BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30980_g1_i1 len=1119 path=[1:0-1118]

Length=1119
                                                                      Score     E

ref|XP_009780572.1|  PREDICTED: uncharacterized protein LOC104229612    214   1e-63   
emb|CDP06677.1|  unnamed protein product                                208   2e-61   
ref|XP_009599069.1|  PREDICTED: uncharacterized protein LOC104094779    207   5e-61   
ref|XP_004246730.1|  PREDICTED: uncharacterized protein LOC101267837    204   9e-60   
ref|XP_006345681.1|  PREDICTED: uncharacterized protein LOC102595308    199   1e-57   
ref|XP_011077407.1|  PREDICTED: uncharacterized protein LOC105161424    192   5e-55   
gb|EYU38497.1|  hypothetical protein MIMGU_mgv1a013304mg                189   4e-54   
ref|XP_002274013.2|  PREDICTED: uncharacterized protein LOC100241364    182   1e-51   Vitis vinifera
emb|CBI32644.3|  unnamed protein product                                182   1e-51   
ref|XP_010037893.1|  PREDICTED: uncharacterized protein LOC104426514    174   3e-48   
ref|XP_008241888.1|  PREDICTED: uncharacterized protein LOC103340269    171   1e-46   
ref|XP_008345432.1|  PREDICTED: uncharacterized protein LOC103408360    169   2e-46   
ref|XP_009340998.1|  PREDICTED: uncharacterized protein LOC103933069    167   2e-45   
gb|KDP29042.1|  hypothetical protein JCGZ_16431                         164   2e-44   
ref|XP_008447318.1|  PREDICTED: uncharacterized protein LOC103489786    164   2e-44   
ref|XP_004302817.1|  PREDICTED: uncharacterized protein LOC101292034    163   7e-44   
ref|XP_008810519.1|  PREDICTED: uncharacterized protein LOC103721909    162   1e-43   
ref|XP_006428958.1|  hypothetical protein CICLE_v10012666mg             162   1e-43   
ref|XP_009338576.1|  PREDICTED: uncharacterized protein LOC103930898    162   2e-43   
ref|XP_010253414.1|  PREDICTED: uncharacterized protein LOC104594694    157   5e-42   
ref|XP_004142097.1|  PREDICTED: uncharacterized protein LOC101220680    157   1e-41   
ref|XP_010937753.1|  PREDICTED: uncharacterized protein LOC105057...    155   4e-41   
ref|XP_006828223.1|  hypothetical protein AMTR_s00023p00176440          153   2e-40   
ref|XP_010684169.1|  PREDICTED: uncharacterized protein LOC104898764    153   4e-40   
gb|KHG03653.1|  Immunoglobulin superfamily member 2                     151   1e-39   
gb|AFK41112.1|  unknown                                                 151   2e-39   
ref|XP_010937752.1|  PREDICTED: uncharacterized protein LOC105057...    150   3e-39   
gb|EPS72129.1|  hypothetical protein M569_02630                         150   3e-39   
ref|XP_002525215.1|  conserved hypothetical protein                     148   1e-38   Ricinus communis
ref|XP_004489610.1|  PREDICTED: uncharacterized protein LOC101505070    147   3e-38   
ref|XP_009405830.1|  PREDICTED: uncharacterized protein LOC103988885    145   2e-37   
ref|XP_003558195.1|  PREDICTED: uncharacterized protein LOC100843295    145   3e-37   
ref|XP_007151527.1|  hypothetical protein PHAVU_004G054300g             144   3e-37   
ref|XP_010086753.1|  hypothetical protein L484_005722                   144   5e-37   
gb|KEH25455.1|  ribosomal protein S24e family protein, putative         142   4e-36   
gb|EMT19043.1|  hypothetical protein F775_31935                         140   1e-35   
ref|XP_007027164.1|  Ribosomal protein S24e family protein, putative    140   2e-35   
ref|XP_010558298.1|  PREDICTED: uncharacterized protein LOC104826994    139   4e-35   
gb|KHN15425.1|  hypothetical protein glysoja_044909                     139   6e-35   
gb|ABR17290.1|  unknown                                                 138   2e-34   Picea sitchensis
ref|XP_002308495.1|  hypothetical protein POPTR_0006s23230g             137   5e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011019274.1|  PREDICTED: uncharacterized protein LOC105122068    137   7e-34   
gb|ABK24274.1|  unknown                                                 137   7e-34   Picea sitchensis
dbj|BAJ96255.1|  predicted protein                                      134   1e-33   
ref|XP_010937755.1|  PREDICTED: uncharacterized protein LOC105057...    132   6e-33   
gb|AAR23805.1|  unknown                                                 131   3e-32   Helianthus annuus
ref|NP_001144084.1|  uncharacterized protein LOC100276917               130   9e-32   Zea mays [maize]
ref|NP_001288548.1|  uncharacterized LOC103639287                       130   1e-31   
gb|ACU13973.1|  unknown                                                 130   1e-31   Glycine max [soybeans]
ref|XP_010937754.1|  PREDICTED: uncharacterized protein LOC105057...    127   4e-31   
ref|NP_001049749.1|  Os03g0282900                                       129   4e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984789.1|  PREDICTED: uncharacterized protein LOC101782959    127   1e-30   
ref|XP_006649878.1|  PREDICTED: uncharacterized protein LOC102722940    126   3e-30   
ref|XP_006398727.1|  hypothetical protein EUTSA_v10014568mg             124   2e-29   
ref|XP_010937756.1|  PREDICTED: uncharacterized protein LOC105057...    121   5e-29   
ref|XP_002468063.1|  hypothetical protein SORBIDRAFT_01g038920          122   5e-29   Sorghum bicolor [broomcorn]
gb|KFK24723.1|  hypothetical protein AALP_AA8G016300                    120   4e-28   
ref|XP_009122759.1|  PREDICTED: uncharacterized protein LOC103847430    118   2e-27   
emb|CDY10430.1|  BnaCnng03310D                                          118   3e-27   
gb|KHN19099.1|  hypothetical protein glysoja_049295                     115   7e-27   
emb|CDX70350.1|  BnaA10g26990D                                          115   2e-26   
gb|ACU17473.1|  unknown                                                 112   1e-25   Glycine max [soybeans]
ref|NP_568106.1|  ribosomal protein S24e family protein                 111   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62949.1|  unknown                                                 110   8e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01313.1|  hypothetical protein                                   110   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288593.1|  hypothetical protein CARUB_v10001888mg             109   2e-24   
ref|XP_010452119.1|  PREDICTED: uncharacterized protein LOC104734279    109   3e-24   
ref|XP_010490734.1|  PREDICTED: uncharacterized protein LOC104768441    107   1e-23   
ref|XP_002870986.1|  hypothetical protein ARALYDRAFT_487048             106   4e-23   
ref|XP_010423833.1|  PREDICTED: uncharacterized protein LOC104708875    104   2e-22   
emb|CAB86028.1|  putative protein                                       102   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KDO47503.1|  hypothetical protein CISIN_1g0271312mg                90.5    5e-19   
gb|EEC74993.1|  hypothetical protein OsI_11050                        89.7    4e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_974724.1|  ribosomal protein S24e family protein               87.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349918.1|  PREDICTED: uncharacterized protein LOC103413211  81.3    4e-15   
gb|KDO47504.1|  hypothetical protein CISIN_1g0271311mg                76.3    4e-13   
ref|XP_008353624.1|  PREDICTED: uncharacterized protein LOC103417...  72.0    5e-12   
ref|XP_008353623.1|  PREDICTED: uncharacterized protein LOC103417...  72.0    6e-12   
gb|KCW49670.1|  hypothetical protein EUGRSUZ_K03186                   67.4    7e-10   
ref|XP_002963498.1|  hypothetical protein SELMODRAFT_438644           68.9    2e-09   
ref|XP_002988209.1|  hypothetical protein SELMODRAFT_447264           67.4    6e-09   
ref|XP_008385784.1|  PREDICTED: uncharacterized protein LOC103448316  53.9    1e-05   



>ref|XP_009780572.1| PREDICTED: uncharacterized protein LOC104229612 [Nicotiana sylvestris]
Length=224

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 159/243 (65%), Gaps = 22/243 (9%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M  LLR   KS+R IQ  L NQGL+  L   SR+ +T+ E P+                +
Sbjct  1    MMGLLRAMTKSNRPIQMGLQNQGLALSL---SRQLSTQTETPQQDNS------------V  45

Query  221  PDFEPN---GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFP  391
              F  N   G VYGRI  +GR T KSDII+M+G SNL+L+D++F+YN  +   AA+IQFP
Sbjct  46   DTFLQNPSTGLVYGRIYGIGRHTRKSDIISMLGASNLSLDDVRFEYNPNYAPVAAMIQFP  105

Query  392  SQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLS  571
            ++  Y A++RAV  +T+R   + + DR QW+ L  YDGK+ILLQGIPRNA  DDVERFLS
Sbjct  106  TRNAYDASLRAVV-RTSRLFRMERADRQQWDTLPHYDGKTILLQGIPRNALADDVERFLS  164

Query  572  GCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIR  751
            GCQYD SSI +F R  Q R  +   A R+A+V FPS+A A+HAFITKNRGF LN+QI +R
Sbjct  165  GCQYDGSSIQIFAR--QQRGFDRPPA-RVALVQFPSQALAAHAFITKNRGFVLNNQIAVR  221

Query  752  ILH  760
            +L 
Sbjct  222  LLQ  224



>emb|CDP06677.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 151/240 (63%), Gaps = 23/240 (10%)
 Frame = +2

Query  47   SLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            SL R A KSSR I+    +QGL +LL  + RRF TE + P                    
Sbjct  2    SLFRTATKSSRLIRPVHQHQGLPSLL--SPRRFATETQQPSQDTTSDSFLRT--------  51

Query  227  FEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDY  406
                G VYG++    + TTK+D++ ++   NL+ +D+K  Y+  +   +  IQFP+Q  Y
Sbjct  52   -PATGLVYGKLFGTTKHTTKTDVLNLLQGCNLSTDDVKVCYDHYYETMSMSIQFPTQLAY  110

Query  407  SAAVRAVTPKTTRQGG--LSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
            +A +R+++    R+G   L K DR QWE LK YDGK+ILLQGIPRNA M+DV+RFLSGCQ
Sbjct  111  NAGIRSIS----RKGRFRLDKADRSQWETLKPYDGKAILLQGIPRNALMEDVQRFLSGCQ  166

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            YD SS+ MFFR   P      +AIRMA+V+FPS+A A HAFITKN+GFCLNSQI +RILH
Sbjct  167  YDASSMQMFFRQAFP------DAIRMALVHFPSQALAMHAFITKNQGFCLNSQIFVRILH  220



>ref|XP_009599069.1| PREDICTED: uncharacterized protein LOC104094779 [Nicotiana tomentosiformis]
Length=224

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 155/240 (65%), Gaps = 16/240 (7%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M  LLR   KS+R IQ  L NQGL+  L   SR+ +T+ E P+          N      
Sbjct  1    MMGLLRAVTKSNRPIQMGLQNQGLTLSL---SRQLSTQMETPQQDNSFDTFLQN------  51

Query  221  PDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQT  400
                  G VYGRI  +GR T KSDII+M+G SNL+L+D++F+YN  +   A +IQF ++ 
Sbjct  52   ---PSTGLVYGRIYGIGRHTRKSDIISMLGASNLSLDDVRFEYNANYAPVAVMIQFRTRN  108

Query  401  DYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             Y A++RAV  +T+R   + + DR QW+ L  YDGK+ILLQGIPRNA  DDVERFLSGCQ
Sbjct  109  AYDASLRAVV-RTSRLFRMERADRQQWDALPHYDGKTILLQGIPRNALADDVERFLSGCQ  167

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            YD SSI +F R  Q R  +   A R+A+V FPS+A A+HAFITKNRGF LN+QI +R+L 
Sbjct  168  YDGSSIQIFAR--QQRGFDRPPA-RVALVQFPSQALATHAFITKNRGFVLNNQIAVRLLQ  224



>ref|XP_004246730.1| PREDICTED: uncharacterized protein LOC101267837 [Solanum lycopersicum]
Length=224

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 156/243 (64%), Gaps = 22/243 (9%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M  L+R  AKS+RSIQ  + NQGL+  L    R+F+T+ E P+          N      
Sbjct  1    MMGLMRVVAKSNRSIQTSIQNQGLTLPL---CRQFSTQMETPQKDNSSDSFLRNPS----  53

Query  221  PDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQT  400
                 +G VYGR+   G+ T KSDII M+G S L+ +DI+F+YN+ +   + +IQFPS+ 
Sbjct  54   -----SGLVYGRLFVTGKHTRKSDIINMLGSSRLSPDDIRFEYNMNYAPVSVMIQFPSRN  108

Query  401  DYSAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLS  571
             Y A +R    + +R+GGL +++R+   QW++L  YDGK+ILLQG+PRNA  +DVERFL+
Sbjct  109  SYEATLR----EGSRKGGLFRMERVGRQQWDSLPRYDGKTILLQGVPRNAVAEDVERFLA  164

Query  572  GCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIR  751
            GCQYD S+I MF R   P+   ++   R   V FPS+A A+HAFITKNRGFCLN+QI +R
Sbjct  165  GCQYDASAIQMFGR---PQRAADRPPTRTVFVEFPSQAKATHAFITKNRGFCLNNQITVR  221

Query  752  ILH  760
            +L 
Sbjct  222  LLQ  224



>ref|XP_006345681.1| PREDICTED: uncharacterized protein LOC102595308 [Solanum tuberosum]
Length=224

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 154/243 (63%), Gaps = 22/243 (9%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M  LLR  AKS+RSIQ  + NQGL+  L    R+F+T+ E P+      P   N      
Sbjct  1    MMGLLRAVAKSNRSIQTSIQNQGLTLSL---CRQFSTQMETPQKDNSSDPFLRNPS----  53

Query  221  PDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQT  400
                 +G VYGR+   G+ T KSDI+ M+G S L+ +D++F+YN+ +   + +IQFP++ 
Sbjct  54   -----SGLVYGRLFVTGKHTRKSDILNMLGSSRLSPDDVRFEYNMNYAPVSVMIQFPTRN  108

Query  401  DYSAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLS  571
             Y A +R    +  R+GGL +++R+   QW+ L  YDGK+ILL G+PRNA  +DVERFL+
Sbjct  109  SYEATLR----EGNRKGGLFRMERVGRQQWDTLPRYDGKTILLVGVPRNAVAEDVERFLA  164

Query  572  GCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIR  751
            GCQYD S+I MF R   P+   ++   R   V FPS+A A+HAFITKNRGFCLN+QI +R
Sbjct  165  GCQYDASAIQMFGR---PQRASDRPPTRTVFVEFPSQAKATHAFITKNRGFCLNNQITVR  221

Query  752  ILH  760
            +L 
Sbjct  222  LLQ  224



>ref|XP_011077407.1| PREDICTED: uncharacterized protein LOC105161424 [Sesamum indicum]
Length=224

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 148/240 (62%), Gaps = 16/240 (7%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M+ L R A K SR ++    N+ L +    + + F+TEA              +     I
Sbjct  1    MSQLSRAAMKWSRLMETAQPNRRLPSTFFLSPKLFSTEAS------DSSLGSADDQFFRI  54

Query  221  PDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQT  400
            PD   +G VYGR+N++ +FTTKSDII ++   NL   ++K +Y  T+   + +++FPS++
Sbjct  55   PD---SGSVYGRVNNITKFTTKSDIINVLEGCNLNPHNLKVEYTRTYLPKSMMVEFPSRS  111

Query  401  DYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             Y AAV+++  K  R   + + D+ QW+    YDGK ILLQGIPRNA +DDVERFLSGC 
Sbjct  112  AYDAAVKSINRKG-RLFNMIRADKAQWDITTPYDGKVILLQGIPRNALIDDVERFLSGCH  170

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            YD SSI MF R        +Q  IRMA+V FPS+A A HA+ITKNRGFCLN+QI +++LH
Sbjct  171  YDSSSIQMFVRP------TDQGPIRMALVRFPSQALAMHAYITKNRGFCLNNQITLQVLH  224



>gb|EYU38497.1| hypothetical protein MIMGU_mgv1a013304mg [Erythranthe guttata]
Length=224

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 146/240 (61%), Gaps = 16/240 (7%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M+ L+R A K SR ++    N  L +    + + F+TEA  P                  
Sbjct  1    MSKLIRAAMKLSRLMETARPNPRLPSTFFISPKLFSTEASEPILGSTNDQFLRT------  54

Query  221  PDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQT  400
                P G VYG++ S+ + TTKSDII ++   NL LE++K +Y  ++   + +++FPS+T
Sbjct  55   ---PPTGLVYGKLTSITKHTTKSDIINLLEGCNLNLENLKVEYGRSYLPVSMMVEFPSRT  111

Query  401  DYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             + AA+RA++ K  R   L+KVD+  W+    YDGK+ILL GIPRNA MDDVER LSGC 
Sbjct  112  VFDAAIRAISRKG-RLYNLTKVDKSDWDTHAPYDGKAILLHGIPRNALMDDVERTLSGCL  170

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            YD SS+ MF R        +Q  IRMA+V FPS+A A HA+ITKNRGFCLN+QI ++IL+
Sbjct  171  YDSSSVQMFVRP------TSQGPIRMALVRFPSQALAMHAYITKNRGFCLNNQITVQILY  224



>ref|XP_002274013.2| PREDICTED: uncharacterized protein LOC100241364 [Vitis vinifera]
Length=221

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 149/236 (63%), Gaps = 25/236 (11%)
 Frame = +2

Query  59   NAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDFEP-  235
            NA + +R +Q    +QGL  L+R     F+TEAEAP+                 P  +P 
Sbjct  9    NANRWNRLLQTAKPSQGLPLLIRS----FSTEAEAPQVSSSD------------PFLQPP  52

Query  236  -NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSA  412
              G VYGR++ + + T ++DI+ ++   NLTL+D+K DYN ++     ++QFPS+  +  
Sbjct  53   STGLVYGRLSGITKHTLRTDILNLLEGCNLTLQDVKVDYNRSYFPVGMMVQFPSRYAFDH  112

Query  413  AVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLS  592
            A++ +  K  R   L + DR QW+ L++YDGK++LLQG+PRNA  +DVERFL+GC+++ S
Sbjct  113  AIKVIN-KKGRLYKLDRADRSQWDPLRTYDGKTVLLQGLPRNALPEDVERFLAGCEFNSS  171

Query  593  SISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            +I +  R   P      + IRMA+V+FPS++ A +AFITKNRGFCLN+QI +R+LH
Sbjct  172  NIQLTTRQAFP------DPIRMALVHFPSQSQAMNAFITKNRGFCLNNQILVRVLH  221



>emb|CBI32644.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 149/236 (63%), Gaps = 25/236 (11%)
 Frame = +2

Query  59   NAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDFEP-  235
            NA + +R +Q    +QGL  L+R     F+TEAEAP+                 P  +P 
Sbjct  6    NANRWNRLLQTAKPSQGLPLLIRS----FSTEAEAPQVSSSD------------PFLQPP  49

Query  236  -NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSA  412
              G VYGR++ + + T ++DI+ ++   NLTL+D+K DYN ++     ++QFPS+  +  
Sbjct  50   STGLVYGRLSGITKHTLRTDILNLLEGCNLTLQDVKVDYNRSYFPVGMMVQFPSRYAFDH  109

Query  413  AVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLS  592
            A++ +  K  R   L + DR QW+ L++YDGK++LLQG+PRNA  +DVERFL+GC+++ S
Sbjct  110  AIKVIN-KKGRLYKLDRADRSQWDPLRTYDGKTVLLQGLPRNALPEDVERFLAGCEFNSS  168

Query  593  SISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            +I +  R   P      + IRMA+V+FPS++ A +AFITKNRGFCLN+QI +R+LH
Sbjct  169  NIQLTTRQAFP------DPIRMALVHFPSQSQAMNAFITKNRGFCLNNQILVRVLH  218



>ref|XP_010037893.1| PREDICTED: uncharacterized protein LOC104426514 [Eucalyptus grandis]
 gb|KCW49669.1| hypothetical protein EUGRSUZ_K03186 [Eucalyptus grandis]
Length=231

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 131/221 (59%), Gaps = 18/221 (8%)
 Frame = +2

Query  104  QGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDFEP--NGKVYGRINSVGRF  277
            +GL +LLRD  R F+TE E P  P               P   P   G VY ++  + R 
Sbjct  27   RGLPSLLRDAPRPFSTEPEQPAQPEDSSAD---------PFLRPPNTGPVYAKLFGMSRH  77

Query  278  TTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVRAVTPKTTRQGGL  457
            T K+DI+ ++   NLT +D++F+YN  F     ++QFPS+  +  A + +  +  R   L
Sbjct  78   TLKTDIVNLLEGCNLTPDDVRFNYNRMFVPMGMMVQFPSRFQFDQAFKVIG-RKGRLYKL  136

Query  458  SKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSSISMFFRTLQPRFIE  637
             + DR QW+ L +YDGK++LLQGIP +A  +DVERF+SGCQYD SSI M  R   P    
Sbjct  137  ERADRSQWDLLMNYDGKTLLLQGIPFSANPNDVERFMSGCQYDASSIQMMVRPANP----  192

Query  638  NQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
              + I+MA VNFPS+  A +AFITKNRGFC NSQ+ +R+L 
Sbjct  193  --DPIKMATVNFPSQIQAMNAFITKNRGFCQNSQVLLRVLQ  231



>ref|XP_008241888.1| PREDICTED: uncharacterized protein LOC103340269 [Prunus mume]
Length=254

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 143/257 (56%), Gaps = 28/257 (11%)
 Frame = +2

Query  50   LLRNAAKSSRSIQACLG-NQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            LLR +  SS S++  +  N+GL++LLR+  RRF+TEAE          Q     P   P 
Sbjct  6    LLRTSIMSSLSVRTAMAQNRGLTSLLREPLRRFSTEAENSLQDSSTSDQPLESSPSNKPQ  65

Query  227  -----------------FE--PNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY  349
                             FE    G VYGR+  V R T K+D++ ++   NL+L+D+K DY
Sbjct  66   KSSPSDKPQESSPSESFFETPSTGSVYGRLLGVKRNTLKTDVVNLLEGCNLSLDDVKMDY  125

Query  350  NITFNGNAAVIQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGI  529
            N  F     ++QFPS+  Y   +R +  K  R   L + +R +W++L  YDGK++LLQGI
Sbjct  126  NRWFTAIGMLVQFPSRQAYDNGIRMIA-KKGRLFKLERANRAEWDSLTPYDGKTVLLQGI  184

Query  530  PRNAQMDDVERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFIT  709
            P NA  +DV+RFL GC+YD SS+ + FR        +QE  + A V F ++  A +AF+ 
Sbjct  185  PPNAVPEDVDRFLCGCEYDSSSLQLSFRP-------SQEPAKWATVRFHTQTEAMNAFLV  237

Query  710  KNRGFCLNSQIGIRILH  760
            KN+GFCLN ++ +R+L 
Sbjct  238  KNKGFCLNGEVLMRVLQ  254



>ref|XP_008345432.1| PREDICTED: uncharacterized protein LOC103408360 [Malus domestica]
Length=236

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 144/250 (58%), Gaps = 21/250 (8%)
 Frame = +2

Query  32   ISKMTSLLRNAAKSSRSIQ-ACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfp  208
            +SK+  LLR A  SS +++ A   N+GL  LL + +RRF+TEAE P        Q  +  
Sbjct  1    MSKL-GLLRAAITSSIAVRTAVPQNRGLPMLLGEPARRFSTEAENPPQNSRPSDQPQDAS  59

Query  209  prpIPDFEP------NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGN  370
                   EP       G VYG++  + R+T K+D++ M+   NL+LED+K DYN  F   
Sbjct  60   -----PIEPFLQTPTTGLVYGKLLGISRYTLKTDVVNMLEGCNLSLEDVKVDYNRAFTPM  114

Query  371  AAVIQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMD  550
              V+QF S   +  A R ++ +  R   L + +R QW+NL  +D K++LLQGIP+ A  +
Sbjct  115  GMVVQFRSWKAFDNAARVIS-RKGRLFKLERANRSQWDNLTPHDAKTVLLQGIPQTAAPE  173

Query  551  DVERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCL  730
            DVERFLSGC+YD SS+ + FR+         E  + A V FPS+  A +AF+ KN+G+C 
Sbjct  174  DVERFLSGCEYDSSSLQIIFRSF-------PEPSKFATVRFPSQTEAMNAFLAKNKGYCQ  226

Query  731  NSQIGIRILH  760
            N QI +R+L 
Sbjct  227  NGQILMRVLQ  236



>ref|XP_009340998.1| PREDICTED: uncharacterized protein LOC103933069 [Pyrus x bretschneideri]
Length=236

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/253 (40%), Positives = 146/253 (58%), Gaps = 27/253 (11%)
 Frame = +2

Query  32   ISKMTSLLRNAAKSSRSIQ-ACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfp  208
            +SK+  LLR    S+ +++ A   N+GL  LL + +RRF+TEAE P    P   Q  +  
Sbjct  1    MSKL-GLLRAVITSNLAVRTAVRQNRGLPMLLGEPARRFSTEAENPPQNSPPSDQPQDAS  59

Query  209  prpIPDFEP------NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGN  370
                   EP       G VYG++  + R+T K+D++ M+   NL+LED+K DYN  F   
Sbjct  60   -----PIEPFLQTPTTGLVYGKLLGISRYTLKTDVVNMLEGCNLSLEDVKVDYNRAFTPM  114

Query  371  AAVIQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNA  541
              V+QF S   +  A R ++    R+G L K++R     W+NL  +DGK++LLQGIP+ A
Sbjct  115  GMVVQFRSWKAFDNAARVIS----RKGRLFKLERANRSLWDNLTPHDGKTVLLQGIPQTA  170

Query  542  QMDDVERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRG  721
              +DVERFLSGC+YD SS+ + FR+         E  + A V FPS+  A +AF+ KN+G
Sbjct  171  APEDVERFLSGCEYDSSSLQIIFRSF-------PEPSKFATVRFPSQTEAMNAFLAKNKG  223

Query  722  FCLNSQIGIRILH  760
            FC N QI +R+L 
Sbjct  224  FCQNGQILMRVLQ  236



>gb|KDP29042.1| hypothetical protein JCGZ_16431 [Jatropha curcas]
Length=225

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 136/238 (57%), Gaps = 14/238 (6%)
 Frame = +2

Query  47   SLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            SL+RN+ +S+ ++ A   N  +S  LR +S+  +TEAE P  P                 
Sbjct  2    SLVRNSIRSNFNVSAFKPNHAISFCLRHSSKHLSTEAEQPPLPQDSSEHPFLRTTGA---  58

Query  227  FEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDY  406
                G VY ++  + + T K+DII M+  SNLT +DIK  YN  F     ++QFPS + +
Sbjct  59   ----GTVYAKLFGITKNTLKTDIINMLDGSNLTPDDIKVSYNRDFMPVGMMLQFPSYSAF  114

Query  407  SAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYD  586
              A +A+  K  R   L + DR QW+ L  YDGK++LLQG+PRN   +DVERFLS C+YD
Sbjct  115  DNAYKAMR-KKGRFYKLDRSDRSQWDILMPYDGKTLLLQGLPRNVVPEDVERFLSDCEYD  173

Query  587  LSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
             SS+ +F R   P      E  ++A++ F +R  A +A ITKNR FCLNSQI +R+L 
Sbjct  174  PSSLQLFPRQGFP------EPTKIALIRFYTRTEAMNALITKNRAFCLNSQISVRVLQ  225



>ref|XP_008447318.1| PREDICTED: uncharacterized protein LOC103489786 [Cucumis melo]
Length=226

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 137/249 (55%), Gaps = 40/249 (16%)
 Frame = +2

Query  50   LLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDF  229
            LLR A  S+   +    N  L    R + R F+TE E P                  P+ 
Sbjct  6    LLRKALGSNFISRPATSNHELPLFFRQSPRFFSTEREQPP-----------------PES  48

Query  230  EPN---------GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVI  382
             PN         G +YG++    R T K+D++ ++   NL+L+DIKF+Y+  F   + +I
Sbjct  49   SPNRFSDKSNTDGFMYGKLFGFSRSTLKTDVLILLEGCNLSLDDIKFEYSRNFFPVSMMI  108

Query  383  QFPSQTDYSAAVRAVTPKTTRQGGLSKV---DRIQWENLKSYDGKSILLQGIPRNAQMDD  553
            QFPSQ  Y  A +A+     R+G L ++   DR QWE L  Y+GK++ LQGIPRNA ++D
Sbjct  109  QFPSQQAYQHAFQAIA----RKGFLHRLERADRSQWELLSPYNGKTVFLQGIPRNALVED  164

Query  554  VERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLN  733
            VERFLSGC YD SSI+++  +         E  +MA V F S   A HAF+TKNRGFCLN
Sbjct  165  VERFLSGCDYDASSINIYRGSF-------SEPTKMATVQFLSPIQAMHAFLTKNRGFCLN  217

Query  734  SQIGIRILH  760
            +QI +++L 
Sbjct  218  NQISMQVLQ  226



>ref|XP_004302817.1| PREDICTED: uncharacterized protein LOC101292034 [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 146/253 (58%), Gaps = 25/253 (10%)
 Frame = +2

Query  32   ISKMTSLLRNAAKSSRSIQACLG--NQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnf  205
            +SK+  LLR + +S+ + +  L   ++ L++LLRD  RRF+T AE P             
Sbjct  1    MSKL-GLLRTSIRSTLAARTSLSQTHRLLASLLRDPPRRFSTAAEQPPQNSAPGQPPSLD  59

Query  206  pprpIPDFEPN--GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAV  379
                     PN    VYG++  + R T ++D++ ++   NLTLED+K  YN  F     +
Sbjct  60   ATVDQIVRNPNTGAAVYGKLVGITRNTLRTDVVNLLEGCNLTLEDVKVHYNGPFIPTGML  119

Query  380  IQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQ------WENLKSYDGKSILLQGIPRNA  541
            +QFPSQ ++  AVR +     R  GL++V R+Q      W+++  YDGK++L++GIPR A
Sbjct  120  VQFPSQREFENAVRVL-----RGRGLAQVFRLQRLDRHLWDDIPHYDGKTVLIEGIPRTA  174

Query  542  QMDDVERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRG  721
              +DVERFLSG  Y+ SSI +F +         Q +IRMA V FPS+  A +A+ITKN+G
Sbjct  175  LQEDVERFLSGTPYEGSSIKIFMK---------QGSIRMATVQFPSQIQAKNAYITKNKG  225

Query  722  FCLNSQIGIRILH  760
            F LN Q+ +R+L 
Sbjct  226  FILNDQVLMRVLQ  238



>ref|XP_008810519.1| PREDICTED: uncharacterized protein LOC103721909 [Phoenix dactylifera]
Length=218

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 116/180 (64%), Gaps = 14/180 (8%)
 Frame = +2

Query  233  PN-GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            PN G V+GR+  +GR T K+D+I      NL+ +D+K +YN  +N    ++QFPS++ + 
Sbjct  49   PNEGLVFGRVTGIGRNTLKTDVIHFFEGCNLSADDVKVEYNRAYNPVGVLLQFPSRSSFD  108

Query  410  AAVRAVTPKTTRQGGL---SKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             AVR    +T R+G L    KV+R QW+ + SYDGK++LLQGIPRNA  +DVERFL GC 
Sbjct  109  MAVR----QTIRKGRLYKMEKVNRSQWDLMTSYDGKAVLLQGIPRNALQEDVERFLHGCN  164

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            YD S+   F R   P      + IR+A+++FP+R  A +AF  KNR FCLN+ I +R+L 
Sbjct  165  YDPSTFQTFVRPGFP------DPIRLALIHFPTRNDAMNAFCIKNRSFCLNNSITMRVLQ  218



>ref|XP_006428958.1| hypothetical protein CICLE_v10012666mg [Citrus clementina]
 ref|XP_006480529.1| PREDICTED: uncharacterized protein LOC102606880 [Citrus sinensis]
 gb|ESR42198.1| hypothetical protein CICLE_v10012666mg [Citrus clementina]
Length=227

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 142/241 (59%), Gaps = 18/241 (7%)
 Frame = +2

Query  47   SLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            SLLRNA KSS S++       L +LLR + + F+TE EAP PPPP       F   P   
Sbjct  2    SLLRNAIKSSVSLRTIKPIHSLPSLLRQSPKHFSTETEAPPPPPPNDASIDLFLQTPT--  59

Query  227  FEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDY  406
                G  YG++  + R T KSDII ++   NLT +D+K +Y   +   A ++QFPS + Y
Sbjct  60   ---KGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAY  116

Query  407  SAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVERFLSGC  577
              A R +     R+G L +++R +   W+ +  Y+GK++LLQ +PR A  +DVERFLSGC
Sbjct  117  DNAFRLIG----RKGRLYRLERAEQSEWDIVMPYNGKTVLLQNVPRIAVAEDVERFLSGC  172

Query  578  QYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRIL  757
            +Y+ SSIS   R   P      ++I+ A V FPS+  A  AFI KNRGFCLN+Q+ +R+L
Sbjct  173  EYEASSISFMLRQSLP------DSIKWATVRFPSQTQAMDAFIRKNRGFCLNNQVSVRVL  226

Query  758  H  760
             
Sbjct  227  Q  227



>ref|XP_009338576.1| PREDICTED: uncharacterized protein LOC103930898 [Pyrus x bretschneideri]
Length=236

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 141/247 (57%), Gaps = 26/247 (11%)
 Frame = +2

Query  50   LLRNAAKSSRSIQ-ACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            LLR    S+ +++ A   N+GL  LL + +RRF+TEAE P    P   Q  +        
Sbjct  6    LLRAVITSNLAVRTAVRQNRGLPMLLGEPARRFSTEAENPPQNSPPSDQPQDAS-----P  60

Query  227  FEP------NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQF  388
             EP       G VYG++  + R+T K+D++ M+   NL+LED+K DYN  F     V+QF
Sbjct  61   IEPFLQTPTTGLVYGKLLGISRYTLKTDVVNMLEGCNLSLEDVKVDYNRAFTPMGMVVQF  120

Query  389  PSQTDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVE  559
             S   +  A R ++    R+G L K++R     W+NL  +DGK++LLQGIP+ A  +DVE
Sbjct  121  RSWKAFDNAARVIS----RKGRLFKLERANRSLWDNLTPHDGKTVLLQGIPQTAAPEDVE  176

Query  560  RFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQ  739
            RFLSGC+YD SS+ + FR+         E  + A + F S+  A +AF+ KN+GFC N Q
Sbjct  177  RFLSGCEYDSSSLQIIFRSF-------PEPSKFATIRFLSQTEAMNAFLAKNKGFCQNGQ  229

Query  740  IGIRILH  760
            I +R+L 
Sbjct  230  ILMRVLQ  236



>ref|XP_010253414.1| PREDICTED: uncharacterized protein LOC104594694 [Nelumbo nucifera]
Length=225

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 133/245 (54%), Gaps = 31/245 (13%)
 Frame = +2

Query  32   ISKMTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpp  211
            + ++  LLR    S+RS Q+ L         R+ +R F T+AE                 
Sbjct  10   LGRLNGLLR----STRSNQSFL-----PLFQREATRHFATDAEQKDSSLD----------  50

Query  212  rpIPDFEP--NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQ  385
               P   P   G  YGR+   GR T K+DII  +   NLT +D+K +YN  F     ++Q
Sbjct  51   ---PFLRPPSTGLAYGRLIGFGRNTLKTDIINFLEGCNLTPQDVKVEYNRAFTSVGMILQ  107

Query  386  FPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERF  565
            FPS+  + +A+R +  +  R   L + DR QW+  KSYDGK +L+QG+PRNA  +D+ER 
Sbjct  108  FPSRIAFDSAIRLMN-RNGRLYKLERADRSQWDVAKSYDGKVVLMQGVPRNALPEDIERV  166

Query  566  LSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIG  745
            LSGC Y+ SSI  F R   P      + +R+A+V FPS+  A +A + KNR FCLN+QI 
Sbjct  167  LSGCVYNSSSIQTFVRPAFP------DPVRLALVEFPSQVEAMNAVLVKNRSFCLNNQIL  220

Query  746  IRILH  760
            +R+L 
Sbjct  221  MRVLQ  225



>ref|XP_004142097.1| PREDICTED: uncharacterized protein LOC101220680 [Cucumis sativus]
 ref|XP_004161686.1| PREDICTED: uncharacterized LOC101220680 [Cucumis sativus]
 gb|KGN54201.1| hypothetical protein Csa_4G293110 [Cucumis sativus]
Length=226

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 130/247 (53%), Gaps = 34/247 (14%)
 Frame = +2

Query  47   SLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            SLLR A  S+   ++   N  L    R + R F+TE E                    P+
Sbjct  5    SLLRKALGSNFISRSATANHELPLFFRQSPRFFSTEQEQAP-----------------PE  47

Query  227  FEPN---------GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAV  379
              PN         G  +G++    R   KSD++ ++   NL+ ED+KF+Y   F   + +
Sbjct  48   SSPNRFSDKTNTDGLRFGKLVGASRSMLKSDVLILLQGCNLSFEDVKFEYVRNFVPTSIM  107

Query  380  IQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVE  559
            IQFPS+  Y  A +A+  K   Q  + + DR QWE L  Y+GK++LL+GIPRNA ++D+E
Sbjct  108  IQFPSEQAYQNAFQAIARKGYLQR-MERADRSQWELLSPYNGKTVLLEGIPRNALVEDLE  166

Query  560  RFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQ  739
            RFLSGC YD SSI+ +  +            + A V F S   A HAF+TKNRGFCLN+Q
Sbjct  167  RFLSGCDYDASSINFYRGSF-------SAPTKTATVQFRSPIQAMHAFLTKNRGFCLNNQ  219

Query  740  IGIRILH  760
            I +R+L 
Sbjct  220  ISMRVLQ  226



>ref|XP_010937753.1| PREDICTED: uncharacterized protein LOC105057021 isoform X2 [Elaeis 
guineensis]
Length=217

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = +2

Query  233  PN-GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            PN G V+GR+  +GR T K+D+I    + NL+ +D+K +YN  +     ++QFPSQ+ + 
Sbjct  48   PNEGLVFGRLFGIGRNTLKTDVIHFFEECNLSTDDVKVEYNREYYPVGVLLQFPSQSSFD  107

Query  410  AAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             AV+    +T R+G L K++R    QW+ ++SYDGK++LLQGIPRNA  + VERFL GC 
Sbjct  108  MAVK----QTIRKGRLYKIERAARSQWDLMRSYDGKAVLLQGIPRNALQEHVERFLHGCN  163

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            YD S+   F R   P      + IR A+++FP++  A +AF  KNR FCLN+ I +R+L 
Sbjct  164  YDPSTFQTFVRPGFP------DPIRFALIHFPTQIDAMNAFCMKNRSFCLNNSITMRVLQ  217



>ref|XP_006828223.1| hypothetical protein AMTR_s00023p00176440 [Amborella trichopoda]
 gb|ERM95639.1| hypothetical protein AMTR_s00023p00176440 [Amborella trichopoda]
Length=231

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 106/177 (60%), Gaps = 7/177 (4%)
 Frame = +2

Query  230  EPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
             P G  YGR+   GR   K+D+I      NLT+EDIK +YN TF     ++QFPS++ + 
Sbjct  62   PPKGLTYGRLTGFGRNALKTDLIHFFDGCNLTVEDIKVEYNRTFVPLGMLLQFPSRSAFD  121

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             A R V  +  R   L KVDR QW+ +  YDGK +L QGIPR A  +DVERFLSGC+YD 
Sbjct  122  TATRLVF-RRGRLYRLDKVDRGQWDIVTPYDGKVLLFQGIPRQAFPEDVERFLSGCRYDG  180

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            S + +  R   P      + IR+A+V FP++  A +A   KNRGFC+NS I  RIL 
Sbjct  181  SDLQLLMRPGFP------DPIRLALVRFPTQLDAMNALRMKNRGFCINSPITARILQ  231



>ref|XP_010684169.1| PREDICTED: uncharacterized protein LOC104898764 [Beta vulgaris 
subsp. vulgaris]
Length=232

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 119/214 (56%), Gaps = 11/214 (5%)
 Frame = +2

Query  104  QGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDFEPNGKVYGRINSVGRFTT  283
            Q L   LRD+ R F+T  E    P               P     G VYGR+  +   T 
Sbjct  23   QNLPLFLRDSPRHFSTRNEHQPLPQHPHSPTPIDSFLHPPS---PGLVYGRLFGISANTL  79

Query  284  KSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVRAVTPKTTRQGGLSK  463
            K+DII +   SNLTL+DIK +YN  F+  A ++QF S  D+SAA R +T + +R   + K
Sbjct  80   KTDIINLFEGSNLTLDDIKVEYNRIFHPMAMLVQFRSMADFSAAFRELT-RRSRSFRMEK  138

Query  464  V-DRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSSISMFFRTLQPRFIEN  640
            V D  QW+ +  Y+G+ +L QGIPRNA  DD++R LSGC Y+ SS+ +F R LQ      
Sbjct  139  VVDHRQWDLVTPYNGRYVLFQGIPRNALPDDIDRLLSGCNYEASSLEIFVRPLQ------  192

Query  641  QEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
               IRMA V FPS   A +A I KN  FCLN+++
Sbjct  193  SGPIRMATVRFPSPIEAMNAVIRKNGAFCLNNRV  226



>gb|KHG03653.1| Immunoglobulin superfamily member 2 [Gossypium arboreum]
Length=229

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 137/237 (58%), Gaps = 10/237 (4%)
 Frame = +2

Query  50   LLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDF  229
            +LRNA K   S++       L + L +  +RF+TE +  +  P        F      D 
Sbjct  3    ILRNAIKLHVSVRTVKPTHVLPSFLSEPPKRFSTEPDQQQQQPLPDASINQFL-----DS  57

Query  230  EPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
               G VYG++  + ++T KSDII+++   NLT +DIK  Y+ +    A +++FPS + +S
Sbjct  58   ASKGFVYGKLFGITKYTMKSDIISLLEGCNLTPDDIKVSYSRSLFPVAMMLRFPSPSAFS  117

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             A R +  +  R   L +VD  +W+ +  Y+GK+++LQG+PR+A ++DVERFLSGC+YD 
Sbjct  118  NAARTIR-RFDRLYRLDRVDTSEWDIVMPYNGKTVVLQGLPRSAALEDVERFLSGCEYDS  176

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            SSI     T +P F      +R+  V FPS   A +A I+KNR  CLN+QI +R+L+
Sbjct  177  SSIQTVTFT-RPGF---TNLVRLTTVQFPSHIEAMNACISKNRKICLNNQISVRVLY  229



>gb|AFK41112.1| unknown [Lotus japonicus]
 gb|AFK47895.1| unknown [Lotus japonicus]
Length=224

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/243 (39%), Positives = 136/243 (56%), Gaps = 23/243 (9%)
 Frame = +2

Query  41   MTSLLRNAAKSSR-SIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprp  217
            M S+ R   + ++ S+ A     GL        R F+TEAE P  P              
Sbjct  2    MGSVFRATIQRTKCSVSALQRTHGLQAF---GPRCFSTEAEQPPQPQDSTTPTP------  52

Query  218  IPDFEPN--GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFP  391
             P FE +  G  Y R++ + R   K+D+I+ +   NLTLED+K +YN  F   A ++QFP
Sbjct  53   -PFFETDNSGLTYARLHGIHRNMLKTDVISFLEGCNLTLEDVKVEYNRNFFPLAMLLQFP  111

Query  392  SQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLS  571
            +++DYS A++ V  K  R      VDR  W+ +  YDGK+I++QGIP NA  +D+ER LS
Sbjct  112  TRSDYSNAIK-VNLKNGRFYKFEMVDRGHWDIVTPYDGKAIVIQGIPMNAAFEDIERTLS  170

Query  572  GCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIR  751
            GC YD SS+S     ++PR + +    ++A V FPSR  A  AFITKNR FCLN+++ + 
Sbjct  171  GCDYDASSVS-----IRPRDVLS----KLATVRFPSRTKAMSAFITKNRTFCLNNRVSVE  221

Query  752  ILH  760
            +L 
Sbjct  222  VLQ  224



>ref|XP_010937752.1| PREDICTED: uncharacterized protein LOC105057021 isoform X1 [Elaeis 
guineensis]
Length=220

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 111/174 (64%), Gaps = 14/174 (8%)
 Frame = +2

Query  233  PN-GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            PN G V+GR+  +GR T K+D+I    + NL+ +D+K +YN  +     ++QFPSQ+ + 
Sbjct  48   PNEGLVFGRLFGIGRNTLKTDVIHFFEECNLSTDDVKVEYNREYYPVGVLLQFPSQSSFD  107

Query  410  AAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             AV+    +T R+G L K++R    QW+ ++SYDGK++LLQGIPRNA  + VERFL GC 
Sbjct  108  MAVK----QTIRKGRLYKIERAARSQWDLMRSYDGKAVLLQGIPRNALQEHVERFLHGCN  163

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
            YD S+   F R   P      + IR A+++FP++  A +AF  KNR FCLN+ I
Sbjct  164  YDPSTFQTFVRPGFP------DPIRFALIHFPTQIDAMNAFCMKNRSFCLNNSI  211



>gb|EPS72129.1| hypothetical protein M569_02630 [Genlisea aurea]
Length=227

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 115/175 (66%), Gaps = 7/175 (4%)
 Frame = +2

Query  236  NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAA  415
            +G  Y ++ ++ ++TTKSD++ ++   NL  E I+ +Y+  +   + +++ PS   +  A
Sbjct  60   SGSTYLKLVNISKYTTKSDVLHLLDGINLKPESIRVEYDRAYYPVSIIVELPSVDAFEVA  119

Query  416  VRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSS  595
             RA+  K  R   L+K D+ +W+ +  +DGK+ILL+ IPRNA  DD+ERFLSGCQYD SS
Sbjct  120  GRAIATKG-RLFNLAKTDKDRWDLIAPFDGKAILLREIPRNAGFDDIERFLSGCQYDSSS  178

Query  596  ISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            + +FFR ++          +MA+V FPS A A+HA++TKN GF LNSQI +++LH
Sbjct  179  LEIFFRPVK------NVVSKMALVRFPSPALAAHAYMTKNGGFVLNSQICVQLLH  227



>ref|XP_002525215.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37181.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 115/175 (66%), Gaps = 9/175 (5%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDS-NLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAA  415
            G VYG++  + R T K+D+I ++G+   LT +DIK  Y  +++  A +IQFP++  +  A
Sbjct  55   GVVYGKLFGITRHTLKTDVINLLGEGCQLTPDDIKLTY-ASYDPVAVMIQFPTRQAFDNA  113

Query  416  VRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSS  595
             + +  K  R   L + DR QW+ +  YDGK++LLQGIP  A  +DVERFLSGC++D SS
Sbjct  114  FKTIG-KKGRLHRLERADRSQWDYIMPYDGKTVLLQGIPEYAAPEDVERFLSGCEFDSSS  172

Query  596  ISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            I +F R   P      EAIR+A+V F +R +A +AFITKN+GFC N++I +R+L 
Sbjct  173  IRLFRRQSVP------EAIRVALVRFHTRTAAMNAFITKNQGFCSNNKISMRVLQ  221



>ref|XP_004489610.1| PREDICTED: uncharacterized protein LOC101505070 [Cicer arietinum]
Length=223

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 138/245 (56%), Gaps = 27/245 (11%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M S++R   K ++S   CL       L R   R F+TEAE P                  
Sbjct  1    MGSVVRATLKKTKS-SVCLFQTSNGFLGR---RFFSTEAEKPPQDSTPSSP---------  47

Query  221  PDFEPN--GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPS  394
            P  + N  G  YGR+  V +   K+DII ++   NLTLED+K +Y+ +FN  A ++QFP+
Sbjct  48   PFLQTNNSGLTYGRLLGVHKHALKTDIINLLEGCNLTLEDVKMEYSRSFNPLAMMVQFPT  107

Query  395  QTDYSAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERF  565
             + Y  A+R +     R+G L K+DRI   QW+ +  +DG++IL+QG+PRN Q  DVER 
Sbjct  108  YSAYDNAIRVIV----RKGRLYKLDRIDRSQWDIVTPFDGRTILIQGLPRNVQFADVERI  163

Query  566  LSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIG  745
            +SG +YD SS+ +F R+      +  E ++MA + F SR  A +A+I +N  +CLN++I 
Sbjct  164  VSGYEYDTSSVEIFIRSG-----DGAEPMKMATIRFHSRTQAMNAYIARNGTYCLNNRIL  218

Query  746  IRILH  760
            I++L 
Sbjct  219  IQVLQ  223



>ref|XP_009405830.1| PREDICTED: uncharacterized protein LOC103988885 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405831.1| PREDICTED: uncharacterized protein LOC103988885 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 107/177 (60%), Gaps = 13/177 (7%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAV  418
            G V+G++   GR   K+D+I      NL+  DIK +YN  +N    ++QF S++ +  AV
Sbjct  55   GLVFGKLTGTGRNALKTDVIHFFEGCNLSTTDIKVEYNKAYNPLGMLLQFSSRSSFDMAV  114

Query  419  RAVTPKTTRQG---GLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
            R    +T R+G    L KVDR  W+   SYDGK++LLQGIPRNA  +D+ERFL+GC +D 
Sbjct  115  R----QTVRKGRLYKLEKVDRSHWDFTTSYDGKAVLLQGIPRNALQEDIERFLNGCNFDP  170

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            S    F R   P      + IR+++V+FP+R  A +A   KNR FCLN+ I +R+L 
Sbjct  171  SRFQTFVRQGFP------DPIRVSLVHFPTRIDAMNAICWKNRSFCLNNPITMRVLQ  221



>ref|XP_003558195.1| PREDICTED: uncharacterized protein LOC100843295 [Brachypodium 
distachyon]
Length=231

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 114/180 (63%), Gaps = 17/180 (9%)
 Frame = +2

Query  239  GKVYGRINS---VGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            GK Y  I+    +G+   K+DII  +    L+L+D+K DYN  +   AA+++FPS   ++
Sbjct  63   GKFYSAISGGSRLGKNMLKTDIIHYLDKCELSLDDVKIDYNRGYYPMAALLKFPSIQAFN  122

Query  410  AAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
            AA+R ++     QG L +++RI   +W++ +SYDGK++LLQG+PRNAQ DD+ERFL G  
Sbjct  123  AALRQIS-----QGRLYRLERINRDEWDHKQSYDGKAVLLQGVPRNAQPDDIERFLCGTN  177

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            ++      F R   P      E IRM +V F S+  A++AFI KN+GFCLN+ + +R++H
Sbjct  178  FEPPPFENFIRPGDP------EPIRMVLVKFRSKTDATNAFIAKNKGFCLNNAVTMRVIH  231



>ref|XP_007151527.1| hypothetical protein PHAVU_004G054300g [Phaseolus vulgaris]
 gb|ESW23521.1| hypothetical protein PHAVU_004G054300g [Phaseolus vulgaris]
Length=219

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = +2

Query  224  DFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTD  403
            D + +G  YG++  + +   K+DII    D NLTLED+K DYN +F   + ++QFP++  
Sbjct  45   DVDHSGVTYGKLFGIRKHVLKTDIINFFEDCNLTLEDVKLDYNRSFFPVSTLLQFPTRKS  104

Query  404  YSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQY  583
            Y  A+R V  K  R   L + DR QW+ +K YDGK+IL+QG+ R A  +DV R LSGC++
Sbjct  105  YDNAIRVVVRKG-RLYRLDRADRSQWDIVKPYDGKTILIQGMHRTASHEDVARILSGCEF  163

Query  584  DLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            D S+I++F R+         E I++A V F SR  A +A+I KN  FC N+++ I++L 
Sbjct  164  DSSAINVFLRSGD---WGAAEPIKLATVRFHSRTQAMNAYIAKNGTFCQNNRLSIQVLQ  219



>ref|XP_010086753.1| hypothetical protein L484_005722 [Morus notabilis]
 gb|EXB23432.1| hypothetical protein L484_005722 [Morus notabilis]
Length=220

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 136/249 (55%), Gaps = 35/249 (14%)
 Frame = +2

Query  32   ISKMTSLLRNAAKS---SRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgn  202
            +SK+  L R A +S   +R++ A  G       L +  R F+TE+E          +   
Sbjct  1    MSKLGGLFRPAIRSNLAARTVGASPGGAFSVASLLERPRHFSTESEPHDAAVDSFLRT--  58

Query  203  fpprpIPDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVI  382
                     + +G VYGR+  +   T ++DI+ ++    +TLED+K ++N        ++
Sbjct  59   ---------QSSGSVYGRLTGITANTLRTDIVRLLEGCGVTLEDVKVEHN------RLMV  103

Query  383  QFPSQTDYSAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDD  553
             F     Y+ A R +  K    GG+ K++R    QW+ +K YDGKS+LLQGIPR   + D
Sbjct  104  HFSFLQAYNQAGREINKK----GGIYKLERAGQRQWDLVKPYDGKSVLLQGIPREGTLVD  159

Query  554  VERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLN  733
            +ERFLSGCQYD SSI MF R      I++    ++A V FPS+  A + FITKN+G+CL+
Sbjct  160  IERFLSGCQYDASSIDMFMRAA----IKD----KLATVRFPSQTQAMNCFITKNKGYCLS  211

Query  734  SQIGIRILH  760
            +Q+ +R+L 
Sbjct  212  NQVLVRVLQ  220



>gb|KEH25455.1| ribosomal protein S24e family protein, putative [Medicago truncatula]
Length=222

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 12/177 (7%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAV  418
            G  YGR+  V R   K+DII  +   NLTL+D+K +Y  +F   + ++QFP+ + Y  A+
Sbjct  55   GLTYGRLVGVNRHALKTDIINFLEGCNLTLDDVKMEYTRSFIPISMMVQFPTYSAYDNAI  114

Query  419  RAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
            R +     R+G L K+DRI   QW+ +  YDG++IL++G+PR++Q  D+++ +SG +YD 
Sbjct  115  RVIG----RKGRLYKLDRIDRSQWDIVTPYDGRTILIEGLPRSSQFADLDQIVSGYEYDS  170

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            SS++MF R       E  E ++MA + F SR  A +AFI KN  +CLNS+I I +L 
Sbjct  171  SSVNMFLRAG-----EGNEPVKMATIRFRSRIQAMNAFIAKNGTYCLNSRISIHVLQ  222



>gb|EMT19043.1| hypothetical protein F775_31935 [Aegilops tauschii]
Length=227

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 108/180 (60%), Gaps = 17/180 (9%)
 Frame = +2

Query  239  GKVYGRINSVGRF---TTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            G+ Y  I+ VGR      K+DII  +    L+L+D+K DYN  F    A+++FPS   + 
Sbjct  59   GRFYTNISGVGRLGKNMLKTDIIHYLDQCELSLDDVKIDYNKGFYPMGALLKFPSVESFE  118

Query  410  AAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             AVR      T QG + +++R+   +WE+  S +GK++LLQG+PRNAQ+DD+ERFL G  
Sbjct  119  TAVR-----QTIQGRMYRLERVSPDEWEHKISLNGKAVLLQGVPRNAQVDDIERFLCGTN  173

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            Y+      F R   P      E +RM +V F SR  A++AFI KN+GFCLN+ + +R++ 
Sbjct  174  YEPPPFENFIRAGVP------EPVRMVLVKFGSRTDATNAFIAKNKGFCLNNPVTVRVIQ  227



>ref|XP_007027164.1| Ribosomal protein S24e family protein, putative [Theobroma cacao]
 gb|EOY07666.1| Ribosomal protein S24e family protein, putative [Theobroma cacao]
Length=228

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 133/238 (56%), Gaps = 11/238 (5%)
 Frame = +2

Query  47   SLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            +LLRNA KS  S++     Q L + L  + +RF+T  + P+PP P               
Sbjct  2    NLLRNAIKSHVSVRTIRPMQALPSFLGASPKRFSTGTDEPQPPQPDASVNQFMESAS---  58

Query  227  FEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDY  406
                G V+ +++ + + T KSDI++++   NLT +DIK  Y+ +F     +++F S   +
Sbjct  59   ---KGFVFAKLHGITKHTMKSDIMSLLEGCNLTADDIKVHYSRSFFPLGMMLRFSSPAAF  115

Query  407  SAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYD  586
            S + R +  +  R   L KV+   W+ ++ Y+GK++LL GIPRNA ++DVERFLSGC YD
Sbjct  116  SNSARTIR-RFDRLYRLEKVEASDWDIVRPYNGKTVLLLGIPRNALVEDVERFLSGCDYD  174

Query  587  LSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
             SSI M     +P         R   V FPS+  A +A I+KNR  CLN+Q+ +R+LH
Sbjct  175  PSSIQM-VTVPKP---GTPVPFRFTTVRFPSQIQAMNACISKNRNVCLNNQLSVRVLH  228



>ref|XP_010558298.1| PREDICTED: uncharacterized protein LOC104826994 [Tarenaya hassleriana]
Length=226

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 111/179 (62%), Gaps = 16/179 (9%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNI--TFNGNAAVIQFPSQTDYSA  412
            G VYG++    + T K+DI+ ++   NLT +DIKF Y+    F      ++FPS++ Y  
Sbjct  59   GPVYGKLLGFSKRTLKTDILHLLDGCNLTPDDIKFSYSRGGAFALLGTYVRFPSRSSYDN  118

Query  413  AVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQY  583
            A+R++     ++G L K++R    QW+ L SY+GK ++L GIP NA +DD+ERFLSGC Y
Sbjct  119  ALRSIM----KKGKLYKIERAERAQWDPLPSYEGKVVVLHGIPLNALVDDIERFLSGCDY  174

Query  584  DLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
               S     R   P      + +R+AVV+FPS+  A +AF TKNRGFCLN+Q+ +++L 
Sbjct  175  H-PSFQFVRRGGMP------DPVRVAVVHFPSQTHAMNAFFTKNRGFCLNNQVMMQVLQ  226



>gb|KHN15425.1| hypothetical protein glysoja_044909 [Glycine soja]
Length=225

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 140/246 (57%), Gaps = 27/246 (11%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLG-NQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprp  217
            M+  +R A KS+ S+ A +  + GL  +     R F+TEAE P      +P         
Sbjct  1    MSGAVRAALKSTTSVCALVQRSHGLLPM-----RCFSTEAEQPPLNSTPRPP--------  47

Query  218  IPDFEPN--GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFP  391
             P FE +  G  YG +  V +   K+DII  +   NLTLED+K DY+ +++  + ++QFP
Sbjct  48   -PFFETDHSGLTYGNLLGVRKHALKTDIINFLEGCNLTLEDVKMDYDRSYSLVSTLLQFP  106

Query  392  SQTDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVER  562
            S+  +  AVR +     R+G L K+DR+    W+ +K YDGK+IL+QG+PR    +D+ R
Sbjct  107  SRDSFDNAVRVIL----RKGRLYKLDRVNRHIWDQVKPYDGKTILIQGMPRAGTYEDIGR  162

Query  563  FLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
             LSG ++D SS+++F R   P  +   + I++A V F SR  A +A+I KN  FC N++I
Sbjct  163  ILSGFEFDSSSVNVFLR---PGGVAGADPIKLATVRFNSRTQAMNAYIAKNGTFCQNNRI  219

Query  743  GIRILH  760
             I+++ 
Sbjct  220  WIQVIQ  225



>gb|ABR17290.1| unknown [Picea sitchensis]
Length=261

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 105/186 (56%), Gaps = 13/186 (7%)
 Frame = +2

Query  221  PDFEP-----NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQ  385
            P+ +P      G VY ++   GR T K DI+      NL  ED+KF YN  +     ++Q
Sbjct  83   PNLDPRSKPHGGLVYAKLTGTGRSTLKMDIVHFFEGCNLKPEDMKFAYNRNYAPLGMILQ  142

Query  386  FPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKS-YDGKSILLQGIPRNAQMDDVER  562
            F S+  Y  A R +T    R   + +VDR QW NL+S +DGK +LL G+P+NA  +DVER
Sbjct  143  FSSRAAYGIAQR-LTAIKGRYYRMMEVDRSQWSNLESPFDGKVLLLHGVPQNALPEDVER  201

Query  563  FLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
            F SGC +D SS+  F R          E +R+A+V+F S+  A HA   KNR  CLNS I
Sbjct  202  FFSGCNFDSSSVRFFMRP------GLDEPVRLALVSFRSQREAMHALREKNRNVCLNSPI  255

Query  743  GIRILH  760
             +R+LH
Sbjct  256  TLRLLH  261



>ref|XP_002308495.1| hypothetical protein POPTR_0006s23230g [Populus trichocarpa]
 gb|EEE92018.1| hypothetical protein POPTR_0006s23230g [Populus trichocarpa]
Length=258

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 139/265 (52%), Gaps = 32/265 (12%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M+ LLR   KS+ S+Q+   N  LS  LR +++ F+TE + P PP               
Sbjct  1    MSLLLRKTIKSNSSLQSFKPNNALSLFLRQSTKHFSTETQPPPPPQENNDPSSID-----  55

Query  221  PDFEPNGK--VYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGN--AAVIQF  388
            P  + +     Y R + V + T K+DII +   SNLT +DI   ++  FN N  AA I+F
Sbjct  56   PFLQDSATSLTYARFHGVRKHTLKTDIINLFEGSNLTPDDIIVVHH-RFNNNPYAAAIKF  114

Query  389  PSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENL--KSYDGKSILLQGIPRNAQMDDVER  562
            PS+  Y  A R++T +  R   L K     W+     SYDGK++LL+G+P NA  +D+ER
Sbjct  115  PSRRAYDNAQRSLT-RAGRIYNLEKTPPTVWDAALRNSYDGKTVLLEGLPPNALNEDIER  173

Query  563  FLSGCQYDLSSISMFFRTLQPRFI-------------------ENQEAIRMAVVNFPSRA  685
            FLSGC++  SSI  F +   P                      E ++ IRMA V F +R 
Sbjct  174  FLSGCKFVPSSIRTFVKYPDPVMSAGRKNPTTSAGKQDGTTSEEKRDPIRMATVLFSTRT  233

Query  686  SASHAFITKNRGFCLNSQIGIRILH  760
             A +A I KNRGFCLN+QI +R+LH
Sbjct  234  EAMNALIKKNRGFCLNNQISVRVLH  258



>ref|XP_011019274.1| PREDICTED: uncharacterized protein LOC105122068 [Populus euphratica]
 ref|XP_011019275.1| PREDICTED: uncharacterized protein LOC105122068 [Populus euphratica]
Length=258

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 139/265 (52%), Gaps = 32/265 (12%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpI  220
            M+ LLR   KS+ ++Q+   N  LS LL  +++ F+TE + P PP               
Sbjct  1    MSFLLRKTIKSNSTLQSFKPNNALSLLLSQSAKHFSTETQPPPPPQENNDSSSID-----  55

Query  221  PDFEPNGK--VYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGN--AAVIQF  388
            P  + +     Y R + V + T K+DII +   SNLT +DI   ++  FN N  AA I+F
Sbjct  56   PFLQDSATSLTYARFHGVRKHTLKTDIINLFEGSNLTPDDIIVVHH-RFNNNPYAAAIKF  114

Query  389  PSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENL--KSYDGKSILLQGIPRNAQMDDVER  562
            PS+  Y  A R++T +  R   L K     W+     SYDGK++LL+G+P NA  +D+ER
Sbjct  115  PSRRAYDNAQRSLT-RAGRIYNLEKTPPTVWDAALRNSYDGKTVLLEGLPPNALNEDIER  173

Query  563  FLSGCQYDLSSISMFFRTLQPRFI-------------------ENQEAIRMAVVNFPSRA  685
            FLSGCQ+  SSI  F +   P                      E ++ IRMA V F +R 
Sbjct  174  FLSGCQFVPSSIRTFVKYPDPVMSAGRKNPTTSEGKQDATTSEEKRDPIRMATVLFSTRT  233

Query  686  SASHAFITKNRGFCLNSQIGIRILH  760
             A +A I KNRGFCLN+QI +R+LH
Sbjct  234  EAMNALIKKNRGFCLNNQISVRVLH  258



>gb|ABK24274.1| unknown [Picea sitchensis]
Length=261

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 105/186 (56%), Gaps = 13/186 (7%)
 Frame = +2

Query  221  PDFEPNGK-----VYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQ  385
            P+ +P  K     VY ++   GR T K DI+      NL  ED+KF YN T+     ++Q
Sbjct  83   PNLDPRSKPHGGLVYAKLTGTGRSTLKMDIVHFFEGCNLKPEDMKFAYNRTYAPLGMILQ  142

Query  386  FPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKS-YDGKSILLQGIPRNAQMDDVER  562
            F S+  Y  A R  T    R   + +VDR QW NL+S +D K +LL G+P++A ++DVER
Sbjct  143  FSSRAAYGIAQR-FTAIKGRYYRMMEVDRSQWSNLESPFDEKVLLLHGVPQSALLEDVER  201

Query  563  FLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
            F SGC +D SS+  F R +        E +R A+V+F S+  A HA   KNR  CLNS I
Sbjct  202  FFSGCNFDSSSVRFFIRPVL------DEPVRFALVSFRSQREAMHALREKNRNVCLNSPI  255

Query  743  GIRILH  760
             +R+LH
Sbjct  256  TLRLLH  261



>dbj|BAJ96255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 105/177 (59%), Gaps = 17/177 (10%)
 Frame = +2

Query  248  YGRINSVGRF---TTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAV  418
            Y  I+ VGR      K+DII  +    L+L+D+K DYN  F    A+++FPS   + AA+
Sbjct  18   YTNISGVGRLGKNMLKTDIIHYLDQCELSLDDVKIDYNKGFYPMGALLKFPSVESFEAAL  77

Query  419  RAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
            R      T QG + +++R+    WE+  S +GK++LLQG+PR+AQ DD+ERFL G  Y+ 
Sbjct  78   R-----QTIQGRMYRLERVSPDVWEHKISLNGKAVLLQGVPRSAQADDIERFLCGTNYEP  132

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
                 F R   P      E +RM +V F SR  A++AFI K++GFCLNS + +R++ 
Sbjct  133  PPFENFVRAGVP------EPVRMVLVKFGSRTDATNAFIAKSKGFCLNSPVTMRVIQ  183



>ref|XP_010937755.1| PREDICTED: uncharacterized protein LOC105057021 isoform X4 [Elaeis 
guineensis]
Length=201

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 104/177 (59%), Gaps = 24/177 (14%)
 Frame = +2

Query  233  PN-GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            PN G V+GR+  +GR T K+D+I    + NL+ +D+K +YN  +     ++QFPSQ+ + 
Sbjct  48   PNEGLVFGRLFGIGRNTLKTDVIHFFEECNLSTDDVKVEYNREYYPVGVLLQFPSQSSFD  107

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             AV+    +T R+G L K++R             +LLQGIPRNA  + VERFL GC YD 
Sbjct  108  MAVK----QTIRKGRLYKIER-------------VLLQGIPRNALQEHVERFLHGCNYDP  150

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            S+   F R   P      + IR A+++FP++  A +AF  KNR FCLN+ I +R+L 
Sbjct  151  STFQTFVRPGFP------DPIRFALIHFPTQIDAMNAFCMKNRSFCLNNSITMRVLQ  201



>gb|AAR23805.1| unknown [Helianthus annuus]
Length=225

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 106/172 (62%), Gaps = 10/172 (6%)
 Frame = +2

Query  236  NGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAA  415
            +G VYG+++ + + T KSD+++++ +  L+++D+K DYN ++     + QFPS++ Y  A
Sbjct  61   SGLVYGKLSGITKTTLKSDVLSLLEECKLSVDDLKVDYNPSYTPMGMMXQFPSRSAYDXA  120

Query  416  VRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSS  595
            +RAV  +  R   L + DR  W++++ Y GK +LLQGIP  A ++D+ERFL+GC+YD S 
Sbjct  121  LRAVA-RKGRLYRLERADRAIWDSIQPYGGKYVLLQGIPPXAILEDIERFLAGCEYDPSD  179

Query  596  ISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIR  751
              +F          +  A RMA+  F S  +   A IT +RGF LN+QI I 
Sbjct  180  NRLF---------SSPGASRMALERFVSATATMSATITXHRGFXLNNQIXIH  222



>ref|NP_001144084.1| uncharacterized protein LOC100276917 [Zea mays]
 gb|ACG37801.1| hypothetical protein [Zea mays]
Length=234

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 104/184 (57%), Gaps = 21/184 (11%)
 Frame = +2

Query  239  GKVYGRINSV-------GRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQ  397
            G  YGR  SV        +   K+DII  +    L+L+D+K +YN  +   AA+++F S+
Sbjct  62   GLAYGRFYSVIGGGSRLEKNILKTDIIHHLDRCGLSLDDVKIEYNKGYAPLAALLRFSSK  121

Query  398  TDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVERFL  568
              ++ A+R        Q  L ++D I    W+  KS+DGK++LLQG+PRNA  DD+ERFL
Sbjct  122  AMFTTAIRQAN-----QNRLHRIDEISRETWDLKKSFDGKAVLLQGVPRNALADDIERFL  176

Query  569  SGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGI  748
             G  ++      F R   P      E IRM +V F ++  A +AFITKNR FCLNSQ+ +
Sbjct  177  CGTNFEPPPFETFLRAGVP------EPIRMMLVKFHTKTDAMNAFITKNRSFCLNSQVSM  230

Query  749  RILH  760
            R+L 
Sbjct  231  RVLQ  234



>ref|NP_001288548.1| uncharacterized LOC103639287 [Zea mays]
 gb|ACN33548.1| unknown [Zea mays]
 gb|AFW88768.1| hypothetical protein ZEAMMB73_376296 [Zea mays]
Length=234

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 104/184 (57%), Gaps = 21/184 (11%)
 Frame = +2

Query  239  GKVYGRINSV-------GRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQ  397
            G  YGR  SV        +   K+DII  +    L+L+D+K +YN  +   AA+++F S+
Sbjct  62   GLAYGRFYSVIGGGSRLEKNILKTDIIHHLDRCGLSLDDVKIEYNKGYAPLAALLRFSSK  121

Query  398  TDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVERFL  568
              ++ A+R        Q  L ++D I    W+  KS+DGK++LLQG+PRNA  DD+ERFL
Sbjct  122  AMFTTAIRQAN-----QNRLHRIDEISRETWDLKKSFDGKAVLLQGVPRNALADDIERFL  176

Query  569  SGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGI  748
             G  ++      F R   P      E IRM +V F ++  A +AFITKNR FCLNSQ+ +
Sbjct  177  CGTNFEPPPFETFLRAGVP------EPIRMMLVKFHTKTDAMNAFITKNRSFCLNSQVSM  230

Query  749  RILH  760
            R+L 
Sbjct  231  RVLQ  234



>gb|ACU13973.1| unknown [Glycine max]
Length=248

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 140/261 (54%), Gaps = 25/261 (10%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLG-NQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprp  217
            M+ ++R A +S+ S+ A +  + GL  L     R F+TEAE P       P         
Sbjct  1    MSGVVRAALRSTTSVCALVQRSHGLLPL-----RCFSTEAEQPPLNSTPPPPPFF-----  50

Query  218  IPDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQ  397
              + + +G  YG +  V ++  K+DII  +   NLTLED+K DY+ +F+  + ++QFP++
Sbjct  51   --ETDHSGLTYGNLLGVRKYALKTDIINFLEGCNLTLEDVKMDYDRSFSPVSTLLQFPTR  108

Query  398  TDYSAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFL  568
              +  AV+ +  K    G L K+DR+   QW+ +K YDGK+IL+QG+PR    +D+ R L
Sbjct  109  DSFDHAVKVILKK----GRLYKLDRVNLHQWDQVKPYDGKTILIQGMPRAGTYEDIGRIL  164

Query  569  SGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGI  748
            SG ++D SSIS+F R   P      + I++A V F SR  A +A I K   F   S +  
Sbjct  165  SGFEFDSSSISLFLR---PGGTAGADPIKLATVRFNSRTQAMNACIAKMERFAKQSHLDT  221

Query  749  R--ILH*QLPFYKLLYIIYNV  805
               ++H  L    ++ ++Y V
Sbjct  222  SYPVIHAPLTGASVIVLLYRV  242



>ref|XP_010937754.1| PREDICTED: uncharacterized protein LOC105057021 isoform X3 [Elaeis 
guineensis]
Length=204

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 100/171 (58%), Gaps = 24/171 (14%)
 Frame = +2

Query  233  PN-GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            PN G V+GR+  +GR T K+D+I    + NL+ +D+K +YN  +     ++QFPSQ+ + 
Sbjct  48   PNEGLVFGRLFGIGRNTLKTDVIHFFEECNLSTDDVKVEYNREYYPVGVLLQFPSQSSFD  107

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             AV+    +T R+G L K++R             +LLQGIPRNA  + VERFL GC YD 
Sbjct  108  MAVK----QTIRKGRLYKIER-------------VLLQGIPRNALQEHVERFLHGCNYDP  150

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
            S+   F R   P      + IR A+++FP++  A +AF  KNR FCLN+ I
Sbjct  151  STFQTFVRPGFP------DPIRFALIHFPTQIDAMNAFCMKNRSFCLNNSI  195



>ref|NP_001049749.1| Os03g0282900 [Oryza sativa Japonica Group]
 gb|AAN64476.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF95325.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11663.1| Os03g0282900 [Oryza sativa Japonica Group]
 gb|EAZ26493.1| hypothetical protein OsJ_10385 [Oryza sativa Japonica Group]
 dbj|BAG87769.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95419.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96744.1| unnamed protein product [Oryza sativa Japonica Group]
Length=238

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 109/189 (58%), Gaps = 17/189 (9%)
 Frame = +2

Query  221  PDFEPN--GKVYGRINSV-------GRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNA  373
            P F+P+  G  YGR  SV        +   K+DII  +  S L+L+D+K DYN  +    
Sbjct  58   PFFKPSDEGVAYGRFYSVIPGGSRLPKSMLKTDIIHHLDKSELSLDDVKIDYNRGYYPVG  117

Query  374  AVIQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDD  553
            A+++F S   ++ AVR    +  RQ  L  + R +++  +SYDGK+ILLQG+PRNA  +D
Sbjct  118  ALLRFSSVPLFNTAVRQT--REGRQYRLEMISREEFDLKQSYDGKAILLQGVPRNAVPED  175

Query  554  VERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLN  733
            +ERFL G   +      F R   P      + IR+ +V F SR  A++AFITKNRGFCLN
Sbjct  176  IERFLCGTNVEPPPFESFLRPGVP------DPIRVVLVKFRSRTDAANAFITKNRGFCLN  229

Query  734  SQIGIRILH  760
            + + +R+L 
Sbjct  230  NPVSMRVLQ  238



>ref|XP_004984789.1| PREDICTED: uncharacterized protein LOC101782959 [Setaria italica]
Length=234

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 105/184 (57%), Gaps = 21/184 (11%)
 Frame = +2

Query  239  GKVYGRI-------NSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQ  397
            G  YGR        N + +   K+DI+  +    L+L+D+K DYN  F    A+++FPS+
Sbjct  62   GLAYGRFYSNIGGGNRIEKNMLKTDILHHLDRCGLSLDDVKIDYNRGFTPLGALLRFPSK  121

Query  398  TDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVERFL  568
              ++ A+R      T Q  L K+D I    W+  +S+DGK++LLQG+PRNA  +D+ERFL
Sbjct  122  AAFTTAIR-----QTSQIRLYKMDMISRDVWDLKQSFDGKAVLLQGVPRNALPEDIERFL  176

Query  569  SGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGI  748
             G  ++      F R   P      E I+M +V F ++  A +AFITKN+ FCLN+Q+ +
Sbjct  177  CGTNFEPPPFESFLRPGVP------EPIKMVLVKFRTKTDAMNAFITKNKSFCLNNQVSM  230

Query  749  RILH  760
            R+L 
Sbjct  231  RVLQ  234



>ref|XP_006649878.1| PREDICTED: uncharacterized protein LOC102722940 [Oryza brachyantha]
Length=237

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 108/187 (58%), Gaps = 17/187 (9%)
 Frame = +2

Query  227  FEPN--GKVYGRINS-------VGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAV  379
            F+P+  G  YGR  S       +G+   K+DII  +    L+L+D+K DYN  +    A+
Sbjct  59   FKPSEEGLAYGRFYSSIPGGSRLGKSMLKTDIIHHLDKCELSLDDVKIDYNRGYYPVGAL  118

Query  380  IQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVE  559
            ++F S   ++ AVR    +  R   L  V R +++  +SYDGK+ILLQG+PRNA  +D+E
Sbjct  119  LRFSSVPLFNTAVRQT--RDGRMYRLEMVSREEFDLKQSYDGKAILLQGVPRNALPEDIE  176

Query  560  RFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQ  739
            RFLSG  ++      F R   P      + IR+ +V F SR  A++AFITKNRGFCL + 
Sbjct  177  RFLSGTNFEPPPFQSFLRPGVP------DPIRVVLVKFRSRTDAANAFITKNRGFCLTNP  230

Query  740  IGIRILH  760
            + +R+L 
Sbjct  231  VSMRVLQ  237



>ref|XP_006398727.1| hypothetical protein EUTSA_v10014568mg [Eutrema salsugineum]
 gb|ESQ40180.1| hypothetical protein EUTSA_v10014568mg [Eutrema salsugineum]
Length=234

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 107/180 (59%), Gaps = 17/180 (9%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY--NITFNGNAAVIQFPSQTDYSA  412
            G++YG+ + V + T K+D++ ++   N+T +D+KF Y      N  A  +QFPS++ Y +
Sbjct  66   GRLYGKFSGVSKHTLKTDVMNILEGCNVTPDDLKFSYMRGGNLNPAAVYVQFPSRSSYDS  125

Query  413  AVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLS  592
            A+  +  K  R   L +  R QW+ +  YDGK I L G+PRN  +DD++RFLSGC Y   
Sbjct  126  AMGTIA-KKGRLYRLERATRSQWDPIVPYDGKVIALHGLPRNVVIDDIDRFLSGCLYYPG  184

Query  593  SISMFFRTLQ----PRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            SI   F T+Q    P+        R+A+V F S+  A +A+ITKNR F LN++I +++L 
Sbjct  185  SIQ--FLTIQGLGRPK--------RVALVRFTSQTQAMNAYITKNRNFLLNNRITLQVLQ  234



>ref|XP_010937756.1| PREDICTED: uncharacterized protein LOC105057021 isoform X5 [Elaeis 
guineensis]
Length=181

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 8/131 (6%)
 Frame = +2

Query  233  PN-GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYS  409
            PN G V+GR+  +GR T K+D+I    + NL+ +D+K +YN  +     ++QFPSQ+ + 
Sbjct  48   PNEGLVFGRLFGIGRNTLKTDVIHFFEECNLSTDDVKVEYNREYYPVGVLLQFPSQSSFD  107

Query  410  AAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             AV+    +T R+G L K++R    QW+ ++SYDGK++LLQGIPRNA  + VERFL GC 
Sbjct  108  MAVK----QTIRKGRLYKIERAARSQWDLMRSYDGKAVLLQGIPRNALQEHVERFLHGCN  163

Query  581  YDLSSISMFFR  613
            YD S+   F R
Sbjct  164  YDPSTFQTFVR  174



>ref|XP_002468063.1| hypothetical protein SORBIDRAFT_01g038920 [Sorghum bicolor]
 gb|EER95061.1| hypothetical protein SORBIDRAFT_01g038920 [Sorghum bicolor]
Length=233

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 104/181 (57%), Gaps = 16/181 (9%)
 Frame = +2

Query  239  GKVYGRINSV-------GRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQ  397
            G  YGR  SV        +   K+DII  +    L+L+D+K DYN  ++  AA+++F S+
Sbjct  62   GLAYGRFYSVIGGGNRLEKNMLKTDIIHHLDRCGLSLDDVKIDYNNRYDPLAALLRFSSK  121

Query  398  TDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGC  577
              ++ A R       R   + ++ R  W+  K +D K++LLQG+PRNA ++D+ERFL G 
Sbjct  122  AMFNTANRQTN--LNRLYRIDEISREVWDLKKPFDEKTVLLQGVPRNALLEDIERFLCGT  179

Query  578  QYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRIL  757
             ++      F R   P      E IRM +V F ++A A +AFITKNRGFCLN+Q+ +R+L
Sbjct  180  NFE-PPFESFIRAGVP------EPIRMVLVKFRTKADAMNAFITKNRGFCLNNQVSMRVL  232

Query  758  H  760
             
Sbjct  233  Q  233



>gb|KFK24723.1| hypothetical protein AALP_AA8G016300 [Arabis alpina]
Length=235

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 108/179 (60%), Gaps = 15/179 (8%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY--NITFNGNAAVIQFPSQTDYSA  412
            G  YG+ +   + T K+DI+ +    N+T  ++KF Y      N +A  +QFP+++ Y A
Sbjct  67   GGFYGKFSGFSKHTLKTDIMNVFEGCNVTPNNLKFSYMRGGNLNPSAVYVQFPTRSAYDA  126

Query  413  AVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQY  583
            A+RA++    ++G L K++R    QW+ +  YDGK + L G+P NA ++D++RFLSGC Y
Sbjct  127  ALRAIS----KKGKLYKLERATRSQWDPIVPYDGKVVALHGLPPNALLEDIDRFLSGCLY  182

Query  584  DLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
               SI   F T+Q   I      R+A+V+F S+  A +A+ITKNR F LN +I +++L 
Sbjct  183  YPGSIQ--FITIQGLGIPK----RVALVHFTSQIQAMNAYITKNRKFVLNQRITLQVLQ  235



>ref|XP_009122759.1| PREDICTED: uncharacterized protein LOC103847430 [Brassica rapa]
Length=235

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 108/180 (60%), Gaps = 17/180 (9%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAA--VIQFPSQTDYSA  412
            G++YG+ +   + T +SD++ ++   N+T +D+KF Y    N N A   +QFPS++ Y +
Sbjct  67   GRLYGKFSGFSKHTLRSDVMNILEGCNVTSDDLKFSYMRGGNLNPAGVYVQFPSRSSYDS  126

Query  413  AVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLS  592
            A+RA+  K  R   L +  + QW+ +  Y+GK I L G+P NA ++D++RFLSGC +   
Sbjct  127  AMRAIA-KKGRLYRLERATQSQWDPIVPYEGKVIALHGLPPNAIIEDIDRFLSGCLFHPG  185

Query  593  SISMFFRTLQ----PRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            SI   F T+Q    P+        R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  186  SIQ--FLTIQGLGSPK--------RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  235



>emb|CDY10430.1| BnaCnng03310D [Brassica napus]
Length=236

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 106/179 (59%), Gaps = 17/179 (9%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAA--VIQFPSQTDYSAA  415
            K+YG+ +   + T +SD++ ++   N+T  D+KF Y    N N A   +QFPS++ Y +A
Sbjct  69   KLYGKFSGFSKHTLRSDVMNILEGCNVTSHDLKFSYMRGGNLNPAGVYVQFPSRSSYDSA  128

Query  416  VRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSS  595
            +RA+  K  R   L +  + QW+ +  Y+GK + L G+P NA ++D++RFLSGC Y   S
Sbjct  129  MRAIA-KKGRLYRLERATQSQWDPIVPYEGKVVALHGLPPNAIIEDIDRFLSGCLYHPGS  187

Query  596  ISMFFRTLQ----PRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            I   F T+Q    P+        R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  188  IQ--FLTIQGLGSPK--------RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  236



>gb|KHN19099.1| hypothetical protein glysoja_049295 [Glycine soja]
Length=185

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 112/195 (57%), Gaps = 20/195 (10%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLG-NQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprp  217
            M+ ++R A +S+ S+ A +  + GL  L     R F+TEAE P       P         
Sbjct  1    MSGVVRAALRSTTSVCALVQRSHGLLPL-----RCFSTEAEQPPLNSTPPPPPFF-----  50

Query  218  IPDFEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQ  397
              + + +G  YG +  V ++  K+DII  +   NLTLED+K DY+ +F+  + ++QFP++
Sbjct  51   --ETDHSGLTYGNLLGVRKYALKTDIINFLEGCNLTLEDVKMDYDRSFSPVSTLLQFPTR  108

Query  398  TDYSAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFL  568
              +  AV+ +  K    G L K+DR+   QW+ +K YDGK+IL+QG+PR    +D+ R L
Sbjct  109  DSFDHAVKVILKK----GRLYKLDRVNLHQWDQVKPYDGKTILIQGMPRAGTYEDIGRIL  164

Query  569  SGCQYDLSSISMFFR  613
            SG ++D SSIS+F R
Sbjct  165  SGFEFDSSSISLFLR  179



>emb|CDX70350.1| BnaA10g26990D [Brassica napus]
Length=236

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 107/179 (60%), Gaps = 17/179 (9%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAA--VIQFPSQTDYSAA  415
            ++YG+ +   + T +SD++ ++   N+T +D+KF Y    N N A   +QFPS++ Y +A
Sbjct  69   RLYGKFSGFSKHTLRSDVMNILEGCNVTSDDLKFSYMRGGNLNPAGVYVQFPSRSSYDSA  128

Query  416  VRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSS  595
            +RA+  K  R   L +  + QW+ +  Y+GK I L G+P NA ++D++RFLSGC +   S
Sbjct  129  MRAIA-KKGRLYRLERATQSQWDPIVPYEGKVIALHGLPPNAIIEDIDRFLSGCLFHPGS  187

Query  596  ISMFFRTLQ----PRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            I   F T+Q    P+        R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  188  IQ--FLTIQGLGSPK--------RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  236



>gb|ACU17473.1| unknown [Glycine max]
Length=192

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 119/213 (56%), Gaps = 27/213 (13%)
 Frame = +2

Query  41   MTSLLRNAAKSSRSIQACLG-NQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprp  217
            M+  +R A KS+ S+ A +  + GL  +     R F+TEAE P      +P         
Sbjct  1    MSGAVRAALKSATSVCALVQRSHGLLPM-----RCFSTEAEQPPLNSTPRPP--------  47

Query  218  IPDFEPN--GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFP  391
             P FE +  G  YG +  V +   K+DII  +   NLTLED+K DY+ +++  + ++QFP
Sbjct  48   -PFFETDHSGLTYGNLLGVRKHALKTDIINFLEGCNLTLEDVKMDYDRSYSLVSTLLQFP  106

Query  392  SQTDYSAAVRAVTPKTTRQGGLSKVDRIQ---WENLKSYDGKSILLQGIPRNAQMDDVER  562
            S+  +  AVR +     R+G L K+DR+    W+ +K YDGK+IL+QG+PR    +D+ R
Sbjct  107  SRDSFDNAVRVIL----RKGRLYKLDRVNRHIWDQVKPYDGKTILIQGMPRAGTYEDIGR  162

Query  563  FLSGCQYDLSSISMFFRTLQPRFIENQEAIRMA  661
             LSG ++D SS+++F R   P  +   + I++A
Sbjct  163  ILSGFEFDSSSVNVFLR---PGGVAGADPIKLA  192



>ref|NP_568106.1| ribosomal protein S24e family protein [Arabidopsis thaliana]
 gb|ABK32184.1| At5g02740 [Arabidopsis thaliana]
 gb|AED90512.1| ribosomal protein S24e family protein [Arabidopsis thaliana]
Length=228

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 101/177 (57%), Gaps = 13/177 (7%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDYS  409
            + YG+ +   +   K+DI+ ++   +LT +D+KF+Y    N+T    A  +QFPS + Y 
Sbjct  61   RFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGNLT--PAAVFVQFPSLSAYD  118

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             A+R +  K  +   L K  R QW+ +  Y+GK + L GIP NA  DD++RFLSGC Y  
Sbjct  119  KALRNIA-KKGKLYRLEKAARAQWDPIVPYEGKVVALHGIPVNAITDDIDRFLSGCLYYP  177

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
             SI   F T+Q          R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  178  GSIQ--FLTVQGLGTSK----RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  228



>gb|AAM62949.1| unknown [Arabidopsis thaliana]
Length=228

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY--NITFNGNAAVIQFPSQTDYSAA  415
            + YG+ +   +   K+DI+ ++   +LT +D+KF+Y         A  +QFPS + Y  A
Sbjct  61   RFYGKFSGFSKHALKTDIMNILEGCSLTSDDLKFNYPRGGKLTPAAVFVQFPSLSAYDKA  120

Query  416  VRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSS  595
            +R +  K  +   L K  R QW+ +  Y+GK + L GIP NA  DD++RFLSGC Y   S
Sbjct  121  LRNIA-KKGKLYRLEKAARAQWDPIVPYEGKVVALHGIPVNAITDDIDRFLSGCLYYPGS  179

Query  596  ISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            I   F T+Q          R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  180  IQ--FLTVQGLGTSK----RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  228



>dbj|BAF01313.1| hypothetical protein [Arabidopsis thaliana]
Length=228

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 101/177 (57%), Gaps = 13/177 (7%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDYS  409
            + YG+ +   +   K+DI+ ++   +LT +D+KF+Y    N+T    A  +QFPS + Y 
Sbjct  61   RFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGNLT--PAAVFVQFPSLSAYD  118

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             A+R +  K  +   L K  R QW+ +  Y+GK + L GIP NA  +D++RFLSGC Y  
Sbjct  119  KALRNIA-KKGKLYRLEKAARAQWDPIVPYEGKVVALHGIPVNAITEDIDRFLSGCLYYP  177

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
             SI   F T+Q          R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  178  GSIQ--FLTVQGLGTSK----RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  228



>ref|XP_006288593.1| hypothetical protein CARUB_v10001888mg [Capsella rubella]
 gb|EOA21491.1| hypothetical protein CARUB_v10001888mg [Capsella rubella]
Length=227

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 104/181 (57%), Gaps = 19/181 (10%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDY  406
            G+ YG+ +   +   K+DI+ ++   N+T +D+KF+Y    N+T    A  +QFPS + Y
Sbjct  59   GRFYGKFSGFSKHALKTDIMNVLEGCNVTPDDLKFNYLRGGNLT--PAAVFVQFPSLSAY  116

Query  407  SAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGC  577
               +R +  K    G L +++R    QW+ +  Y+GK + L G+P NA  DD++RFLSGC
Sbjct  117  DRGLRNIAKK----GKLYRLERAARSQWDPIVPYEGKVVALHGLPVNAITDDIDRFLSGC  172

Query  578  QYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRIL  757
             Y   SI   F T+Q        + R+A+V F S+  A +A+ITKNR F LN +I +++L
Sbjct  173  LYYPGSIQ--FLTVQGL----GTSKRVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVL  226

Query  758  H  760
             
Sbjct  227  Q  227



>ref|XP_010452119.1| PREDICTED: uncharacterized protein LOC104734279 [Camelina sativa]
Length=229

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 106/181 (59%), Gaps = 19/181 (10%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDY  406
            G+ YG+ +   + + ++DI+ ++   N+T +D+KF+Y    N+T    A  +QFPS + Y
Sbjct  61   GRFYGKFSGFSKHSLRTDIMNVLEGCNVTPDDLKFNYPRGGNLT--PAAVFVQFPSLSAY  118

Query  407  SAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGC  577
              A+R +  K    G L +++R    QW+ +  ++GK + L G+P NA  DD++RFLSGC
Sbjct  119  DRALRNIAKK----GKLYRLERAARSQWDPIVPFEGKVVALHGLPVNAITDDIDRFLSGC  174

Query  578  QYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRIL  757
             Y   SI   F T+Q        + R+A+V F S+  A +A+ITKNR F LN +I +++L
Sbjct  175  LYYPGSIQ--FLTVQGL----GTSKRVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVL  228

Query  758  H  760
             
Sbjct  229  Q  229



>ref|XP_010490734.1| PREDICTED: uncharacterized protein LOC104768441 [Camelina sativa]
Length=230

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 106/180 (59%), Gaps = 19/180 (11%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDYS  409
            + YG+ +   + + +SDI+ ++   N+T +D+KF+Y    N+T    A  +QFPS + Y 
Sbjct  63   RFYGKFSGFSKHSLRSDIMNVLEGCNVTPDDLKFNYPRGGNLT--PAAVFVQFPSLSAYD  120

Query  410  AAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQ  580
             A+R +     R+G L +++R    QW+ +  ++GK + L G+P NA  DD+++FLSGC 
Sbjct  121  RALRNIA----RKGKLYRLERAARSQWDPIVPFEGKVVALHGLPVNAITDDIDKFLSGCL  176

Query  581  YDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
            Y   SI   F T+Q        + R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  177  YYPGSIQ--FLTIQGL----GTSKRVALVRFTSQTQAMNAYITKNRNFLLNERITLQVLQ  230



>ref|XP_002870986.1| hypothetical protein ARALYDRAFT_487048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47245.1| hypothetical protein ARALYDRAFT_487048 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 101/177 (57%), Gaps = 13/177 (7%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDYS  409
            + YG+ +   +   K+D++ ++   ++T +D+KF+Y    N+T    A  +QFPS + Y 
Sbjct  61   RFYGKFSGFSKHALKTDVMNILEGCSVTSDDLKFNYPRGGNLT--PAAVFVQFPSLSAYD  118

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             A+R +  K  +   L +  R QW+ +  Y+GK + L G+P NA  +D++RFLSGC Y  
Sbjct  119  KALRNIA-KKGKLYRLERAARAQWDPIVPYEGKVVALHGLPVNAITEDIDRFLSGCLYYP  177

Query  590  SSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
             SI   F T+Q          R+A+V F S+  A +A+ITKNR F LN +I +++L 
Sbjct  178  GSIQ--FLTVQGLGTSK----RVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVLQ  228



>ref|XP_010423833.1| PREDICTED: uncharacterized protein LOC104708875 [Camelina sativa]
Length=229

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 105/181 (58%), Gaps = 19/181 (10%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDY  406
            G+ YG+ +   + + ++DI+ ++   N+T +D+KF+Y    N+T    A  +QFPS + Y
Sbjct  61   GRFYGKFSGFSKHSLRTDIMNVLEGCNVTPDDLKFNYPRGGNLT--PAAVFVQFPSLSAY  118

Query  407  SAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKSILLQGIPRNAQMDDVERFLSGC  577
              A+R +  K    G L +++R    QW+ +  ++GK + L G+  NA  +D++RFLSGC
Sbjct  119  DRALRNIAKK----GKLYRLERAARSQWDPIVPFEGKVVALHGLSVNAITEDIDRFLSGC  174

Query  578  QYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRIL  757
             Y   SI   F T+Q        + R+A+V F S+  A +A+ITKNR F LN +I +++L
Sbjct  175  LYYPGSIQ--FLTIQGL----GTSKRVALVRFTSQTQAMNAYITKNRNFLLNQRITLQVL  228

Query  758  H  760
             
Sbjct  229  Q  229



>emb|CAB86028.1| putative protein [Arabidopsis thaliana]
Length=251

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 104/201 (52%), Gaps = 38/201 (19%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAV----------  379
            + YG+ +   +   K+DI+ ++   +LT +D+KF+Y    N+T    AAV          
Sbjct  61   RFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGNLT---PAAVEEFESKLMNF  117

Query  380  --------------IQFPSQTDYSAAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSIL  517
                          +QFPS + Y  A+R +  K  +   L K  R QW+ +  Y+GK + 
Sbjct  118  YPFSFSTMLVYISFVQFPSLSAYDKALRNIA-KKGKLYRLEKAARAQWDPIVPYEGKVVA  176

Query  518  LQGIPRNAQMDDVERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASH  697
            L GIP NA  DD++RFLSGC Y   SI   F T+Q        + R+A+V F S+  A +
Sbjct  177  LHGIPVNAITDDIDRFLSGCLYYPGSIQ--FLTVQGL----GTSKRVALVRFTSQTQAMN  230

Query  698  AFITKNRGFCLNSQIGIRILH  760
            A+ITKNR F LN +I +++L 
Sbjct  231  AYITKNRNFLLNQRITLQVLQ  251



>gb|KDO47503.1| hypothetical protein CISIN_1g0271312mg, partial [Citrus sinensis]
Length=77

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 6/83 (7%)
 Frame = +2

Query  512  ILLQGIPRNAQMDDVERFLSGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASA  691
            +LLQ +PR A  +DVERFLSGC+Y+ SSIS   R   P      ++I+ A V FPS+  A
Sbjct  1    VLLQNVPRIAVAEDVERFLSGCEYEASSISFMLRQSLP------DSIKWATVRFPSQTQA  54

Query  692  SHAFITKNRGFCLNSQIGIRILH  760
              AFI KNRGFCLN+Q+ +R+L 
Sbjct  55   MDAFIRKNRGFCLNNQVSVRVLQ  77



>gb|EEC74993.1| hypothetical protein OsI_11050 [Oryza sativa Indica Group]
Length=295

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 105/244 (43%), Gaps = 70/244 (29%)
 Frame = +2

Query  221  PDFEPN--GKVYGRINSV-------GRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNA  373
            P F+P+  G  YGR  SV        +   K+DII  +  S L+L+D+K DYN  +    
Sbjct  58   PFFKPSDEGVAYGRFYSVIPGGSRLPKSMLKTDIIHHLDKSELSLDDVKIDYNRGYYPVG  117

Query  374  AVIQFPS------------------------------QTDYSAAVRAVTPKT--------  439
            A+++F S                              Q+    A++ +   T        
Sbjct  118  ALLRFSSVPLFNTAVRQTREGRQYRLEMISREEFDLKQSYDGKAIKVIVDVTDSIFSERF  177

Query  440  --TRQGGLSKVDRIQW---------------ENLKSYDGKSILLQGIPRNAQMDDVERFL  568
               ++GG  + D I                   ++  D   ILLQG+PRNA  +D+ERFL
Sbjct  178  EREKRGGCLEADGIVGGRTSIASLNPTETINHTVQLCDSDIILLQGVPRNAVPEDIERFL  237

Query  569  SGCQYDLSSISMFFRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGI  748
             G   +      F R   P      + IR+ +V F SR  A++AFITKNRGFCLN+ + +
Sbjct  238  CGTNVEPPPFESFLRPGVP------DPIRVVLVKFRSRTDAANAFITKNRGFCLNNPVSM  291

Query  749  RILH  760
            R+L 
Sbjct  292  RVLQ  295



>ref|NP_974724.1| ribosomal protein S24e family protein [Arabidopsis thaliana]
 gb|AED90511.1| ribosomal protein S24e family protein [Arabidopsis thaliana]
Length=185

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 7/126 (6%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDY----NITFNGNAAVIQFPSQTDYS  409
            + YG+ +   +   K+DI+ ++   +LT +D+KF+Y    N+T    A  +QFPS + Y 
Sbjct  61   RFYGKFSGFSKHALKTDIMNVLEGCSLTSDDLKFNYPRGGNLT--PAAVFVQFPSLSAYD  118

Query  410  AAVRAVTPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDL  589
             A+R +  K  +   L K  R QW+ +  Y+GK + L GIP NA  DD++RFLSGC Y  
Sbjct  119  KALRNIA-KKGKLYRLEKAARAQWDPIVPYEGKVVALHGIPVNAITDDIDRFLSGCLYYP  177

Query  590  SSISMF  607
             SI   
Sbjct  178  GSIQFL  183



>ref|XP_008349918.1| PREDICTED: uncharacterized protein LOC103413211 [Malus domestica]
Length=142

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 78/171 (46%), Gaps = 38/171 (22%)
 Frame = +2

Query  248  YGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVRAV  427
            YG++  + R T K+D++ M+   NL+LED++ DYN  F     V+QF S   +  A R +
Sbjct  10   YGKLLGISRNTLKTDVVNMLQGYNLSLEDVRVDYNRAFRRMGMVVQFQSWRAFDNAARVI  69

Query  428  TPKTTRQGGLSKVDRIQWENLKSYDGKSILLQGIPRNAQMDDVERFLSGCQYDLSSISMF  607
            + K  R   L + +R QW+NL SYDGK+   +  P                         
Sbjct  70   SRK-GRLYKLERANRSQWDNLTSYDGKNCKSRSFP-------------------------  103

Query  608  FRTLQPRFIENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQIGIRILH  760
                        E+ + A V+  S+  + +A + K +G C N QI +RIL 
Sbjct  104  ------------ESSKFATVHCTSQTESIYALLAKKKGPCQNGQILMRILQ  142



>gb|KDO47504.1| hypothetical protein CISIN_1g0271311mg, partial [Citrus sinensis]
Length=150

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 86/158 (54%), Gaps = 12/158 (8%)
 Frame = +2

Query  47   SLLRNAAKSSRSIQACLGNQGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPD  226
            SLLRNA KSS S++       L +LLR + + F+TE EAP PPPP       F   P   
Sbjct  2    SLLRNAIKSSVSLRTIKPIHSLPSLLRQSPKHFSTETEAPPPPPPNDASIDLFLQTPT--  59

Query  227  FEPNGKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDY  406
                G  YG++  + R T KSDII ++   NLT +D+K +Y   +   A ++QFPS + Y
Sbjct  60   ---KGVFYGKLLGISRQTLKSDIINLLEGCNLTPDDLKVNYTRNYMPFAMMMQFPSFSAY  116

Query  407  SAAVRAVTPKTTRQGGLSKVDRI---QWENLKSYDGKS  511
              A R +     R+G L +++R    +W+ +  Y+GK+
Sbjct  117  DNAFRLI----GRKGRLYRLERAEQSEWDIVMPYNGKT  150



>ref|XP_008353624.1| PREDICTED: uncharacterized protein LOC103417211 isoform X2 [Malus 
domestica]
Length=102

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +2

Query  248  YGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVRAV  427
            YG++    R T K+D++ M+   NL LED+K DYN  F     V+QF S   +  A R +
Sbjct  10   YGKLLGKSRNTLKTDVVNMLEGCNLRLEDVKVDYNQAFTPMGMVVQFQSWRAFDNAARVI  69

Query  428  TPKTTRQGGLSKVDRIQWENLKSYDGKSIL  517
            + K  R   L + +R QW+NL SYDGK++ 
Sbjct  70   SRK-GRLYKLERANRSQWDNLTSYDGKTVF  98



>ref|XP_008353623.1| PREDICTED: uncharacterized protein LOC103417211 isoform X1 [Malus 
domestica]
Length=110

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  248  YGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVRAV  427
            YG++    R T K+D++ M+   NL LED+K DYN  F     V+QF S   +  A R +
Sbjct  10   YGKLLGKSRNTLKTDVVNMLEGCNLRLEDVKVDYNQAFTPMGMVVQFQSWRAFDNAARVI  69

Query  428  TPKTTRQGGLSKVDRIQWENLKSYDGKSILLQ  523
            + K  R   L + +R QW+NL SYDGK++L +
Sbjct  70   SRK-GRLYKLERANRSQWDNLTSYDGKTVLFK  100



>gb|KCW49670.1| hypothetical protein EUGRSUZ_K03186 [Eucalyptus grandis]
Length=169

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 15/126 (12%)
 Frame = +2

Query  104  QGLSTLLRDTSRRFTTEAEAprpppprqpqrgnfpprpIPDFEP--NGKVYGRINSVGRF  277
            +GL +LLRD  R F+TE E P  P               P   P   G VY ++  + R 
Sbjct  27   RGLPSLLRDAPRPFSTEPEQPAQPEDSSAD---------PFLRPPNTGPVYAKLFGMSRH  77

Query  278  TTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVRAVTPKTTRQGGL  457
            T K+DI+ ++   NLT +D++F+YN  F     ++QFPS+  +  A + +     R+G L
Sbjct  78   TLKTDIVNLLEGCNLTPDDVRFNYNRMFVPMGMMVQFPSRFQFDQAFKVI----GRKGRL  133

Query  458  SKVDRI  475
             K++R+
Sbjct  134  YKLERV  139



>ref|XP_002963498.1| hypothetical protein SELMODRAFT_438644 [Selaginella moellendorffii]
 gb|EFJ35369.1| hypothetical protein SELMODRAFT_438644 [Selaginella moellendorffii]
Length=388

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 86/186 (46%), Gaps = 13/186 (7%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVR  421
            K Y +++++ R   K+DI+    + NL  E +   Y+  F    A I F S      AV+
Sbjct  203  KTYAKLHNLPRQILKNDIVNYFSELNLQKESVHMTYDEKFYPLYAHIAFDSTEALKNAVK  262

Query  422  AVTPKTTRQGGLSKVDR-IQW---------ENLKSYDGKSILLQGIPRNAQMDDVERFLS  571
             +  K    G + K++  +Q+         E+L  Y G+ +L+  IP   +++D+ERF  
Sbjct  263  ILQTKGRLGGRIVKMESFVQFMPPTHPQMTEHLNKYLGRMLLMLHIPPEGRIEDLERFFD  322

Query  572  GCQYDLSSISMF--FRTLQPRFI-ENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
            G  +D S++SM    +    RF  E    +R A + F S   A  A   K   F LN  I
Sbjct  323  GYGFDPSALSMLDAVQMTLARFPKEGNRMVRRAAIGFCSSLEAMRALREKQGDFVLNEPI  382

Query  743  GIRILH  760
             +R++ 
Sbjct  383  ELRLIQ  388



>ref|XP_002988209.1| hypothetical protein SELMODRAFT_447264 [Selaginella moellendorffii]
 gb|EFJ10628.1| hypothetical protein SELMODRAFT_447264 [Selaginella moellendorffii]
Length=388

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 13/186 (7%)
 Frame = +2

Query  242  KVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAVR  421
            K Y +++++ R   K+DI+    + NL  + +   Y+  F    A I F S      AV+
Sbjct  203  KTYAKLHNLPRQILKNDIVNYFSELNLQKDSVHMTYDEKFYPLYAHIAFDSTEALKNAVK  262

Query  422  AVTPKTTRQGGLSKVDR-IQW---------ENLKSYDGKSILLQGIPRNAQMDDVERFLS  571
             +  K    G + K++  +Q+         E+L  Y G+ +L+  IP   +++D+ERF  
Sbjct  263  ILQTKGRLGGRIVKMESFVQFMPPTHPQMTEHLNKYLGRMLLMLHIPPEGRIEDLERFFD  322

Query  572  GCQYDLSSISMF--FRTLQPRFI-ENQEAIRMAVVNFPSRASASHAFITKNRGFCLNSQI  742
            G  +D S++SM    +    RF  E    +R A + F S   A  A   K   F LN  I
Sbjct  323  GYGFDPSALSMLDAVQMTLARFPKEGNRMVRRAAIGFCSSLEAMRALREKQGDFVLNEPI  382

Query  743  GIRILH  760
             +R++ 
Sbjct  383  ELRLIQ  388



>ref|XP_008385784.1| PREDICTED: uncharacterized protein LOC103448316 [Malus domestica]
Length=98

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 4/79 (5%)
 Frame = +2

Query  239  GKVYGRINSVGRFTTKSDIIAMIGDSNLTLEDIKFDYNITFNGNAAVIQFPSQTDYSAAV  418
            G  YG++  + R T K+D++ M+    L LED+K DY+  F      +QF S   +  A 
Sbjct  17   GLAYGKLLGISRNTLKTDVVNMLDGYKLRLEDVKVDYSRAFTPMGMEVQFQSWKAFDNAA  76

Query  419  RAVTPKTTRQGGLSKVDRI  475
            R +    +R+GGL K++R+
Sbjct  77   RVI----SRKGGLYKLERV  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2689904046432