BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30991_g1_i1 len=411 path=[1:0-410]

Length=411
                                                                      Score     E

gb|ABI52585.1|  pollen-specific protein                                 115   5e-27   Camellia sinensis [black tea]
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             110   2e-25   
gb|AAQ90182.1|  ntp101                                                  110   2e-25   Nicotiana tabacum [American tobacco]
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             110   3e-25   
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             108   2e-24   
gb|AAD02557.1|  PGPS/NH15                                               102   3e-24   Petunia x hybrida [garden petunia]
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             107   3e-24   
gb|KDP30646.1|  hypothetical protein JCGZ_16211                         105   5e-24   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    105   1e-23   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             105   1e-23   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    105   1e-23   
ref|XP_002523382.1|  multicopper oxidase, putative                      105   1e-23   Ricinus communis
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    105   1e-23   
gb|KHN42953.1|  L-ascorbate oxidase like                              99.0    1e-23   
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             105   2e-23   
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                104   3e-23   
gb|AAQ90185.1|  ntp805                                                  103   5e-23   Nicotiana tabacum [American tobacco]
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             103   5e-23   
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             103   7e-23   
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             103   1e-22   
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             102   1e-22   
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             102   1e-22   
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             102   1e-22   
gb|EPS72881.1|  pollen-specific protein                                 102   2e-22   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    102   2e-22   Nicotiana tabacum [American tobacco]
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             102   2e-22   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             102   3e-22   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             101   3e-22   
gb|EPS68478.1|  hypothetical protein M569_06286                         101   3e-22   
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             101   3e-22   
dbj|BAL41449.1|  SKU5 similar 1                                         101   4e-22   
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             101   4e-22   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             101   4e-22   
gb|KHN20513.1|  L-ascorbate oxidase like                                100   5e-22   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             100   7e-22   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             100   9e-22   
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             100   9e-22   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             100   9e-22   
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         100   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog           99.4    2e-21   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog           99.4    2e-21   
emb|CDP18567.1|  unnamed protein product                              99.4    2e-21   
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg              99.4    2e-21   
emb|CAN69061.1|  hypothetical protein VITISV_032605                   99.4    2e-21   Vitis vinifera
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein       99.0    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog           99.0    3e-21   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog           99.0    3e-21   
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg              99.0    3e-21   
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  99.0    3e-21   
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  98.6    3e-21   
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    3e-21   
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg              98.6    4e-21   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein       98.6    4e-21   Populus trichocarpa [western balsam poplar]
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                  97.8    6e-21   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    7e-21   
ref|XP_002523381.1|  multicopper oxidase, putative                    97.8    7e-21   Ricinus communis
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721           97.8    7e-21   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g           97.4    8e-21   
ref|NP_187948.1|  protein SKU5-like 13                                97.4    8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog           97.4    8e-21   
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg           97.4    9e-21   
gb|KDP30647.1|  hypothetical protein JCGZ_16212                       97.4    9e-21   
emb|CDY24188.1|  BnaC01g37680D                                        97.4    9e-21   
ref|XP_007014658.1|  SKU5 similar 13                                  97.4    1e-20   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220        97.1    1e-20   
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    1e-20   
emb|CDY23597.1|  BnaC05g39970D                                        97.1    1e-20   
emb|CDY43994.1|  BnaA05g25890D                                        97.1    1e-20   
emb|CDX75708.1|  BnaC03g37910D                                        97.1    1e-20   
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    1e-20   
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    1e-20   
emb|CDX82540.1|  BnaA03g32810D                                        97.1    1e-20   
emb|CDY43352.1|  BnaA01g29830D                                        96.7    2e-20   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg           96.7    2e-20   
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    2e-20   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    2e-20   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    2e-20   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  96.7    2e-20   
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg           96.7    2e-20   
ref|XP_007014661.1|  SKU5 similar 12                                  96.3    2e-20   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  96.3    2e-20   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    3e-20   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    3e-20   
gb|KHG27164.1|  L-ascorbate oxidase                                   95.1    4e-20   
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog           95.1    7e-20   
gb|AGW80453.1|  pollen-specific protein                               94.7    8e-20   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    1e-19   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...  94.4    1e-19   
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    1e-19   
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    1e-19   
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g           94.0    1e-19   
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    1e-19   
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    2e-19   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    3e-19   
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    3e-19   
emb|CDP04133.1|  unnamed protein product                              93.2    4e-19   
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    4e-19   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    4e-19   
emb|CAE53901.1|  putative L-ascorbate oxidase homolog                 88.6    4e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    5e-19   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                 92.4    5e-19   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg           92.4    5e-19   
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                 92.4    5e-19   
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog           92.4    6e-19   
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog           92.4    6e-19   
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  92.4    6e-19   
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg              92.0    7e-19   
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    7e-19   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    8e-19   
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    9e-19   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    1e-18   
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    1e-18   
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    1e-18   
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    1e-18   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    1e-18   
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    1e-18   
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog           91.3    1e-18   
ref|NP_001055876.2|  Os05g0485800                                     85.9    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog           91.3    1e-18   
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog           91.3    2e-18   
gb|KHG03555.1|  L-ascorbate oxidase                                   91.3    2e-18   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg           90.9    2e-18   
gb|KHN44494.1|  L-ascorbate oxidase like                              90.5    2e-18   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog           90.5    2e-18   
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog           90.5    2e-18   
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog           90.5    3e-18   
gb|KHN42951.1|  L-ascorbate oxidase like                              89.0    4e-18   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog           90.1    4e-18   
ref|NP_001132891.1|  uncharacterized protein LOC100194388             88.6    5e-18   Zea mays [maize]
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog           89.7    6e-18   
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog           89.7    6e-18   
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg           89.4    6e-18   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  89.4    7e-18   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog           89.4    7e-18   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog           89.4    7e-18   
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog           89.4    7e-18   
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720           89.4    7e-18   
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg           89.4    8e-18   
emb|CDY10549.1|  BnaC03g70650D                                        89.0    8e-18   
emb|CDY56013.1|  BnaA08g29220D                                        89.0    8e-18   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog           89.4    8e-18   
ref|NP_187947.1|  protein SKU5-like 11                                89.0    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg           89.0    1e-17   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g           88.6    1e-17   
emb|CDM84722.1|  unnamed protein product                              88.6    1e-17   
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog           88.6    1e-17   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                      88.6    1e-17   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog           88.6    1e-17   
gb|EMT12555.1|  L-ascorbate oxidase-like protein                      87.8    1e-17   
dbj|BAK07214.1|  predicted protein                                    88.6    1e-17   
gb|EMS63309.1|  L-ascorbate oxidase-like protein                      86.3    2e-17   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  88.2    2e-17   
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog           87.4    2e-17   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                      88.2    2e-17   
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog           88.2    2e-17   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog           88.2    2e-17   
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog           88.2    2e-17   
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog           88.2    2e-17   
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  88.2    2e-17   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog           88.2    2e-17   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog           88.2    2e-17   
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  88.2    2e-17   
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...  87.8    2e-17   
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                  87.8    2e-17   
gb|KHG05644.1|  L-ascorbate oxidase                                   87.8    3e-17   
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                  87.8    3e-17   
gb|EEC79422.1|  hypothetical protein OsI_20394                        87.0    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                 87.4    3e-17   
dbj|BAK05994.1|  predicted protein                                    87.4    3e-17   
gb|AAD10639.1|  putative pollen specific protein                      87.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151662.1|  L-ascorbate oxidase precursor                    87.0    4e-17   Zea mays [maize]
gb|ACN34077.1|  unknown                                               87.0    5e-17   Zea mays [maize]
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog           87.0    5e-17   
gb|ADK47981.1|  L-ascorbate oxidase-like protein                      87.0    5e-17   
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog           87.0    5e-17   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770        87.0    5e-17   Sorghum bicolor [broomcorn]
ref|XP_004305573.1|  PREDICTED: L-ascorbate oxidase homolog           84.3    6e-17   
ref|NP_564697.1|  SKU5 similar 14                                     86.7    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAT01329.1|  putative L-ascorbate oxidase                          86.7    7e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog           86.3    8e-17   
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog           86.3    9e-17   
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                 86.3    9e-17   
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog           86.3    9e-17   
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617           85.9    1e-16   
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog           85.9    1e-16   
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970        85.9    1e-16   Sorghum bicolor [broomcorn]
ref|NP_001044620.1|  Os01g0816700                                     85.9    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog           85.9    1e-16   
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein       85.9    1e-16   
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557           85.9    1e-16   
ref|NP_175953.1|  protein SKU5 similar 12                             85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EEE55579.1|  hypothetical protein OsJ_03867                        85.9    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g           85.1    2e-16   
dbj|BAD94289.1|  L-ascorbate oxidase precursor                        79.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                  85.1    2e-16   
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog           85.1    2e-16   
gb|ACF86554.2|  unknown                                               85.1    2e-16   Zea mays [maize]
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg           85.1    2e-16   
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor         85.1    2e-16   Zea mays [maize]
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog           85.1    2e-16   
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog           84.7    2e-16   
emb|CAA47177.1|  Bplo                                                 84.7    3e-16   Brassica napus [oilseed rape]
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                 84.7    3e-16   
emb|CDX82541.1|  BnaA03g32800D                                        84.7    3e-16   
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...  84.7    3e-16   Brassica napus [oilseed rape]
emb|CDY23596.1|  BnaC05g39980D                                        84.7    3e-16   
gb|AFC88081.1|  skewed-like protein                                   84.3    3e-16   
ref|XP_008359469.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...  84.3    3e-16   
emb|CDY24189.1|  BnaC01g37690D                                        84.3    4e-16   
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog           84.3    4e-16   
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog           84.3    4e-16   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog           84.3    4e-16   
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                 84.3    4e-16   
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog           84.3    4e-16   
emb|CDX75707.1|  BnaC03g37900D                                        84.3    4e-16   
emb|CAA47178.1|  Bplo                                                 84.3    4e-16   Brassica napus [oilseed rape]
emb|CDY43353.1|  BnaA01g29840D                                        84.0    5e-16   
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog           84.3    5e-16   
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog           84.0    5e-16   
gb|AES71848.2|  L-ascorbate oxidase-like protein                      83.6    6e-16   
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                 83.6    6e-16   
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                 83.6    7e-16   
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog           83.6    7e-16   
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog           83.6    7e-16   
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                 83.6    7e-16   
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                 83.6    7e-16   
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog           83.6    7e-16   
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog           83.6    8e-16   
gb|ABV89619.1|  Sku5-like 11                                          83.6    8e-16   Brassica rapa
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor         83.2    1e-15   Zea mays [maize]
gb|ACN26659.1|  unknown                                               83.2    1e-15   Zea mays [maize]
gb|KDP47151.1|  hypothetical protein JCGZ_00042                       82.8    1e-15   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg           82.8    1e-15   
gb|AFK44839.1|  unknown                                               81.3    1e-15   
emb|CDY50029.1|  BnaA06g00300D                                        82.4    2e-15   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg           82.0    2e-15   
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog           82.0    2e-15   
emb|CDY54363.1|  BnaC06g07290D                                        82.0    2e-15   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg              82.0    3e-15   
emb|CDP10787.1|  unnamed protein product                              81.6    3e-15   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog           81.6    3e-15   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog           81.6    3e-15   
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog           81.3    3e-15   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog           81.6    3e-15   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog           81.6    4e-15   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog           81.3    4e-15   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg           81.3    4e-15   
emb|CAA47176.1|  Bplo                                                 81.3    4e-15   Brassica napus [oilseed rape]
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog           81.3    4e-15   
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog           81.3    5e-15   
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog           81.3    5e-15   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog           80.9    6e-15   
dbj|BAH57047.1|  AT4G38420                                            79.3    7e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KGN43295.1|  hypothetical protein Csa_7G018770                     80.1    7e-15   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog           80.5    9e-15   
emb|CDX91548.1|  BnaC02g16120D                                        80.1    9e-15   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog           80.5    9e-15   
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494           80.1    1e-14   
ref|XP_004171059.1|  PREDICTED: L-ascorbate oxidase homolog           79.7    1e-14   
emb|CAB37498.1|  putative pectinesterase                              80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195555.2|  protein SKU5 similar 9                              80.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                         80.1    1e-14   Petunia x hybrida [garden petunia]
gb|KHN05478.1|  L-ascorbate oxidase like                              80.1    1e-14   
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   Vitis vinifera
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   Vitis vinifera
gb|AAD41439.1|AC007727_28  Strong similarity to gb|X96932 ascorba...  78.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAN83942.1|  hypothetical protein VITISV_013559                   80.1    1e-14   Vitis vinifera
emb|CDX97352.1|  BnaA02g21430D                                        79.7    1e-14   
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog           80.1    1e-14   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                  80.1    1e-14   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog           79.7    1e-14   
gb|AFK45722.1|  unknown                                               75.9    1e-14   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog           79.7    2e-14   
dbj|BAF01895.1|  hypothetical protein                                 77.4    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog           79.7    2e-14   
gb|KHN46930.1|  L-ascorbate oxidase like                              77.8    2e-14   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog           79.7    2e-14   
ref|NP_001241709.1|  uncharacterized protein LOC100856887             77.8    2e-14   
gb|KHF99853.1|  L-ascorbate oxidase                                   79.3    2e-14   
ref|XP_002528421.1|  multicopper oxidase, putative                    79.3    2e-14   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg           79.3    2e-14   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg           79.3    2e-14   
ref|NP_177743.1|  SKU5-like 5 protein                                 79.3    2e-14   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg              79.3    2e-14   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog           79.3    2e-14   
gb|AAL09733.1|  At1g76160/T23E18_10                                   79.3    2e-14   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog           79.3    2e-14   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog           79.0    2e-14   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420        79.0    3e-14   
gb|KHG21949.1|  L-ascorbate oxidase                                   79.0    3e-14   
emb|CDX87633.1|  BnaA07g32400D                                        79.0    3e-14   
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog           79.0    3e-14   
gb|ACN50176.1|  pectinesterase                                        79.0    3e-14   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog           79.0    3e-14   
emb|CDY67479.1|  BnaCnng55180D                                        79.0    3e-14   
gb|ACF85744.1|  unknown                                               78.2    3e-14   
gb|KHG03845.1|  L-ascorbate oxidase                                   79.0    3e-14   
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog           79.0    3e-14   
emb|CDY35790.1|  BnaA08g04510D                                        79.0    3e-14   
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604           79.0    3e-14   
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog           78.6    3e-14   
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog           78.6    4e-14   
gb|ACL53812.1|  unknown                                               78.6    4e-14   
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog           78.6    4e-14   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog           78.6    4e-14   
ref|XP_009402576.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  77.8    4e-14   
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog           78.6    4e-14   
gb|AAG52028.1|AC022456_9  pectinesterase, putative, 5' partial; 9...  76.3    5e-14   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    5e-14   
gb|KHF99506.1|  L-ascorbate oxidase                                   78.2    5e-14   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    5e-14   
gb|KGN55480.1|  hypothetical protein Csa_4G653410                     77.8    5e-14   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    5e-14   
ref|XP_010089486.1|  L-ascorbate oxidase-like protein                 75.9    5e-14   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg           78.2    5e-14   
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                         78.2    5e-14   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                    78.2    5e-14   
ref|NP_173603.1|  SKU5 similar 8 protein                              78.2    5e-14   
ref|XP_009127358.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    5e-14   
ref|XP_007041705.1|  SKU5 similar 5                                   78.2    5e-14   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                   78.2    5e-14   
ref|XP_002867467.1|  hypothetical protein ARALYDRAFT_328883           78.2    6e-14   
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    6e-14   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    6e-14   
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    6e-14   
dbj|BAH20248.1|  AT1G41830                                            77.4    6e-14   
emb|CDY16369.1|  BnaA02g11730D                                        77.8    6e-14   
emb|CDX73238.1|  BnaC06g36860D                                        78.2    6e-14   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog           78.2    6e-14   
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog           77.8    6e-14   
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg           77.8    6e-14   
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  77.8    6e-14   
gb|KEH40258.1|  multi-copper oxidase-like protein                     77.8    7e-14   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg           77.8    7e-14   
ref|XP_010478973.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    7e-14   
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog           77.8    7e-14   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog           77.8    7e-14   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog           77.8    7e-14   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog           77.8    7e-14   
ref|XP_006396009.1|  hypothetical protein EUTSA_v10004223mg           77.4    7e-14   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog           77.8    7e-14   
ref|XP_009402575.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  77.4    7e-14   
gb|KDO85017.1|  hypothetical protein CISIN_1g009149mg                 77.4    7e-14   
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg           77.8    7e-14   
gb|AAF99833.1|AC008046_5  Putative pectinesterase                     77.8    7e-14   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                         77.8    8e-14   
ref|NP_564479.1|  SKU5 similar 6                                      77.8    8e-14   
gb|AAL24296.1|  Unknown protein                                       77.8    8e-14   
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543           77.8    8e-14   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990        77.8    8e-14   
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g           77.4    9e-14   
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    9e-14   
ref|XP_010655385.1|  PREDICTED: L-ascorbate oxidase homolog           72.8    9e-14   
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg           77.4    9e-14   
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg           77.4    9e-14   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                 77.4    1e-13   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                  77.4    1e-13   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
gb|AFK41636.1|  unknown                                               72.8    1e-13   
gb|KHN12597.1|  L-ascorbate oxidase like                              77.0    1e-13   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg           77.4    1e-13   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
gb|AAM97070.1|  pectinesterase, putative                              77.4    1e-13   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
gb|AGT57427.1|  ascorbate oxidase                                     77.4    1e-13   
ref|XP_010438504.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  77.4    1e-13   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg              77.4    1e-13   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  77.4    1e-13   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_010433262.1|  PREDICTED: L-ascorbate oxidase homolog           77.4    1e-13   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    1e-13   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    1e-13   
emb|CDP04415.1|  unnamed protein product                              77.0    1e-13   
emb|CDY29530.1|  BnaA06g14400D                                        77.4    1e-13   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    1e-13   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g           77.0    1e-13   
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    1e-13   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    1e-13   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg           77.0    1e-13   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  77.0    1e-13   
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein       77.0    1e-13   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  76.6    1e-13   
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    2e-13   
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein       77.0    2e-13   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog           77.0    2e-13   
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g           76.6    2e-13   
emb|CBI23229.3|  unnamed protein product                              72.8    2e-13   
ref|NP_001059758.2|  Os07g0510900                                     72.4    2e-13   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460        76.6    2e-13   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
ref|XP_008345816.1|  PREDICTED: L-ascorbate oxidase homolog           73.6    2e-13   
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog           76.6    2e-13   
gb|ABR18324.1|  unknown                                               76.3    2e-13   
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog           76.3    2e-13   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  76.3    2e-13   
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog           76.3    2e-13   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g           76.3    2e-13   
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                 76.3    2e-13   
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                  76.3    3e-13   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog           76.3    3e-13   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog           76.3    3e-13   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg              76.3    3e-13   
gb|AFK91526.1|  laccase-like protein                                  75.9    3e-13   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950        76.3    3e-13   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                 75.9    3e-13   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    3e-13   
gb|KHG11003.1|  L-ascorbate oxidase                                   75.9    3e-13   
emb|CDP07321.1|  unnamed protein product                              75.9    3e-13   
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                 75.5    3e-13   
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    3e-13   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    3e-13   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    3e-13   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g           75.9    3e-13   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  75.9    3e-13   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    3e-13   
gb|KHN44868.1|  L-ascorbate oxidase like                              75.5    4e-13   
emb|CAA65634.1|  PS60                                                 75.9    4e-13   
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    4e-13   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    4e-13   
emb|CDY31468.1|  BnaC05g15770D                                        75.9    4e-13   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog           75.9    4e-13   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g           75.9    4e-13   
gb|ADB28926.1|  multicopper oxidase protein                           73.9    4e-13   
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg           75.5    4e-13   
ref|NP_194538.1|  SKU5 similar 10 protein                             75.5    4e-13   
gb|EPS57861.1|  hypothetical protein M569_16956                       75.1    4e-13   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg              75.5    4e-13   
dbj|BAK04971.1|  predicted protein                                    75.5    4e-13   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog           75.5    4e-13   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                      75.5    4e-13   
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog           75.5    4e-13   
emb|CDY64276.1|  BnaCnng43630D                                        75.5    5e-13   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077           75.5    5e-13   
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  75.5    5e-13   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog           75.5    5e-13   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300        75.5    5e-13   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g           75.5    5e-13   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog           75.5    5e-13   
gb|KEH30611.1|  multi-copper oxidase-like protein                     75.5    5e-13   
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog           75.5    5e-13   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog           75.1    5e-13   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog           75.5    5e-13   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog           75.1    5e-13   
gb|KHG04142.1|  L-ascorbate oxidase                                   75.1    6e-13   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                        75.1    6e-13   
emb|CDY54804.1|  BnaA06g40970D                                        75.5    6e-13   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                        75.1    6e-13   
gb|EPS74059.1|  hypothetical protein M569_00695                       75.1    6e-13   
gb|ACN28536.1|  unknown                                               74.7    6e-13   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog           75.1    6e-13   
gb|KEH36280.1|  multi-copper oxidase-like protein                     75.1    6e-13   
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  75.1    7e-13   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog           75.1    7e-13   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog           75.1    7e-13   
gb|ACJ85585.1|  unknown                                               75.1    7e-13   
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog           75.1    7e-13   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    7e-13   
gb|AFK35121.1|  unknown                                               74.7    7e-13   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    8e-13   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg           74.7    8e-13   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    8e-13   
gb|ABK95805.1|  unknown                                               74.7    8e-13   
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    8e-13   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                         74.7    8e-13   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                         74.7    8e-13   
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                  74.7    8e-13   
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    8e-13   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg           74.7    9e-13   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                       74.7    9e-13   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                        74.7    9e-13   
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog           74.3    9e-13   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    9e-13   
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  74.7    1e-12   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein       74.7    1e-12   
ref|NP_001058365.1|  Os06g0678800                                     74.7    1e-12   
gb|EAZ02087.1|  hypothetical protein OsI_24168                        74.7    1e-12   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog           74.3    1e-12   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog           74.7    1e-12   
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  74.3    1e-12   
gb|KHG25743.1|  L-ascorbate oxidase                                   74.3    1e-12   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog           74.3    1e-12   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg           74.3    1e-12   
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog           74.3    1e-12   
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...  74.3    1e-12   



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWN+RSEMW RAYLGQQFYFSVLSP RSLRDEY+LPEK  +CG+VK   +PP
Sbjct  499  MTTLDNAGMWNMRSEMWERAYLGQQFYFSVLSPARSLRDEYNLPEKTPVCGLVKDLPEPP  558

Query  230  PYTM*GVL  207
            PY+  G+ 
Sbjct  559  PYSNSGIF  566



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVKG   P 
Sbjct  495  MTTLDNAGMWNLRSEMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPA  554

Query  230  PYT  222
            PYT
Sbjct  555  PYT  557



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVKG   P 
Sbjct  495  MTTLDNAGMWNLRSEMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPA  554

Query  230  PYT  222
            PYT
Sbjct  555  PYT  557



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVKG   P 
Sbjct  495  MTTLDNAGMWNLRSEMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPA  554

Query  230  PYT  222
            PYT
Sbjct  555  PYT  557



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS+MW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVK    PP
Sbjct  504  MTTLDNAGIWNLRSDMWERNYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKSMPMPP  563

Query  230  PY  225
            PY
Sbjct  564  PY  565



>gb|AAD02557.1| PGPS/NH15 [Petunia x hybrida]
Length=167

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRS+MW + YLGQQ YFSVLSP  SLRDEY+LP+   LCGIVKG   P 
Sbjct  104  MTTLDNAGMWNLRSDMWEKFYLGQQLYFSVLSPSGSLRDEYNLPDNHPLCGIVKGMPMPA  163

Query  230  PY  225
            PY
Sbjct  164  PY  165



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEM  RAYLGQQFYFSV+S  RSLRDEY LPE Q LCGIVK   KP 
Sbjct  492  MTTLDNAGMWNLRSEMRERAYLGQQFYFSVVSEARSLRDEYSLPETQELCGIVKSLPKPA  551

Query  230  PYT  222
            PYT
Sbjct  552  PYT  554



>gb|KDP30646.1| hypothetical protein JCGZ_16211 [Jatropha curcas]
Length=450

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWNLRSEMW R YLGQQ Y SVLSP RSLRDEY++P+   LCG+VKG  KPP
Sbjct  387  LLTFDNCGMWNLRSEMWERTYLGQQLYASVLSPARSLRDEYNVPDNAMLCGLVKGLPKPP  446

Query  230  PYTM  219
            PYT+
Sbjct  447  PYTI  450



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+W R YLGQQ Y SVLSP RSLRDEY++P+   LCGIVKG  KPP
Sbjct  488  LLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPP  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+W R YLGQQ Y SVLSP RSLRDEY++P+   LCGIVKG  KPP
Sbjct  489  LLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPP  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTI  552



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+W R YLGQQ Y SVLSP RSLRDEY++P+   LCGIVKG  KPP
Sbjct  490  LLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPP  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSEMW R YLGQQ Y SVLSP RSLRDEY++P+   LCG+VKG  KPP
Sbjct  488  LLTFDNAGMWNIRSEMWERTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKGLPKPP  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+W R YLGQQ Y SVLSP RSLRDEY++P+   LCGIVKG  KPP
Sbjct  489  LLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPP  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTI  552



>gb|KHN42953.1| L-ascorbate oxidase like [Glycine soja]
Length=106

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEM    YLGQQ Y SVLSP RSLRDEY+LPE Q +CGIVK   KPP
Sbjct  43   MLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLVCGIVKDMPKPP  102

Query  230  PYT  222
            PY+
Sbjct  103  PYS  105



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEM  RAYLGQQFY SV+S  RSLRDEY LPE Q LCGIVK   KP 
Sbjct  493  MTTLDNAGMWNLRSEMRERAYLGQQFYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPA  552

Query  230  PYT  222
            PYT
Sbjct  553  PYT  555



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   104 bits (259),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRS+M  RAYLGQQ YFSVLSP RSLRDEY++P  Q LCGIV+   KP 
Sbjct  496  MTTLDNAGMWNLRSDMAERAYLGQQLYFSVLSPARSLRDEYNIPLTQQLCGIVQNLPKPT  555

Query  230  PYT  222
            PY+
Sbjct  556  PYS  558



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVK    P 
Sbjct  496  MTTLDNAGLWNLRSEMWERYYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPS  555

Query  230  PY  225
            PY
Sbjct  556  PY  557



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVK    P 
Sbjct  496  MTTLDNAGLWNLRSEMWERYYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPS  555

Query  230  PY  225
            PY
Sbjct  556  PY  557



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVK    P 
Sbjct  496  MTTLDNAGLWNLRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPLPS  555

Query  230  PY  225
            PY
Sbjct  556  PY  557



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEM  RAYLGQQ Y SV+S  RSLRDEY LPE Q LCGIVK   KP 
Sbjct  492  MTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPA  551

Query  230  PYT  222
            PYT
Sbjct  552  PYT  554



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEM  RAYLGQQ Y SV+S  RSLRDEY LPE Q LCGIVK   KP 
Sbjct  493  MTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPA  552

Query  230  PYT  222
            PYT
Sbjct  553  PYT  555



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEM  RAYLGQQ Y SV+S  RSLRDEY LPE Q LCGIVK   KP 
Sbjct  493  MTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPA  552

Query  230  PYT  222
            PYT
Sbjct  553  PYT  555



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRSEM  RAYLGQQ Y SV+S  RSLRDEY LPE Q LCGIVK   KP 
Sbjct  493  MTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPA  552

Query  230  PYT  222
            PYT
Sbjct  553  PYT  555



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   102 bits (255),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRSEM  RAYLGQQFYFSVLSP RSLRDEY++   Q LCGIVKG   P 
Sbjct  521  MTTLDNAGLWNLRSEMRERAYLGQQFYFSVLSPARSLRDEYNILPDQPLCGIVKGLPLPM  580

Query  230  PYT  222
            PY+
Sbjct  581  PYS  583



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW + YLG+Q YFSVLSP RSLRDEY++P+   LCGIVKG   P 
Sbjct  491  MLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPA  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+W+LRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVK    P 
Sbjct  494  MTTLDNAGLWSLRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPS  553

Query  230  PY  225
            PY
Sbjct  554  PY  555



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW + YLG+Q YFSVLSP RSLRDEY++P+   LCGIVKG   P 
Sbjct  526  MLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPA  585

Query  230  PY  225
            PY
Sbjct  586  PY  587



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW + YLG+Q YFSVLSP RSLRDEY++P+   LCGIVKG   P 
Sbjct  491  MLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPA  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   101 bits (252),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRS M  R YLGQQ YFSVLSP +SLRDEY++PE Q  CGIV+G  KP 
Sbjct  470  MTTLDNAGMWNLRSMMLERQYLGQQLYFSVLSPAKSLRDEYNIPETQLQCGIVEGLPKPM  529

Query  230  PYTM  219
            PYT+
Sbjct  530  PYTI  533



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW + YLG+Q YFSVLSP RSLRDEY++P+   LCGIVKG   P 
Sbjct  492  MLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPA  551

Query  230  PY  225
            PY
Sbjct  552  PY  553



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSEMW R YLGQQFY S LSP RSLRDEY LPE   LCGIVK   KP 
Sbjct  489  LLTFDNAGMWNVRSEMWERTYLGQQFYVSTLSPGRSLRDEYSLPEGTLLCGIVKDMPKPA  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTL  552



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+W+LRSEMW R YLGQQ YFSVLSP RSLRDEY+LP+   LCGIVK    P 
Sbjct  494  MTTLDNAGLWSLRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKTMPMPS  553

Query  230  PY  225
            PY
Sbjct  554  PY  555



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW + YLG+Q YFSVLSP RSLRDEY+LP+   LCG+VKG   P 
Sbjct  491  MLTFDNAGMWNLRSEMWEKTYLGEQMYFSVLSPSRSLRDEYNLPDNHPLCGVVKGMPLPA  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEM    YLGQQ Y SVLSP RSLRDEY+LPE Q LCGIVK   KPP
Sbjct  453  MLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLLCGIVKDMPKPP  512

Query  230  PYT  222
            PY+
Sbjct  513  PYS  515



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW + YLG+Q YFSVLSP RSLRDEY+LP+   LCG+VKG   P 
Sbjct  491  MLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPGRSLRDEYNLPDNHPLCGVVKGMPLPT  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSEMW +AYLGQQ Y SVLSPE SLRDEY++P+   LCG VKG  KP 
Sbjct  488  LLTFDNAGMWNIRSEMWEKAYLGQQLYVSVLSPELSLRDEYNIPDNALLCGKVKGLPKPK  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEM    YLGQQ Y SVLSP RSLRDEY+LPE Q LCGIVK   KPP
Sbjct  494  MLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLLCGIVKDMPKPP  553

Query  230  PYT  222
            PY+
Sbjct  554  PYS  556



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+  R YLGQ+ Y SVLSPERSLRDEY++P+   LCGIVK   KPP
Sbjct  488  MLTFDNAGMWNLRSELAERRYLGQELYISVLSPERSLRDEYNIPDDALLCGIVKDLAKPP  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAG+WN+RSEMW RAYLGQQ Y SVLSP RSLRDEY+LP+   LCGIVK   KP 
Sbjct  490  LLTFDNAGLWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPA  549

Query  230  PYTM  219
            PY++
Sbjct  550  PYSI  553



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEM    YLGQQ Y SVLSP RSLRDEY+LPE Q +CGIVK   KPP
Sbjct  487  MLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLVCGIVKDMPKPP  546

Query  230  PYT  222
            PY+
Sbjct  547  PYS  549



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RSE   R YLGQQFY SVLSP RSLRDEY+LPE   LCGIVK + KPP
Sbjct  489  MLTFDNAGMWNVRSEQPERRYLGQQFYVSVLSPARSLRDEYNLPETAQLCGIVKDSPKPP  548

Query  230  PYT  222
            PY+
Sbjct  549  PYS  551



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALC-GIVKGAKKP  234
            MTTLDNAGMWNLRSEM  RAYLGQQ YFSVLSP RSLRDEY+LP+ Q LC GIV+    P
Sbjct  493  MTTLDNAGMWNLRSEMQHRAYLGQQLYFSVLSPARSLRDEYNLPDNQPLCGGIVEKLPLP  552

Query  233  PPYT  222
             PYT
Sbjct  553  APYT  556



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRS+M  R YLGQQFYFSVLSPE SLRDEY++   Q LCGIV G   P 
Sbjct  493  MTTLDNAGMWNLRSDMLERTYLGQQFYFSVLSPENSLRDEYNIFPTQQLCGIVSGLPMPA  552

Query  230  PY  225
            PY
Sbjct  553  PY  554



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAG+WNLRSE W R YLGQQ Y SVLSP RSLRDEY++P+   LCGIVKG  KP 
Sbjct  499  LLTFDNAGLWNLRSETWERNYLGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQ  558

Query  230  PYTM  219
            PYT+
Sbjct  559  PYTI  562



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSEMW RAYLGQQ Y SVLSP RSLRDEY++P+   LCG+VK   KP 
Sbjct  490  LLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPE  549

Query  230  PYTM  219
            PY++
Sbjct  550  PYSI  553



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAG+WNLRSE W R YLGQQ Y SVLSP RSLRDEY++P+   LCGIVKG  KP 
Sbjct  487  LLTFDNAGLWNLRSETWERNYLGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQ  546

Query  230  PYTM  219
            PYT+
Sbjct  547  PYTI  550



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAG+WNLRSE+  R YLGQQ Y SVLSPERSLRDEY++P+   LCGIVK   KPP
Sbjct  488  MLTFDNAGIWNLRSELLERRYLGQQMYLSVLSPERSLRDEYNIPDNALLCGIVKDMPKPP  547

Query  230  PYTM  219
            PY++
Sbjct  548  PYSI  551



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWNLRS+M  R YLGQQFYFSVLSPE SLRDEY++   Q LCGIV G   P 
Sbjct  493  MTTLDNAGMWNLRSDMLERTYLGQQFYFSVLSPENSLRDEYNIFPTQQLCGIVSGLPMPA  552

Query  230  PY  225
            PY
Sbjct  553  PY  554



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSEMW RAYLGQQ Y SVLSP RSLRDEY++P+   LCG+VK   KP 
Sbjct  490  LLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPE  549

Query  230  PYTM  219
            PY++
Sbjct  550  PYSV  553



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSEMW RAYLGQQ Y SVLSP RSLRDEY++P+   LCG+VK   KP 
Sbjct  474  LLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPE  533

Query  230  PYTM  219
            PY++
Sbjct  534  PYSV  537



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAG+WN+RSEMW R YLGQQ Y SVLSP RSLRDEY+LP+   LCGIVK   KP 
Sbjct  490  LLTFDNAGLWNIRSEMWERVYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPA  549

Query  230  PYTM  219
            PY++
Sbjct  550  PYSI  553



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWN+RS    R YLG+Q Y SVLSP RSLRDEY+LP+ Q LCGIVK   KPP
Sbjct  503  MTTLDNAGMWNMRSMSLERQYLGEQIYVSVLSPNRSLRDEYNLPDTQLLCGIVKDMPKPP  562

Query  230  PYT  222
            PY+
Sbjct  563  PYS  565



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -2

Query  404  TLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPPPY  225
            T DNAGMWN+RSEMW + YLGQQ Y SVLSPE SLRDEY++P+   LCG VKG  KP PY
Sbjct  490  TFDNAGMWNIRSEMWEKTYLGQQLYVSVLSPELSLRDEYNIPDNALLCGKVKGLPKPKPY  549

Query  224  TM  219
            T+
Sbjct  550  TI  551



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RSE   R YLGQQFY SVLSP RSLRDEY+LPE   LCGIVK   KPP
Sbjct  489  MLTFDNAGMWNVRSEQPERRYLGQQFYVSVLSPARSLRDEYNLPETTQLCGIVKDLPKPP  548

Query  230  PY  225
            PY
Sbjct  549  PY  550



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  404  TLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPPPY  225
            T DNAGMWN+RSE+W R YLGQQ Y SV+SP RSLRDEY++P+   LCG+VK   KPPPY
Sbjct  490  TFDNAGMWNIRSEVWERTYLGQQLYASVISPARSLRDEYNIPDNALLCGLVKDLPKPPPY  549

Query  224  TM  219
            ++
Sbjct  550  SV  551



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE     YLGQQ Y SVLSP+RSLRDEY+LP+ Q LCGIVK   KPP
Sbjct  486  MLTFDNAGMWNLRSEHAENRYLGQQLYISVLSPQRSLRDEYNLPDTQLLCGIVKDLPKPP  545

Query  230  PYT  222
            PY+
Sbjct  546  PYS  548



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+W R YLGQQ Y SV SP RSLRDEY+LP+   LCG V+G  KP 
Sbjct  486  MLTFDNAGMWNLRSELWERRYLGQQLYISVQSPARSLRDEYNLPDTALLCGAVEGLPKPA  545

Query  230  PYT  222
            PYT
Sbjct  546  PYT  548



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE+W + YLGQQ Y SVLSP RSLRDEY++P+   LCG+VK   KPP
Sbjct  488  LLTFDNAGMWNIRSEIWEKTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKDLPKPP  547

Query  230  PYTM  219
            PY +
Sbjct  548  PYVI  551



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  546

Query  230  PYTM  219
            PYT+
Sbjct  547  PYTI  550



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE+W R YLGQQ Y SV SP RSLRDEY++P+   LCG+V    KPP
Sbjct  490  LLTFDNAGMWNIRSEIWERTYLGQQLYASVASPVRSLRDEYNIPDNAPLCGVVTNLPKPP  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T+DNAGMW+LRSE+W R YLGQQ Y SV+SP RSLRDEY++P+   LCGIVK   KP 
Sbjct  484  LLTIDNAGMWSLRSELWERQYLGQQLYLSVVSPARSLRDEYNMPDNARLCGIVKRMPKPA  543

Query  230  PYT  222
            PYT
Sbjct  544  PYT  546



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  489  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTI  552



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  489  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTI  552



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  489  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTI  552



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  446  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  505

Query  230  PYTM  219
            PYT+
Sbjct  506  PYTI  509



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RSE   R YLGQQFY SVLSP RSLRDEY+LP+   +CGIVK   KPP
Sbjct  489  MLTFDNAGMWNVRSEQSERRYLGQQFYVSVLSPARSLRDEYNLPDNTLVCGIVKDLPKPP  548

Query  230  PYT  222
            PY+
Sbjct  549  PYS  551



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNVRSENWERRYLGEQLYISVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RSE   R YLGQQFY SVLSP  SLRDEY+LPE   LCGIVK   KPP
Sbjct  489  MLTFDNAGMWNVRSEQPERRYLGQQFYVSVLSPAHSLRDEYNLPETTQLCGIVKDLPKPP  548

Query  230  PYT  222
            PY+
Sbjct  549  PYS  551



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW+LRSE+W R YLGQQ Y SV+SP RSLRDEY++P+   LCG+V    KPP
Sbjct  488  MLTFDNAGMWSLRSELWERHYLGQQLYISVVSPARSLRDEYNIPDNTLLCGVVASLPKPP  547

Query  230  PYT  222
            PY 
Sbjct  548  PYV  550



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  488  LLTFDNAGMWNIRSENWERRYLGEQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  547

Query  230  PYTM  219
            PYT+
Sbjct  548  PYTI  551



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE+W R YLGQQ Y SVLSPE SLRDEY++P+   LCG+V+   KPP
Sbjct  489  LLTFDNCGMWNIRSEIWDRHYLGQQLYASVLSPEHSLRDEYNIPDNALLCGVVESMPKPP  548

Query  230  PYTM  219
            PY++
Sbjct  549  PYSI  552



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW+LRSE+W R YLGQQ Y SV+SP RSLRDEY++P+   LCG+V    KPP
Sbjct  494  MLTFDNAGMWSLRSELWERHYLGQQLYISVVSPARSLRDEYNIPDNTLLCGVVASLPKPP  553

Query  230  PYT  222
            PY 
Sbjct  554  PYV  556



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RSE   R YLGQQFY SVLSP RSLRDEY+LP+   +CG+VK   KPP
Sbjct  489  MLTFDNAGMWNVRSEQSERRYLGQQFYVSVLSPARSLRDEYNLPDNTLVCGVVKDLPKPP  548

Query  230  PYT  222
            PY+
Sbjct  549  PYS  551



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+W R YLGQQ Y SV SP RSLRDEY LP+   LCG V    KPP
Sbjct  488  MLTFDNAGMWNLRSELWERRYLGQQLYISVQSPARSLRDEYSLPDTVLLCGAVASLPKPP  547

Query  230  PYT  222
            PYT
Sbjct  548  PYT  550



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWNLRSE+W R YLGQQ Y SV+SP RSL+DEY+LPE    CGIV+G  +PP
Sbjct  412  LLTFDNCGMWNLRSEIWDRHYLGQQLYASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPP  471

Query  230  PYT  222
            P++
Sbjct  472  PFS  474



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSEMW R YLGQQ Y SV SPERSLRDEY++P+   LCG V    KPP
Sbjct  490  MLTFDNAGMWNLRSEMWERHYLGQQIYISVTSPERSLRDEYNIPDNTLLCGDVADLPKPP  549

Query  230  PYT  222
             Y 
Sbjct  550  SYV  552



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWNLRSE+W R YLGQQ Y SV+SP RSL+DEY+LPE    CGIV+G  +PP
Sbjct  488  LLTFDNCGMWNLRSEIWDRHYLGQQLYASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPP  547

Query  230  PYT  222
            P++
Sbjct  548  PFS  550



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + TLDNAGMWNLRSE+    YLGQQ YFSV SP RSLRDEY++P+   LCG+VK    PP
Sbjct  490  LLTLDNAGMWNLRSELTENRYLGQQMYFSVQSPARSLRDEYNIPDNTLLCGLVKDMPLPP  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + TLDNAGMWNLRSE+    YLGQQ YFSV SP RSLRDEY++P+   LCG+VK    PP
Sbjct  490  LLTLDNAGMWNLRSELTENRYLGQQMYFSVQSPARSLRDEYNIPDNTLLCGLVKDMPLPP  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG  KP 
Sbjct  487  LLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNAGLCGIVKGLSKPI  546

Query  230  PYT  222
             Y+
Sbjct  547  IYS  549



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+W R YLGQQ Y SVLSP RSLRDEY++PEK  +CG V    +PP
Sbjct  498  MLTFDNAGMWNLRSELWERRYLGQQLYISVLSPARSLRDEYNMPEKALICGDVVNLPRPP  557

Query  230  PYT  222
             Y 
Sbjct  558  SYV  560



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+    YLGQQ Y SVLSP RSLRDEY++P+ Q LCGIV    +PP
Sbjct  484  MLTFDNAGMWNLRSELGENRYLGQQLYVSVLSPNRSLRDEYNMPDTQVLCGIVTDLPEPP  543

Query  230  PYT  222
            PY+
Sbjct  544  PYS  546



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW+LRSE+W R YLGQQ Y SVLSP RSLRDEY +P+   LCG V    KPP
Sbjct  488  MLTFDNAGMWSLRSELWERHYLGQQLYISVLSPARSLRDEYSIPDNTLLCGDVTTLPKPP  547

Query  230  PYT  222
            PY 
Sbjct  548  PYV  550



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLR+ +W + YLGQQ Y SV+SPERSLRDEY++PE   LCG V    KPP
Sbjct  488  MLTFDNAGMWNLRTMIWDKQYLGQQLYISVISPERSLRDEYNIPENSLLCGNVVNLPKPP  547

Query  230  PY  225
            PY
Sbjct  548  PY  549



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+W R Y GQQ Y SV SP RSLRDEY LP+   LCG V    KPP
Sbjct  490  MLTFDNAGMWNLRSELWERRYQGQQLYISVQSPARSLRDEYSLPDTVLLCGAVASLPKPP  549

Query  230  PYT  222
            PYT
Sbjct  550  PYT  552



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW+LR+E   R++LGQQ Y SVLSPERSLRDEY+LP+   +CG+VK   KPP
Sbjct  495  MLTTDNAGMWHLRNEAPERSFLGQQMYISVLSPERSLRDEYNLPDNSLICGLVKDMPKPP  554

Query  230  PYTM  219
            PY++
Sbjct  555  PYSI  558



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T+DNAGMWNLRS +  R YLGQQ YFSVLSP  SLRDEY++P+   LCGIVK   KP 
Sbjct  494  MLTMDNAGMWNLRSTLLERQYLGQQLYFSVLSPNYSLRDEYNVPDDALLCGIVKDMPKPK  553

Query  230  PYTM  219
            PY++
Sbjct  554  PYSI  557



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLR+ +W + YLGQQ Y SV+SP RSLRDEY++PE   LCG V    KPP
Sbjct  488  MLTFDNAGMWNLRTLIWDKQYLGQQLYISVVSPARSLRDEYNIPENTLLCGNVVNLPKPP  547

Query  230  PYT  222
            PYT
Sbjct  548  PYT  550



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+  R YLGQ+ Y SVLSPERSLRDEY+LP+   LCG V G   P 
Sbjct  489  MLTFDNAGMWNLRSELLERRYLGQEMYISVLSPERSLRDEYNLPDNAPLCGSVVGLPLPA  548

Query  230  PYTM  219
            PYT+
Sbjct  549  PYTI  552



>emb|CAE53901.1| putative L-ascorbate oxidase homolog [Triticum aestivum]
Length=156

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS +W R YLG+Q Y S  SP RSLRDEY++P+    CG V G   PP
Sbjct  92   MLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMPLPP  151

Query  230  PYTM  219
            PYT+
Sbjct  152  PYTI  155



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW+LRSE+W R YLGQQ Y SV+SP RSLRDEY++P+   LCG V G  KPP
Sbjct  489  MLTFDNAGMWSLRSELWERHYLGQQLYISVVSPARSLRDEYNMPDNTLLCGDVVGLPKPP  548

Query  230  PYT  222
             Y 
Sbjct  549  SYV  551



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+  R YLGQQ Y SV SP RSLRDEY++P+   LCG+VK    PP
Sbjct  472  MLTFDNAGMWNLRSELTERRYLGQQLYISVQSPARSLRDEYNMPDNALLCGVVKDLPWPP  531

Query  230  PYTM  219
            PY++
Sbjct  532  PYSI  535



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENWERRYLGQQLYASVLSPEKSLRDEYNIPLNTNLCGIVKGLPMPA  546

Query  230  PYT  222
             YT
Sbjct  547  IYT  549



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SVLSP RSLRDEY++P+   LCGIVK   KP 
Sbjct  487  LLTFDNAGMWNLRSELTENRYLGQQLYISVLSPARSLRDEYNMPDNALLCGIVKDLPKPH  546

Query  230  PYTM  219
            PYT+
Sbjct  547  PYTI  550



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+W R YLGQQ YF+V SP RSLRDEY++P+   LCG V    KPP
Sbjct  488  MLTFDNAGMWNLRSELWERRYLGQQLYFTVQSPARSLRDEYNMPDNALLCGDVANLPKPP  547

Query  230  PYT  222
             Y 
Sbjct  548  SYV  550



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SVLSP RSLRDEY++P+   LCG+VKG   P 
Sbjct  483  LLTFDNAGMWNLRSELIENRYLGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPK  542

Query  230  PYTM  219
            PYT+
Sbjct  543  PYTI  546



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SVLSP RSLRDEY++P+   LCG+VKG   P 
Sbjct  491  LLTFDNAGMWNLRSELTENRYLGQQLYMSVLSPARSLRDEYNIPDHTLLCGLVKGMPLPK  550

Query  230  PYTM  219
            PYT+
Sbjct  551  PYTI  554



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAGMWN+RS +  R YLGQQ Y SVLSP RSLRDEY++PE Q LCG VK    P 
Sbjct  488  MTTLDNAGMWNMRSLLLERNYLGQQLYVSVLSPARSLRDEYNMPETQLLCGKVKNLPFPA  547

Query  230  PYT  222
            PY+
Sbjct  548  PYS  550



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SVLSP RSLRDEY++P+   LCG+VKG   P 
Sbjct  490  LLTFDNAGMWNLRSELIENRYLGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPK  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + TLDNAGMWNLRSE+    YLGQQ YFSV SP RSLRDEY++P+   LCG+VK    P 
Sbjct  490  LLTLDNAGMWNLRSELTENRYLGQQLYFSVQSPARSLRDEYNIPDNALLCGLVKDMSLPQ  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DN G+WNLRSE+    YLGQQ Y SV++PERSLRDEY++PE   LCG+VKG  KPP
Sbjct  488  MLTFDNVGVWNLRSELAENRYLGQQLYISVITPERSLRDEYNIPENSLLCGLVKGLPKPP  547

Query  230  PY  225
             Y
Sbjct  548  SY  549



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW+LRSEMW R YLGQQ Y SV+SP RSLRDEY++P+   LCG V    KPP
Sbjct  483  MLTFDNAGMWSLRSEMWERHYLGQQLYVSVVSPARSLRDEYNMPDNALLCGDVASLPKPP  542

Query  230  PYT  222
             Y 
Sbjct  543  SYV  545



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLG Q YFSVLSP +S++DEY++P+   LCGIVK   KP 
Sbjct  491  MTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNKSIKDEYNMPDNDLLCGIVKDMPKPT  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLG Q YFSVLSP +S++DEY++P+   LCGIVK   KP 
Sbjct  494  MTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNKSIKDEYNMPDNDLLCGIVKDMPKPT  553

Query  230  PY  225
            PY
Sbjct  554  PY  555



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTT+DNAG+WNLRS    R YLGQQ YFSVLSP+R L+DEY++P+   LCGI+K    P 
Sbjct  494  MTTIDNAGLWNLRSNSLERQYLGQQLYFSVLSPKRDLKDEYNMPDNDILCGIIKDMPLPK  553

Query  230  PYTM  219
            PY++
Sbjct  554  PYSV  557



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE+  R YLGQ+ Y SVLSPERSLRDEY++P+   LCG V    KP 
Sbjct  489  MLTFDNAGMWNLRSELAERRYLGQELYISVLSPERSLRDEYNMPDDAELCGAVTSLPKPT  548

Query  230  PYTM  219
            PY++
Sbjct  549  PYSI  552



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE W R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVK   KP 
Sbjct  487  LLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNAGLCGIVKDLPKPS  546

Query  230  PYT  222
             Y+
Sbjct  547  IYS  549



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRSE     YLGQQ Y SVLSPE SLRDEY+LPE Q +CGIVK   KP 
Sbjct  482  MLTFDNAGMWNLRSEQAENRYLGQQLYISVLSPELSLRDEYNLPETQIVCGIVKSLPKPA  541

Query  230  P  228
            P
Sbjct  542  P  542



>ref|NP_001055876.2| Os05g0485800 [Oryza sativa Japonica Group]
 dbj|BAF17790.2| Os05g0485800 [Oryza sativa Japonica Group]
Length=100

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  36   MLTFDNAGMWNVRSNIWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLPLPP  95

Query  230  PY  225
             Y
Sbjct  96   SY  97



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTT+DNAG+WNLRS    R YLGQQ YFSVLSP+R L+DEY++P+   LCGI+K    P 
Sbjct  494  MTTIDNAGLWNLRSNSLERQYLGQQLYFSVLSPKRDLKDEYNMPDNDILCGIIKDMPLPK  553

Query  230  PYTM  219
            PY++
Sbjct  554  PYSV  557



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLG Q YFSVLSP RS++DEY++P+ + LCG+VK   +P 
Sbjct  493  MTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNRSIKDEYNMPDNELLCGLVKDMPRPT  552

Query  230  PY  225
            PY
Sbjct  553  PY  554



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + + DN GMWN+RSE+W R YLGQQ Y SVLSP +SLRDEY++PE   +CG+V+   +PP
Sbjct  488  LLSFDNCGMWNIRSEIWDRRYLGQQLYVSVLSPNKSLRDEYNMPEGALVCGVVENMPRPP  547

Query  230  P  228
            P
Sbjct  548  P  548



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+R+E W R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRAENWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             YT
Sbjct  547  VYT  549



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS++    YLGQQ Y SVLSPE SLRDEY++P+   LCG+VK   KP 
Sbjct  489  MLTFDNAGMWNLRSDIAESRYLGQQLYISVLSPEHSLRDEYNMPDSNLLCGLVKNLPKPA  548

Query  230  PYT  222
            PY+
Sbjct  549  PYS  551



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS++    YLGQQ Y SVLSPE SLRDEY++P+   LCG+VK   KP 
Sbjct  490  MLTFDNAGMWNLRSDIAESRYLGQQLYISVLSPEHSLRDEYNMPDSNLLCGLVKNLPKPA  549

Query  230  PYT  222
            PY+
Sbjct  550  PYS  552



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLGQQ YFS LSP+R L+DEY++P+   LCGI+K    P 
Sbjct  493  MTTLDNAGLWNLRSNSVERQYLGQQLYFSALSPKRDLKDEYNMPDNDVLCGIIKDMPLPK  552

Query  230  PYTM  219
            PY++
Sbjct  553  PYSV  556



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLGQQ YFS LSP+R L+DEY++P+   LCGI+K    P 
Sbjct  493  MTTLDNAGLWNLRSNSLERQYLGQQLYFSALSPKRDLKDEYNMPDNDVLCGIIKDMPLPK  552

Query  230  PYTM  219
            PY++
Sbjct  553  PYSV  556



>gb|KHN42951.1| L-ascorbate oxidase like [Glycine soja]
Length=421

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + + DN G+WNLRSE+    YLGQQ Y SVL+PERSLRDEY++PE   LCG+VKG  KP 
Sbjct  359  LLSFDNVGVWNLRSELAENRYLGQQLYISVLTPERSLRDEYNIPEYALLCGVVKGLPKPE  418

Query  230  PY  225
            PY
Sbjct  419  PY  420



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLR+ +W + YLGQQ YFSV+SP RSLRDEY++PE   LCG V    +P 
Sbjct  488  MLTFDNAGMWNLRTLVWDKQYLGQQLYFSVVSPARSLRDEYNIPENALLCGNVVKLPQPA  547

Query  230  PYT  222
            PYT
Sbjct  548  PYT  550



>ref|NP_001132891.1| uncharacterized protein LOC100194388 [Zea mays]
 gb|ACF81925.1| unknown [Zea mays]
Length=421

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+Q Y SV+SPERSLRDEY++PE    CG V G   PP
Sbjct  357  MMTFDNAGMWSIRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPP  416

Query  230  PY  225
             Y
Sbjct  417  SY  418



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLG Q YFSVLSP  SL+DEY++P+   LCGI+K    P 
Sbjct  457  MTTLDNAGLWNLRSNSLERQYLGHQLYFSVLSPSCSLKDEYNMPDNDILCGIIKDLPLPK  516

Query  230  PYTM  219
            PY++
Sbjct  517  PYSI  520



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SV SP RSLRDEY++P+K  LCG+VK    P 
Sbjct  490  LLTFDNAGMWNLRSELTENRYLGQQLYMSVQSPARSLRDEYNIPDKTLLCGLVKDLPLPK  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SV SP RSLRDEY++P+K  LCG+VK    P 
Sbjct  490  LLTFDNAGMWNLRSELTENRYLGQQLYMSVQSPARSLRDEYNIPDKTLLCGLVKDLPLPK  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + + DN G+WNLRSE+    YLGQQ Y SVL+PERSLRDEY++PE   LCG+VKG  KP 
Sbjct  490  LLSFDNVGVWNLRSELAENRYLGQQLYISVLTPERSLRDEYNIPEYALLCGVVKGLPKPE  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             YT
Sbjct  547  SYT  549



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             YT
Sbjct  547  SYT  549



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+W R YLGQQ Y SV+SPERSLRDE ++P+   LCG V    +PP
Sbjct  577  LLTFDNAGMWNLRSELWERRYLGQQLYISVVSPERSLRDESNMPDNALLCGAVAKLPRPP  636

Query  230  PY  225
             Y
Sbjct  637  SY  638



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNVRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + ++DNAGMWNLRS +W R YLGQQ Y SV   +RSLRDEY++P+   LCGIV    KP 
Sbjct  497  LVSMDNAGMWNLRSNIWERNYLGQQLYLSVRLHKRSLRDEYNMPDNALLCGIVANMSKPT  556

Query  230  PYTM  219
            PY++
Sbjct  557  PYSL  560



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + + DN GMWNLRS      YLGQQ Y S++SPE SLRDEY++P+   LCG+VKG  KPP
Sbjct  487  LLSTDNVGMWNLRSLTAENMYLGQQLYISIMSPEGSLRDEYNMPDDNLLCGVVKGLPKPP  546

Query  230  PYT  222
            PYT
Sbjct  547  PYT  549



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS +W R YLG+Q Y S  SP RSLRDEY++P+    CG V G   PP
Sbjct  492  MLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNSLRCGKVVGMPLPP  551

Query  230  PYTM  219
            PYT+
Sbjct  552  PYTI  555



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+R+E   RAYLGQQ Y SV +PER LRDEY+LP+   LCG+VK   KP 
Sbjct  494  LLTFDNVGMWNVRNECMERAYLGQQLYISVPTPERVLRDEYNLPDNALLCGMVKNMPKPK  553

Query  230  PYTM  219
            PYT+
Sbjct  554  PYTL  557



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS +W R YLG+Q Y S  SP RSLRDEY++P+    CG V G   PP
Sbjct  492  MLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNSLRCGKVVGMPLPP  551

Query  230  PYTM  219
            PYT+
Sbjct  552  PYTI  555



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             YT
Sbjct  547  RYT  549



>gb|EMT12555.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=440

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  376  MLTFDNAGMWNVRSNLWERHYLGEQLYMSVVSPARSLRDEYNMPENALRCGKVVGLSMPP  435

Query  230  PY  225
             Y
Sbjct  436  SY  437



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS +W R YLG+Q Y S  SP RSLRDEY++P+    CG V G   PP
Sbjct  493  MLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMPLPP  552

Query  230  PYTM  219
            PYT+
Sbjct  553  PYTI  556



>gb|EMS63309.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=329

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+R+ +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  265  MLTFDNAGMWNVRTNLWERHYLGEQLYMSVVSPARSLRDEYNMPENALRCGKVVGLPLPP  324

Query  230  PY  225
             Y
Sbjct  325  SY  326



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLG Q YFSVLSP  SL+DEY++P+   LCGI+K    P 
Sbjct  486  MTTLDNAGLWNLRSNSLERQYLGHQLYFSVLSPSCSLKDEYNMPDNDILCGIIKDLPLPK  545

Query  230  PYTM  219
            PY++
Sbjct  546  PYSI  549



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLGQQ Y SV SP RSLRDEY++P+   LCG+VK    P 
Sbjct  383  LLTFDNAGMWNLRSELAENRYLGQQLYMSVQSPARSLRDEYNIPDNTLLCGLVKDLPLPK  442

Query  230  PYTM  219
            PYT+
Sbjct  443  PYTI  446



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS +W R YLG+Q Y S  SP RSLRDEY++P+    CG V G   PP
Sbjct  506  MLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMPLPP  565

Query  230  PYTM  219
            PYT+
Sbjct  566  PYTI  569



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+R+E W R YLG+Q Y SV SPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRAENWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  546

Query  230  PYT  222
             YT
Sbjct  547  VYT  549



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+R+E W R YLG+Q Y SV SPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRAENWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  546

Query  230  PYT  222
             YT
Sbjct  547  VYT  549



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVK  249
            MTTLDN GMWNLRS    R YLGQQ YFSV+SPE SLRDEY LPE Q LCGIVK
Sbjct  490  MTTLDNCGMWNLRSVSLERNYLGQQLYFSVVSPEHSLRDEYLLPEGQLLCGIVK  543



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS MW R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  491  MLTFDNAGMWNIRSNMWERFYLGEQLYVSVISPARSLRDEYNMPENGLRCGKVVGMPMPP  550

Query  230  PY  225
             Y
Sbjct  551  SY  552



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+R+E W R YLG+Q Y SV SPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRAENWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPT  546

Query  230  PYT  222
             YT
Sbjct  547  VYT  549



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLG Q Y SVLSP RSLRDEY++P+   LCG+VK    P 
Sbjct  490  LLTFDNAGMWNLRSELLENRYLGSQLYVSVLSPARSLRDEYNIPDNTLLCGLVKDMPLPK  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLG Q Y SVLSP RSLRDEY++P+   LCG+VK    P 
Sbjct  490  LLTFDNAGMWNLRSELLENRYLGSQLYVSVLSPARSLRDEYNIPDNTLLCGLVKDMPLPK  549

Query  230  PYTM  219
            PYT+
Sbjct  550  PYTI  553



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE+    YLG Q Y SVLSP RSLRDEY++P+   LCG+VK    P 
Sbjct  491  LLTFDNAGMWNLRSELTENRYLGSQLYISVLSPARSLRDEYNIPDNTLLCGLVKDMPMPK  550

Query  230  PYTM  219
            PYT+
Sbjct  551  PYTI  554



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+Q Y SV+SPERSLRDEY++PE    CG V G   PP
Sbjct  493  MMTFDNAGMWSIRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPP  552

Query  230  PY  225
             Y
Sbjct  553  SY  554



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQMYASVLSPEKSLRDEYNMPETSLQCGLVKGMPKPN  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE+W R YLGQQ Y SV+SP +SL+DEY++P+   +CG+V+   +PP
Sbjct  472  LLTFDNCGMWNIRSEVWDRHYLGQQLYASVVSPNKSLKDEYNMPDGALVCGVVESMPRPP  531

Query  230  P  228
            P
Sbjct  532  P  532



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENSERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             YT
Sbjct  547  SYT  549



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  402  MLTFDNAGMWNVRSNIWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLPLPP  461

Query  230  PY  225
             Y
Sbjct  462  SY  463



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M + DN G+WNLRSE+    YLGQQ Y SV +PERSLRDEY+LPE   LCGIVK   KPP
Sbjct  488  MLSFDNVGVWNLRSEIAENRYLGQQLYISVPTPERSLRDEYNLPENSLLCGIVKDLPKPP  547

Query  230  PYT  222
             Y 
Sbjct  548  SYV  550



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  496  MLTFDNAGMWNVRSNLWERHYLGEQLYMSVVSPARSLRDEYNMPENALRCGKVVGLPLPP  555

Query  230  PY  225
             Y
Sbjct  556  SY  557



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  496  LLTFDNAGMWNIRSENLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  555

Query  230  PYT  222
             Y+
Sbjct  556  HYS  558



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+Q Y SV+SPERSLRDEY++PE    CG V G   PP
Sbjct  495  MMTFDNAGMWSVRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPP  554

Query  230  PY  225
             Y
Sbjct  555  SY  556



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+Q Y SV+SPERSLRDEY++PE    CG V G   PP
Sbjct  495  MMTFDNAGMWSVRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPP  554

Query  230  PY  225
             Y
Sbjct  555  SY  556



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY+LPE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYVSVLSPEKSLRDEYNLPESSLQCGLVKGKPKIN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  486  MLTFDNAGMWNVRSNLWERQYLGEQMYISVISPARSLRDEYNMPETSLRCGKVVGLPMPP  545

Query  230  PY  225
             Y
Sbjct  546  SY  547



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++P+    CG V G   PP
Sbjct  491  MLTFDNAGMWNIRSNIWERHYLGEQLYMSVVSPARSLRDEYNMPDNALRCGKVVGLPMPP  550

Query  230  PY  225
             Y
Sbjct  551  SY  552



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+QFY SV+SPE SLRDEY++P+    CG V G   PP
Sbjct  494  MLTFDNAGMWSVRSNIWERYYLGEQFYISVISPEHSLRDEYNMPDNDLRCGKVVGLPLPP  553

Query  230  PYT  222
             Y+
Sbjct  554  SYS  556



>ref|XP_004305573.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=269

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS    RAYLGQQ Y SV +  RSLRDEY L +   LCG+VKG  KPP
Sbjct  206  MLTFDNAGMWNLRSAQAERAYLGQQLYLSVENVARSLRDEYMLLDTTPLCGVVKGLPKPP  265

Query  230  PY  225
            PY
Sbjct  266  PY  267



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             Y+
Sbjct  547  HYS  549



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  492  MLTFDNAGMWNVRSNIWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLPLPP  551

Query  230  PY  225
             Y
Sbjct  552  SY  553



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLR+ +W R Y+G+Q Y SV SP RSLRDEY++P+    CG V G   PP
Sbjct  493  MLTFDNAGMWNLRTNIWERYYMGEQLYMSVTSPARSLRDEYNMPDNGLRCGKVVGMPLPP  552

Query  230  PYTM  219
            PY +
Sbjct  553  PYII  556



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            MTTLDNAG+WNLRS    R YLG Q YFSVLSP  S++DEY++P+   +CG VK   +P 
Sbjct  493  MTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNHSVKDEYNMPDNDLVCGFVKDMPRPT  552

Query  230  PY  225
            PY
Sbjct  553  PY  554



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP  234
            M T DNAGMWNLRSEM    YLGQQ Y SVLSPE+S RDEY+LP+   +CGIVK   +P
Sbjct  482  MLTFDNAGMWNLRSEMAENRYLGQQMYMSVLSPEKSNRDEYNLPDTHQVCGIVKDMPRP  540



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R YLG+Q Y SV SP RSLRDEY++PE    CG V G   PP
Sbjct  493  MLTFDNAGMWNIRSNLWERHYLGEQLYVSVTSPARSLRDEYNMPETSLRCGKVVGLPMPP  552

Query  230  PY  225
             Y
Sbjct  553  SY  554



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWN+RSE   R YLG+Q Y SVLSPE+SLRDEY++P    LCGIVKG   P 
Sbjct  487  LLTFDNAGMWNIRSENLERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPA  546

Query  230  PYT  222
             Y+
Sbjct  547  HYS  549



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLR+ +W + YLGQQ Y SV SP RSLRDEY++PE    CG V    KP 
Sbjct  488  MLTFDNAGMWNLRTLVWDKQYLGQQLYISVASPARSLRDEYNMPENALHCGNVVNLPKPA  547

Query  230  PYT  222
            PYT
Sbjct  548  PYT  550



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+Q Y SV SPERSLRDEY++PE    CG V G   PP
Sbjct  494  MMTFDNAGMWSIRSNIWERNYLGEQLYISVTSPERSLRDEYNMPETSLRCGKVVGLPLPP  553

Query  230  PY  225
             Y
Sbjct  554  SY  555



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS MW R YLG Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  489  MLTFDNAGMWNIRSNMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPP  548

Query  230  PY  225
             Y
Sbjct  549  SY  550



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + + DN GMWN+RSE   R YLGQQ Y SVLSPE SLRDEY++P+    CG+VKG  KP 
Sbjct  491  LLSFDNCGMWNVRSENMERRYLGQQLYLSVLSPESSLRDEYNMPQNSLQCGLVKGLPKPQ  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DNAGMWN+RSEMW R YLGQQ Y SVL P  SL+DEY++P+   LCG VK   KP 
Sbjct  454  LLTFDNAGMWNIRSEMWERTYLGQQLYVSVLCPGCSLKDEYNVPDNALLCGQVKDLPKPN  513

Query  233  -PPY  225
              PY
Sbjct  514  HTPY  517



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENAERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS MW R YLG Q Y SV+SP RSLRDEY++PE    CG V G   PP
Sbjct  486  MLTFDNAGMWNIRSNMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPP  545

Query  230  PY  225
             Y
Sbjct  546  SY  547



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DN GMWNLRSE+    YLGQQ Y SV +PE SLRDEY++PE   LCG V G  KP 
Sbjct  491  MLTFDNVGMWNLRSEIAENRYLGQQLYISVPTPEGSLRDEYNIPENAVLCGAVVGLPKPA  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>dbj|BAD94289.1| L-ascorbate oxidase precursor [Arabidopsis thaliana]
Length=57

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  386  MWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPPPY  225
            MWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  KP PY
Sbjct  1    MWNVRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPY  54



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKGKPKIN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+QFY SV+SP RSLRDEY++P+    CG V G   PP
Sbjct  494  MLTFDNAGMWSVRSNVWERYYLGEQFYISVISPARSLRDEYNMPDNALRCGKVVGLPLPP  553

Query  230  PY  225
             Y
Sbjct  554  SY  555



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++RS +W R YLG+QFY SV+SP RSLRDEY++P+    CG V G   PP
Sbjct  494  MLTFDNAGMWSVRSNVWERYYLGEQFYISVISPARSLRDEYNMPDNALRCGKVVGLPLPP  553

Query  230  PY  225
             Y
Sbjct  554  SY  555



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VKG  K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKGKPKIN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS    RAYLGQQ Y SV +  RSLRDEY L +   LCG+VKG  KPP
Sbjct  490  MLTFDNAGMWNLRSAQAERAYLGQQLYLSVENVARSLRDEYMLLDTTPLCGVVKGLPKPP  549

Query  230  PY  225
            PY
Sbjct  550  PY  551



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  491  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  550

Query  230  P  228
            P
Sbjct  551  P  551



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>ref|XP_008359469.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=487

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE   R YLGQQ Y  V + +RSLR+EY++P+   +CG+VKG  KPP
Sbjct  424  LLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDTALVCGLVKGMPKPP  483

Query  230  PYT  222
            PY+
Sbjct  484  PYS  486



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  489  LLTFDNCGMWNIRSENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPA  548

Query  230  -PY  225
             PY
Sbjct  549  NPY  551



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE   R YLGQQ Y  V + +RSLR+EY++P+   +CG+VKG  KPP
Sbjct  489  LLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPKPP  548

Query  230  PYT  222
            PY+
Sbjct  549  PYS  551



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP  234
            M T DNAGMWNLRSE     YLGQQ Y SVLSPE S RDEY+LP+ Q +CGIVK   +P
Sbjct  482  MLTFDNAGMWNLRSENTENKYLGQQLYISVLSPEFSNRDEYNLPDTQLVCGIVKDLPRP  540



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS +W R Y G+QFY SV SP RSLRDEY++P+    CG V G   PP
Sbjct  476  MLTFDNAGMWNVRSNVWERYYTGEQFYISVTSPARSLRDEYNMPDTSLRCGRVVGLPMPP  535

Query  230  PY  225
             Y
Sbjct  536  SY  537



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  487  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  546

Query  230  P  228
            P
Sbjct  547  P  547



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y S+LSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y S+LSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y S+LSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  490  LLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTPKPV  549

Query  233  PPY  225
             PY
Sbjct  550  NPY  552



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  489  LLTFDNCGMWNIRSENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPA  548

Query  230  -PY  225
             PY
Sbjct  549  NPY  551



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE   R YLGQQ Y  V + +RSLR+EY++P+   +CG+VKG  KPP
Sbjct  488  LLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPKPP  547

Query  230  PYT  222
            PY+
Sbjct  548  PYS  550



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  489  LLTFDNCGMWNIRSENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPA  548

Query  230  -PY  225
             PY
Sbjct  549  NPY  551



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  450  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  509

Query  230  P  228
            P
Sbjct  510  P  510



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  486  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  545

Query  230  P  228
            P
Sbjct  546  P  546



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  486  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  545

Query  230  P  228
            P
Sbjct  546  P  546



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS  W   YLGQQ Y SV SP RSLRDEY++P+    CG V G   PP
Sbjct  489  MLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPDNTLRCGAVVGLPLPP  548

Query  230  PY  225
             Y
Sbjct  549  SY  550



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRS  W   YLGQQ Y SV SPERSLRDEY++P     CG V G   PP
Sbjct  489  LLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPERSLRDEYNMPLNALRCGAVVGLPLPP  548

Query  230  PYT  222
             YT
Sbjct  549  SYT  551



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  486  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  545

Query  230  P  228
            P
Sbjct  546  P  546



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW LRSE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  486  MLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  545

Query  230  P  228
            P
Sbjct  546  P  546



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   K  
Sbjct  491  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKIN  550

Query  230  PY  225
            PY
Sbjct  551  PY  552



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWNLRS  W   YLGQQ Y SV SP RSLRDEY++P     CG V G   PP
Sbjct  489  MLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPANALRCGAVVGLPLPP  548

Query  230  PYT  222
             YT
Sbjct  549  SYT  551



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKP-  234
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  488  LLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPV  547

Query  233  PPY  225
             PY
Sbjct  548  NPY  550



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++ S +W R YLG+QFY SV+SP RSLRDEY++P+    CG V G   PP
Sbjct  494  MLTFDNAGMWSVHSNIWERYYLGEQFYISVVSPARSLRDEYNMPDNALRCGKVVGLPLPP  553

Query  230  PY  225
             Y
Sbjct  554  SY  555



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW++ S +W R YLG+QFY SV+SP RSLRDEY++P+    CG V G   PP
Sbjct  494  MLTFDNAGMWSVHSNIWERYYLGEQFYISVVSPARSLRDEYNMPDNALRCGKVVGLPLPP  553

Query  230  PY  225
             Y
Sbjct  554  SY  555



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKG  246
            LDN GMWN+RSE WAR YLGQQFY  V SP RS+RDEY++P+   LCG  K 
Sbjct  483  LDNVGMWNVRSEFWARQYLGQQFYLRVYSPVRSIRDEYNIPKNALLCGRAKA  534



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMWN+RS+   R YLGQQFY  V +  RSLR+EY++P+   +CGIVK   KP 
Sbjct  489  MLTFDNAGMWNIRSDQPERRYLGQQFYVDVENIARSLRNEYNMPDNALVCGIVKDMPKPA  548

Query  230  PYTM  219
            PY+M
Sbjct  549  PYSM  552



>gb|AFK44839.1| unknown [Medicago truncatula]
Length=375

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            M T DNAGMW L SE     YLGQQ Y SV S E+S RDEY+LPE Q +CGIVK   +PP
Sbjct  312  MLTFDNAGMWQLGSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPP  371

Query  230  P  228
            P
Sbjct  372  P  372



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   K  
Sbjct  476  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKIN  535

Query  230  PY  225
            PY
Sbjct  536  PY  537



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   K  
Sbjct  489  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKIN  548

Query  230  PY  225
            PY
Sbjct  549  PY  550



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DNAGMWNLRSE   R YLGQQ Y  V + +RSLR+EY++P+   +CG+VKG   PP
Sbjct  488  LLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPMPP  547

Query  230  PYT  222
            PY+
Sbjct  548  PYS  550



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+RSE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   K  
Sbjct  481  LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKIN  540

Query  230  PY  225
            PY
Sbjct  541  PY  542



>gb|EYU38005.1| hypothetical protein MIMGU_mgv1a004001mg [Erythranthe guttata]
Length=550

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPPP  228
            LDN GMWN+RSE WAR YLGQQ+Y  V +P +S+RDEY +P    LCG  +G KK  P
Sbjct  484  LDNVGMWNIRSEYWARQYLGQQYYLRVYTPVKSVRDEYPIPSNALLCGRAQGIKKKHP  541



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            LDN GMWN+RSE WAR YLGQQFY  V SP  SLRDEY +P+   LCG   G K  P
Sbjct  484  LDNVGMWNVRSENWARQYLGQQFYLRVYSPANSLRDEYPIPKNALLCGRASGRKTRP  540



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            +  LDN GMWNLRSE WAR YLGQQFY  V +P  SLRDEY +P    LCG   G +  P
Sbjct  482  LIALDNVGMWNLRSEFWARQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRP  541



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            +  LDN GMWNLRSE WAR YLGQQFY  V +P  SLRDEY +P    LCG   G +  P
Sbjct  481  LIALDNVGMWNLRSEFWARQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRP  540



>ref|XP_004170388.1| PREDICTED: L-ascorbate oxidase homolog, partial [Cucumis sativus]
Length=457

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  404  TLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPPP  228
            +LDN GMWN+RSE WAR YLGQQFY  V +P +S RDEY++P+   LCG  +G     P
Sbjct  399  SLDNVGMWNIRSEFWARQYLGQQFYLRVYTPVKSFRDEYNVPDNALLCGKAEGKSTASP  457



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            +  LDN GMWNLRSE WAR YLGQQFY  V +P  SLRDEY +P    LCG   G +  P
Sbjct  482  LIALDNVGMWNLRSEFWARQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRP  541



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKG  246
            LDN GMWN+RSE WAR YLGQQFY  V SP  S+RDEY +P+   LCG  KG
Sbjct  488  LDNVGMWNVRSEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLCGRAKG  539



>ref|XP_011088669.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAK  240
            LDN GMWNLRSE WAR YLGQQFY  V +P RS RDEY +P+   LCG   G +
Sbjct  484  LDNVGMWNLRSEYWARQYLGQQFYLRVYTPVRSFRDEYAIPQNALLCGRADGKR  537



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKG  246
            LDN GMWN+RSE WAR YLGQQFY  V SP  S+RDEY +P+   LCG  KG
Sbjct  488  LDNVGMWNVRSEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLCGRAKG  539



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = -2

Query  410  MTTLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            + T DN GMWN+ SE   R YLGQQ Y SVLSPE+SLRDEY++PE    CG+VK   KP 
Sbjct  489  LLTFDNCGMWNIASENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPA  548

Query  230  -PY  225
             PY
Sbjct  549  NPY  551



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  401  LDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPP  231
            LDN GMWN+RSE WAR YLGQQFY  V +P  SLRDEY +P+   LCG   G +  P
Sbjct  481  LDNVGMWNIRSEFWARQYLGQQFYLRVYTPSTSLRDEYPIPKNALLCGRATGRRTRP  537



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  404  TLDNAGMWNLRSEMWARAYLGQQFYFSVLSPERSLRDEYDLPEKQALCGIVKGAKKPPP  228
            +LDN GMWN+RSE WAR YLGQQFY  V +P +S RDEY++P+   LCG  +G     P
Sbjct  488  SLDNVGMWNIRSEFWARQYLGQQFYLRVYTPVKSFRDEYNVPDNALLCGKAEGKSTASP  546



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519372013440