+ +    + L+
Sbjct  118  MQLDDLCTATLGRP-QRGNLSQMAASLGYELDAGFWTLL  155



>ref|WP_007097408.1| hypothetical protein [Synechococcus sp. RS9916]
 gb|EAU73298.1| hypothetical protein RS9916_27344 [Synechococcus sp. RS9916]
Length=164

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 90/168 (54%), Gaps = 9/168 (5%)
 Frame = -3

Query  657  GRYEVVINEDV--IRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRE  484
            G  + VIN D   I+ LDLSP Q       P   K    VE    +       D  DPRE
Sbjct  4    GPLDHVINIDARAIQELDLSPLQAWMEQPLPERLKAGAVVELRYAWP-----RDADDPRE  58

Query  483  LSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELF  304
            LSE PE RLW +R DA +PWLP+LL+   G LA++ AMLVPH  +   G+ F+P+ALEL+
Sbjct  59   LSECPEPRLWALRADAQHPWLPLLLERSGGNLAQHVAMLVPHDFSPSEGIRFDPQALELW  118

Query  303  VMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            V +++ ++    +    +   R     MA  LG+ +    + L+D++P
Sbjct  119  VTQRLMLLDHLNRGQQQS--QRGNLNQMAATLGYELDPGFWALLDQHP  164



>ref|XP_006473931.1| PREDICTED: uncharacterized protein LOC102613362 isoform X1 [Citrus 
sinensis]
 ref|XP_006473933.1| PREDICTED: uncharacterized protein LOC102614036 isoform X1 [Citrus 
sinensis]
Length=125

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 3/74 (4%)
 Frame = -3

Query  780  LHAHAP---FSCSVAFNPSGNFDLSLYDDENNIERAAPPMPPTEGRYEVVINEDVIRSLD  610
            LH++ P    S SVAFNP GNFD+S+++DE N  +  PPMPPTEGR++VV+  D IRSLD
Sbjct  49   LHSNRPRGQISVSVAFNPQGNFDISMFEDEGNSSKLEPPMPPTEGRFDVVLENDAIRSLD  108

Query  609  LSPFQNATGITSPS  568
            LSPF +ATGITSP+
Sbjct  109  LSPFHSATGITSPT  122



>ref|WP_025781608.1| hypothetical protein [Candidatus Synechococcus spongiarum]
Length=167

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 5/131 (4%)
 Frame = -3

Query  546  VERTIGFTINFKREDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAML  367
            +E  +   I + R  E DPRELSE PE+RLW + +D   PWLP+LL+   G+L+RY AM+
Sbjct  37   LEGQVALAIAWDRPLE-DPRELSEIPEVRLWHLHVDQHCPWLPLLLERDTGQLSRYVAMV  95

Query  366  VPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDE  187
            VPH  +   G+ F+PEALEL++  ++ ++  W   H  +   R + + MA +LGF +   
Sbjct  96   VPHDFHASEGIRFHPEALELWITARLMVLDRWRHNHGLS--GRRRLEQMASVLGFVLDRS  153

Query  186  LFDLID--KYP  160
             + +ID  +YP
Sbjct  154  FWTMIDGVRYP  164



>ref|WP_006171075.1| hypothetical protein [Synechococcus sp. WH 5701]
 gb|EAQ74813.1| hypothetical protein WH5701_11399 [Synechococcus sp. WH 5701]
Length=163

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 89/158 (56%), Gaps = 7/158 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++ + IR+LDLSP Q  +                 +G   ++ R+ + DPRELSE PE
Sbjct  8    LSVSAESIRTLDLSPLQPWSACAPADLLA----AAGALGLDFDWPRQSD-DPRELSELPE  62

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLW +R DA +PWLP++LD  +G+L R+ AML+PH  +   G+ F PE+LEL++  + F
Sbjct  63   LRLWSLRADALHPWLPLVLDRSSGQLCRHVAMLLPHGFSRHEGIRFAPESLELWITHRFF  122

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++  W  Q  G    R     MA +LGF +    +D I
Sbjct  123  LLDHW-SQERGLNC-RQGLAQMAAVLGFELDPSFWDPI  158



>ref|WP_011128589.1| hypothetical protein [Synechococcus sp. WH 8102]
 ref|NP_897820.1| hypothetical protein SYNW1729 [Synechococcus sp. WH 8102]
 emb|CAE08244.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=156

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 83/159 (52%), Gaps = 8/159 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V IN D IR LDL+P Q  +    PS       +E+     + F    D  DPREL+E P
Sbjct  4    VQINADAIRRLDLTPLQPWSSQPLPS------LLEQGPALELQFDWPRDPSDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA +PWLP+LL+   G L R+ AM+VPH  N   G+ F P+ALEL++  ++
Sbjct  58   EPRLWALRADARFPWLPLLLERDQGSLIRHVAMVVPHSFNRSEGLRFEPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +        G P  R     MA  LG+ +    + L+
Sbjct  118  MQLDDLCTATLGRP-QRGNLSQMAASLGYELDAGFWTLL  155



>gb|ABB92241.1| conserved hypothetical protein [uncultured marine type-A Synechococcus 
5B2]
Length=156

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 84/159 (53%), Gaps = 8/159 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V+IN D IR LDLSP Q        S     + +E      ++F    D  DPREL+E P
Sbjct  4    VLINADSIRRLDLSPLQPW------SEQSWAELLENGPVLELSFDWPRDPTDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA YPWLP+LL+   G L R+ AM+VPH  N   G+ F+P+ALEL++  ++
Sbjct  58   EPRLWALRADARYPWLPLLLERDRGSLIRHVAMVVPHSFNRSEGLRFDPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +      + G    R     MA  LG+ +    + L+
Sbjct  118  MQLDDLCTANLGR-HQRGNLSQMASALGYELDSGFWSLL  155



>ref|YP_002049518.1| hypothetical protein PCC_0899 [Paulinella chromatophora]
 gb|ACB43308.1| hypothetical protein PCC_0899 [Paulinella chromatophora]
Length=168

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 92/160 (58%), Gaps = 7/160 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            V I  + IRSLDLSP +  + + +P           T+ F  ++    E DPRELSE PE
Sbjct  6    VKIPSNAIRSLDLSPIK--SWVNTPVENILSS--SSTLQFQFDWALAPE-DPRELSECPE  60

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLW +  DA YPWLP+LLD  +G LA++ AML+PH  + K G+ F  ++LEL++  ++F
Sbjct  61   LRLWSLHADANYPWLPLLLDRSSGHLAQHVAMLIPHSFSQKDGLNFALDSLELWLTHRLF  120

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
            ++  W   +YG    R     M+R LG+ +    +  +D+
Sbjct  121  LLDRW-SINYGLS-ARQNMIRMSRALGYELNPSFWLKLDE  158



>ref|WP_009789290.1| hypothetical protein [Synechococcus sp. BL107]
 gb|EAU70491.1| hypothetical protein BL107_10501 [Synechococcus sp. BL107]
Length=156

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKP-KDFVERTIGFTINFKR-EDEYDPRELSEF  472
            V+I+ + IR LDLSP +  T        +P  + +E+     +NF    D+ DPREL+E 
Sbjct  4    VLIDAESIRRLDLSPLRICTD-------QPLNELLEQGPILELNFHWPRDQDDPRELAEC  56

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE RLW +R DA YPWLP++L+   G L R+ AM+VPH  N   G+ F+P+ALEL++  +
Sbjct  57   PEPRLWALRADARYPWLPLMLERDRGSLIRHVAMVVPHSFNRTEGLRFDPQALELWITHR  116

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +  +    ++       R     M+  LG+ + D  + L+
Sbjct  117  LMQLDDLCQEQLHRSM-RGNLSQMSAALGYELNDSFWSLL  155



>ref|WP_010316588.1| hypothetical protein [Synechococcus sp. CB0205]
Length=163

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 87/152 (57%), Gaps = 11/152 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK--REDEYDPRELSEF  472
            V I+   ++   L P Q    +       PKD ++ +   T+ F   R  E DPRELSE 
Sbjct  11   VSISAQQVQDQSLEPLQPWFAL------DPKDLLQASGSLTLQFDWPRSAE-DPRELSEI  63

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
             E+RLW +R DA  PWLP+LL+  +G+L R+ AML+PHQ N   G+ F P++LEL++  +
Sbjct  64   TELRLWSLRADALCPWLPLLLERSSGQLTRHVAMLLPHQFNRSEGIRFAPDSLELWMTHR  123

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAI  196
            ++++  W  + YG    R   + MA +LGF +
Sbjct  124  LYLLDHW-SRGYGLNC-RGNLEQMAAVLGFEL  153



>gb|ABD96472.1| unknown [uncultured marine type-A Synechococcus GOM 5D20]
Length=156

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 81/159 (51%), Gaps = 8/159 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V IN D IR LDL+P Q  +    PS       +E      + F    D  DPREL+E P
Sbjct  4    VHINADAIRRLDLTPLQPWSSQPLPS------LLELGPALELQFYWPRDPSDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA YPWLP+LL+   G L R+ AM+VPH  N   G+ F P+ALEL++  ++
Sbjct  58   EPRLWALRADANYPWLPLLLERDQGSLIRHVAMVVPHSFNRSEGLRFEPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +        G    R     MA  LG+ +    + L+
Sbjct  118  MQLEDLCTSKLGLS-QRGNLSQMAASLGYELDAGFWTLL  155



>ref|WP_011360395.1| hypothetical protein [Synechococcus sp. CC9902]
 ref|YP_377628.1| hypothetical protein Syncc9902_1626 [Synechococcus sp. CC9902]
 gb|ABB26584.1| conserved hypothetical protein [Synechococcus sp. CC9902]
Length=156

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 88/160 (55%), Gaps = 8/160 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V+I+ + IR LDLSP +        S    KD +++     +NF    D  DPREL+E P
Sbjct  4    VLIDAESIRRLDLSPLRIW------SDQPLKDLLKQGPILELNFHWPRDPEDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA YPWLP++L+   G L R+ AM+VPH  N   G+ F+P+ALEL++  ++
Sbjct  58   EPRLWSLRADARYPWLPLMLERDRGSLIRHVAMVVPHSFNRTEGLRFDPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
              +    ++       R     M+  LG+ + D  + L++
Sbjct  118  MQLDDLCQEQLDRTM-RGNLSQMSAALGYELNDSFWSLLN  156



>gb|ABD96367.1| unknown [uncultured marine type-A Synechococcus GOM 3O12]
Length=156

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 81/159 (51%), Gaps = 8/159 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V IN + IR LDL+P Q  +    PS       +E      + F    D  DPREL+E P
Sbjct  4    VQINAEAIRRLDLTPLQPWSNQPLPS------LLELGPALELQFDWPRDPSDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA YPWLP+LL+   G L R+ AM+VPH  N   G+ F P+ALEL++  ++
Sbjct  58   EPRLWALRADARYPWLPLLLERDQGSLIRHVAMVVPHSFNRSEGLRFEPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +        G    R     MA  LG+ +    + L+
Sbjct  118  MQLDDLCTSTLGLS-QRGNLSQMAASLGYELDAGFWTLL  155



>ref|WP_038556234.1| hypothetical protein [Synechococcus sp. KORDI-52]
 gb|AII50093.1| hypothetical protein KR52_13255 [Synechococcus sp. KORDI-52]
Length=161

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 89/161 (55%), Gaps = 8/161 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V+I+   IR+LDL P +  +    P +A     + +  G  + F     + DPREL E P
Sbjct  4    VLIDAPAIRALDLRPLKIWS--DQPLNA----LLSQGPGLELRFDWPRAQDDPRELPECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA +PWLP+LL+   G L R+ A++VPH  +   G+ F+PEALEL+V  ++
Sbjct  58   EPRLWALRADARFPWLPLLLERDHGSLIRHVALVVPHSFSRSEGLRFDPEALELWVTHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDK  166
             ++    +Q  G P  R     MA  LG+ +    + L+++
Sbjct  118  MLLDDLCQQQLGRPM-RGNLSQMAAALGYELDAGFWSLLNQ  157



>gb|AII47268.1| hypothetical protein KR49_12790 [Synechococcus sp. KORDI-49]
Length=160

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 89/162 (55%), Gaps = 12/162 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV---ERTIGFTINFKREDEYDPRELSE  475
            V I+ D IR LDL+P Q       P  A+    V     T+  + ++ R+ + DPREL+E
Sbjct  4    VQIDADAIRRLDLTPLQ-------PWAARSLGEVLTQGATLELSFDWPRQAD-DPRELAE  55

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE RLW +R DA +PWLP++L+   G L R+ AM+VPH+ +   G+ F PEALEL++  
Sbjct  56   CPEPRLWALRADARHPWLPLVLERDQGSLIRHVAMVVPHRFSRTDGLRFEPEALELWITH  115

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            ++  +    +Q  G    R     MA  LG+ +    + L+D
Sbjct  116  RLMQLDDLCRQTLGRSM-RGNLSQMAASLGYELDAGFWTLLD  156



>ref|WP_006910187.1| hypothetical protein [Cyanobium sp. PCC 7001]
 gb|EDY38288.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
Length=155

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 89/159 (56%), Gaps = 11/159 (7%)
 Frame = -3

Query  639  INEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK--REDEYDPRELSEFPE  466
            +    I +LDLSP      ++      P+  ++      ++F+  R+ + DPRELSE PE
Sbjct  3    VGPAAIAALDLSPLAAWAALS------PEQLLQHGGSLDLSFEWPRQPD-DPRELSEIPE  55

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
            +RLW +R DA  PWLP+L++  +G+L R+ AML+PH  +   G+ F PEALEL++  ++F
Sbjct  56   VRLWCLRADAAMPWLPLLIERSSGQLTRHVAMLLPHGFSRGEGIRFAPEALELWITHRLF  115

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            ++ +W  +  G    R     MA +LG  +    +  +D
Sbjct  116  LLDAW-SRSRGLQC-RQGLVQMAAVLGLEVDPAFWQPLD  152



>gb|ABD96265.1| unknown [uncultured marine type-A Synechococcus GOM 3M9]
 gb|ABD96434.1| unknown [uncultured marine type-A Synechococcus GOM 4P21]
Length=160

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 88/162 (54%), Gaps = 12/162 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFV---ERTIGFTINFKREDEYDPRELSE  475
            V I+ D IR LDL+P Q       P  A+    V     T+  + ++ R+ + DPREL+E
Sbjct  4    VQIDADAIRRLDLTPLQ-------PWAARSLGEVLTQGATLELSFDWPRQAD-DPRELAE  55

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE RLW +R DA +PWLP++L+   G L R+ AM+VPH+ +   G+ F PEALEL++  
Sbjct  56   CPEPRLWALRADARHPWLPLVLERDQGSLIRHVAMVVPHRFSRTDGLRFEPEALELWITH  115

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            ++  +     Q  G    R     MA  LG+ +    + L+D
Sbjct  116  RLMQLDDLCSQTLGRSM-RGNLSQMAASLGYELDAGFWTLLD  156



>ref|WP_015107709.1| hypothetical protein [Cyanobium gracile]
 ref|YP_007044591.1| hypothetical protein Cyagr_0030 [Cyanobium gracile PCC 6307]
 gb|AFY27250.1| hypothetical protein Cyagr_0030 [Cyanobium gracile PCC 6307]
Length=165

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 83/145 (57%), Gaps = 11/145 (8%)
 Frame = -3

Query  624  IRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFK--REDEYDPRELSEFPEIRLWF  451
            +R+LDLSP      +   +            G T++F   RE E DPRELSE PE+RLW 
Sbjct  21   VRALDLSPLAGLASLAPAALLS------AASGLTLDFGWPREAE-DPRELSEIPELRLWS  73

Query  450  VRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSW  271
            +R DA +PWLP++L+   G+L R+ AML+PH  +   G+ F PE+LEL++ +++F++  W
Sbjct  74   LRADALHPWLPLVLERSGGQLTRHVAMLLPHGFSPTEGIRFAPESLELWITQRLFLLDHW  133

Query  270  LKQHYGTPFPRLKTKDMARMLGFAI  196
                 G    R     MA +LG+ +
Sbjct  134  AAT--GGIECRANLGQMAAVLGYEL  156



>ref|WP_011935993.1| hypothetical protein [Synechococcus sp. RCC307]
 ref|YP_001227832.1| hypothetical protein SynRCC307_1576 [Synechococcus sp. RCC307]
 emb|CAK28479.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
Length=157

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 85/150 (57%), Gaps = 7/150 (5%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + ++ D IR LD+SP Q       P+ A  +  +E  +   + + R D+ DPRELSE PE
Sbjct  7    INVSADQIRCLDMSPLQELR--QRPATALLE--LEDGLALQLEWPRADD-DPRELSEVPE  61

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
             RLW +R DA  PWL +LL    G+L+R+ AM V H+ +   G+ F+P+ L L++  ++F
Sbjct  62   CRLWSLRADALCPWLTLLLQRSDGQLSRHVAMQVLHEFSRTEGLRFDPDDLSLWISHRLF  121

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAI  196
             +  W  QH G    R +   MA +LGF +
Sbjct  122  WLDEWGNQH-GLAL-RGRLGQMAAVLGFNV  149



>ref|WP_038543718.1| hypothetical protein [Synechococcus sp. KORDI-100]
 gb|AII42803.1| hypothetical protein KR100_05410 [Synechococcus sp. KORDI-100]
Length=155

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 11/160 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVER--TIGFTINFKREDEYDPRELSEF  472
            V+IN   IR LDLSP   A  +  P      + ++R   +    ++ R+ E DPREL+E 
Sbjct  4    VLINAAAIRQLDLSPL--AVSMDLPL----TELLDRGPVVELRFDWPRDPE-DPRELAEC  56

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE RLW +R DA +PWLP+LL+   G L R+ AM+VPH+ +   G+ F P+ALEL++  +
Sbjct  57   PEPRLWALRADARFPWLPLLLERDHGSLIRHVAMVVPHEFSRTEGLRFEPQALELWITHR  116

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            +  +    + H  +   R     MA  LG+ + D  + L+
Sbjct  117  LMQLDDLCRNHGRS--MRGNLSQMAAALGYELDDSFWSLL  154



>ref|WP_011619894.1| hypothetical protein [Synechococcus sp. CC9311]
 ref|YP_731182.1| hypothetical protein sync_1979 [Synechococcus sp. CC9311]
 gb|ABI45064.1| conserved hypothetical protein [Synechococcus sp. CC9311]
Length=163

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 87/166 (52%), Gaps = 17/166 (10%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKP-KDFVERTIGFTINFKR-EDEYDPRELSEF  472
            VVI+   I++LDL          +P   +P  D +    G  + +    D  DPRELSE 
Sbjct  10   VVIDAVAIQTLDLKAL-------NPWMERPLTDLLNDGAGLELQYNWPRDADDPRELSEC  62

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE RLW +R DA YPWLP++L+   G L ++ AM+VPH  +   G+ F+P+ALE+++  +
Sbjct  63   PEPRLWALRADAVYPWLPLVLERSGGSLIQHVAMVVPHDFSPSEGIRFDPQALEIWITHR  122

Query  291  VFIVYSWLKQHYGTPFP---RLKTKDMARMLGFAIGDELFDLIDKY  163
              ++      H G   P   R     MA  +G+ +    + L+D++
Sbjct  123  FMLL-----DHLGAQLPQSQRWNLLQMAATIGYEVDAAFWTLLDQH  163



>ref|WP_007101958.1| hypothetical protein [Synechococcus sp. RS9917]
 gb|EAQ69758.1| hypothetical protein RS9917_09991 [Synechococcus sp. RS9917]
Length=157

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 93/164 (57%), Gaps = 11/164 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQN--ATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEF  472
            V++++D IR LDL+P Q+   + ++    A P       +    ++ R  + DPRE+SE 
Sbjct  3    VLVSQDAIRLLDLTPLQDWLHSPLSERLAAGP------VLELRYDWPRNGD-DPREVSEC  55

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE RLW +R D   PWLP+LL+ + G L ++ AMLVPH  +   G+ F+P+ALEL++  +
Sbjct  56   PEPRLWALRADGRCPWLPLLLERQGGSLVQHVAMLVPHSFSRGEGLRFDPQALELWITHR  115

Query  291  VFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLIDKYP  160
            + ++ +  +    +    L    MA+ LG+ +    + L+D+ P
Sbjct  116  LILLDTLARSEGASQRGNLTL--MAQSLGYELDPGFWQLLDQAP  157



>ref|WP_011363737.1| hypothetical protein [Synechococcus sp. CC9605]
 ref|YP_381064.1| hypothetical protein Syncc9605_0737 [Synechococcus sp. CC9605]
 gb|ABB34509.1| conserved hypothetical protein [Synechococcus sp. CC9605]
Length=156

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 89/162 (55%), Gaps = 12/162 (7%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVER---TIGFTINFKREDEYDPRELSE  475
            V+I+   IR+LDL P +  +        +P D +      +    ++ R  + DPREL E
Sbjct  4    VLIDALAIRALDLRPLEIWS-------TQPLDVLLGQGPVLELRFDWPRAQD-DPRELPE  55

Query  474  FPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMK  295
             PE RLW +R DA YPWLP+LL+   G L R+ A++VPH  +   G+ F+PEALEL+V  
Sbjct  56   CPEPRLWALRADARYPWLPLLLERDQGSLIRHVALVVPHSFSRSEGLRFDPEALELWVTH  115

Query  294  KVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLID  169
            ++ ++    ++  G P  R     MA  LG+ + +  + L++
Sbjct  116  RLMVLDDLCQRELGRPM-RGNLSQMAAALGYELDEGFWSLLN  156



>ref|XP_002325174.2| hypothetical protein POPTR_0018s12350g [Populus trichocarpa]
 gb|EEF03739.2| hypothetical protein POPTR_0018s12350g [Populus trichocarpa]
Length=74

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = -3

Query  354  MNMKLGVVFNPEALELFVMKKV----FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDE  187
            +NMK G+VFNPEAL+LF MKKV     ++ + L+QH   P PRLKT DMARMLGF IG+E
Sbjct  3    VNMKSGIVFNPEALKLFAMKKVNFRCVLLVAGLQQHINVPKPRLKTSDMARMLGFGIGNE  62

Query  186  LFDLIDKY  163
            LFD ID++
Sbjct  63   LFDSIDQH  70



>ref|WP_028951499.1| hypothetical protein [Synechococcus sp. CC9616]
Length=155

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 85/159 (53%), Gaps = 9/159 (6%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKR-EDEYDPRELSEFP  469
            V+I    IR LDLSP   A  + +P +    D ++      + F    D  DPREL+E P
Sbjct  4    VLIKAAAIRQLDLSPL--AASMEAPLN----DLLDLGPVLELRFDWPRDPEDPRELAECP  57

Query  468  EIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKV  289
            E RLW +R DA +PWLP+LL+   G L R+ AM+VPH  +   G+ F P+ALEL++  ++
Sbjct  58   EPRLWALRADARFPWLPLLLERDNGSLIRHVAMVVPHDFSRTEGLRFEPQALELWITHRL  117

Query  288  FIVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
              +    + H  +   R     MA  LG+ + D  + L+
Sbjct  118  MHLDDLCRAHGRS--MRGNLSQMAAALGYELDDSFWSLL  154



>ref|WP_029552879.1| hypothetical protein [Synechococcus sp. CB0101]
Length=151

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 76/123 (62%), Gaps = 3/123 (2%)
 Frame = -3

Query  561  KPKDFVERTIGFTINFKR-EDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELA  385
            +P+  ++++    +NF+      DPRELSE PE+R+W +R DA  PWLP+LL+  +G+L 
Sbjct  22   EPEALLQQSGSLELNFEWPRASDDPRELSEIPELRVWSLRADALCPWLPLLLERSSGQLT  81

Query  384  RYAAMLVPHQMNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLG  205
            R+ AML+PH  +   G+ F P++LEL++  ++F++  W +        R   + MA +LG
Sbjct  82   RHVAMLLPHSFSRSEGIRFAPDSLELWMTHRLFLLDHWSRGQGLN--CRGNLEQMAAVLG  139

Query  204  FAI  196
            F +
Sbjct  140  FEL  142



>gb|AHF64311.1| hypothetical protein Syncc8109_1967 [Synechococcus sp. WH 8109]
Length=156

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 85/158 (54%), Gaps = 6/158 (4%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            V+I+   IR+LDL P +  +  T P  A         +    ++ R  + DPREL E PE
Sbjct  4    VLIDAPAIRALDLRPLEIWS--TQPLDALLSQGP--VLELRFDWPRAQD-DPRELPECPE  58

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
             RLW +R DA YPWLP+LL+   G L R+ A++VPH  +   G+ F+PEALE +V  ++ 
Sbjct  59   PRLWALRADARYPWLPLLLERDQGSLIRHVALVVPHSFSRSEGLRFDPEALEPWVTHRLM  118

Query  285  IVYSWLKQHYGTPFPRLKTKDMARMLGFAIGDELFDLI  172
            ++    ++  G P  R     MA  LG+ +    + L+
Sbjct  119  VLDDLCQRELGRPM-RGNLSQMAAALGYELDAGFWSLM  155



>ref|WP_006853359.1| hypothetical protein [Synechococcus sp. WH 8016]
 gb|EHA64177.1| protein of unknown function DUF1817 [Synechococcus sp. WH 8016]
Length=163

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 88/165 (53%), Gaps = 17/165 (10%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKP-KDFVERTIGFTINFKR-EDEYDPRELSEF  472
            VVI+   I++LDL          +P   +P  D +    G  + +    D  DPRELSE 
Sbjct  10   VVIDAVAIQTLDLRAL-------NPWMERPLTDLLSDGAGLELQYNWPRDADDPRELSEC  62

Query  471  PEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKK  292
            PE RLW +R DA +PWLP++L+   G L ++ AM+VPH  +   G+ F+P+ALE+++  +
Sbjct  63   PEPRLWALRADAVHPWLPLVLERSGGSLIQHVAMVVPHDFSPSEGIRFDPQALEIWITHR  122

Query  291  VFIVYSWLKQHYGTPFPRLKTKD---MARMLGFAIGDELFDLIDK  166
              ++      H G   P+ +  +   MA  +G+ +    + L+D+
Sbjct  123  FMLL-----DHLGKHLPQSQRGNLLQMAATIGYEVDAAFWTLLDQ  162



>ref|WP_035829206.1| hypothetical protein [Cyanobium sp. CACIAM 14]
 gb|KEF43186.1| hypothetical protein ER33_00120 [Cyanobium sp. CACIAM 14]
Length=161

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 3/113 (3%)
 Frame = -3

Query  531  GFTINFKR-EDEYDPRELSEFPEIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQ  355
            G  I F    D  DPRELSE PE+RLW +R DA +PWLP++L+   G+L R+ AML+PH 
Sbjct  42   GLAIGFDWPRDPDDPRELSEIPELRLWSLRADALHPWLPLVLERSDGQLTRHVAMLLPHG  101

Query  354  MNMKLGVVFNPEALELFVMKKVFIVYSWLKQHYGTPFPRLKTKDMARMLGFAI  196
             +   G+ F PE+LEL++  ++F++  W     G    R     MA +LG+ +
Sbjct  102  FSRSEGIRFAPESLELWITHRLFLLDHW-ATAAGLEC-RANLGQMAAVLGYEL  152



>ref|WP_006043637.1| hypothetical protein [Synechococcus sp. WH 7805]
 gb|EAR20083.1| hypothetical protein WH7805_14223 [Synechococcus sp. WH 7805]
Length=166

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 84/164 (51%), Gaps = 13/164 (8%)
 Frame = -3

Query  645  VVINEDVIRSLDLSPFQNATGITSPSHAKPKDFVERTIGFTINFKREDEYDPRELSEFPE  466
            + I  D I+ LDL      + +  P      D     +  T  + R  E DPRELSE  E
Sbjct  10   LTIGADAIQRLDLRALD--SWMDKPLTKLLNDGA--VLELTYEWPRPAE-DPRELSECAE  64

Query  465  IRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKLGVVFNPEALELFVMKKVF  286
             RLW +R DA YPWLP+LLD   G L ++ AMLVPH      G+ F+P+ALEL++  ++ 
Sbjct  65   PRLWALRADAKYPWLPLLLDRPKGCLVQHVAMLVPHDFRPSDGIRFDPQALELWITHRLM  124

Query  285  IVYSWLKQH---YGTP-FPRLKTKDMARMLGFAIGDELFDLIDK  166
            +    L QH    G P   R     MA  LGF +    ++L+D+
Sbjct  125  V----LDQHGADAGIPGHQRGNLSLMAASLGFELDGGFWELLDQ  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2059388686538