BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30938_g1_i1 len=714 path=[692:0-713]

Length=714
                                                                      Score     E

gb|EPS66901.1|  hypothetical protein M569_07876                         201   1e-60   
ref|XP_007027486.1|  Alpha-expansin 3 precursor                         202   6e-60   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        199   4e-59   
gb|AAF17571.1|AF202120_1  alpha-expansin                                195   1e-57   Regnellidium diphyllum
emb|CAN73461.1|  hypothetical protein VITISV_033906                     195   1e-57   Vitis vinifera
ref|XP_002266243.1|  PREDICTED: expansin-A4                             195   1e-57   Vitis vinifera
ref|XP_003609913.1|  Expansin                                           195   2e-57   
emb|CBI30173.3|  unnamed protein product                                196   5e-57   
gb|EYU41589.1|  hypothetical protein MIMGU_mgv1a026815mg                191   4e-56   
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        191   4e-56   
ref|XP_003522084.1|  PREDICTED: expansin-A10                            191   4e-56   
gb|KHN43735.1|  Expansin-A2                                             191   4e-56   
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        191   5e-56   
ref|NP_200443.1|  expansin A14                                          190   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        190   8e-56   
gb|AAM65722.1|  expansin                                                189   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812336.1|  PREDICTED: expansin-A16-like                       191   1e-55   
gb|KHG15821.1|  Expansin-A4 -like protein                               189   2e-55   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       189   2e-55   
dbj|BAC67193.1|  expansin                                               189   3e-55   Pyrus communis
ref|NP_001150534.1|  alpha-expansin 6 precursor                         189   3e-55   Zea mays [maize]
ref|XP_002982383.1|  hypothetical protein SELMODRAFT_421722             188   4e-55   
ref|XP_002966542.1|  hypothetical protein SELMODRAFT_143857             188   5e-55   
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             189   5e-55   
dbj|BAC67194.1|  expansin                                               188   6e-55   Pyrus communis
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      188   7e-55   Gossypium hirsutum [American cotton]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             188   8e-55   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             188   8e-55   
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        188   8e-55   
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        187   9e-55   
emb|CDP15297.1|  unnamed protein product                                193   1e-54   
ref|XP_010558331.1|  PREDICTED: expansin-A9                             187   1e-54   
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       187   1e-54   
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             187   1e-54   
gb|AFB77223.1|  expansin 1                                              187   1e-54   
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       187   2e-54   
ref|XP_002297611.1|  expansin S1 precursor family protein               186   2e-54   Populus trichocarpa [western balsam poplar]
gb|AEU08407.1|  expansin 2                                              187   2e-54   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       187   2e-54   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               186   2e-54   Ricinus communis
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        187   2e-54   
ref|XP_010528418.1|  PREDICTED: expansin-A3                             187   2e-54   
gb|AAP48989.1|  expansin                                                186   2e-54   Sambucus nigra
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    187   2e-54   
ref|XP_010502317.1|  PREDICTED: expansin-A15                            186   2e-54   
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        186   3e-54   
ref|NP_191109.1|  expansin A16                                          186   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       186   3e-54   
gb|ABM54492.1|  expansin 2                                              186   3e-54   Cunninghamia lanceolata [China fir]
ref|XP_010516124.1|  PREDICTED: expansin-A16                            186   3e-54   
gb|ACA05164.1|  expansin 1                                              186   3e-54   Dimocarpus longan [longan]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             186   4e-54   
ref|XP_008464122.1|  PREDICTED: expansin-A4                             186   4e-54   
ref|XP_010490643.1|  PREDICTED: expansin-A9                             186   4e-54   
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       186   4e-54   
ref|XP_010093601.1|  hypothetical protein L484_006489                   186   4e-54   
gb|AFZ78605.1|  expansin protein                                        186   4e-54   
gb|AFK38404.1|  unknown                                                 186   4e-54   
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       186   4e-54   
ref|XP_010256907.1|  PREDICTED: expansin-A4                             186   4e-54   
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       186   5e-54   
ref|XP_009618705.1|  PREDICTED: expansin-A15-like                       185   6e-54   
gb|KHG29956.1|  Expansin-A4 -like protein                               186   6e-54   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             186   6e-54   
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             185   6e-54   
gb|AAK48848.1|AF350939_1  expansin                                      186   6e-54   Prunus cerasus [pie cherry]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    185   6e-54   
ref|XP_002878036.1|  ATEXPA16                                           185   6e-54   
ref|XP_006395739.1|  hypothetical protein EUTSA_v10004804mg             185   8e-54   
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        185   8e-54   
ref|XP_007215892.1|  hypothetical protein PRUPE_ppa010654mg             184   8e-54   
emb|CDP19176.1|  unnamed protein product                                185   9e-54   
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        185   9e-54   
emb|CDY03019.1|  BnaC07g22080D                                          184   9e-54   
ref|XP_008384848.1|  PREDICTED: expansin-A4                             185   9e-54   
ref|XP_004304289.1|  PREDICTED: expansin-A15-like                       184   9e-54   
ref|XP_010507137.1|  PREDICTED: expansin-A23-like                       185   1e-53   
gb|ABO32367.1|  expansin                                                185   1e-53   Litchi chinensis [litchi]
gb|ACF87150.1|  unknown                                                 185   1e-53   Zea mays [maize]
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        185   1e-53   
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        184   1e-53   
emb|CDY24952.1|  BnaC03g22200D                                          184   1e-53   
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        185   1e-53   
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        184   1e-53   
ref|XP_008802710.1|  PREDICTED: expansin-A4                             184   1e-53   
ref|XP_008230781.1|  PREDICTED: expansin-A15                            184   1e-53   
ref|XP_004302749.1|  PREDICTED: expansin-A4-like                        184   1e-53   
ref|XP_009404081.1|  PREDICTED: expansin-A15                            184   2e-53   
emb|CAH18933.1|  expansin                                               184   2e-53   Pyrus communis
ref|XP_010321849.1|  PREDICTED: expansin-A10-like                       184   2e-53   
emb|CDP00351.1|  unnamed protein product                                186   2e-53   
emb|CDY69611.1|  BnaCnng64440D                                          184   2e-53   
ref|NP_001234881.1|  expansin9 precursor                                184   2e-53   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       184   2e-53   
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        184   2e-53   
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        184   2e-53   
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        184   2e-53   
ref|XP_003621257.1|  Alpha-expansin                                     183   2e-53   
dbj|BAE06067.1|  expansin                                               184   2e-53   Sagittaria pygmaea
ref|XP_004300427.1|  PREDICTED: expansin-A4-like                        184   2e-53   
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        184   3e-53   
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        184   3e-53   
gb|AEQ55273.1|  expansin                                                183   3e-53   
emb|CDY71146.1|  BnaCnng71550D                                          183   3e-53   
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        184   3e-53   
ref|XP_003538409.1|  PREDICTED: expansin-A6                             184   3e-53   
gb|ACJ84404.1|  unknown                                                 183   3e-53   Medicago truncatula
ref|XP_010412466.1|  PREDICTED: expansin-A25-like                       184   3e-53   
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        184   3e-53   
ref|NP_001288961.1|  expansin-A4 precursor                              184   3e-53   
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        184   3e-53   
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        184   3e-53   
gb|EPS58017.1|  hypothetical protein M569_16799                         183   3e-53   
gb|ACA05165.1|  expansin 2                                              183   3e-53   Dimocarpus longan [longan]
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          183   4e-53   
ref|XP_002323897.2|  expansin 1 family protein                          183   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             183   4e-53   
emb|CDY04077.1|  BnaC02g37920D                                          183   4e-53   
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         183   4e-53   
ref|XP_010243262.1|  PREDICTED: expansin-A16-like                       184   4e-53   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              183   4e-53   Ricinus communis
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             183   4e-53   
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             183   4e-53   
ref|NP_001288942.1|  expansin-A16 precursor                             183   4e-53   
gb|KHN17924.1|  Expansin-A3                                             184   5e-53   
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        183   5e-53   
emb|CDY44393.1|  BnaA02g29840D                                          182   5e-53   
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        183   5e-53   
gb|AGF90535.1|  alpha-expansin 1                                        182   5e-53   
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        184   5e-53   
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        183   5e-53   
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         183   6e-53   
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     183   6e-53   
emb|CDY40233.1|  BnaA09g35150D                                          183   6e-53   
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               183   6e-53   Ricinus communis
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        182   7e-53   
ref|XP_003613849.1|  Expansin                                           182   7e-53   
dbj|BAH36862.1|  alpha expansin                                         182   7e-53   Rosa hybrid cultivar
ref|XP_009388613.1|  PREDICTED: expansin-A7                             182   7e-53   
emb|CDP09064.1|  unnamed protein product                                182   7e-53   
emb|CDY07024.1|  BnaA04g22910D                                          182   7e-53   
ref|XP_011089478.1|  PREDICTED: expansin-A6                             182   7e-53   
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       184   7e-53   
ref|NP_001266044.1|  expansin-A5-like precursor                         182   7e-53   
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             182   8e-53   
ref|XP_002876856.1|  ATEXPA15                                           182   8e-53   
gb|AAG01874.1|AF291658_1  alpha-expansin 2                              181   8e-53   Striga asiatica [witchweed]
ref|XP_010534508.1|  PREDICTED: expansin-A4                             182   8e-53   
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                182   9e-53   
gb|EYU35820.1|  hypothetical protein MIMGU_mgv1a012373mg                182   9e-53   
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          182   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009129300.1|  PREDICTED: expansin-A23-like                       182   9e-53   
ref|XP_008357089.1|  PREDICTED: expansin-A6                             182   9e-53   
gb|AAC32927.1|  putative expansin                                       182   9e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30766.1|  Expansin-A4 -like protein                               182   1e-52   
emb|CDY45181.1|  BnaA06g33850D                                          182   1e-52   
ref|XP_002870966.1|  ATEXPA9                                            182   1e-52   
ref|XP_010029307.1|  PREDICTED: expansin-A10-like                       182   1e-52   
ref|NP_178409.2|  expansin A15                                          182   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075523.1|  PREDICTED: expansin-A10                            182   1e-52   
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              182   1e-52   Triphysaria versicolor
ref|XP_008387521.1|  PREDICTED: expansin-A9-like                        183   1e-52   
gb|AEQ55281.1|  expansin                                                182   1e-52   
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        182   1e-52   
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        182   1e-52   
gb|ACJ48968.2|  expansin                                                182   1e-52   Breonia chinensis
gb|AAV85475.1|  expansin                                                182   1e-52   Populus tomentosa [Chinese white poplar]
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        183   1e-52   
gb|AGM16361.1|  alpha-expansin protein 19                               182   1e-52   
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        182   1e-52   
ref|XP_009364387.1|  PREDICTED: expansin-A4                             182   1e-52   
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        182   1e-52   
ref|XP_010651411.1|  PREDICTED: expansin-A10                            181   1e-52   
ref|XP_002309061.1|  expansin family protein                            182   1e-52   Populus trichocarpa [western balsam poplar]
ref|NP_001266033.1|  expansin-A15-like precursor                        181   1e-52   
ref|XP_008219462.1|  PREDICTED: expansin-A16-like                       182   1e-52   
ref|XP_002881669.1|  ATEXPA4                                            182   2e-52   
gb|KFK33492.1|  hypothetical protein AALP_AA5G020100                    182   2e-52   
ref|NP_001288907.1|  expansin-A15-like precursor                        181   2e-52   
ref|XP_010505648.1|  PREDICTED: expansin-A4                             182   2e-52   
ref|XP_009380637.1|  PREDICTED: expansin-A4                             182   2e-52   
gb|AFZ78602.1|  expansin protein                                        181   2e-52   
gb|AGF90536.1|  expansin 2                                              181   2e-52   
ref|XP_008461679.1|  PREDICTED: expansin-A4                             182   2e-52   
ref|XP_010937609.1|  PREDICTED: expansin-A4                             182   2e-52   
ref|XP_003621258.1|  Alpha-expansin                                     181   2e-52   
ref|XP_010067412.1|  PREDICTED: expansin-A4                             183   2e-52   
ref|XP_006366709.1|  PREDICTED: expansin-A10-like                       181   2e-52   
ref|XP_008219464.1|  PREDICTED: expansin-A16-like                       182   2e-52   
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             181   2e-52   
gb|ABN09939.1|  expansin A4                                             181   2e-52   Musa acuminata [banana]
gb|KDP31268.1|  hypothetical protein JCGZ_11644                         181   2e-52   
ref|XP_011035781.1|  PREDICTED: expansin-A10                            181   2e-52   
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                182   2e-52   
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        181   2e-52   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        182   2e-52   
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        181   2e-52   
gb|AEQ55280.1|  expansin                                                181   2e-52   
ref|XP_006401349.1|  hypothetical protein EUTSA_v10014463mg             181   2e-52   
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             181   2e-52   
ref|XP_011071693.1|  PREDICTED: expansin-A1-like                        181   2e-52   
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        181   2e-52   
ref|XP_011011315.1|  PREDICTED: expansin-A8-like                        181   2e-52   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             181   2e-52   
ref|NP_001159250.1|  hypothetical protein precursor                     182   2e-52   Zea mays [maize]
gb|AIE54285.1|  expansin                                                181   2e-52   
ref|NP_195846.1|  expansin A9                                           181   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34800.1|  hypothetical protein AALP_AA5G194900                    180   2e-52   
ref|XP_010918818.1|  PREDICTED: expansin-A10-like                       187   3e-52   
ref|NP_001288870.1|  expansin-A14 precursor                             181   3e-52   
ref|NP_001267685.1|  expansin-A16-like                                  181   3e-52   
emb|CDY44070.1|  BnaA02g14340D                                          181   3e-52   
gb|AAR82849.1|  expansin-1                                              181   3e-52   Petunia x hybrida [garden petunia]
gb|AFK34543.1|  unknown                                                 181   3e-52   
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                181   3e-52   
emb|CDX76090.1|  BnaA04g03540D                                          181   3e-52   
emb|CDY07642.1|  BnaA03g18690D                                          181   3e-52   
ref|XP_010678409.1|  PREDICTED: expansin-A23-like                       181   3e-52   
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        181   3e-52   
gb|ABN09940.1|  expansin A5                                             181   3e-52   Musa acuminata [banana]
gb|ACT67493.1|  expansin A1                                             181   3e-52   Raphanus sativus
gb|ACF83087.1|  unknown                                                 181   3e-52   Zea mays [maize]
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        181   3e-52   
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             181   3e-52   
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        181   3e-52   
emb|CDY10456.1|  BnaCnng03570D                                          181   3e-52   
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                181   3e-52   
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        181   4e-52   
gb|ADY68814.1|  expansin                                                181   4e-52   
dbj|BAH36863.1|  alpha expansin                                         180   4e-52   Rosa hybrid cultivar
gb|KEH33311.1|  expansin A10                                            181   4e-52   
gb|KHG20113.1|  Expansin-A4 -like protein                               181   4e-52   
ref|XP_010033123.1|  PREDICTED: expansin-A4                             181   4e-52   
ref|XP_009122794.1|  PREDICTED: expansin-A9                             181   4e-52   
ref|XP_006364587.1|  PREDICTED: expansin-A15-like                       181   4e-52   
ref|XP_011000095.1|  PREDICTED: expansin-A23-like                       180   4e-52   
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        181   4e-52   
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        181   4e-52   
ref|XP_009406842.1|  PREDICTED: expansin-A15-like                       180   4e-52   
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       180   4e-52   
gb|AEN70914.1|  expansin                                                181   4e-52   
gb|AEN70891.1|  expansin                                                181   4e-52   
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    180   4e-52   Cucumis sativus [cucumbers]
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          181   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        180   4e-52   
gb|ADC35365.1|  alpha-expansin 2                                        181   5e-52   Coffea arabica [arabica coffee]
gb|KHG20514.1|  Expansin-A15 -like protein                              181   5e-52   
ref|XP_008459328.1|  PREDICTED: expansin-A5-like                        180   5e-52   
gb|KHG12430.1|  Expansin-A4 -like protein                               181   5e-52   
ref|XP_002313434.1|  alpha-expansin 1 family protein                    181   5e-52   Populus trichocarpa [western balsam poplar]
ref|NP_001288866.1|  expansin-A1 precursor                              180   5e-52   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       181   5e-52   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        180   5e-52   
gb|AFK44569.1|  unknown                                                 181   5e-52   
ref|XP_007226739.1|  hypothetical protein PRUPE_ppa019174mg             180   5e-52   
ref|XP_007227192.1|  hypothetical protein PRUPE_ppa019560mg             181   5e-52   
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        181   5e-52   
ref|XP_008241367.1|  PREDICTED: expansin-A9-like                        181   5e-52   
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        181   5e-52   
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        180   5e-52   
ref|XP_010106493.1|  hypothetical protein L484_025251                   180   5e-52   
ref|XP_007203396.1|  hypothetical protein PRUPE_ppa021118mg             181   5e-52   
gb|KEH22886.1|  expansin-A1-like protein                                180   5e-52   
ref|XP_009389577.1|  PREDICTED: expansin-A10-like                       180   5e-52   
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     179   6e-52   
gb|ABO30976.2|  alpha expansin protein 1                                180   6e-52   Calotropis procera
ref|XP_009765412.1|  PREDICTED: expansin-A10                            180   6e-52   
gb|AAT11859.2|  expansin 1                                              180   6e-52   Mangifera indica
ref|NP_001284471.1|  expansin-A4 precursor                              180   6e-52   
gb|ADY68818.1|  expansin                                                180   6e-52   
emb|CDY20735.1|  BnaA02g08750D                                          180   6e-52   
dbj|BAO57279.1|  alpha-expansin                                         180   6e-52   
gb|AEN70893.1|  expansin                                                180   6e-52   
ref|NP_001148577.1|  LOC100282193 precursor                             181   6e-52   Zea mays [maize]
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        180   7e-52   
gb|ADY68815.1|  expansin                                                180   7e-52   
ref|XP_010528352.1|  PREDICTED: expansin-A5                             180   7e-52   
ref|XP_010937180.1|  PREDICTED: expansin-A10-like                       180   7e-52   
ref|XP_010111142.1|  hypothetical protein L484_010756                   180   7e-52   
ref|XP_011019858.1|  PREDICTED: expansin-A6                             180   7e-52   
gb|AEN70907.1|  expansin                                                180   7e-52   
ref|XP_002283741.1|  PREDICTED: expansin-A10                            179   7e-52   
tpg|DAA48584.1|  TPA: alpha-expansin 3                                  181   7e-52   
emb|CDX80810.1|  BnaC03g00640D                                          180   7e-52   
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             180   7e-52   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             182   7e-52   
emb|CDY64407.1|  BnaC02g47920D                                          179   8e-52   
ref|XP_011035307.1|  PREDICTED: expansin-A6                             180   8e-52   
ref|XP_009760985.1|  PREDICTED: expansin-A10-like                       179   8e-52   
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        180   8e-52   
ref|XP_008241368.1|  PREDICTED: expansin-A9-like                        181   8e-52   
emb|CDY40938.1|  BnaC06g30760D                                          179   8e-52   
emb|CDY02943.1|  BnaC04g25430D                                          180   8e-52   
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    180   8e-52   
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        181   8e-52   
gb|AAR09168.1|  alpha-expansin 1                                        180   8e-52   
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        180   8e-52   
ref|XP_010690765.1|  PREDICTED: expansin-A4                             180   8e-52   
ref|XP_009129104.1|  PREDICTED: expansin-A15                            180   9e-52   
gb|ABN09942.1|  expansin A5                                             179   9e-52   
emb|CDP12277.1|  unnamed protein product                                179   9e-52   
ref|XP_010521846.1|  PREDICTED: expansin-A6                             180   9e-52   
ref|XP_011087233.1|  PREDICTED: expansin-A1-like                        180   9e-52   
gb|ACO07292.1|  expansin 10                                             180   9e-52   
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         180   9e-52   
ref|XP_006366490.1|  PREDICTED: expansin-A6                             180   9e-52   
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             180   9e-52   
emb|CDY20467.1|  BnaC04g05770D                                          180   9e-52   
ref|NP_181500.1|  expansin A4                                           180   1e-51   
ref|XP_002323665.1|  expansin S1 precursor family protein               179   1e-51   
ref|NP_001051731.1|  Os03g0822000                                       180   1e-51   
gb|KHG28809.1|  Expansin-A5 -like protein                               179   1e-51   
ref|NP_001234085.1|  expansin precursor                                 179   1e-51   
gb|ACZ57921.1|  expansin protein 1                                      179   1e-51   
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        179   1e-51   
gb|AAR82850.1|  expansin-2                                              180   1e-51   
ref|XP_008387523.1|  PREDICTED: expansin-A9-like                        180   1e-51   
gb|AFZ78606.1|  expansin protein                                        180   1e-51   
ref|XP_002298353.1|  alpha-expansin 1 family protein                    180   1e-51   
ref|XP_009151773.1|  PREDICTED: expansin-A23-like                       179   1e-51   
gb|AEE69071.1|  expansin-4                                              179   1e-51   
ref|XP_003552064.1|  PREDICTED: expansin-A4                             179   1e-51   
ref|XP_002864447.1|  ATEXPA14                                           179   1e-51   
gb|AFK48363.1|  unknown                                                 179   1e-51   
ref|XP_003607738.1|  Expansin                                           180   1e-51   
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             179   1e-51   
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        179   1e-51   
gb|ABR16833.1|  unknown                                                 179   1e-51   
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       179   1e-51   
emb|CAA59470.1|  orf                                                    179   1e-51   
gb|AEN70901.1|  expansin                                                179   1e-51   
gb|KHN02295.1|  Expansin-A16                                            180   1e-51   
ref|XP_003552173.1|  PREDICTED: expansin-A4                             179   1e-51   
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        179   2e-51   
gb|EPS64820.1|  hypothetical protein M569_09956                         179   2e-51   
ref|NP_001234364.1|  expansin precursor                                 179   2e-51   
gb|AAR88519.1|  expansin A1                                             179   2e-51   
ref|XP_009625406.1|  PREDICTED: expansin-A15-like                       179   2e-51   
ref|XP_009589509.1|  PREDICTED: expansin-A10-like                       179   2e-51   
gb|ABK93541.1|  unknown                                                 179   2e-51   
ref|NP_001240136.1|  expansin-A1-like precursor                         179   2e-51   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    179   2e-51   
ref|XP_010264435.1|  PREDICTED: expansin-A4                             179   2e-51   
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       179   2e-51   
ref|XP_009341067.1|  PREDICTED: expansin-A4-like                        180   2e-51   
gb|ADY68817.1|  expansin                                                179   2e-51   
gb|ACN94264.1|  expansin                                                179   2e-51   
gb|AEN70900.1|  expansin                                                179   2e-51   
gb|AEQ55274.1|  expansin                                                179   2e-51   
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        179   2e-51   
ref|XP_010696099.1|  PREDICTED: putative expansin-A26                   179   2e-51   
gb|KEH30169.1|  expansin A10                                            179   2e-51   
ref|XP_010510558.1|  PREDICTED: expansin-A6                             179   2e-51   
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        179   2e-51   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             178   2e-51   
ref|XP_004249634.1|  PREDICTED: expansin-A3                             179   2e-51   
gb|KHG01029.1|  Expansin-A15 -like protein                              178   3e-51   
ref|XP_001767753.1|  predicted protein                                  178   3e-51   
ref|XP_003553565.1|  PREDICTED: expansin-A16-like                       179   3e-51   
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             179   3e-51   
gb|KDO72599.1|  hypothetical protein CISIN_1g026331mg                   178   3e-51   
ref|NP_001288852.1|  expansin-A3 precursor                              179   3e-51   
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         179   3e-51   
gb|AEQ55275.1|  expansin                                                179   3e-51   
gb|AEQ55290.1|  expansin                                                179   3e-51   
gb|AEQ55270.1|  expansin                                                178   3e-51   
gb|KHG18125.1|  Expansin-A10 -like protein                              178   3e-51   
ref|XP_006482617.1|  PREDICTED: expansin-A5-like                        178   3e-51   
ref|NP_180461.1|  expansin A6                                           178   3e-51   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        178   3e-51   
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        178   3e-51   
ref|NP_001234081.1|  expansin A4 precursor                              179   3e-51   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             178   3e-51   
ref|XP_006431177.1|  hypothetical protein CICLE_v10012611mg             178   3e-51   
gb|ABR04073.1|  expansin 1                                              178   3e-51   
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         178   3e-51   
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       178   3e-51   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  178   3e-51   
emb|CDX74942.1|  BnaA05g06880D                                          178   3e-51   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             178   3e-51   
gb|AIG88581.1|  expansin                                                178   3e-51   
gb|AEN70895.1|  expansin                                                178   4e-51   
gb|AFZ78603.1|  expansin protein                                        178   4e-51   
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        178   4e-51   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       178   4e-51   
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             178   4e-51   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    178   4e-51   
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         178   4e-51   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       178   4e-51   
dbj|BAC67191.1|  expansin                                               178   4e-51   
gb|ABK24904.1|  unknown                                                 178   4e-51   
ref|XP_010066900.1|  PREDICTED: expansin-A1                             178   4e-51   
ref|XP_003616412.1|  Expansin                                           178   4e-51   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       178   4e-51   
ref|XP_002973947.1|  hypothetical protein SELMODRAFT_267720             177   4e-51   
ref|XP_009385244.1|  PREDICTED: expansin-A4-like                        181   4e-51   
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        178   4e-51   
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    178   4e-51   
ref|XP_002881024.1|  ATEXPA6                                            178   5e-51   
ref|NP_001234761.1|  expansin18 precursor                               178   5e-51   
ref|XP_002283358.1|  PREDICTED: expansin-A4                             178   5e-51   
gb|AGR44457.1|  expansin 4                                              177   5e-51   
ref|XP_011034337.1|  PREDICTED: expansin-A10-like                       177   5e-51   
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         177   5e-51   
gb|KDO43109.1|  hypothetical protein CISIN_1g025809mg                   177   5e-51   
ref|XP_004141444.1|  PREDICTED: expansin-A5-like                        177   5e-51   
ref|NP_001242978.1|  expansin-A4-like precursor                         178   6e-51   
ref|NP_181300.1|  expansin-A3                                           178   6e-51   
gb|AFK40565.1|  unknown                                                 177   6e-51   
ref|XP_006350774.1|  PREDICTED: expansin-A6                             178   6e-51   
ref|XP_010527915.1|  PREDICTED: expansin-A15                            177   6e-51   
emb|CDY31742.1|  BnaA04g16780D                                          178   6e-51   
ref|XP_003554526.2|  PREDICTED: expansin-A15-like isoform X1            177   6e-51   
ref|NP_189545.1|  expansin A5                                           177   6e-51   
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        177   6e-51   
ref|XP_002969116.1|  hypothetical protein SELMODRAFT_409954             177   6e-51   
ref|XP_009629442.1|  PREDICTED: expansin-A10-like                       177   6e-51   
ref|NP_001288899.1|  expansin-A6 precursor                              177   6e-51   
ref|XP_007157607.1|  hypothetical protein PHAVU_002G083600g             177   6e-51   
ref|XP_011084824.1|  PREDICTED: expansin-A2-like                        178   6e-51   
ref|XP_010032826.1|  PREDICTED: expansin-A10-like                       177   7e-51   
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        177   7e-51   
ref|XP_006443365.1|  hypothetical protein CICLE_v10021887mg             177   7e-51   
gb|EPS67093.1|  hypothetical protein M569_07682                         177   7e-51   
ref|XP_010517036.1|  PREDICTED: expansin-A3                             177   7e-51   
ref|XP_010093144.1|  hypothetical protein L484_005152                   178   7e-51   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    177   8e-51   
ref|XP_002319704.2|  expansin S1 precursor family protein               177   8e-51   
ref|XP_011025291.1|  PREDICTED: putative expansin-A17                   177   8e-51   
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        177   8e-51   
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             177   8e-51   
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        177   8e-51   
ref|XP_008366663.1|  PREDICTED: expansin-A9-like                        178   9e-51   
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        177   9e-51   
ref|XP_002284858.1|  PREDICTED: expansin-A1                             177   9e-51   
ref|XP_006280986.1|  hypothetical protein CARUB_v10026987mg             177   9e-51   
ref|XP_011094866.1|  PREDICTED: expansin-A6                             177   9e-51   
ref|XP_006341021.1|  PREDICTED: expansin-A3                             177   9e-51   
gb|ABP48816.1|  alpha expansin protein 2                                177   9e-51   
gb|ACK43223.1|  alpha-expansin                                          177   1e-50   
gb|ACA05166.1|  expansin 3                                              177   1e-50   
gb|AAQ08016.1|  expansin                                                177   1e-50   
ref|XP_003616026.1|  Expansin                                           177   1e-50   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        177   1e-50   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        177   1e-50   
ref|XP_002963702.1|  hypothetical protein SELMODRAFT_230202             177   1e-50   
emb|CDP02244.1|  unnamed protein product                                176   1e-50   
ref|XP_003523015.1|  PREDICTED: expansin-A15-like                       177   1e-50   
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        177   1e-50   
gb|KEH39447.1|  expansin A10                                            177   1e-50   
gb|AFZ78601.1|  expansin protein                                        176   1e-50   
ref|XP_003543517.1|  PREDICTED: expansin-A4                             177   1e-50   
gb|KHN18562.1|  Expansin-A15                                            177   1e-50   
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         177   1e-50   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  176   1e-50   
ref|XP_001761996.1|  predicted protein                                  177   1e-50   
ref|XP_002887242.1|  ATEXPA1                                            176   1e-50   
ref|XP_002266625.1|  PREDICTED: expansin-A6                             177   1e-50   
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          176   1e-50   
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             177   1e-50   
ref|XP_006395279.1|  hypothetical protein EUTSA_v10005494mg             177   2e-50   
gb|ABO32366.1|  expansin                                                176   2e-50   
gb|ACK36943.1|  expansin                                                177   2e-50   
gb|KCW83632.1|  hypothetical protein EUGRSUZ_B00524                     176   2e-50   
ref|XP_010536806.1|  PREDICTED: expansin-A14                            176   2e-50   
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        177   2e-50   
ref|XP_008367551.1|  PREDICTED: expansin-A1-like                        176   2e-50   
ref|XP_004517024.1|  PREDICTED: expansin-A15-like                       176   2e-50   
ref|XP_002981865.1|  hypothetical protein SELMODRAFT_179212             177   2e-50   
ref|NP_001266116.1|  expansin-A15-like precursor                        176   2e-50   
gb|AAG13983.1|AF297522_1  expansin 2                                    176   2e-50   
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    176   2e-50   
ref|XP_004143366.1|  PREDICTED: expansin-A3-like                        177   2e-50   
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        176   2e-50   
emb|CDX86367.1|  BnaA06g30840D                                          176   2e-50   
ref|XP_011098644.1|  PREDICTED: expansin-A10                            176   2e-50   
ref|XP_007162798.1|  hypothetical protein PHAVU_001G181600g             177   2e-50   
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             176   2e-50   
ref|XP_010552569.1|  PREDICTED: expansin-A1-like                        176   2e-50   
gb|AAF17570.1|AF202119_1  alpha-expansin                                176   2e-50   
emb|CDX77222.1|  BnaC04g40170D                                          176   2e-50   
ref|XP_002269517.1|  PREDICTED: expansin-A10                            176   2e-50   
gb|AES77638.2|  expansin A10                                            176   2e-50   
ref|XP_010030057.1|  PREDICTED: expansin-A15-like                       176   2e-50   
gb|KHN28805.1|  Expansin-A15                                            176   2e-50   
ref|XP_006600699.1|  PREDICTED: expansin-A15-like isoform X2            176   2e-50   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        176   2e-50   
ref|XP_008393347.1|  PREDICTED: expansin-A1-like                        176   2e-50   
ref|XP_009804397.1|  PREDICTED: expansin-A10                            176   2e-50   
emb|CAN79985.1|  hypothetical protein VITISV_038036                     176   2e-50   
gb|AHZ41241.1|  EXPB1                                                   176   2e-50   
ref|XP_008462508.1|  PREDICTED: expansin-A9-like                        177   2e-50   
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        176   2e-50   
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        176   2e-50   
ref|XP_002875515.1|  predicted protein                                  176   2e-50   
gb|ADN03964.1|  EXP1                                                    176   2e-50   
ref|XP_003549683.2|  PREDICTED: expansin-A15-like isoform X1            176   2e-50   
ref|XP_010430876.1|  PREDICTED: expansin-A23-like                       175   2e-50   
ref|NP_001140501.1|  uncharacterized protein LOC100272562 precursor     177   2e-50   
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          176   3e-50   



>gb|EPS66901.1| hypothetical protein M569_07876, partial [Genlisea aurea]
Length=222

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 134/174 (77%), Gaps = 6/174 (3%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            WKEA AT+YGAP+G  TIGGACG+E+  +  +   TAALS AL+ +A++CG+C+EI+C +
Sbjct  6    WKEAKATFYGAPDGSGTIGGACGYEDDMRDAFGVRTAALSAALFKDAQACGSCYEIRCAQ  65

Query  340  -SEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQ  164
             ++ C++  + V+VT T+ CP S   CS P+ HFD+SQPAF +IA++E GVVPV+YR+V 
Sbjct  66   GNDGCRQPAETVQVTATNLCP-SGGWCSYPNEHFDMSQPAFLQIAKYEAGVVPVQYRRVP  124

Query  163  CKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            CK+ GG++F ITGNPNFNLVT+TNV G GD+ KVEV+   +  W E+KRNWGEK
Sbjct  125  CKKNGGIRFKITGNPNFNLVTITNVGGAGDVTKVEVRTVDLP-WTELKRNWGEK  177



>ref|XP_007027486.1| Alpha-expansin 3 precursor [Theobroma cacao]
 gb|EOY07988.1| Alpha-expansin 3 precursor [Theobroma cacao]
Length=295

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 128/180 (71%), Gaps = 10/180 (6%)
 Frame = -3

Query  511  WKEAHATYYGAPEGTIGGACGFEEY-KQIYSPYTAALSPALYNEAESCGACFEIKCVES-  338
            WK+ HAT+Y    GT GGACG+E+  K  Y   TAALS AL+N  + CGACFEIKCV+S 
Sbjct  66   WKQGHATFYEGGSGTFGGACGYEDVVKMGYGLNTAALSAALFNNGQKCGACFEIKCVDSS  125

Query  337  EFCKKGHKPVEVTVTDSCPAS-------DARCSPPHVHFDLSQPAFHEIAEHEGGVVPVK  179
            E+CK G   + VT TDSCP +          C+PP  HFDL++PAF +IAE++GG+VPV+
Sbjct  126  EWCKPGQPSLIVTATDSCPPNYDLPSDNGGWCNPPRAHFDLAKPAFGQIAEYQGGIVPVQ  185

Query  178  YRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV-KADGVKEWIEMKRNWGEK  2
            YR+V CK++GG++FT+TGNP FNLV+V NV G GD+  V V K D  + WI +KRNWG+K
Sbjct  186  YRRVPCKKQGGIRFTVTGNPYFNLVSVWNVGGAGDVISVHVLKGDNKQTWIPLKRNWGQK  245



>ref|XP_004307494.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=255

 Score =   199 bits (505),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 130/203 (64%), Gaps = 16/203 (8%)
 Frame = -3

Query  565  LLIVLVVALPCVF-----AHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            L IV ++A    F     +H   WK AHAT+YG  +  GT+GGACG+   Y   Y   TA
Sbjct  7    LCIVSLIAFSTAFVVDATSHVGPWKSAHATFYGGGDATGTMGGACGYGNLYSDGYGINTA  66

Query  409  ALSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPH  251
            ALS AL+N   SCGACFE+KCV +++C  G   + VT T+ CP + A+       C+PP 
Sbjct  67   ALSTALFNNGLSCGACFELKCVNTKWCHSGRPSIFVTATNFCPPNWAQANDNGGWCNPPR  126

Query  250  VHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDL  71
             HFDLSQP F +IAE+  G+VPV YR+V C+++GG++F I+GNP FNLV +TNVAG GD+
Sbjct  127  AHFDLSQPIFLKIAEYSAGIVPVAYRRVPCRKRGGMRFKISGNPYFNLVLITNVAGAGDI  186

Query  70   EKVEVKADGVKEWIEMKRNWGEK  2
             KV VK      W+ M RNWG+ 
Sbjct  187  VKVSVKGSKTG-WMPMSRNWGQN  208



>gb|AAF17571.1|AF202120_1 alpha-expansin [Regnellidium diphyllum]
Length=252

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 133/208 (64%), Gaps = 15/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVL-VVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            MA+   LS   VL + +   +    S W +AHAT+YG  +  GT+GGACG+ + Y   Y 
Sbjct  1    MASSATLSWAFVLSLFSFSGLSYGSSGWNDAHATFYGGSDASGTMGGACGYGDLYTSGYG  60

Query  421  PYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----ASD--AR  266
              TAALS AL+N   SCGACF +KC   + +C  G   VEVT T+ CP     ASD    
Sbjct  61   TNTAALSTALFNGGLSCGACFAVKCSGNTRWCLPG--TVEVTATNFCPPNWAEASDNGGW  118

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFD++QPAF +IA++ GG+VPVKYR+V C++KGGV+FTI GNPNFNLV +TNV 
Sbjct  119  CNPPRKHFDMAQPAFEQIAKYRGGIVPVKYRRVPCQKKGGVRFTINGNPNFNLVLLTNVG  178

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+  V +K      WI M RNWG+ 
Sbjct  179  GAGDVVAVSIKGS-RTGWIPMTRNWGQN  205



>emb|CAN73461.1| hypothetical protein VITISV_033906 [Vitis vinifera]
Length=272

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            W  AHAT+YG  +   T+GGACG+ + +KQ Y   TAALS  L+N  ++CGACFEIKCV+
Sbjct  51   WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  110

Query  340  S-EFCKKGHKPVEVTVTDSCPASD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRK  170
              + CK+G   + VT T+ CP S     C+PP  HFDLSQPAF +IAE++ G+VPV+YR+
Sbjct  111  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  170

Query  169  VQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V CK+KGG++FTI+GNP FNLV + NV G GD+  V+VK D   +W  +KRNWG+ 
Sbjct  171  VPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQN  226



>ref|XP_002266243.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=272

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            W  AHAT+YG  +   T+GGACG+ + +KQ Y   TAALS  L+N  ++CGACFEIKCV+
Sbjct  51   WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  110

Query  340  S-EFCKKGHKPVEVTVTDSCPASD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRK  170
              + CK+G   + VT T+ CP S     C+PP  HFDLSQPAF +IAE++ G+VPV+YR+
Sbjct  111  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  170

Query  169  VQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V CK+KGG++FTI+GNP FNLV + NV G GD+  V+VK D   +W  +KRNWG+ 
Sbjct  171  VPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQN  226



>ref|XP_003609913.1| Expansin [Medicago truncatula]
 gb|AES92110.1| expansin A1 [Medicago truncatula]
Length=284

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 128/180 (71%), Gaps = 9/180 (5%)
 Frame = -3

Query  514  EWKEAHATYYGAPEGTIGGACGFEEY-KQIYSPYTAALSPALYNEAESCGACFEIKCVES  338
             WK+AHAT+Y    GT GGACG+E+  K  Y   TAA+S  L+N+  +CGAC+EI+CV+S
Sbjct  60   SWKKAHATFYEGGSGTFGGACGYEDVVKDGYGLDTAAVSTVLFNKGLACGACYEIRCVDS  119

Query  337  -EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPV  182
             + CK G   ++VT TD CP + A+       C+PP  HFDL++PA+ +IAE++ G++PV
Sbjct  120  PQGCKPGQASIKVTATDLCPPNFAQSSENGGWCNPPREHFDLAKPAYLKIAEYKAGIIPV  179

Query  181  KYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +YR+V CKR+GG+ FTITGNP FNL+ V NV G GD+ KV+VK +    W ++KRNWGEK
Sbjct  180  QYRRVPCKRQGGIHFTITGNPYFNLIKVANVGGAGDVVKVQVKGEDKLTWTDLKRNWGEK  239



>emb|CBI30173.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGF-EEYKQIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            W  AHAT+YG  +   T+GGACG+ + +KQ Y   TAALS  L+N  ++CGACFEIKCV+
Sbjct  115  WHNAHATFYGGADASQTMGGACGYGDLHKQGYGVQTAALSTVLFNGGQACGACFEIKCVD  174

Query  340  S-EFCKKGHKPVEVTVTDSCPASD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRK  170
              + CK+G   + VT T+ CP S     C+PP  HFDLSQPAF +IAE++ G+VPV+YR+
Sbjct  175  DPQGCKRGQASLMVTATNLCPPSSNGGWCNPPREHFDLSQPAFLQIAEYKAGIVPVQYRR  234

Query  169  VQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V CK+KGG++FTI+GNP FNLV + NV G GD+  V+VK D   +W  +KRNWG+ 
Sbjct  235  VPCKKKGGIRFTISGNPYFNLVFIWNVGGAGDITSVQVKGDRKLKWTTLKRNWGQN  290



>gb|EYU41589.1| hypothetical protein MIMGU_mgv1a026815mg [Erythranthe guttata]
Length=257

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 142/211 (67%), Gaps = 12/211 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPC-VFAHKSE-----WKEAHATYYGAPEG--TIGGACGFE  443
            + A+   M  S L++LV+  P    +H  +     WK+AHAT+YG  +G  T+GGACG++
Sbjct  1    MAAILQGMLASSLMILVLVGPTSAHSHGPDFKVGPWKDAHATFYGGADGSGTMGGACGYD  60

Query  442  EY-KQIYSPYTAALSPALYNEAESCGACFEIKCVE-SEFCKKG-HKPVEVTVTDSCP-AS  275
            +  K+ Y   T ALS AL+N+ ++CG+C+EI+C + +++CK G    + VT T+ CP   
Sbjct  61   DLVKEGYGFNTTALSSALFNDGKACGSCYEIRCAKGNKWCKPGASSSIFVTATNFCPPGG  120

Query  274  DARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+ P+ HFDLSQPA+ +IAE++ G+VPV+YR+V CK++GGVK TITGNP FNLVTVT
Sbjct  121  TGCCNSPNEHFDLSQPAYLQIAEYKAGIVPVQYRRVPCKKRGGVKLTITGNPYFNLVTVT  180

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NV G GD+  VEV       W ++ RNWG+K
Sbjct  181  NVGGAGDVTNVEVSGGKDLPWTKLSRNWGQK  211



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            ++L +  +   L+LL  +   +P ++A   +W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MALASFVSVALLALLAPVTARIPGLYA-GGQWQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+NE +SCGACFEIKC  + ++C  G   + +T T+ CP + A    
Sbjct  60   QGYGVQTAALSTALFNEGQSCGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSD  119

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDLS P F +IAE+  G+VPV YR+V C+R GG++FTI G   FNLV +
Sbjct  120  DGGWCNPPRPHFDLSMPMFLKIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLVLI  179

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ M RNWG+ 
Sbjct  180  TNVAGAGDIVRASVKGS-RTGWMPMSRNWGQN  210



>ref|XP_003522084.1| PREDICTED: expansin-A10 [Glycine max]
Length=249

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 126/200 (63%), Gaps = 14/200 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            L   + L+V LP V      W  AHAT+YG  +  GT+GGACG+   Y+Q Y   TAALS
Sbjct  9    LPFFLFLLVWLPRV---TCGWTAAHATFYGGADASGTMGGACGYGNLYQQGYGTSTAALS  65

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDA-------RCSPPHVHF  242
             AL+N  ++CGACF++ C  S FC +G  P+ +T T+ CP + +        C+PP +HF
Sbjct  66   AALFNNGQTCGACFQLVCYNSPFCIRGAGPITITATNFCPRNGSFSANGIGWCNPPLMHF  125

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            D+SQPAF +IA +  GVVPV +R+V C ++GG++FTI GNP FNLV V NV G GD++ V
Sbjct  126  DMSQPAFTKIALYRAGVVPVLFRRVVCLKRGGIRFTINGNPYFNLVLVYNVGGLGDVKAV  185

Query  61   EVKADGVKEWIEMKRNWGEK  2
             +K      W  M RNWG+ 
Sbjct  186  SIKGSSTG-WQPMTRNWGQN  204



>gb|KHN43735.1| Expansin-A2 [Glycine soja]
Length=242

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 126/200 (63%), Gaps = 14/200 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            L   + L+V LP V      W  AHAT+YG  +  GT+GGACG+   Y+Q Y   TAALS
Sbjct  2    LPFFLFLLVWLPRV---TCGWTAAHATFYGGADASGTMGGACGYGNLYQQGYGTSTAALS  58

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDA-------RCSPPHVHF  242
             AL+N  ++CGACF++ C  S FC +G  P+ +T T+ CP + +        C+PP +HF
Sbjct  59   AALFNNGQTCGACFQLVCYNSPFCIRGAGPITITATNFCPRNGSFSANGIGWCNPPLMHF  118

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            D+SQPAF +IA +  GVVPV +R+V C ++GG++FTI GNP FNLV V NV G GD++ V
Sbjct  119  DMSQPAFTKIALYRAGVVPVLFRRVVCLKRGGIRFTINGNPYFNLVLVYNVGGLGDVKAV  178

Query  61   EVKADGVKEWIEMKRNWGEK  2
             +K      W  M RNWG+ 
Sbjct  179  SIKGSSTG-WQPMTRNWGQN  197



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 135/210 (64%), Gaps = 13/210 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQI  428
            L+ +A+ M L+  IV+   +P V+     W++AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  7    LLCIASLMALASTIVVEARIPGVYT-GGAWQDAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS AL+N   SCGACFE+KC  + ++CK G   + VT T+ CP + A+     
Sbjct  66   YGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDG  125

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G+  FNLV + N
Sbjct  126  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHN  185

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ KV VK      W+ + RNWG+ 
Sbjct  186  VAGAGDIVKVYVKGTNT-PWMSLSRNWGQN  214



>ref|NP_200443.1| expansin A14 [Arabidopsis thaliana]
 sp|Q9FMA0.1|EXP14_ARATH RecName: Full=Expansin-A14; Short=AtEXPA14; AltName: Full=Alpha-expansin-14; 
Short=At-EXP14; Short=AtEx14; AltName: Full=Ath-ExpAlpha-1.5; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11259.1| expansin [Arabidopsis thaliana]
 dbj|BAF02076.1| Expansin [Arabidopsis thaliana]
 gb|AED96748.1| expansin A14 [Arabidopsis thaliana]
Length=255

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 133/205 (65%), Gaps = 14/205 (7%)
 Frame = -3

Query  583  AEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
             +M +SL +++++    V  + S W  A AT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  5    GKMIISLSLMMMIMWKSVDGYSSGWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNT  64

Query  412  AALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N  +SCGACF+IKCV+  ++C  G   + VT T+ CP + A+       C+P
Sbjct  65   AALSTALFNGGQSCGACFQIKCVDDPKWCIGG--TITVTGTNFCPPNFAQANNAGGWCNP  122

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDL+QP F  IA+++ GVVPV+YR+V C+RKGG++FTI G+  FNLV +TNVAG G
Sbjct  123  PQHHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAG  182

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V +K    + W  M RNWG+ 
Sbjct  183  DVISVSIKGTNTR-WQSMSRNWGQN  206



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 134/210 (64%), Gaps = 13/210 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQI  428
            L+ +A+ M L+  IV+   +P V+     W+ AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  7    LLCIASLMALASTIVVEARIPGVYT-GGAWQGAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS AL+N   SCGACFEIKC  + ++CK G   + VT T+ CP + A+     
Sbjct  66   YGVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNG  125

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G+  FNLV + N
Sbjct  126  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHN  185

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ KV VK      W+ + RNWG+ 
Sbjct  186  VAGAGDIVKVYVKGTNT-PWMSLSRNWGQN  214



>gb|AAM65722.1| expansin [Arabidopsis thaliana]
Length=249

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 131/203 (65%), Gaps = 14/203 (7%)
 Frame = -3

Query  577  MRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAA  407
            M +SL +++++    V  + S W  A AT+YG  +  GT+GGACG+   Y Q Y   TAA
Sbjct  1    MIISLSLIMMIMWKSVDGYSSGWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAA  60

Query  406  LSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPH  251
            LS AL+N  +SCGACF+IKCV   ++C  G   + VT T+ CP + A+       C+PP 
Sbjct  61   LSTALFNGGQSCGACFQIKCVNDPKWCIGG--TITVTGTNFCPPNFAQANNAGGWCNPPQ  118

Query  250  VHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDL  71
             HFDL+QP F  IA+++ GVVPV+YR+V C+RKGG++FTI G+  FNLV +TNVAG GD+
Sbjct  119  HHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDV  178

Query  70   EKVEVKADGVKEWIEMKRNWGEK  2
              V +K    + W  M RNWG+ 
Sbjct  179  ISVSIKGTNTR-WQSMSRNWGQN  200



>ref|XP_008812336.1| PREDICTED: expansin-A16-like [Phoenix dactylifera]
Length=288

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 12/182 (7%)
 Frame = -3

Query  517  SEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKC  347
            S+W  AHAT+YG  +G  T  GACG+++   Q Y   TAALS AL+N+  SCGACFEIKC
Sbjct  60   SQWNFAHATFYGGSDGSDTRAGACGYQDTVSQGYGLQTAALSNALFNDGLSCGACFEIKC  119

Query  346  -VESEFCKKGHKPVEVTVTDSCPAS-------DARCSPPHVHFDLSQPAFHEIAEHEGGV  191
              E+++CK G+  + VT T+ CP +          C+PP VHFDL+QPAF +IAE++ G+
Sbjct  120  HNEAKWCKPGNPSIFVTATNQCPPNYNLPSDNGGWCNPPRVHFDLTQPAFLQIAEYKAGI  179

Query  190  VPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNW  11
            VPV YR+V CKR+GG++FTITGNP FNLV V NVAG GD+  V VK + +  W+ + RNW
Sbjct  180  VPVAYRRVPCKRQGGIRFTITGNPYFNLVLVWNVAGAGDVHNVLVKGNKL-PWVSLTRNW  238

Query  10   GE  5
            G+
Sbjct  239  GQ  240



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 134/215 (62%), Gaps = 15/215 (7%)
 Frame = -3

Query  613  QF*LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
             F LS++  A+   LS L V+   +P VF   + W+ AHAT+YG  +  GT+GGACG+  
Sbjct  7    SFSLSVLCFASL--LSFLAVVNARIPGVFTGGA-WESAHATFYGGSDASGTMGGACGYGN  63

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A 
Sbjct  64   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYAL  123

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNL
Sbjct  124  PNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNL  183

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V VTNVAG GD+ KV+VK      W+ M RNWG+ 
Sbjct  184  VLVTNVAGAGDIVKVKVKGTNT-NWMSMSRNWGQN  217



>ref|XP_010257730.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257731.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257732.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257733.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 130/205 (63%), Gaps = 15/205 (7%)
 Frame = -3

Query  583  AEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            A +RLSL IVL+  L  V  + S W +AH T+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  2    AFLRLSL-IVLLATLKTVHGYGSGWTDAHVTFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N   SCGAC+EIKCV +  +C  G   + VT T+ CP ++A        C+P
Sbjct  61   AALSTALFNNGLSCGACYEIKCVNDPRWCLPG--SIIVTATNFCPPNNALPNNAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F  IA+++ G+VPV+YR+V C++ GG++FTI G+  FNLV +TNV G G
Sbjct  119  PLQHFDLSQPVFQHIAQYKAGIVPVQYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V +K      W  M RNWG+ 
Sbjct  179  DVVAVSIKGS-RTGWQAMSRNWGQN  202



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 132/211 (63%), Gaps = 13/211 (6%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            SL  +     LSL +     +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  3    SLRVLYIAFMLSLFMAANARIPGVYTGGS-WEGAHATFYGGNDASGTMGGACGYGNLYSQ  61

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N   SCGACFEIKC +   +C  G+  + VT T+ CP + A+    
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDD  121

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IAE++ G+VPV YR+V C+++GGV+FTI G   FNLV +T
Sbjct  122  GGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLIT  181

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ +V VK  G   W+ M RNWG+ 
Sbjct  182  NVAGAGDIVRVSVKG-GNTGWMPMSRNWGQN  211



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 129/217 (59%), Gaps = 22/217 (10%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVAL--------PCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
            MAA M   LL+V    +        P V+     W+ AHAT+YG  +  GT+GGACG+  
Sbjct  1    MAAAMPALLLVVATAMMFSPAAARIPGVYGGGG-WQSAHATFYGGSDASGTMGGACGYGN  59

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCVES---EFCKKGHKPVEVTVTDSCPASD  272
             Y Q Y    AALS AL+N+  SCGACFEIKC +     +C+ G   + VT T+ CP + 
Sbjct  60   LYSQGYGVNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNY  119

Query  271  AR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNF  113
            A        C+PP  HFDL+ P F  IAE+  G+VPV YR+V C++ GGV+FTI G   F
Sbjct  120  ALPSDDGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYF  179

Query  112  NLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NLV +TNVAG GD+ +  VKA G  EW+ M RNWG+ 
Sbjct  180  NLVLITNVAGAGDVVRASVKASGAGEWMPMSRNWGQN  216



>ref|XP_002982383.1| hypothetical protein SELMODRAFT_421722 [Selaginella moellendorffii]
 gb|EFJ16628.1| hypothetical protein SELMODRAFT_421722 [Selaginella moellendorffii]
Length=250

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 127/196 (65%), Gaps = 14/196 (7%)
 Frame = -3

Query  559  IVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEEYKQI-YSPYTAALSPALY  389
            ++L VAL    A   +W  AHAT+YG  +  GT+GGACG+       Y   TAALS AL+
Sbjct  13   LLLFVALN--LAAAQQWSNAHATFYGGSDASGTMGGACGYGNVLSAGYGVNTAALSTALF  70

Query  388  NEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQ  230
            N   +CGACF+++CV S +C+ G K V VT T+ CP ++A        C+ P  HFDLSQ
Sbjct  71   NGGATCGACFQMQCVNSRWCRPG-KSVTVTATNFCPPNNALSSDNGGWCNTPREHFDLSQ  129

Query  229  PAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKA  50
            P + ++A ++GG+VPV+YR+V+C ++GG+ FT+ GNPNFNLV + NVAG GDL  V +K 
Sbjct  130  PVWEQMAIYQGGIVPVQYRRVKCYKQGGIIFTMNGNPNFNLVLIKNVAGWGDLRAVSIKG  189

Query  49   DGVKEWIEMKRNWGEK  2
                 W+ MKRNWG  
Sbjct  190  SNTG-WLPMKRNWGSN  204



>ref|XP_002966542.1| hypothetical protein SELMODRAFT_143857 [Selaginella moellendorffii]
 gb|EFJ32569.1| hypothetical protein SELMODRAFT_143857 [Selaginella moellendorffii]
Length=250

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 127/196 (65%), Gaps = 14/196 (7%)
 Frame = -3

Query  559  IVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEEYKQI-YSPYTAALSPALY  389
            ++L VAL    A   +W  AHAT+YG  +  GT+GGACG+       Y   TAALS AL+
Sbjct  13   LLLFVALN--LAAAQQWSNAHATFYGGSDASGTMGGACGYGNVLSAGYGVNTAALSTALF  70

Query  388  NEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQ  230
            N   +CGACF+++CV S +C+ G K V VT T+ CP ++A        C+ P  HFDLSQ
Sbjct  71   NGGATCGACFQMQCVNSRWCRPG-KSVTVTATNFCPPNNALPSDNGGWCNTPREHFDLSQ  129

Query  229  PAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKA  50
            P + ++A ++GG+VPV+YR+V+C ++GG+ FT+ GNPNFNLV + NVAG GDL  V +K 
Sbjct  130  PVWEQMAIYQGGIVPVQYRRVKCYKQGGIIFTMNGNPNFNLVLIKNVAGWGDLRAVSIKG  189

Query  49   DGVKEWIEMKRNWGEK  2
                 W+ MKRNWG  
Sbjct  190  SNTG-WLPMKRNWGSN  204



>ref|XP_006291657.1| hypothetical protein CARUB_v10017813mg, partial [Capsella rubella]
 gb|EOA24555.1| hypothetical protein CARUB_v10017813mg, partial [Capsella rubella]
Length=275

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 134/223 (60%), Gaps = 21/223 (9%)
 Frame = -3

Query  634  LCL*SQKQF*LSLIAMAAEMRLSLLIVLVVALPC-VFAHKSEWKEAHATYYGAPE--GTI  464
            LC  S++ F      M     L +L++   A+ C V  + + W  AHAT+YG  +  GT+
Sbjct  16   LCTFSKRMF------MGKMGLLGILVLCFAAMVCSVHGYDAGWVNAHATFYGGSDASGTM  69

Query  463  GGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTD  290
            GGACG+   Y Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+
Sbjct  70   GGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIIVTATN  127

Query  289  SCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTI  131
             CP ++A        C+PP  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI
Sbjct  128  FCPPNNALPNNAGGWCNPPLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTI  187

Query  130  TGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             G+  FNLV VTNV G GD+  V VK    + W +M RNWG+ 
Sbjct  188  NGHSYFNLVLVTNVGGAGDVHSVAVKGSRTR-WQQMSRNWGQN  229



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 134/210 (64%), Gaps = 13/210 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQI  428
            L+ + + M L+  IV+   +P V+   + W++AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  7    LLCIVSLMALASTIVVDARIPGVYT-GAAWQDAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS AL+N   SCGACFE+KC  + ++CK G   + VT T+ CP + A+     
Sbjct  66   YGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNG  125

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G+  FNLV + N
Sbjct  126  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHN  185

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ K  VK      W+ + RNWG+ 
Sbjct  186  VAGAGDIVKAYVKGTNT-PWMSLSRNWGQN  214



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 133/215 (62%), Gaps = 15/215 (7%)
 Frame = -3

Query  613  QF*LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
             F LS++  A+   LS    +   +P VF   + W+ AHAT+YG  +  GT+GGACG+  
Sbjct  7    SFSLSVLCFASL--LSFFGWVNARIPGVFTGGA-WESAHATFYGGSDASGTMGGACGYGN  63

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALSPAL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A 
Sbjct  64   LYSQGYGVNTAALSPALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYAL  123

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNL
Sbjct  124  PNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNL  183

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V VTNVAG GD+ KV+VK      W+ M RNWG+ 
Sbjct  184  VLVTNVAGAGDIVKVKVKGTNT-NWMSMSRNWGQN  217



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+ A  A + +SL+ V    +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSACLASLLISLMWVAEARIPGVYSGGA-WEAAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV V
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKGSKT-SWMSMSRNWGQN  213



>ref|XP_006291698.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
 gb|EOA24596.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
Length=260

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 133/211 (63%), Gaps = 13/211 (6%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            SLI +       LL +    +P V++  S W  AHAT+YG  +  GT+GGACG+ + Y Q
Sbjct  5    SLILLTIIPLFLLLSLTHAGIPGVYS-GSSWLTAHATFYGGNDASGTMGGACGYGDLYSQ  63

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N  +SCGACFE+KCV + ++C  G   V VT T+ CP + A+    
Sbjct  64   GYGTNTAALSTALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLAQPSDN  123

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IA++  G+VP+ YR+V CK+ GG++FTI G+  FNLV +T
Sbjct  124  GGWCNPPRAHFDLAMPVFLKIAQYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLIT  183

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ K  VK+     W+ + RNWG+ 
Sbjct  184  NVAGAGDIVKASVKSS-KSGWMGLTRNWGQN  213



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 133/210 (63%), Gaps = 13/210 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQI  428
            L+ + + M L+  IV+   +P V+     W++AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  7    LLCIVSLMALASTIVVDARIPGVYT-GGAWQDAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS AL+N   SCGACFE+KC  + ++CK G   + VT T+ CP + A+     
Sbjct  66   YGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNG  125

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G+  FNLV + N
Sbjct  126  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHN  185

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ K  VK      W+ + RNWG+ 
Sbjct  186  VAGAGDIVKAYVKGTNT-PWMSLSRNWGQN  214



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   187 bits (476),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 133/210 (63%), Gaps = 13/210 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQI  428
            L+ + + M L+  IV+   +P V+     W++AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  7    LLCIVSLMALASTIVVDARIPGVYT-GGAWQDAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS AL+N   SCGACFE+KC  + ++CK G   + VT T+ CP + A+     
Sbjct  66   YGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDG  125

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G+  FNLV + N
Sbjct  126  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHN  185

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ K  VK      W+ + RNWG+ 
Sbjct  186  VAGAGDIVKAYVKGTNT-PWMSLSRNWGQN  214



>emb|CDP15297.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 126/181 (70%), Gaps = 11/181 (6%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGFEEYKQI-YSPYTAALSPALYNEAESCGACFEIKCV-  344
            WK AHAT+YG  +G  T+GGACG+ + KQ  Y   TAALS AL+N  ++CGAC+EIKCV 
Sbjct  57   WKSAHATFYGGADGSGTMGGACGYGDLKQEGYGLETAALSQALFNNGQTCGACYEIKCVN  116

Query  343  ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVP  185
            ++++CK G   + VT T++CP + A        C+PP  HFDL+Q AF +IAE++ G+VP
Sbjct  117  DNQWCKPGQPSLFVTATNNCPPNYALSSDNGGWCNPPREHFDLAQAAFLQIAEYQAGIVP  176

Query  184  VKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            V+YR+V C +KGG++FTITGNP F LV V NV G GD+  V VK D    W  M+RNWG+
Sbjct  177  VQYRRVPCAKKGGIRFTITGNPYFTLVLVWNVGGAGDVTSVRVKGDNNVNWTPMQRNWGQ  236

Query  4    K  2
            K
Sbjct  237  K  237


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 80/181 (44%), Gaps = 49/181 (27%)
 Frame = -3

Query  511  WKEAHATYYGAPEGTIGGACGFEEYKQIYSPYTAALSPA--------LYNEAESCGACFE  356
            WK A AT+YG  +G +      ++   I   +   L  A        L+N  ++C     
Sbjct  292  WKNARATFYGGADGYV------DDINYIIYTFPHVLMHARCTMACTVLFNNGQTC-----  340

Query  355  IKCVESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKY  176
                   +CK                    C+PP  HF+LS P F +IA +    +    
Sbjct  341  -------WCK--------------------CNPPREHFELSNPEFLQIAGNFSCTISQVL  373

Query  175  ---RKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
                +V CK++ G+ FTI GNP F LV V NV G GD+ +VEV+      WI +K NWG+
Sbjct  374  SLTMQVPCKKQEGICFTIAGNPYFYLVLVRNVGGAGDVTRVEVQGADKSNWIHLKSNWGQ  433

Query  4    K  2
            K
Sbjct  434  K  434



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 136/213 (64%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            + L+A+   +  S L   V A +P V++    W +AHAT+YG  +  GT+GGACG+   Y
Sbjct  10   MKLVAVVPAVTASFLAAEVDAKIPGVYS-GGPWIDAHATFYGGADASGTMGGACGYGNLY  68

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC++   +C  G+  + +T T+ CP     AS
Sbjct  69   SQGYGVNTAALSTALFNNGLSCGACFELKCIDDPRWCLPGNPSILITATNFCPPNFAQAS  128

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F ++A+++ G+VPV YR+V C++KGG++FTI G   FNLV 
Sbjct  129  DNGGWCNPPREHFDLAMPMFLKLAQYKAGIVPVSYRRVPCRKKGGIRFTINGFKYFNLVL  188

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VTNVAG GD+ KV VK     EWI M RNWG+ 
Sbjct  189  VTNVAGAGDVVKVSVKGTNT-EWITMSRNWGQN  220



>ref|XP_009767600.1| PREDICTED: expansin-A15-like [Nicotiana sylvestris]
Length=248

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVF----AHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            +S+L + +V L C+F     +   W EAHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MSILWISIVGLFCIFNCVDGNDEGWIEAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS A++N   SCGACFEIKCV +S+ C  G   + VT T+ CP + A        C+P
Sbjct  61   AALSTAMFNNGLSCGACFEIKCVGDSKSCIPGS--IVVTATNFCPPNYALPNNAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F +IA +  G+VPV YR+V C++KGG++FT+ G+  FNLV VTNV G G
Sbjct  119  PLHHFDLSQPIFQQIALYRAGIVPVSYRRVPCQKKGGIRFTMNGHSYFNLVLVTNVGGSG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V VK     +WI M RNWG+ 
Sbjct  179  DVNAVSVKGS-RTDWIPMSRNWGQN  202



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 129/204 (63%), Gaps = 13/204 (6%)
 Frame = -3

Query  580  EMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
             + LSL       +P VFA    W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  11   SLALSLFATANAKIPGVFA-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  69

Query  409  ALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPP  254
            ALS AL+N   SCGACFE+KC  + ++C  G+  + +T T+ CP + A+       C+PP
Sbjct  70   ALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPP  129

Query  253  HVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGD  74
              HFDL+ P F ++A++  G+VPV YR+V C+++GG++FTI G   FNLV VTNVAG GD
Sbjct  130  RPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGD  189

Query  73   LEKVEVKADGVKEWIEMKRNWGEK  2
            + +V VK     +W+ M RNWG+ 
Sbjct  190  IVRVSVKGANT-QWLSMSRNWGQN  212



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 130/201 (65%), Gaps = 13/201 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            ++LL ++   +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  13   MALLTLVDAKIPGVYSGGA-WQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  400  PALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVH  245
             AL+N   SCGACFEIKC  E ++C  G   + +T T+ CP + A        C+PP  H
Sbjct  72   TALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPH  131

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNVAG GD+ K
Sbjct  132  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVK  191

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            V VK     EW+ + RNWG+ 
Sbjct  192  VSVKGSKT-EWMSLSRNWGQN  211



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 131/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            SL  +     LS  +V+   +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  8    SLTVLCFASLLSFSVVVNARIPGVYTGGS-WESAHATFYGGSDASGTMGGACGYGNLYSQ  66

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP + A     
Sbjct  67   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDN  126

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IAE+  G+VPV +R+V C+++GG++FTI G   FNLV VT
Sbjct  127  GGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVT  186

Query  94   NVAGGGDLEKVEVKADGVKE-WIEMKRNWGEK  2
            NVAG GD+ KV VK  G K  W+ M RNWG+ 
Sbjct  187  NVAGAGDIVKVSVK--GTKTGWLSMSRNWGQN  216



>ref|XP_002297611.1| expansin S1 precursor family protein [Populus trichocarpa]
 gb|EEE82416.1| expansin S1 precursor family protein [Populus trichocarpa]
Length=247

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 126/198 (64%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            +++L+  L  V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  8    IVILLTMLKIVKGYGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  67

Query  391  YNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N   SCGAC+EIKCV    +C +G   + VT T+ CP ++A        C+PP  HFDL
Sbjct  68   FNNGLSCGACYEIKCVNDNIWCLRG--SITVTATNFCPPNNALPNNDGGWCNPPQQHFDL  125

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F +IA+++ G+VPV+YR+V C++ GG++FTI G+  FNLV +TNV G GD+  V +
Sbjct  126  SQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAVSI  185

Query  55   KADGVKEWIEMKRNWGEK  2
            K      W  M RNWG+ 
Sbjct  186  KGT-KSNWQAMSRNWGQN  202



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+ A  A + +SL+ V    +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSACLASLLISLMWVAEARIPGVYSGGA-WEAAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV V
Sbjct  123  DGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKGSKTG-WMSMSRNWGQN  213



>ref|XP_010504408.1| PREDICTED: expansin-A16-like [Camelina sativa]
Length=260

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 131/202 (65%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            L LL+ L  A +P V++  S W+ AHAT+YG  +  GT+GGACG+ + Y Q Y   TAAL
Sbjct  14   LFLLLSLTDAGIPGVYS-SSSWQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAAL  72

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N  +SCGACFE+KCV + ++C  G   V VT T+ CP + A+       C+PP  
Sbjct  73   STALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRA  132

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IA +  G+VP+ YR+V CK+ GG++FTI G+  FNLV +TNVAG GD+ 
Sbjct  133  HFDLAMPVFLKIAAYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIV  192

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            K  VK      W+ + RNWG+ 
Sbjct  193  KASVKGSKTG-WMSLTRNWGQN  213



>ref|XP_002523388.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
 gb|EEF38967.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
Length=247

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 127/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  580  EMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            E+ +  ++ L+  L  V  + S W  AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  2    ELLIYTIVALLSILRTVEGYGSGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTA  61

Query  409  ALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPP  254
            ALS AL+N   SCGACFEIKCV ++++C  G   + +T T+ CP + A        C+PP
Sbjct  62   ALSTALFNSGLSCGACFEIKCVNDNKWCLPGS--IIITATNFCPPNLALPNNNGGWCNPP  119

Query  253  HVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGD  74
              HFDLSQP F  IA++  G+VPV+YR+V C++ GG++FTI G+  FNLV +TNV G GD
Sbjct  120  QQHFDLSQPVFQRIAQYRAGIVPVQYRRVPCRKTGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  73   LEKVEVKADGVKEWIEMKRNWGEK  2
            +  V +K      W  M RNWG+ 
Sbjct  180  IVAVSIKGSNT-NWQAMSRNWGQN  202



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 128/201 (64%), Gaps = 13/201 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LSL       +P VFA    W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  14   LSLFATANAKIPGVFA-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  72

Query  400  PALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVH  245
             AL+N   SCGACFE+KC  + ++C  G+  + +T T+ CP + A+       C+PP  H
Sbjct  73   TALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPH  132

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDL+ P F ++A++  G+VPV YR+V C+++GG++FTI G   FNLV VTNVAG GD+ +
Sbjct  133  FDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVR  192

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            V VK     +W+ M RNWG+ 
Sbjct  193  VSVKGANT-QWLSMSRNWGQN  212



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 134/219 (61%), Gaps = 20/219 (9%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIV--LVVA-----LPCVFAHKSEWKEAHATYYGAPE--GTIGGAC  452
            ++  A A   RLSL I    +VA     +P V+     W+ AHAT+YG  +  GT+GGAC
Sbjct  1    MAAFAFAITFRLSLAITASFLVASATARIPGVYT-GGPWQSAHATFYGGSDASGTMGGAC  59

Query  451  GFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPA  278
            G+   Y Q Y   TAALS AL+N   SCGACFEIKC E  ++C  G+  + VT T+ CP 
Sbjct  60   GYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPP  119

Query  277  SDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNP  119
            + A+       C+PP  HFDL+ P F +IA++  G+VPV +R+V C++KGG++FTI G  
Sbjct  120  NFAQPSDDGGWCNPPRQHFDLAMPMFLKIAQYRAGIVPVSFRRVPCRKKGGIRFTINGFR  179

Query  118  NFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             FNLV +TNVAG GD+ +  +K      W+ M RNWG+ 
Sbjct  180  YFNLVLITNVAGAGDVVRASIKGSKT-AWMSMSRNWGQN  217



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 131/209 (63%), Gaps = 13/209 (6%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIY  425
            +A  A + +SL  V+   +P  +   + W+ AHAT+YG  +  GT+GGACG+   Y Q Y
Sbjct  3    LACIASLVISLFSVVEARIPGNYGGGA-WESAHATFYGGSDASGTMGGACGYGNLYSQGY  61

Query  424  SPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR------  266
               TAALS AL+N+ ESCGACFEIKC  +  +C  G   + VT T+ CP + A       
Sbjct  62   GVNTAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPNDNGG  121

Query  265  -CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNV  89
             C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GGV+FTI G   FNLV ++NV
Sbjct  122  WCNPPRTHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTINGFRYFNLVLISNV  181

Query  88   AGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            AG GD+ +V VK      W+ M RNWG+ 
Sbjct  182  AGAGDIVRVSVKGS-RTGWMSMSRNWGQN  209



>gb|KFK34799.1| hypothetical protein AALP_AA5G194700 [Arabis alpina]
Length=260

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 132/208 (63%), Gaps = 14/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            +   + L LL+ L  A +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  8    LLTTIPLFLLLSLTEAGIPGVYS-GSSWQTAHATFYGGDDASGTMGGACGYGNLYSQGYG  66

Query  421  PYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   +CGACFEIKCV + ++C  G   V VT T+ CP + A+       
Sbjct  67   TNTAALSTALFNSGLTCGACFEIKCVNDPKWCHSGAPSVFVTATNFCPPNLAQPSDNGGW  126

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDL+ P F +IAE+  G+VP+ YR+V CK+ GG++FTI G+  FNLV +TNVA
Sbjct  127  CNPPRSHFDLAMPIFLKIAEYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITNVA  186

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+ K  VK      W+ + RNWG+ 
Sbjct  187  GAGDIVKTSVKGSKT-SWMSLTRNWGQN  213



>ref|XP_010502317.1| PREDICTED: expansin-A15 [Camelina sativa]
Length=253

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 128/208 (62%), Gaps = 15/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPC-VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            M     L +L++   A+ C V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  3    MGKMGLLGILVLCFAAMVCSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  421  PYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        
Sbjct  63   TNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIVVTATNFCPPNNALPNNAGGW  120

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI G+  FNLV VTNV 
Sbjct  121  CNPPLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVG  180

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+  V VK    + W +M RNWG+ 
Sbjct  181  GAGDVHSVAVKGSRTR-WQQMSRNWGQN  207



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 21/214 (10%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA-------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-  440
            MAA++ L+L+ V+VV        +P V+ +   W  AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAAKV-LTLMAVMVVTALTVNAKIPGVY-NGGPWVNAHATFYGGADASGTMGGACGYGNL  58

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----A  278
            Y Q Y   TAALS AL+N   SCG+CFE+KCV +  +C  G+  + +T T+ CP     A
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQA  118

Query  277  SD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
            SD    C+PP  HFDL+ P F  IA+++ G+VPV YR++ C++KGG++FTI G   FNLV
Sbjct  119  SDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLV  178

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             VTNVAG GD+ KV VK     +W+++ RNWG+ 
Sbjct  179  LVTNVAGAGDVRKVSVKGTNT-QWLDLSRNWGQN  211



>ref|NP_191109.1| expansin A16 [Arabidopsis thaliana]
 sp|Q9M2S9.1|EXP16_ARATH RecName: Full=Expansin-A16; Short=AtEXPA16; AltName: Full=Alpha-expansin-16; 
Short=At-EXP16; Short=AtEx16; AltName: Full=Ath-ExpAlpha-1.7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB75908.1| expansin-like protein [Arabidopsis thaliana]
 dbj|BAD43638.1| expansin-like protein [Arabidopsis thaliana]
 gb|AEE79393.1| expansin A16 [Arabidopsis thaliana]
Length=260

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 131/210 (62%), Gaps = 13/210 (6%)
 Frame = -3

Query  598  LIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQI  428
            LI +       LL      +P VF+  S W+ AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  6    LILLTIFPLFLLLSFTDAGIPRVFSGGS-WQTAHATFYGGNDASGTMGGACGYGNLYSQG  64

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS +L+N  +SCGACFEIKCV + ++C  G+  V VT T+ CP + A+     
Sbjct  65   YGTNTAALSTSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNG  124

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VP+ YR+V C++ GG++FTI G+  FNLV +TN
Sbjct  125  GWCNPPRSHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITN  184

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ +  VK      W+ + RNWG+ 
Sbjct  185  VAGAGDIARTSVKGSKTG-WMSLTRNWGQN  213



>ref|XP_010427324.1| PREDICTED: expansin-A16-like [Camelina sativa]
Length=260

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 132/202 (65%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            L LL+ L  A +P V++  S W+ AHAT+YG  +  GT+GGACG+ + Y Q Y   TAAL
Sbjct  14   LFLLLSLTEAGIPGVYS-GSSWQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAAL  72

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N  +SCGACFE+KCV + ++C  G   V VT T+ CP + A+       C+PP  
Sbjct  73   STALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRA  132

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P+F +IA +  G+VP+ YR+V CK+ GG++FTI G+  FNLV +TNVAG GD+ 
Sbjct  133  HFDLAMPSFLKIAAYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIV  192

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            +  VK      W+ + RNWG+ 
Sbjct  193  RASVKGSKTG-WMSLTRNWGQN  213



>gb|ABM54492.1| expansin 2 [Cunninghamia lanceolata]
Length=258

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 129/211 (61%), Gaps = 19/211 (9%)
 Frame = -3

Query  580  EMRLSLLIVLVVALPCVFAHK-------SEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            EM L  L +LV+   CV + +         W EAHAT+YG  +  GT+GGACG+   Y Q
Sbjct  2    EMGLMYLALLVLVHACVVSGRIPGVFEPGAWTEAHATFYGGSDASGTMGGACGYGNLYSQ  61

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N+  SCGACFEIKCV + E+C  G   + +T T+ CP + A     
Sbjct  62   GYGVQTAALSTALFNDGLSCGACFEIKCVNDPEWCHPGSPSIFITATNFCPPNYALPNDN  121

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDLS P F + AE+  G+VPV +R+V C RKGGV+FTI G   FNLV +T
Sbjct  122  GGWCNPPRPHFDLSMPIFLKFAEYRAGIVPVLHRRVPCVRKGGVRFTINGFRYFNLVLIT  181

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  182  NVAGAGDIVKVSVKG-ARTGWMPMSRNWGQN  211



>ref|XP_010516124.1| PREDICTED: expansin-A16 [Camelina sativa]
Length=260

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 131/202 (65%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            L LL+ L  A +P V++  S W+ AHAT+YG  +  GT+GGACG+ + Y Q Y   TAAL
Sbjct  14   LFLLLSLTDAGIPGVYS-GSSWQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAAL  72

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N  +SCGACFE+KCV + ++C  G   V VT T+ CP + A+       C+PP  
Sbjct  73   STALFNSGQSCGACFEVKCVNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRA  132

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IA +  G+VP+ YR+V CK+ GG++FTI G+  FNLV +TNVAG GD+ 
Sbjct  133  HFDLAMPVFLKIAAYRAGIVPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIV  192

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            K  VK      W+ + RNWG+ 
Sbjct  193  KASVKGSKTG-WMSLTRNWGQN  213



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 128/202 (63%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            LSLL +   A +P V+   S W+  HAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  10   LSLLFLTANAKIPGVYT-GSPWESGHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  68

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   SCGACFE+KCV +  +C  G+  + VT T+ CP + A+       C+PP  
Sbjct  69   STALFNSGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRT  128

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F  IA++  G+VPV YR+V C+++GG++FTI G   FNLV VTNVAG GD+ 
Sbjct  129  HFDLAMPMFFAIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIV  188

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            KV VK      W+ M RNWG+ 
Sbjct  189  KVSVKGSNTG-WLTMSRNWGQN  209



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S  A  A + +SL+ V    +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSASACLASLLISLMWVAEARIPGVYSGGA-WEAAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV V
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKGSKTG-WMSMSRNWGQN  213



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 132/209 (63%), Gaps = 13/209 (6%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIY  425
            I++   + LS  +++   +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y
Sbjct  5    ISLCIALLLSFSLLIDARIPGVYS-GGPWQSAHATFYGGADASGTMGGACGYGNLYSQGY  63

Query  424  SPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR------  266
               TAALS AL+N+ +SCGACFEIKC  +  +C  G   + +T T+ CP + A       
Sbjct  64   GVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGG  123

Query  265  -CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNV  89
             C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNV
Sbjct  124  WCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNV  183

Query  88   AGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            AG GD+ +V VK      W+ + RNWG+ 
Sbjct  184  AGAGDIVRVSVKGT-RTGWMSLTRNWGQN  211



>ref|XP_010490643.1| PREDICTED: expansin-A9 [Camelina sativa]
Length=258

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 137/214 (64%), Gaps = 21/214 (10%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA-------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-  440
            MAA++ L+L+ V+VV        +P V+ +   W  AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAAKV-LTLMAVMVVTAFTVNAKIPGVY-NGGPWTNAHATFYGEADASGTMGGACGYGNL  58

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCP-----A  278
            Y Q Y   TAALS AL+N   SCG+CFE+KCV    +C  G+  + +T T+ CP     A
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQA  118

Query  277  SD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
            SD    C+PP  HFDL+ P F  IA+++ G+VPV YR++ C++KGG++FTI G   FNLV
Sbjct  119  SDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLV  178

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             VTNVAG GD+ KV VK     +W+++ RNWG+ 
Sbjct  179  LVTNVAGAGDVRKVSVKGTNT-QWLDLSRNWGQN  211



>ref|XP_011048141.1| PREDICTED: expansin-A15-like [Populus euphratica]
Length=247

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 126/198 (64%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            +++L+  L  V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  8    IVILLTMLKIVKGYGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  67

Query  391  YNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N   SCGAC+EIKCV    +C +G   + VT T+ CP ++A        C+PP  HFDL
Sbjct  68   FNNGLSCGACYEIKCVNDNIWCLRG--SIIVTATNFCPPNNALPNNDGGWCNPPQQHFDL  125

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F +IA+++ G+VPV+YR+V C++ GG++FTI G+  FNLV +TNV G GD+  V +
Sbjct  126  SQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAVSI  185

Query  55   KADGVKEWIEMKRNWGEK  2
            K      W  M RNWG+ 
Sbjct  186  KGT-KSNWQAMSRNWGQN  202



>ref|XP_010093601.1| hypothetical protein L484_006489 [Morus notabilis]
 gb|EXB54329.1| hypothetical protein L484_006489 [Morus notabilis]
Length=251

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 132/211 (63%), Gaps = 21/211 (10%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPC--VFAHK--SEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            MAA +   ++ ++ +  P   +FAH     W +AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  1    MAANL---VVFIMAIGFPSMGLFAHGYGEGWSDAHATFYGGGDASGTMGGACGYGNLYSQ  57

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N   SCGACFEIKCV + ++C  G   V VT T+ CP ++A     
Sbjct  58   GYGTNTAALSTALFNNGMSCGACFEIKCVSDPKWCLPGS--VVVTATNFCPPNNALPNNA  115

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDLSQP F +IA++  G+VP+ YR+V C+++GG++FTI G+  FNLV +T
Sbjct  116  GGWCNPPQQHFDLSQPVFQQIAQYRAGIVPISYRRVPCRKRGGIRFTINGHSYFNLVLIT  175

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NV G GD+  V +K      W  M RNWG+ 
Sbjct  176  NVGGAGDVHTVSIKGS-RTGWQPMSRNWGQN  205



>gb|AFZ78605.1| expansin protein [Populus tomentosa]
Length=247

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 128/198 (65%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            +++L+  L  V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  8    MVILLTMLKIVKGYGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  67

Query  391  YNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N   SCGAC+EIKCV ++ +C +  + + VT T+ CP ++A        C+PP  HFDL
Sbjct  68   FNNGLSCGACYEIKCVNDNTWCLQ--ESIIVTATNFCPPNNALPNNDGGWCNPPQQHFDL  125

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F +IA+++ G+VPV+YR+V C++ GG++FTI G+  FNLV +TNV G GD+  V +
Sbjct  126  SQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAVSI  185

Query  55   KADGVKEWIEMKRNWGEK  2
            K      W  M RNWG+ 
Sbjct  186  KGT-TSNWQAMSRNWGQN  202



>gb|AFK38404.1| unknown [Lotus japonicus]
Length=248

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 131/205 (64%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCV----FAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            +  L +L+V + CV    +A    W +AHAT+YG  +  GT+GGACG+   Y + Y   T
Sbjct  1    MGFLGLLLVGILCVGSGAYAASDGWMDAHATFYGGGDASGTMGGACGYGNLYSEGYGTET  60

Query  412  AALSPALYNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N   SCGAC+EIKCV  + +C  G   + VT T+ CP ++A        C+P
Sbjct  61   AALSTALFNNGLSCGACYEIKCVSHQKWCLTGS--IMVTATNFCPPNNALPNDAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQPAF +IA+++ G+VPV YR+V C++KGG+ FTI G+  FNLV +TNV G G
Sbjct  119  PLQHFDLSQPAFQQIAQYKAGIVPVAYRRVPCQKKGGISFTINGHSYFNLVLITNVGGSG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D++ V +K     +W  M RNWG+ 
Sbjct  179  DVQAVSIKGS-RTDWQPMSRNWGQN  202



>ref|XP_010425091.1| PREDICTED: expansin-A15-like [Camelina sativa]
Length=253

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 128/208 (62%), Gaps = 15/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPC-VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            M     L +L++   A+ C V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  3    MGKMGLLGILLLCFAAMVCSVRGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  421  PYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        
Sbjct  63   TNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIVVTATNFCPPNNALPNNAGGW  120

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI G+  FNLV VTNV 
Sbjct  121  CNPPLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVG  180

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+  V VK    + W +M RNWG+ 
Sbjct  181  GAGDVHSVAVKGSRTR-WQQMSRNWGQN  207



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 130/207 (63%), Gaps = 13/207 (6%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSP  419
            ++A + +S L ++   +P V+     W+ AHAT+YG  +  GT+GGACG+   Y Q Y  
Sbjct  9    VSAVLLISFLTLVDARIPGVYT-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  418  YTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------C  263
             TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A        C
Sbjct  68   NTAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWC  127

Query  262  SPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAG  83
            +PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNVAG
Sbjct  128  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGIRFTINGFRYFNLVLITNVAG  187

Query  82   GGDLEKVEVKADGVKEWIEMKRNWGEK  2
             GD+ KV VK      W+ M RNWG+ 
Sbjct  188  AGDIVKVSVKGSQTG-WMSMSRNWGQN  213



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 134/208 (64%), Gaps = 14/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            +A  + L+L++V V A +P V++  +EW+ AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  7    VACLVALNLILVAVEARIPGVYS-GAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  65

Query  421  PYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFEIKC  E ++C  G   + VT T+ CP + A        
Sbjct  66   VNTAALSTALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPSDNGGW  125

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNVA
Sbjct  126  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVA  185

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+ K  VK      W+ + RNWG+ 
Sbjct  186  GAGDIVKASVKGSKTG-WMSLSRNWGQN  212



>ref|XP_009618705.1| PREDICTED: expansin-A15-like [Nicotiana tomentosiformis]
Length=248

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 130/205 (63%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVF--AHKSE--WKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            + +L   +V L C+F   H  +  W EAHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MPILWFSIVGLFCIFNCVHGIDEGWIEAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS A++N   SCGACFEIKCV +SE+C  G   + VT T+ CP + A        C+P
Sbjct  61   AALSTAMFNNGLSCGACFEIKCVGDSEWCIPG--SIVVTATNFCPPNYALPNNAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F +IA +  G+VPV YR+V C++KGG++FT+ G+  FNLV VTNV G G
Sbjct  119  PLHHFDLSQPIFQQIAHYRAGIVPVSYRRVGCQKKGGIRFTMNGHSYFNLVLVTNVGGSG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V VK     +WI M RNWG+ 
Sbjct  179  DVNAVSVKGS-RTDWIPMSRNWGQN  202



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 129/212 (61%), Gaps = 15/212 (7%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPCV---FAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYK  434
            +A+     L  LI++  A+      F    EW+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A    
Sbjct  61   QGYGVSTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  180

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ K  VK     EW+ M RNWG+ 
Sbjct  181  TNVAGAGDIVKASVKGSKT-EWMSMSRNWGQN  211



>ref|XP_006403453.1| hypothetical protein EUTSA_v10010989mg, partial [Eutrema salsugineum]
 gb|ESQ44906.1| hypothetical protein EUTSA_v10010989mg, partial [Eutrema salsugineum]
Length=260

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 124/192 (65%), Gaps = 12/192 (6%)
 Frame = -3

Query  544  ALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAES  374
             +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   +
Sbjct  24   GIPGVYS-GSSWQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLT  82

Query  373  CGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFH  218
            CGACFEIKCV + ++C  G   V VT T+ CP + A+       C+PP  HFDL+ P F 
Sbjct  83   CGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFL  142

Query  217  EIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK  38
            +IA++  G+VP+ YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ +  VK     
Sbjct  143  KIAQYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSKSG  202

Query  37   EWIEMKRNWGEK  2
             W+ + RNWG+ 
Sbjct  203  SWMSLTRNWGQN  214



>ref|XP_006391003.1| hypothetical protein EUTSA_v10019043mg [Eutrema salsugineum]
 gb|ESQ28289.1| hypothetical protein EUTSA_v10019043mg [Eutrema salsugineum]
Length=249

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 122/199 (61%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            L+++L V   CV  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  8    LMVILGVMTSCVNGYGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  67

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCGACFEI+C  + ++C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  68   LFNNGLSCGACFEIRCQNDGKWCLPG--SIVVTATNFCPPNNALPNNAGGWCNPPQQHFD  125

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            LSQP F  IA++  G+VPV YR+V C R+GG++FTI G+  FNLV +TNV G GD+    
Sbjct  126  LSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAA  185

Query  58   VKADGVKEWIEMKRNWGEK  2
            VK      W  M RNWG+ 
Sbjct  186  VKGS-RTGWQAMSRNWGQN  203



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+ A  A + +S++ V    +P V+   + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSACLASLLISVMWVAEARIPGVYTGDA-WEAAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV V
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKGSKTG-WMSMSRNWGQN  213



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 132/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            L L+A+A+   L+ L+     +P V++    W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    LRLVALAS--LLAFLVPAAARIPGVYS-SGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N+  SCGACFEIKC +  ++C  G   + +T T+ CP + A    
Sbjct  61   QGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV +
Sbjct  121  DGGWCNPPXPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLI  180

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ M RNWG+ 
Sbjct  181  TNVAGAGDIVRASVKGS-RTGWMPMSRNWGQN  211



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 128/199 (64%), Gaps = 13/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL      +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  17   LLSFTDAGIPGVYSGGS-WQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTA  75

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N  +SCGACFEIKCV + ++C  G+  V VT T+ CP + A+       C+PP  HFD
Sbjct  76   LFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFD  135

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            L+ P F +IAE+  G+VP+ YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ +  
Sbjct  136  LAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDILRTS  195

Query  58   VKADGVKEWIEMKRNWGEK  2
            VK      W+ + RNWG+ 
Sbjct  196  VKGSKTG-WMSLTRNWGQN  213



>ref|XP_006395739.1| hypothetical protein EUTSA_v10004804mg [Eutrema salsugineum]
 gb|ESQ33025.1| hypothetical protein EUTSA_v10004804mg [Eutrema salsugineum]
Length=253

 Score =   185 bits (469),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 128/208 (62%), Gaps = 15/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPC-VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            M     L + ++ + A+ C V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  3    MGKMALLGIFMMGLSAMVCSVHGYDASWVNAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  421  PYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFEI+C  +  +C  G   + VT T+ CP ++A        
Sbjct  63   TNTAALSTALFNNGLSCGACFEIRCQSDGAWCLPG--AIVVTATNFCPPNNALPNNAGGW  120

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI G+  FNLV VTNV 
Sbjct  121  CNPPLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVG  180

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+  V VK    + W +M RNWG+ 
Sbjct  181  GAGDVHSVAVKGSRTR-WQQMSRNWGQN  207



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 134/215 (62%), Gaps = 16/215 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
            ++    AA + ++LL  L +    +P V+     W++AHAT+YG  +  GT+GGACG+  
Sbjct  1    MAFFRNAATLAMTLLAFLTLGDARIPGVYT-GGPWQQAHATFYGGSDASGTMGGACGYGN  59

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS AL+N+ +SCGACFEIKC E  ++C  G   + +T T+ CP + A 
Sbjct  60   LYSQGYGVETAALSTALFNDGQSCGACFEIKCGEDLKWCHHGSPSIFITATNFCPPNYAL  119

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNL  179

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V VTNVAG GD+ ++ VK      W+ M RNWG+ 
Sbjct  180  VLVTNVAGAGDIVRLSVKGS-RTGWMPMSRNWGQN  213



>ref|XP_007215892.1| hypothetical protein PRUPE_ppa010654mg [Prunus persica]
 gb|EMJ17091.1| hypothetical protein PRUPE_ppa010654mg [Prunus persica]
Length=241

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 122/192 (64%), Gaps = 8/192 (4%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL+  +  +  V  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    LLLGFLSVVSSVNGYYGGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFH  218
            L+N   SCGAC+EI+CV + ++C  G   + VT T+ CP     C PP  HFDLSQP F 
Sbjct  67   LFNNGLSCGACYEIRCVNDPQWCLPG--TIVVTATNFCPPG-GWCDPPQQHFDLSQPVFL  123

Query  217  EIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK  38
             IA++  GVVPV YR+V+CKR+GG++FT+ G+  FNLV VTNV G GD++ V +K    +
Sbjct  124  HIAQYRAGVVPVSYRRVRCKRRGGIRFTVNGHSYFNLVLVTNVGGAGDVQSVAIKGSRTR  183

Query  37   EWIEMKRNWGEK  2
             W  M RNWG+ 
Sbjct  184  -WQLMSRNWGQN  194



>emb|CDP19176.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   185 bits (469),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 128/204 (63%), Gaps = 14/204 (7%)
 Frame = -3

Query  580  EMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
             +++ LLI   V       + S W  AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  3    SIQVFLLISTFVLKTVHSLNPSAWSAAHATFYGGNDASGTMGGACGYGNLYSQGYGTSTA  62

Query  409  ALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPP  254
            ALS AL+N  ++CGACFEIKCV + ++C  G   + VT T+ CP ++A        C+PP
Sbjct  63   ALSTALFNNGQACGACFEIKCVNAGKWCLSGS--IMVTATNFCPPNNALPNNDGGWCNPP  120

Query  253  HVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGD  74
              HFDLSQP F  IA++E G+VPV+YR+V C++ GG++FTI G+  FNLV VTNV G GD
Sbjct  121  LKHFDLSQPIFQRIAQYEAGIVPVQYRRVPCRKSGGIRFTINGHSYFNLVLVTNVGGAGD  180

Query  73   LEKVEVKADGVKEWIEMKRNWGEK  2
            +  + +K      WI M RNWG+ 
Sbjct  181  VVSLSIKGT-RTGWIAMSRNWGQN  203



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 133/215 (62%), Gaps = 16/215 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
            ++    AA + +SLL  L +A   +P V+A   +W+ AHAT+YG  +  GT+GGACG+  
Sbjct  1    MAFFHGAATIAVSLLAFLTLADARIPGVYA-GGQWQTAHATFYGGSDASGTMGGACGYGN  59

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS AL+NE  SCGACFEIKC +   +C  G   + +T T+ CP + A 
Sbjct  60   LYSQGYGVETAALSTALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYAL  119

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IA++  G+VPV YR+V C++ GG++FTI G   FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNL  179

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V +TNVA  GD+ +V VK      W+ M RNWG+ 
Sbjct  180  VLITNVASAGDIVRVSVKGS-RTGWMPMSRNWGQN  213



>emb|CDY03019.1| BnaC07g22080D [Brassica napus]
Length=248

 Score =   184 bits (468),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 127/205 (62%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPC----VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            +SLL + ++ L      V  +++ W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MSLLGIFLLGLAAMASSVHGYEAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        C+P
Sbjct  61   AALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIVVTATNFCPPNNALPNTAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI G+  FNLV VTNV G G
Sbjct  119  PLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V VK      W +M RNWG+ 
Sbjct  179  DVRSVAVKGS-RTNWQQMSRNWGQN  202



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   185 bits (469),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+    A + +SL+ V    +P V+   + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSTSIASLIISLMWVAEARIPGVYTGGA-WQGAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC E   +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVKVSVKG-ARTGWMSMSRNWGQN  213



>ref|XP_004304289.1| PREDICTED: expansin-A15-like [Fragaria vesca subsp. vesca]
Length=243

 Score =   184 bits (468),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 126/198 (64%), Gaps = 13/198 (7%)
 Frame = -3

Query  568  SLLIVLVVALPCVFA-----HKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            + L +L+V    +F+     + S W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  3    AFLGILLVGFMSMFSSVNGYYYSGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT  62

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDL  236
            AALS AL+N   SCGAC+E++CV + ++C  G   + VT T+ CP     C PP  HFDL
Sbjct  63   AALSTALFNNGLSCGACYELRCVNDPQWCLPG--TIVVTATNFCPPG-GWCDPPQQHFDL  119

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F +IA++  GVVPV YR+V+C+R GG++FTI G+  FNLV VTNV G GD++ V +
Sbjct  120  SQPVFLKIAQYRAGVVPVSYRRVRCRRAGGIRFTINGHSYFNLVLVTNVGGAGDVQSVAI  179

Query  55   KADGVKEWIEMKRNWGEK  2
            K    + W  M RNWG+ 
Sbjct  180  KGSRTR-WQMMSRNWGQN  196



>ref|XP_010507137.1| PREDICTED: expansin-A23-like [Camelina sativa]
Length=252

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 126/206 (61%), Gaps = 16/206 (8%)
 Frame = -3

Query  577  MRLSLLIVLVVALPCVFAH------KSEWKEAHATYYGAPEG--TIGGACGFEE-YKQIY  425
            M   +L +LV A   V AH       S W +AHAT+YG   G  T+ GACG+ + +KQ Y
Sbjct  1    MSFVVLAILVSAANLVLAHVGLTNIDSSWYDAHATFYGDMSGGETMQGACGYGDLFKQGY  60

Query  424  SPYTAALSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR------C  263
               TAALS AL+N  ++CGACFE+ CV S++CK     +++T T+ CP + A       C
Sbjct  61   GLETAALSTALFNNGQTCGACFELMCVNSQYCKPNAGTIKITATNFCPPNYAEPFQYHWC  120

Query  262  SPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAG  83
            +PP+ HFDLS   F   AE+ GG+VPVK+R++ C + GGV+F I GNP F +V V NV G
Sbjct  121  NPPNNHFDLSMKMFLSFAEYRGGIVPVKFRRMMCGKSGGVRFEIKGNPYFIMVLVYNVGG  180

Query  82   GGDLEKVEVKADGVKEWIEMKRNWGE  5
             GD+  VE++      WI M RNWG+
Sbjct  181  AGDVTNVEIRGH-KSNWIAMSRNWGQ  205



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 129/202 (64%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            LSLL +   A +P V+     W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  10   LSLLFLTANAKIPGVYT-GGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  68

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   SCGACFE+KCV +  +C  G+  + VT T+ CP + A+       C+PP  
Sbjct  69   STALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRT  128

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G   FNLV VTNVAG GD+ 
Sbjct  129  HFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIV  188

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            KV VK      W+ M RNWG+ 
Sbjct  189  KVSVKGSKTG-WLTMSRNWGQN  209



>gb|ACF87150.1| unknown [Zea mays]
 gb|AFW67135.1| alpha-expansin 6 [Zea mays]
Length=265

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 121/193 (63%), Gaps = 14/193 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V+     W+ AHAT+YG  +  GT+GGACG+   Y Q Y    AALS AL+N+  SC
Sbjct  27   IPGVYGGGG-WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNQGLSC  85

Query  370  GACFEIKCVES---EFCKKGHKPVEVTVTDSCPASDA-------RCSPPHVHFDLSQPAF  221
            GACFEIKC +     +C+ G   + VT T+ CP + A        C+PP  HFDL+ P F
Sbjct  86   GACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMF  145

Query  220  HEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGV  41
              IAE+  G+VPV YR+V C++ GGV+FTI G   FNLV +TNVAG GD+ +  VKA G 
Sbjct  146  LHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDVVRASVKASGT  205

Query  40   KEWIEMKRNWGEK  2
             EW+ M RNWG+ 
Sbjct  206  GEWMPMSRNWGQN  218



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 137/214 (64%), Gaps = 21/214 (10%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA-------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-  440
            MAA++ L+L+ V+V         +P V+ +   W  AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAAKV-LTLMAVMVATALTVNAKIPGVY-NGGPWINAHATFYGGADASGTMGGACGYGNL  58

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----A  278
            Y Q Y   TAALS AL+N   SCG+CFE+KCV +  +C  G+  + +T T+ CP     A
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQA  118

Query  277  SD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
            SD    C+PP  HFDL+ P F  IA+++ G+VPV YR++ C++KGG++FTI G   FNLV
Sbjct  119  SDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLV  178

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             VTNVAG GD+ KV VK     +W+++ RNWG+ 
Sbjct  179  LVTNVAGAGDVRKVSVKGTNT-QWLDLSRNWGQN  211



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 129/212 (61%), Gaps = 17/212 (8%)
 Frame = -3

Query  589  MAAEMRLSL-----LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            MAA + LS+     L V   A    F     W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAATVLLSIASLASLFVATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCG+CFEIKC +   +C  G+  + +T T+ CP + A+   
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IA++  G+VPV YR+V C++KGG++FTI G   FNLV +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKKGGIRFTINGFRYFNLVLI  180

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  181  TNVAGAGDIIRVSVKGTNT-AWMSMSRNWGQN  211



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            +++I +A      LL  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAIIKLAILFTTYLLFNLADARIPGVYS-GGAWQNAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHQYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGS-RTGWMSLSRNWGQN  211



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+    A + +SL+ V    +P V+     W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSTCIASLIISLMWVAEARIPGVYT-GGAWQGAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC +   +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK     +W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKGS-RTDWMSMSRNWGQN  213



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 130/211 (62%), Gaps = 13/211 (6%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            SL  +     LSL +     +P V+     W+ AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  3    SLRVLYIAFMLSLFMAANARIPGVYT-GGPWEGAHATFYGGNDASGTMGGACGYGNLYSQ  61

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N   SCGACFE+KC +   +C  G+  + VT T+ CP + A+    
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDD  121

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IAE++ G+VPV YR+V C+++GGV+FTI G   FNLV +T
Sbjct  122  GGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLIT  181

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  182  NVAGAGDIVRVSVKGANTG-WMPMSRNWGQN  211



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 133/212 (63%), Gaps = 15/212 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            L L+A+A+   L+ L+     +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    LRLVALASL--LAFLVPAAARIPGVYSGGA-WQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N+  SCGACFEIKC  E ++C  G   + +T T+ CP + A    
Sbjct  61   QGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV +
Sbjct  121  DGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLI  180

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  181  TNVAGAGDIMRASVKGS-RTGWMPLSRNWGQN  211



>ref|XP_008230781.1| PREDICTED: expansin-A15 [Prunus mume]
Length=241

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 121/192 (63%), Gaps = 8/192 (4%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL+  +  +  V  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    LLLGFLSVVSSVNGYYGGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFH  218
            L+N   SCGAC+EI+CV + ++C  G   + VT T+ CP     C PP  HFDLSQP F 
Sbjct  67   LFNNGLSCGACYEIRCVNDPQWCLPG--AIVVTATNFCPPG-GWCDPPQQHFDLSQPVFL  123

Query  217  EIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK  38
             IA++  GVVPV YR+V+CKR+GG++FT+ G+  FNLV VTNV G GD+  V +K    +
Sbjct  124  RIAQYRAGVVPVSYRRVRCKRRGGIRFTVNGHSYFNLVLVTNVGGAGDVHSVAIKGSRTR  183

Query  37   EWIEMKRNWGEK  2
             W  M RNWG+ 
Sbjct  184  -WQLMSRNWGQN  194



>ref|XP_004302749.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=260

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 132/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            L L+ +A+    SLL+V    +P  +     W+EAHAT+YG  +  GT+GGACG+   Y 
Sbjct  6    LRLLCIASLA--SLLMVANARIPGPYT-GGPWQEAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC +   +C  G   + VT T+ CP + A+   
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE++ G+VPV YR+V C +KGG++FTI G+  FNLV V
Sbjct  123  NGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+  V VK      W+ M RNWG+ 
Sbjct  183  TNVAGAGDIVSVSVKGTNTG-WMPMSRNWGQN  213



>ref|XP_009404081.1| PREDICTED: expansin-A15 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 126/207 (61%), Gaps = 18/207 (9%)
 Frame = -3

Query  577  MRLSLLIVLVVA----LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSP  419
            MR+ LL + V+A    L     +   W  AHAT+YG  +  GT+GGACG+   Y Q Y  
Sbjct  1    MRMRLLGLAVIAFVSLLSAAHGYGGGWTRAHATFYGGSDASGTMGGACGYGNLYSQGYGT  60

Query  418  YTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------C  263
             TAALS AL+N   SCGAC+E+ CV + ++C +G   + VT T+ CP + A        C
Sbjct  61   NTAALSTALFNNGLSCGACYELMCVNDHQYCLRG--TIVVTATNFCPPNSALPNDAGGWC  118

Query  262  SPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAG  83
            +PP  HFDLSQP F  IA++  G+VPV YR+V C+++GG++FTI G+  FNLV +TNV G
Sbjct  119  NPPLQHFDLSQPVFLRIAQYRAGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGG  178

Query  82   GGDLEKVEVKADGVKEWIEMKRNWGEK  2
             GD+  V VK      W  M RNWG+ 
Sbjct  179  AGDVNAVSVKGS-RTGWQSMSRNWGQN  204



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 130/211 (62%), Gaps = 13/211 (6%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            SL  +     LSL +     +P V+     W+ AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  3    SLRVLYIAFMLSLFMEANARIPGVYT-GGPWEGAHATFYGGNDASGTMGGACGYGNLYSQ  61

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N   SCGACFEIKC +   +C  G+  + VT T+ CP + A+    
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDD  121

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IAE++ G+VPV YR+V C+++GGV+FTI G   FNLV +T
Sbjct  122  GGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLIT  181

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  182  NVAGAGDIVRVSVKGANTG-WMPMSRNWGQN  211



>ref|XP_010321849.1| PREDICTED: expansin-A10-like [Solanum lycopersicum]
Length=241

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 127/198 (64%), Gaps = 8/198 (4%)
 Frame = -3

Query  583  AEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            A++ + L+  L +A     + K +W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  2    AQIVIFLVCFLAIASFVKGSGKGKWINAHATFYGGGDASGTMGGACGYGNLYNQGYGTKT  61

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDL  236
            AALS AL+N   SCG+C+EIKCV E ++C  G   ++VT T+ CP     C+PP  HFDL
Sbjct  62   AALSTALFNNGLSCGSCYEIKCVNEHKWCLSG--SIKVTATNFCPP-GGWCNPPLHHFDL  118

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F  IA++  G+VP+ YR++ C+RKGG++FTI G+  FNLV VTNV G GD+  V +
Sbjct  119  SQPIFQHIAQYRAGIVPIAYRRIPCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHAVAI  178

Query  55   KADGVKEWIEMKRNWGEK  2
            K     +W  M RNWG+ 
Sbjct  179  KGSKT-QWQSMSRNWGQN  195



>emb|CDP00351.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 133/219 (61%), Gaps = 20/219 (9%)
 Frame = -3

Query  613  QF*LSL-----IAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGA  455
            +F LSL     I MAA     LL+ L+  +  V  +   W  AHAT+YG  +  GT+GGA
Sbjct  68   RFLLSLCSIAKIKMAAPAGF-LLVGLLAMVSSVHGYGG-WINAHATFYGGGDASGTMGGA  125

Query  454  CGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPA  278
            CG+   Y Q Y   TAALS AL+N   SCG+CFEI+CV S++C  G   + VT T+ CP 
Sbjct  126  CGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFEIRCVNSKYCLPG--AILVTATNFCPP  183

Query  277  SDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNP  119
            ++A        C+PP  HFDLSQP F  +A++  G+VPV YR+V C R+GG++FTI G+ 
Sbjct  184  NNALPNNAGGWCNPPLQHFDLSQPVFQRMAQYRAGIVPVAYRRVPCSRRGGMRFTINGHS  243

Query  118  NFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             FNLV VTNV G GD+  V +K      W +M RNWG+ 
Sbjct  244  YFNLVLVTNVGGAGDVHSVAIKGS-RTGWQQMSRNWGQN  281



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            +++I +A      LL  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAIIKLAILFTAYLLFNLADARIPGVYS-GGAWQNAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGSKTG-WMSLSRNWGQN  211



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 131/209 (63%), Gaps = 19/209 (9%)
 Frame = -3

Query  577  MRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIY  425
            ++  L+I+LV+       +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y
Sbjct  4    LKFFLIIILVILVGVEGRIPGVYSGGS-WQNAHATFYGGSDASGTMGGACGYGNLYSQGY  62

Query  424  SPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR------  266
                AALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A       
Sbjct  63   GVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGG  122

Query  265  -CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNV  89
             C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNL+ VTNV
Sbjct  123  WCNPPRTHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFSYFNLILVTNV  182

Query  88   AGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            AG GD+ KV VK      WI + RNWG+ 
Sbjct  183  AGAGDITKVMVKGT-RTNWITLSRNWGQN  210



>ref|XP_010276443.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 126/198 (64%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            L+VL+  L  V    S W +AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  8    LMVLLAMLQTVHGFGSGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  67

Query  391  YNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N   SCGAC+EIKCV + ++C  G   + +T T+ CP ++A        C+PP  HFDL
Sbjct  68   FNNGLSCGACYEIKCVNDPKWCLPGS--IIITATNFCPPNNALPNNAGGWCNPPLQHFDL  125

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F  IA+++ G+VPV+YR+V C++ GG++FTI G+  FNLV +TNV G GD+  V +
Sbjct  126  SQPVFQRIAQYKAGIVPVQYRRVACEKTGGIRFTINGHSYFNLVLITNVGGAGDVVAVSI  185

Query  55   KADGVKEWIEMKRNWGEK  2
            K      W  M RNWG+ 
Sbjct  186  KGS-RTGWQAMSRNWGQN  202



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+    A + +SL+ V    +P V+     W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSTCIASLIISLMWVAEARIPGVYT-GGAWQGAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC +   +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK     +W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKG-ARTDWMSMSRNWGQN  213



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 134/214 (63%), Gaps = 16/214 (7%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            S+  + + + L  L+ LV A +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  3    SMGVITSIVGLIFLVSLVEARIPGVYSGGS-WQTAHATFYGGSDASGTMGGACGYGNLYS  61

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES---EFCKKGHKPVEVTVTDSCPASDAR-  266
            Q Y   TAALS AL+N   SCGACFEIKC      ++C  G   + +T T+ CP + A+ 
Sbjct  62   QGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKP  121

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR++ C+++GG++FTI G   FNLV
Sbjct  122  NDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNLV  181

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             +TNVAG GD+ KV VK      WI + RNWG+ 
Sbjct  182  LITNVAGAGDIIKVWVKGSKT-NWISLSRNWGQN  214



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 131/209 (63%), Gaps = 13/209 (6%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIY  425
             ++   + LS  +++   +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y
Sbjct  5    FSLCIPLLLSFSLLIEARIPGVYS-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  63

Query  424  SPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR------  266
               TAALS AL+N+ +SCGACFEIKC  +  +C  G   + +T T+ CP + A       
Sbjct  64   GVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGG  123

Query  265  -CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNV  89
             C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNV
Sbjct  124  WCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNV  183

Query  88   AGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            AG GD+ +V VK      W+ + RNWG+ 
Sbjct  184  AGAGDIVRVSVKGT-RTGWMSLTRNWGQN  211



>ref|XP_003621257.1| Alpha-expansin [Medicago truncatula]
 gb|AES77475.1| expansin A10 [Medicago truncatula]
Length=242

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 125/197 (63%), Gaps = 14/197 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAH------KSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            L+ L++A+  + +H       + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  3    LLGLLLAIFYMVSHVNGRGGHASWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTA  62

Query  409  ALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLS  233
            ALS AL+N   SCGAC+EIKCV + ++C  G   + VT T+ CP     C PP+ HFDLS
Sbjct  63   ALSTALFNNGLSCGACYEIKCVNDPQWCNPG--SIIVTATNFCPPG-GWCDPPNHHFDLS  119

Query  232  QPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVK  53
            QP F  IA++  G+VPV YR+V+CKR+GG++FTI G+  FNLV VTNV G GD+  V +K
Sbjct  120  QPIFQHIAQYRAGIVPVAYRRVRCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAIK  179

Query  52   ADGVKEWIEMKRNWGEK  2
                  W  M RNWG+ 
Sbjct  180  GS-RSRWQAMSRNWGQN  195



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 132/199 (66%), Gaps = 15/199 (8%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            + ++   +P V++  SEW++AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  24   VFIVDARVPGVYS-GSEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTAL  82

Query  391  YNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N+  SCGACFEIKC  + ++C  G   + +T T+ CP + A        C+PP  HFDL
Sbjct  83   FNQGLSCGACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDL  142

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            + P F +IA++  G+VPV+YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ +V V
Sbjct  143  AMPMFLKIAQYRAGIVPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRVSV  202

Query  55   KADGVKE-WIEMKRNWGEK  2
            K  G K  W+ M RNWG+ 
Sbjct  203  K--GTKTGWMPMSRNWGQN  219



>ref|XP_004300427.1| PREDICTED: expansin-A4-like [Fragaria vesca subsp. vesca]
Length=259

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            ++ +A  A + +SL  +    +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  3    MASLACIAALLISLTSITEARIPGVYSGGA-WQGAHATFYGGSDASGTMGGACGYGNLYS  61

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  62   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSD  121

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV V
Sbjct  122  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLV  181

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK      W+ + RNWG+ 
Sbjct  182  SNVAGAGDIVRVSVKGS-RTGWMSLSRNWGQN  212



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 128/201 (64%), Gaps = 13/201 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LSL +     +P V+   + W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  13   LSLFMAABARIPGVYTGGA-WEGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  400  PALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVH  245
             AL+N   SCGACFEIKC +   +C  G+  + VT T+ CP + A+       C+PP  H
Sbjct  72   TALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRTH  131

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDL+ P F +IAE++ G+VPV YR+V C+++GGV+FTI G   FNLV +TNVAG GD+ +
Sbjct  132  FDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVR  191

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            V VK      W+ M RNWG+ 
Sbjct  192  VSVKGANTG-WMPMSRNWGQN  211



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 133/215 (62%), Gaps = 16/215 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
            ++    AA + +SLL  L +A   +P V+A    W+ AHAT+YG  +  GT+GGACG+  
Sbjct  1    MAFFHGAATIAVSLLAFLTLADARIPGVYA-GGPWQTAHATFYGGSDASGTMGGACGYGN  59

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS AL+N+  SCGACFEIKC E   +C  G   + +T T+ CP + A 
Sbjct  60   LYSQGYGVETAALSTALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYAL  119

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IA++  G+VPV YR+V C++ GG++FTI G   FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKAGGIRFTINGFEYFNL  179

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V +TNVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  180  VLITNVAGAGDIVRVSVKGS-RTGWMPMSRNWGQN  213



>gb|AEQ55273.1| expansin [Breonia chinensis]
 gb|AEQ55288.1| expansin [Breonia chinensis]
Length=248

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 125/204 (61%), Gaps = 14/204 (7%)
 Frame = -3

Query  580  EMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            E+ + L I  +   P V  +   W +AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  2    ELLVFLTIGYLSIFPLVHGYDEGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTA  61

Query  409  ALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPP  254
            ALS AL+N   SCGACFEIKCV +   C  G   + VT T+ CP ++A        C+PP
Sbjct  62   ALSTALFNNGLSCGACFEIKCVNDPRGCLPGS--IVVTATNFCPPNNALPSNNGGWCNPP  119

Query  253  HVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGD  74
              HFDLSQP F  IA++  G+VPV YR+V C++KGG++FTI G+  FNLV +TNV G GD
Sbjct  120  LHHFDLSQPVFQHIAQYRAGIVPVSYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGD  179

Query  73   LEKVEVKADGVKEWIEMKRNWGEK  2
            +  V +K     +W  M RNWG+ 
Sbjct  180  VHAVSIKGS-RSDWQPMSRNWGQN  202



>emb|CDY71146.1| BnaCnng71550D [Brassica napus]
Length=249

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 122/199 (61%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            +++VL V    V  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  8    VMVVLAVMTSRVNGYGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  67

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCGACFEI+C  + ++C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  68   LFNNGLSCGACFEIRCQNDGKWCLPG--SIVVTATNFCPPNNALPNNAGGWCNPPQQHFD  125

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            LSQP F  IA+H+ G+VPV YR+V C R+GG++FTI G+  FNLV +TNV G GD+    
Sbjct  126  LSQPVFQRIAQHKAGIVPVAYRRVSCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAW  185

Query  58   VKADGVKEWIEMKRNWGEK  2
            VK      W  M RNWG+ 
Sbjct  186  VKGS-RTGWQAMSRNWGQN  203



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 133/214 (62%), Gaps = 16/214 (7%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            S+  + + + L  L+ LV A +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  3    SMGVITSIIGLIFLVSLVEARIPGVYSGGS-WQTAHATFYGGSDASGTMGGACGYGNLYS  61

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES---EFCKKGHKPVEVTVTDSCPASDAR-  266
            Q Y   TAALS AL+N   SCGACFEIKC      ++C  G   + +T T+ CP + A+ 
Sbjct  62   QGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKP  121

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F  IA++  G+VPV YR++ C+++GG++FTI G   FNLV
Sbjct  122  NDNGGWCNPPRSHFDLAMPMFLNIAQYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNLV  181

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             +TNVAG GD+ KV VK      WI + RNWG+ 
Sbjct  182  LITNVAGAGDIIKVWVKGSKT-NWISLSRNWGQN  214



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 136/213 (64%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            ++++ + A + L LL++   A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAMLNIIAIVSLLLLMIPSQAKIPGVYS-GGPWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC +  ++C  G+  + VT T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPS  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G   FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK     EW+ M RNWG+ 
Sbjct  180  ITNVAGAGDIMRASVKGSKT-EWMSMSRNWGQN  211



>gb|ACJ84404.1| unknown [Medicago truncatula]
 gb|AFK35147.1| unknown [Medicago truncatula]
Length=242

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 125/197 (63%), Gaps = 14/197 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAH------KSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            L+ L++A+  + +H       + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  3    LLGLLLAIFYMVSHVNGRGGHASWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTA  62

Query  409  ALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLS  233
            ALS AL+N   SCGAC+EIKCV + ++C  G   + VT T+ CP     C PP+ HFDLS
Sbjct  63   ALSTALFNNGLSCGACYEIKCVNDPQWCNPG--SIIVTATNFCPPG-GWCDPPNHHFDLS  119

Query  232  QPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVK  53
            QP F  IA++  G+VPV YR+V+CKR+GG++FTI G+  FNLV VTNV G GD+  V +K
Sbjct  120  QPIFQHIAQYRAGIVPVAYRRVRCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAIK  179

Query  52   ADGVKEWIEMKRNWGEK  2
                  W  M RNWG+ 
Sbjct  180  GS-RSRWQAMSRNWGQN  195



>ref|XP_010412466.1| PREDICTED: expansin-A25-like [Camelina sativa]
Length=257

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 124/202 (61%), Gaps = 16/202 (8%)
 Frame = -3

Query  565  LLIVLVVALPCVFAH------KSEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYT  413
            LL +LV A   V AH       S W +AHAT+YG   G  T+ GACG+ + +KQ Y   T
Sbjct  10   LLAILVSAANLVLAHVGLTNIDSSWYDAHATFYGDMSGGETMQGACGYGDLFKQGYGLET  69

Query  412  AALSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR------CSPPH  251
            AALS AL+N  ++CGACFE+ CV S++CK     +++T T  CP + A       C+PP+
Sbjct  70   AALSTALFNNGQTCGACFELMCVNSQYCKPNAGTIKITATTFCPPNYAEPVQYHWCNPPN  129

Query  250  VHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDL  71
             HFDLS   F   AE+ GG+VPVK+R++ C + GGV+F I GNP F +V V NV G GD+
Sbjct  130  NHFDLSMKMFLSFAEYRGGIVPVKFRRMMCGKSGGVRFEIKGNPYFIMVLVYNVGGAGDV  189

Query  70   EKVEVKADGVKEWIEMKRNWGE  5
              VE++      WI M RNWG+
Sbjct  190  TNVEIRGHK-SNWIAMSRNWGQ  210



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 126/200 (63%), Gaps = 12/200 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPYTAALS  401
            LS L ++   +  V+     W+ AHAT+YG  +  GT+GGACG+   Y   Y    AALS
Sbjct  13   LSFLTIVESKVRGVYT-AGPWQSAHATFYGGSDASGTMGGACGYGNLYSTGYGVNNAALS  71

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
              L+N   SCGACFEIKC + ++C  G+  + VT T+ CP + A        C+PP  HF
Sbjct  72   TVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHF  131

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DLS P F +IA++  G+VPV YR+V CK++GG++FTI G   FN++ VTNVAG GD+++V
Sbjct  132  DLSMPVFLQIAQYRAGIVPVTYRRVPCKKQGGIRFTINGFNYFNMIIVTNVAGAGDIQQV  191

Query  61   EVKADGVKEWIEMKRNWGEK  2
            +VK    K WI M RNWG+ 
Sbjct  192  QVKGTNTK-WIIMSRNWGQN  210



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            +++I +A      LL  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAVIKLAILFTAYLLFNLADARIPGVYS-GGAWQNAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGSKTG-WMSLSRNWGQN  211



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 132/211 (63%), Gaps = 13/211 (6%)
 Frame = -3

Query  601  SLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            S++  A+ +  SL+ +    +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  5    SVVFAASLISFSLMWLADARIPGVYS-GGPWQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP + A+    
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDN  123

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IAE+  G+VPV +R+V C+++GG++FTI G   FNLV ++
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLIS  183

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  184  NVAGAGDIVRVSVKG-ARTGWMSMSRNWGQN  213



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 129/202 (64%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            LSLL+    A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  16   LSLLLTQSHAKIPGVYS-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  74

Query  403  SPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   SCGACFEIKC +  ++C  G+  + VT T+ CP + A        C+PP  
Sbjct  75   STALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPTDNGGWCNPPRP  134

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G   FNLV +TNVAG GD+ 
Sbjct  135  HFDLAMPMFLKIAQYRAGIVPVSYRRVACRKQGGMRFTINGFRYFNLVLITNVAGAGDIM  194

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            +  VK     EW+ M RNWG+ 
Sbjct  195  RASVKGSKT-EWMSMSRNWGQN  215



>gb|EPS58017.1| hypothetical protein M569_16799 [Genlisea aurea]
Length=249

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 128/206 (62%), Gaps = 19/206 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAH-----KSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPY  416
            +  +  L++A+P +F+H        W  AHAT+YG  +  GT+GGACG+   Y Q Y   
Sbjct  1    MGFVGFLLLAVPSLFSHVNGEDGGGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYGTD  60

Query  415  TAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CS  260
            TAALS AL+N  +SCG+C+EI+CV E  +C +    V VT T+ CP ++A        C+
Sbjct  61   TAALSTALFNNGQSCGSCYEIRCVGEQRWCLQ--ASVVVTATNFCPPNNALPNDAGGWCN  118

Query  259  PPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGG  80
            PP +HFDLSQP F  IA +  G+VPV YR+V C RKGG++FTI G+  FNLV +TNVAG 
Sbjct  119  PPRLHFDLSQPIFQRIAVYRAGIVPVAYRRVPCVRKGGIRFTINGHSYFNLVLITNVAGA  178

Query  79   GDLEKVEVKADGVKEWIEMKRNWGEK  2
            GD+  V +K      W  M RNWG+ 
Sbjct  179  GDVIAVSIKGS-RSGWEPMSRNWGQN  203



>gb|ACA05165.1| expansin 2 [Dimocarpus longan]
Length=250

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 123/199 (62%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL+  +  +  V A  S W   HAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  9    LLVGFLAVVTSVNAGPSGWISGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  68

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCG+C+EIKCV ++ +C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  69   LFNSGLSCGSCYEIKCVNDARWCLPGS--IVVTATNFCPPNNALPNDAGGWCNPPQQHFD  126

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            LSQP F  IA++  G+VPV YR+V C+RKGG++FTI G+  FNLV +TNV G GD+  V 
Sbjct  127  LSQPVFQHIAQYRAGIVPVAYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVS  186

Query  58   VKADGVKEWIEMKRNWGEK  2
            +K      W  M RNWG+ 
Sbjct  187  IKGS-RTGWQAMSRNWGQN  204



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 130/207 (63%), Gaps = 13/207 (6%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSP  419
            +A  +  S+++     +P V++  S+W+ AHAT+YG  +  GT+GGACG+   Y Q Y  
Sbjct  7    LALALLASIMVPAFARIPGVYS-GSDWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  65

Query  418  YTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------C  263
             TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A        C
Sbjct  66   ETAALSTALFNSGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWC  125

Query  262  SPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAG  83
            +PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV ++NVAG
Sbjct  126  NPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVSCRKPGGIRFTINGFRYFNLVLISNVAG  185

Query  82   GGDLEKVEVKADGVKEWIEMKRNWGEK  2
             GD+ KV VK      W+ M RNWG+ 
Sbjct  186  AGDIVKVWVKGSRTG-WMSMSRNWGQN  211



>ref|XP_002323897.2| expansin 1 family protein [Populus trichocarpa]
 gb|EEF04030.2| expansin 1 family protein [Populus trichocarpa]
Length=244

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 123/180 (68%), Gaps = 9/180 (5%)
 Frame = -3

Query  517  SEWKEAHATYYGAPEG--TIGGACGF-EEYKQIYSPYTAALSPALYNEAESCGACFEIKC  347
            S W +AHAT+YG  +G  T+ GACG+ + +KQ Y   TAALS AL+N  ++CGACFE+KC
Sbjct  20   SSWYDAHATFYGDIKGGQTMMGACGYGDLFKQGYGLQTAALSTALFNNGQTCGACFELKC  79

Query  346  V-ESEFCKKGHKPVEVTVTDSCP----ASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPV  182
            V + ++CK     +++T T+ CP    AS+A C+PP  HFDLS P F  IAE+  G+VPV
Sbjct  80   VNDPQWCKNHAGTIKITATNLCPPNYGASNAWCNPPQQHFDLSMPMFLTIAEYRAGIVPV  139

Query  181  KYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            KYR++ C ++GGVKF I GNP + LV V NVAG G++  V +K    + WI+M RNWG+ 
Sbjct  140  KYRRILCSKEGGVKFDIHGNPYWMLVLVRNVAGAGEVINVRIKGSQTR-WIQMSRNWGQN  198



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 131/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            +++ A      L L + LV A +P V+     W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAIRATTCVASLVLFLTLVEARIPGVYT-GGAWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPS  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++F I G+  FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  180  ITNVAGAGDIVKVSVKGSKTG-WMSMSRNWGQN  211



>emb|CDY04077.1| BnaC02g37920D [Brassica napus]
Length=246

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 131/201 (65%), Gaps = 11/201 (5%)
 Frame = -3

Query  577  MRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAA  407
            M  S+  V+++A+  V    + W++AHAT+YG   G  T+ GACG+ + +++ Y   TAA
Sbjct  1    MNRSMSFVMLLAI-LVSVADAAWEDAHATFYGDISGKETMQGACGYGDLFQEGYGLETAA  59

Query  406  LSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDA------RCSPPHVH  245
            LS AL+N  ++CGACFE+ CV S++CK+    + +T T+ CP +         C+PP+ H
Sbjct  60   LSTALFNNGQTCGACFELTCVNSQWCKQNAGAIRITATNFCPPNYTPPVDIHWCNPPNKH  119

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDLS   F  IAE++ G+VPVK+R+V+C+++GGV+F I GNPNF +V V NV G GD+  
Sbjct  120  FDLSMKMFTSIAEYKSGIVPVKFRRVKCQKRGGVRFEIKGNPNFIMVLVYNVGGAGDVNS  179

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            + +K      WI MKRNWG+ 
Sbjct  180  LAIKGHK-SNWISMKRNWGQN  199



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 127/201 (63%), Gaps = 13/201 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
             SL  V+   +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  13   FSLFWVVNARIPGVYTGGS-WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  400  PALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVH  245
             AL+N   SCGACFEIKC +  ++C  G   + +T T+ CP + A        C+PP  H
Sbjct  72   TALFNNGLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNFALPSDNGGWCNPPRPH  131

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDL+ P F +IAE+  G+VPV +R++ C+++GG++FTI G   FNLV V+NVAG GD+ K
Sbjct  132  FDLAMPMFLKIAEYRAGIVPVNFRRIPCRKQGGIRFTINGFRYFNLVLVSNVAGAGDIVK  191

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            V +K     +W+ M RNWG+ 
Sbjct  192  VSIKGSKT-DWLSMSRNWGQN  211



>ref|XP_010243262.1| PREDICTED: expansin-A16-like [Nelumbo nucifera]
Length=280

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 127/181 (70%), Gaps = 12/181 (7%)
 Frame = -3

Query  511  WKEAHATYYGAPE--GTIGGACGFEEYK-QIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            WK AHAT+YG  +  GT+GGACG+ + + Q Y  +TAALS AL+ +  +CGAC+EIKCV+
Sbjct  54   WKSAHATFYGGADASGTMGGACGYGDLRAQGYGDHTAALSTALFKDGFACGACYEIKCVD  113

Query  340  S-EFCKKGHKPVEVTVTDSCPAS-------DARCSPPHVHFDLSQPAFHEIAEHEGGVVP  185
              ++CK G   + VT T+ CP +          C+PP  HFD++QPAF  IAE++ G++P
Sbjct  114  DDQWCKPGQPSLFVTATNICPPNYNLPSDNGGWCNPPREHFDIAQPAFLLIAEYKSGIIP  173

Query  184  VKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            VKYR+V CK+KGG++FTI+GNP +N V V NV G GD+++V VK D V EW  MKR+WG+
Sbjct  174  VKYRRVSCKKKGGIRFTISGNPYYNKVLVWNVGGAGDVKEVLVKGDKV-EWTPMKRDWGQ  232

Query  4    K  2
             
Sbjct  233  N  233



>ref|XP_002514740.1| Alpha-expansin 15 precursor, putative [Ricinus communis]
 gb|EEF47846.1| Alpha-expansin 15 precursor, putative [Ricinus communis]
Length=249

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 125/198 (63%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            L+  +  +P V+ +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  8    LLGFLSLVPFVYGYDGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  67

Query  391  YNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N   SCGACFEIKC +  ++C  G   + VT T+ CP ++A        C+PP  HFDL
Sbjct  68   FNNGLSCGACFEIKCTDDPKWCLPGS--IVVTATNFCPPNNALPNNAGGWCNPPQHHFDL  125

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            +QP F  IA++  G+VPV YR+V C+++GG++FTI G+  FNLV +TNV G GD++ V +
Sbjct  126  AQPVFQRIAQYRSGIVPVVYRRVPCQKRGGIRFTINGHSYFNLVLITNVGGAGDVQAVSI  185

Query  55   KADGVKEWIEMKRNWGEK  2
            K     +W  M RNWG+ 
Sbjct  186  KGS-RSDWQPMSRNWGQN  202



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 130/208 (63%), Gaps = 16/208 (8%)
 Frame = -3

Query  583  AEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYKQIYS  422
            A + LSL+ ++ VA   LP  ++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  7    AGVILSLVCLMWVADARLPGDYS-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  65

Query  421  PYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFEIKC  E  +C  G   + VT T+ CP + A        
Sbjct  66   VNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGW  125

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++KGG++FTI G   FNLV VTNVA
Sbjct  126  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVA  185

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+ +V VK      W+ M RNWG+ 
Sbjct  186  GAGDILRVNVKGS-RTGWMSMSRNWGQN  212



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 134/212 (63%), Gaps = 20/212 (9%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +SLIA+A+        ++   +P V++ ++ W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  10   VSLIALAST-------IVEARIPGVYSGEA-WQGAHATFYGGSDASGTMGGACGYGNLYS  61

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + VT T+ CP + A    
Sbjct  62   QGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPND  121

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FT+ G   FNLV +
Sbjct  122  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTVNGFKYFNLVLI  181

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ KV VK      W+ + RNWG+ 
Sbjct  182  TNVAGAGDIVKVSVKGSKTG-WMSLSRNWGQN  212



>ref|NP_001288942.1| expansin-A16 precursor [Brassica rapa]
 gb|AGM16358.1| alpha-expansin protein 16 [Brassica rapa]
Length=260

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 129/202 (64%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLV-VALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPYTAAL  404
            L L + L   A+P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  14   LFLFLSLTNAAIPGVYSGGS-WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAAL  72

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   +CGACFEIKCV + ++C  G   V VT T+ CP + A+       C+PP  
Sbjct  73   STALFNNGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRA  132

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IAE+  G+VP+ YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ 
Sbjct  133  HFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIV  192

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            +  VK      W+ + RNWG+ 
Sbjct  193  RTSVKGSKTG-WMGLTRNWGQN  213



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 136/213 (64%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            ++++ + A + L LLI+   A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAMLNIIAIVSLLLLIIPSQAKIPGVYS-GGPWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC +  ++C  G+  + VT T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPS  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G   FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK     EW+ M RNWG+ 
Sbjct  180  ITNVAGAGDIMRASVKGSKT-EWMSMSRNWGQN  211



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 130/208 (63%), Gaps = 16/208 (8%)
 Frame = -3

Query  583  AEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYKQIYS  422
            A + LSL+ ++ VA   LP  ++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  7    AGVILSLVCLMWVADARLPGDYS-GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  65

Query  421  PYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFEIKC  E  +C  G   + VT T+ CP + A        
Sbjct  66   VNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGW  125

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++KGG++FTI G   FNLV VTNVA
Sbjct  126  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVA  185

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+ +V VK      W+ M RNWG+ 
Sbjct  186  GAGDILRVNVKGS-RTGWMSMSRNWGQN  212



>emb|CDY44393.1| BnaA02g29840D [Brassica napus]
Length=246

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 132/205 (64%), Gaps = 15/205 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSP  419
            M   M L +L+ ++V++       + W++AHAT+YG   G  T+ GACG+ + +++ Y  
Sbjct  1    MNRSMSLVMLLAILVSVA-----DAAWEDAHATFYGDISGKETMQGACGYGDLFQEGYGL  55

Query  418  YTAALSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDA------RCSP  257
             TAALS AL+N  ++CGACFE+ CV S++CK+    + +T T+ CP +         C+P
Sbjct  56   ETAALSTALFNNGQTCGACFELTCVNSQWCKQNAGTIRITATNFCPPNYTPPVDIHWCNP  115

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P+ HFDLS   F  IAE++ G+VPVK+R+V+C+++GGV+F + GNPNF +V V NV G G
Sbjct  116  PNKHFDLSMKMFTSIAEYKSGIVPVKFRRVKCQKRGGVRFEVKGNPNFIMVLVYNVGGAG  175

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  + +K      WI M+RNWG+ 
Sbjct  176  DVNSLAIKGHK-SNWISMQRNWGQN  199



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 130/212 (61%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            L++  +A    L L++ +   +P V++    W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    LNVAFIACVFSLMLVVAVESRIPGVYS-GGAWQSAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y     ALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A    
Sbjct  63   QGYGVNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFALPND  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++KGG++FTI G   FNLV V
Sbjct  123  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +V VK      WI M RNWG+ 
Sbjct  183  TNVAGAGDIVRVYVKGSKT-NWITMSRNWGQN  213



>gb|AGF90535.1| alpha-expansin 1 [Ammopiptanthus nanus]
Length=248

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 131/205 (64%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVF----AHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            ++L+ +L+VA   +F    A+   W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MALIGLLLVAFLTMFSSAHAYAEGWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AA+S AL+N   SCG+C+EI+CV ++++C  G   + VT T+ CP ++         C+P
Sbjct  61   AAVSTALFNNGLSCGSCYEIRCVNDNKWCLPG--SIVVTATNFCPPNNGLPNNAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F  IA+++ G+VPV YR+V C+RKGG++FTI G+  FNLV +TNV G G
Sbjct  119  PQQHFDLSQPVFLRIAQYKAGIVPVSYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V VK      W+ M RNWG+ 
Sbjct  179  DVHAVAVKGS-RTGWMPMSRNWGQN  202



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 118/181 (65%), Gaps = 13/181 (7%)
 Frame = -3

Query  511  WKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            W  AHAT+YG  +  GT+GGACG+   Y Q Y    AALS  L+N   SCGACFE+KC +
Sbjct  33   WTTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSCGACFELKCTD  92

Query  340  SEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPV  182
             ++C  G+  + VT T+ CP + A        C+PP  HFDL+ P F +IAE+  G+VPV
Sbjct  93   QKWCTPGNPSILVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPV  152

Query  181  KYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK-EWIEMKRNWGE  5
             YR+V C+++GG++FTI G   FNLV VTNVAG GD++KV VK  G K  WI M RNWG+
Sbjct  153  NYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIQKVYVK--GTKTNWIAMNRNWGQ  210

Query  4    K  2
             
Sbjct  211  N  211



>ref|XP_009398502.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 125/191 (65%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V+    +W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+NE +SC
Sbjct  23   IPGVYT-GGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSC  81

Query  370  GACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFEIKC E  ++C +G   + +T T+ CP + A        C+PP  HFDL+ PAF +
Sbjct  82   GACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLK  141

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV +R+V C++ GG++FTI G   FNLV +TNVAG GD+ +V VK      
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRVSVKGSRTG-  200

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  201  WMPMSRNWGQN  211



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 129/202 (64%), Gaps = 16/202 (8%)
 Frame = -3

Query  565  LLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            LL+VL +A   +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  12   LLLVLKLADARIPGVYSGGS-WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  70

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   SCGACFEIKC  E ++C  G   + +T T+ CP + A        C+PP  
Sbjct  71   STALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRP  130

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNVAG GD+ 
Sbjct  131  HFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIV  190

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            K  VK      W+ + RNWG+ 
Sbjct  191  KASVKGSKTG-WMSLSRNWGQN  211



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 131/214 (61%), Gaps = 20/214 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVV-------ALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-  440
            MA+  R+  L+ L++        +P V+     W+ AHAT+YG  +  GT+GGACG+   
Sbjct  1    MASVSRVVGLVSLILFSTLAEARIPGVYT-GGPWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-  266
            Y Q Y   TAALS AL+N   SCGACFEIKC  E ++C  G   + VT T+ CP + A  
Sbjct  60   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALP  119

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLV  179

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             VTNVAG GD+ K+ VK      W+ M RNWG+ 
Sbjct  180  LVTNVAGAGDINKLWVKGSKTG-WMSMSRNWGQN  212



>emb|CDY40233.1| BnaA09g35150D [Brassica napus]
Length=260

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 130/202 (64%), Gaps = 14/202 (7%)
 Frame = -3

Query  571  LSLLIVLV-VALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            L LL+ L   A+P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  14   LFLLLSLTNAAIPGVYSGGS-WQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAAL  72

Query  403  SPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL++   +CGACFEIKCV + ++C  G   V VT T+ CP + A+       C+PP  
Sbjct  73   STALFSSGLTCGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRA  132

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDL+ P F +IAE+  G+VP+ YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ 
Sbjct  133  HFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIV  192

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
            +  VK      W+ + RNWG+ 
Sbjct  193  RTSVKGSKTG-WMGLTRNWGQN  213



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 129/203 (64%), Gaps = 17/203 (8%)
 Frame = -3

Query  565  LLIVLVVA----LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAA  407
            LL++L+ A    +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAA
Sbjct  12   LLVMLMGASEARIPGVYTGGS-WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  406  LSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPH  251
            LS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A        C+PP 
Sbjct  71   LSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPNDNGGWCNPPR  130

Query  250  VHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDL  71
             HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV ++NVAG GD+
Sbjct  131  PHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDI  190

Query  70   EKVEVKADGVKEWIEMKRNWGEK  2
             KV VK      W+ M RNWG+ 
Sbjct  191  VKVSVKGS-RTGWMSMSRNWGQN  212



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 125/200 (63%), Gaps = 12/200 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LSLL      +P V+     W+ AHAT+YG  +  GT+GGACG+   Y   Y    AALS
Sbjct  13   LSLLTAANAKVPGVYT-GGPWQSAHATFYGGEDASGTMGGACGYGNLYSAGYGVNNAALS  71

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
             AL+N   SCGACFEI+C + ++C  G+  + VT T+ CP + A        C+PP  HF
Sbjct  72   TALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHF  131

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DL++P F + A++  G+VPV YR+V CK+ GG++FTI G   FN+V VTNVAG GD++KV
Sbjct  132  DLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVTNVAGAGDIQKV  191

Query  61   EVKADGVKEWIEMKRNWGEK  2
             VK    K W+ M RNWG+ 
Sbjct  192  FVKGTNTK-WMAMSRNWGQN  210



>ref|XP_003613849.1| Expansin [Medicago truncatula]
 gb|AES96807.1| expansin A10 [Medicago truncatula]
 gb|AFK37003.1| unknown [Medicago truncatula]
Length=248

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 123/199 (62%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
             ++V +      + +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    FIMVFLTMFSSAYGYGGGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCG+CFEI+C  + ++C  G   + VT T+ CP + A        C+PP  HFD
Sbjct  67   LFNSGLSCGSCFEIRCAGDRKWCLPG--SILVTATNFCPPNTALPNNNGGWCNPPLQHFD  124

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            L+QP F  IA+++ G+VPV YR+V C+R+GG++FTI G+  FNLV VTNV G GD+  V 
Sbjct  125  LAQPVFLRIAQYKAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVA  184

Query  58   VKADGVKEWIEMKRNWGEK  2
            +K      W++M RNWG+ 
Sbjct  185  IKGS-RSGWMQMSRNWGQN  202



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 127/200 (64%), Gaps = 13/200 (7%)
 Frame = -3

Query  568  SLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSP  398
            SLLI+    +P  +     W++AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS 
Sbjct  14   SLLILANARIPGPYT-GGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  72

Query  397  ALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
            AL+N   SCGACFEI+C +   +C  G   + VT T+ CP + A+       C+PP  HF
Sbjct  73   ALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHF  132

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DL+ P F +IAE++ G+VPV YR+V C+++GG++FTI G+  FNLV +TNVAG GD+  V
Sbjct  133  DLAMPMFLKIAEYKAGIVPVSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGDVVSV  192

Query  61   EVKADGVKEWIEMKRNWGEK  2
             VK      W+ M RNWG+ 
Sbjct  193  SVKGTNTG-WMPMSRNWGQN  211



>ref|XP_009388613.1| PREDICTED: expansin-A7 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V+    +W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+NE +SC
Sbjct  23   IPGVYT-GGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSC  81

Query  370  GACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            G+CFEIKC +   +C  G   + +T T+ CP + A        C+PP  HFDLS P F +
Sbjct  82   GSCFEIKCADDPRWCHGGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLSMPMFLK  141

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV +R+V C++ GG++FTI G   FNLV +TNVAG GDL +  VK     E
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDLVRASVKGS-RTE  200

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  201  WMPMSRNWGQN  211



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            + L+ +A+ + L+ ++     +P V+    +W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VGLVCIASVLALAFMLGAEARIPGVYT-GGDWQSAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL++   SCGACFEIKC  +  +C  G   + VT T+ CP + A    
Sbjct  63   QGYGVNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALPND  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV V
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG G++ +V VK      WI M RNWG+ 
Sbjct  183  TNVAGAGNIVRVSVKGS-RTGWISMSRNWGQN  213



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 132/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEY  437
            +++  +A      +L  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYS-GGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGS-RTGWMSLSRNWGQN  211



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 129/214 (60%), Gaps = 23/214 (11%)
 Frame = -3

Query  577  MRLSLLIVLVVALPCVFAHKSE-----------WKEAHATYYGAPE--GTIGGACGFEE-  440
            M L  +IV + +L  V    +E           W+ AHAT+YG  +  GT+GGACG+   
Sbjct  1    MALLAVIVCIASLISVLQPPAEARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-  266
            Y Q Y   TAALS AL+N   SCGACFEIKC +E ++C  G   + VT T+ CP + A  
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYALP  120

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++KGG++FTI G   FNLV
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKKGGIRFTINGFRYFNLV  180

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             +TNVAG GD+ +V +K      W+ M RNWG+ 
Sbjct  181  LITNVAGAGDIVRVSIKGS-RTGWMSMSRNWGQN  213



>ref|XP_007037392.1| Expansin A1, ALPHA 1.2,EXPA1 [Theobroma cacao]
 gb|EOY21893.1| Expansin A1, ALPHA 1.2,EXPA1 [Theobroma cacao]
Length=290

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 130/212 (61%), Gaps = 18/212 (8%)
 Frame = -3

Query  592  AMAAEMRLSLLIVLVVALPCVFAHK----SEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            ++  E  ++L  ++++    +F+H       W  AHAT+YG  +  GT+GGACG+   Y 
Sbjct  36   SLQLEREMALFGLVLMGFLPLFSHAYGYGGGWIGAHATFYGGGDASGTMGGACGYGNLYS  95

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKCV +  +C  G   + VT T+ CP + A    
Sbjct  96   QGYGTNTAALSTALFNNGLSCGACFEIKCVNDPRWCLPGS--IVVTATNFCPPNSALPNT  153

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PPH HFDLSQP F  IA++  G+VPV YR+V C+++GG++FTI G+  FNLV +
Sbjct  154  AGGWCNPPHHHFDLSQPVFQRIAQYRAGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLI  213

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNV G GD+  V +K   +  W  M RNWG+ 
Sbjct  214  TNVGGAGDVHSVSIKGSKIG-WQPMSRNWGQN  244



>ref|NP_001266044.1| expansin-A5-like precursor [Cicer arietinum]
 emb|CAC19183.2| alpha-expansin [Cicer arietinum]
Length=245

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 122/194 (63%), Gaps = 9/194 (5%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKS--EWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LL + +  +  V  H     W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  8    LLGIFLYKVSHVKGHGGHVSWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALS  67

Query  400  PALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPA  224
             AL+N   SCGAC+EIKCV   ++C  G   + VT T+ CP     C PP+ HFDLSQP 
Sbjct  68   TALFNNGLSCGACYEIKCVNDPQWCIAG-SSIVVTATNFCPP-GGWCDPPNHHFDLSQPI  125

Query  223  FHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADG  44
            F +IA+++ G+VPV YR+V+C+RKGG++FTI G+  FNLV VTNV G GD+  V +K   
Sbjct  126  FQQIAQYKAGIVPVAYRRVRCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAIKGS-  184

Query  43   VKEWIEMKRNWGEK  2
               W  M RNWG+ 
Sbjct  185  RSRWQAMSRNWGQN  198



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 134/213 (63%), Gaps = 19/213 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            MAA++   + ++L  A      +P V+     W  AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAAKVITLMAVMLATAFTVHARIPGVYT-GGPWVNAHATFYGGADASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCG+CFE+KC+ +  +C  G+  + +T T+ CP     AS
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F  IA+++ G+VPV YR++ C++KGG++FTI G   FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VTNVAG GD+ KV VK     +W+++ RNWG+ 
Sbjct  180  VTNVAGAGDVRKVSVKGTNT-QWLDLSRNWGQN  211



>ref|XP_002876856.1| ATEXPA15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53115.1| ATEXPA15 [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 124/199 (62%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            +L+   V +  V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  12   VLVGFAVMVCSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  71

Query  394  LYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  72   LFNNGLSCGACFEIKCQSDGAWCLPG--AIIVTATNFCPPNNALPNNAGGWCNPPLHHFD  129

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            LSQP F  IA+++ GVVPV YR+V C R+GG++FTI G+  FNLV VTNV G GD+  V 
Sbjct  130  LSQPIFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVA  189

Query  58   VKADGVKEWIEMKRNWGEK  2
            VK    + W +M RNWG+ 
Sbjct  190  VKGSRTR-WQQMSRNWGQN  207



>gb|AAG01874.1|AF291658_1 alpha-expansin 2 [Striga asiatica]
Length=207

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 121/188 (64%), Gaps = 14/188 (7%)
 Frame = -3

Query  532  VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGAC  362
            V A+ S W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SCG+C
Sbjct  18   VDAYDSGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  77

Query  361  FEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAE  206
            +EIKCV + ++C  G   + VT T+ CP ++A        C+PP  HFDLSQP    +A+
Sbjct  78   YEIKCVNDGQWCLPG--SILVTATNFCPPNNALPSDDGGWCNPPRKHFDLSQPVLQHMAK  135

Query  205  HEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIE  26
            ++ G+VPV YR+V C RKGG++FTI G+ NFNLV VTNV+G GD+  V VK      W+ 
Sbjct  136  YKAGIVPVVYRRVPCIRKGGIRFTINGHTNFNLVLVTNVSGAGDVHSVSVKGSKT-SWVA  194

Query  25   MKRNWGEK  2
            M RNWG  
Sbjct  195  MSRNWGHN  202



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 134/216 (62%), Gaps = 20/216 (9%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVAL-------PCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-  446
            +AM   + ++ L + V+ L       P +++  S W+ AHAT+YG  +  GT+GGACG+ 
Sbjct  1    MAMNPRILVTALPLFVLFLSFADARIPGIYS-GSAWQSAHATFYGGSDASGTMGGACGYG  59

Query  445  EEYKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDA  269
              Y Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A
Sbjct  60   NLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFA  119

Query  268  R-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFN  110
            +       C+PP  HFDL+ P F +IAE+  G+VP+ YR+V C+++GG++FTI G+  FN
Sbjct  120  QPSDNGGWCNPPRAHFDLAMPMFLKIAEYRAGIVPISYRRVPCRKRGGIRFTINGHRYFN  179

Query  109  LVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            LV +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  LVLITNVAGAGDIVRASVKGS-RTGWMSLSRNWGQN  214



>gb|EYU26594.1| hypothetical protein MIMGU_mgv1a012061mg [Erythranthe guttata]
Length=262

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 131/215 (61%), Gaps = 19/215 (9%)
 Frame = -3

Query  595  IAMAAEMRL---SLLIVLVVALPCVFA--HKSEWKEAHATYYGAPE--GTIGGACGF-EE  440
            +A AA + L   S+L  +  A   +F       W+ AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAAAATLLLYIGSILCFITTARAKIFGVYAGGPWQNAHATFYGGSDASGTMGGACGYGNL  60

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKC---VESEFCKKGHKPVEVTVTDSCPASDA  269
            Y Q Y   TAALS AL+N   SCGACFEIKC    +S+ C  G   + +T T+ CP ++A
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDSKSCNPGSPSILITATNFCPPNNA  120

Query  268  R-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFN  110
                    C+PP  HFDL+ P F +IAE   G+V V YR+V C+++GGV+FT+ G+  FN
Sbjct  121  LPNDNGGWCNPPRTHFDLAVPMFIKIAEFRAGIVAVNYRRVACRKQGGVRFTVNGSKYFN  180

Query  109  LVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            LV +TNVAG GD+ +V +K     +W+ M RNWG+
Sbjct  181  LVLITNVAGAGDIVRVSIKGTNT-QWLTMSRNWGQ  214



>gb|EYU35820.1| hypothetical protein MIMGU_mgv1a012373mg [Erythranthe guttata]
Length=252

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 130/209 (62%), Gaps = 14/209 (7%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIY  425
            + +   + ++ L+ L+  +      +  W +AHAT+YG  +  GT+GGACG+   Y Q Y
Sbjct  1    MGLRGFIAIACLLFLLSIIVANGGSERGWNDAHATFYGGGDASGTMGGACGYGNLYSQGY  60

Query  424  SPYTAALSPALYNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCPASDAR------  266
               TAALS  L+N  +SCGACFE+KCV  E +C +    + VT T+ CP ++A       
Sbjct  61   GTNTAALSTTLFNNGQSCGACFELKCVNDERWCLQ--SSIVVTATNFCPPNNALPNNDGG  118

Query  265  -CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNV  89
             C+PP+ HFDLSQP F +IA+ E G+VP+ YR+V C++KGG++FT+ G+  FNLV +TNV
Sbjct  119  WCNPPNQHFDLSQPVFQQIAKQEAGIVPILYRRVPCQKKGGIRFTVNGHSYFNLVLITNV  178

Query  88   AGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             G GD++ V +K      W  M RNWG+ 
Sbjct  179  GGAGDVQSVSIKGS-RTNWEPMSRNWGQN  206



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 131/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            +++ A      L L + LV A +P V+     W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYT-GGAWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPS  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++F I G+  FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  180  ITNVAGAGDIVKVSVKGSKTG-WMSMSRNWGQN  211



>ref|XP_009129300.1| PREDICTED: expansin-A23-like [Brassica rapa]
 gb|AGM16365.1| alpha-expansin protein 25 [Brassica rapa]
Length=246

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 131/201 (65%), Gaps = 11/201 (5%)
 Frame = -3

Query  577  MRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAA  407
            M  S+  V+++A+  V    + W++AHAT+YG   G  T+ GACG+ + +++ Y   TAA
Sbjct  1    MNRSMSFVMILAI-LVSVADAAWEDAHATFYGDISGKETMQGACGYGDLFQEGYGLETAA  59

Query  406  LSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDA------RCSPPHVH  245
            LS AL+N  ++CGACFE+ CV S++CK+    + +T T+ CP +         C+PP+ H
Sbjct  60   LSTALFNNGQTCGACFELTCVNSQWCKQNAGTIRITATNFCPPNYTPPVDIHWCNPPNKH  119

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDLS   F  IAE++ G+VPVK+R+V+C+++GGV+F + GNPNF +V V NV G GD+  
Sbjct  120  FDLSMKMFTSIAEYKSGIVPVKFRRVKCQKRGGVRFEVKGNPNFIMVLVYNVGGAGDVNS  179

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            + +K      WI M+RNWG+ 
Sbjct  180  LAIKGHK-SNWISMQRNWGQN  199



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 131/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+    A + +SL+ V    +P V+   + W+ AHAT+YG  +  GT+ GACG+   Y 
Sbjct  4    VSVSTCIATLLISLMWVAEARIPGVYTGGA-WQGAHATFYGGSDASGTMXGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   T ALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLI  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK  G   W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKGAGTG-WMSMSRNWGQN  213



>gb|AAC32927.1| putative expansin [Arabidopsis thaliana]
Length=248

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 125/202 (62%), Gaps = 15/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPC-VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            L + +    A+ C V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  4    LGIALFCFAAMVCSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAAL  63

Query  403  SPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        C+PP  
Sbjct  64   STALFNNGLSCGACFEIKCQSDGAWCLPG--AIIVTATNFCPPNNALPNNAGGWCNPPLH  121

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDLSQP F  IA+++ GVVPV YR+V C R+GG++FTI G+  FNLV VTNV G GD+ 
Sbjct  122  HFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVH  181

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
             V VK    + W +M RNWG+ 
Sbjct  182  SVAVKGSRTR-WQQMSRNWGQN  202



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 15/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +SL  +     L     +   +P VF+  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  6    ISLTLLCFTSLLPFFTSVNARIPGVFSTGS-WETAHATFYGGSDASGTMGGACGYGNLYS  64

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP + A    
Sbjct  65   QGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSD  124

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV +R+V C+++GG++FT+ G   FNLV +
Sbjct  125  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTVNGFRYFNLVLI  184

Query  97   TNVAGGGDLEKVEVKADGVKE-WIEMKRNWGEK  2
            TNVAG GD+ KV +K  G K  W+ M RNWG+ 
Sbjct  185  TNVAGAGDIVKVSIK--GTKTGWMSMSRNWGQN  215



>emb|CDY45181.1| BnaA06g33850D [Brassica napus]
Length=248

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 125/205 (61%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPC----VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            +SLL + ++        V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MSLLGIFLLGFAAMASSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        C+P
Sbjct  61   AALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIVVTATNFCPPNNALPNTAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI G+  FNLV VTNV G G
Sbjct  119  PLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGAG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V VK    K W  M RNWG+ 
Sbjct  179  DVRSVAVKGSRTK-WQPMSRNWGQN  202



>ref|XP_002870966.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47225.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 135/214 (63%), Gaps = 21/214 (10%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA-------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-  440
            MAA + ++L+ V+VV        +P V+     W  AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAARV-ITLMAVMVVTAFTVNAKIPGVYT-GGPWINAHATFYGEADASGTMGGACGYGNL  58

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCP-----A  278
            Y Q Y   TAALS AL+N   SCG+C+E+KCV    +C  G+  + VT T+ CP     A
Sbjct  59   YSQGYGVNTAALSTALFNNGLSCGSCYELKCVNDPGWCLPGNPSILVTATNFCPPNFNQA  118

Query  277  SD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
            SD    C+PP  HFDL+ P F  IA+++ G+VPV YR++ C++KGG++FTI G   FNLV
Sbjct  119  SDDGGWCNPPREHFDLAMPMFLTIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLV  178

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             VTNVAG GD+ KV VK     +W+++ RNWG+ 
Sbjct  179  LVTNVAGAGDVNKVSVKGTNT-QWLDLSRNWGQN  211



>ref|XP_010029307.1| PREDICTED: expansin-A10-like [Eucalyptus grandis]
 gb|KCW56204.1| hypothetical protein EUGRSUZ_I01954 [Eucalyptus grandis]
Length=244

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 120/191 (63%), Gaps = 8/191 (4%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            L+   V +   + +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  11   LLSQFVPVSRAYGYYGGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTAL  70

Query  391  YNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFHE  215
            +N   SCGACFE++CV + ++C  G   + VT T+ CP     C PP +HFDLSQP F  
Sbjct  71   FNNGLSCGACFELRCVNDPQWCLPG--AIVVTATNFCPPG-GWCDPPQLHFDLSQPVFQH  127

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IA++  G+VPV YR+V+C+R GG++FT+ G+  FNLV +TNV G GD+  V +K    + 
Sbjct  128  IAQYRAGIVPVAYRRVRCRRSGGIRFTVNGHSYFNLVLITNVGGAGDVHSVAIKGSRTR-  186

Query  34   WIEMKRNWGEK  2
            W  M RNWG+ 
Sbjct  187  WQPMSRNWGQN  197



>ref|NP_178409.2| expansin A15 [Arabidopsis thaliana]
 sp|O80622.2|EXP15_ARATH RecName: Full=Expansin-A15; Short=AtEXPA15; AltName: Full=Alpha-expansin-15; 
Short=At-EXP15; Short=AtEx15; AltName: Full=Ath-ExpAlpha-1.3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL59989.1| putative expansin protein [Arabidopsis thaliana]
 gb|AAM51417.1| putative expansin protein [Arabidopsis thaliana]
 gb|AAS76673.1| alpha-expansin 15 [Arabidopsis thaliana]
 gb|AAS80168.1| alpha-expansin precursor [Arabidopsis thaliana]
 gb|AEC05663.1| expansin A15 [Arabidopsis thaliana]
Length=253

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 125/202 (62%), Gaps = 15/202 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPC-VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAAL  404
            L + +    A+ C V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAAL
Sbjct  9    LGIALFCFAAMVCSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAAL  68

Query  403  SPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHV  248
            S AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A        C+PP  
Sbjct  69   STALFNNGLSCGACFEIKCQSDGAWCLPG--AIIVTATNFCPPNNALPNNAGGWCNPPLH  126

Query  247  HFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLE  68
            HFDLSQP F  IA+++ GVVPV YR+V C R+GG++FTI G+  FNLV VTNV G GD+ 
Sbjct  127  HFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVH  186

Query  67   KVEVKADGVKEWIEMKRNWGEK  2
             V VK    + W +M RNWG+ 
Sbjct  187  SVAVKGSRTR-WQQMSRNWGQN  207



>ref|XP_011075523.1| PREDICTED: expansin-A10 [Sesamum indicum]
Length=248

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 125/200 (63%), Gaps = 14/200 (7%)
 Frame = -3

Query  568  SLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSP  398
            +LL+  +  +  V  +   W +AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS 
Sbjct  6    ALLVGFLAMVSHVHGYGGGWIDAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALST  65

Query  397  ALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
            AL+N   SCG+C+EI+CV E  +C  G   + VT T+ CP ++A        C+PP  HF
Sbjct  66   ALFNNGLSCGSCYEIRCVNERRWCLPG--SIVVTATNFCPPNNALPNNAGGWCNPPLRHF  123

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DLSQP F  IA+++ G+VPV YR+V C+R+GG++FTI G+  FNLV +TNV G GD+  V
Sbjct  124  DLSQPVFQHIAQYKAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAV  183

Query  61   EVKADGVKEWIEMKRNWGEK  2
             +K      W  M RNWG+ 
Sbjct  184  SIKGS-RTGWQPMSRNWGQN  202



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 133/217 (61%), Gaps = 23/217 (11%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA--------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
            M+A ++L L I   +         +P +++    W+ AHAT+YG  +  GT+GGACG+  
Sbjct  1    MSAPIKLLLCIATFICFLTSAQARIPGIYS-GGPWQGAHATFYGGSDASGTMGGACGYGN  59

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKC---VESEFCKKGHKPVEVTVTDSCPASD  272
             Y Q Y   TAALS AL+N   SCGACFEI+C    + ++C  G   + VT T+ CP + 
Sbjct  60   LYSQGYGVNTAALSTALFNNGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNF  119

Query  271  AR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNF  113
            A+       C+PP  HFDL+ P F +IA++  G+VPV YR++ C+++GG++FTI G   F
Sbjct  120  AQPSDNGGWCNPPRTHFDLAMPMFLKIAQYRAGIVPVNYRRIPCRKQGGIRFTINGFRYF  179

Query  112  NLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NLV VTNVAG GD+ +V +K     +W+ M RNWG+ 
Sbjct  180  NLVLVTNVAGAGDIVRVSIKGTNT-QWVSMSRNWGQN  215



>ref|XP_008387521.1| PREDICTED: expansin-A9-like [Malus domestica]
Length=290

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 121/179 (68%), Gaps = 9/179 (5%)
 Frame = -3

Query  511  WKEAHATYYGAPEGTIGGACGFEEY-KQIYSPYTAALSPALYNEAESCGACFEIKCVES-  338
            WK AHAT Y    GT GGACG+ +  K+ Y   T ALS AL+N+ +SCGACFEI+CV+S 
Sbjct  66   WKHAHATCYEGGSGTFGGACGYHDVVKEGYGLKTVALSDALFNKGQSCGACFEIRCVDSP  125

Query  337  EFCKKGHKPVEVTVTDSCPAS-------DARCSPPHVHFDLSQPAFHEIAEHEGGVVPVK  179
            ++CK G   V VT T+ CP +          C+ P  HFD+++P F +IAE++ G+VPV+
Sbjct  126  QWCKPGQPVVSVTATNHCPPNYNLPSDNGGWCNSPREHFDIAKPIFLQIAEYKAGIVPVE  185

Query  178  YRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            YR+V CK++GG++FTITGNP FN V V NV G GD+  VEVK DG   W  +KR WG++
Sbjct  186  YRRVPCKKQGGIRFTITGNPYFNEVMVWNVGGSGDVTSVEVKGDGKLPWTPLKRMWGQR  244



>gb|AEQ55281.1| expansin [Breonia chinensis]
 gb|AEQ55296.1| expansin [Breonia chinensis]
Length=247

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 14/201 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            + L +V  +A+         W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  4    VGLFLVGFLAMVTKVHGNGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  63

Query  400  PALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVH  245
             AL+N   SCG+CFEI+CV + ++C  G   + VT T+ CP ++A        C+PP  H
Sbjct  64   TALFNNGLSCGSCFEIRCVNDPKWCLPG--TIVVTATNFCPPNNALPNNAGGWCNPPLQH  121

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDLSQP F  IA++  G+VPV YR++ C+RKGG++FTI G+  FNLV +TNV G GD+  
Sbjct  122  FDLSQPVFQHIAQYRAGIVPVAYRRLPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHS  181

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            VE+K      W +M RNWG+ 
Sbjct  182  VEIKGS-RTGWQQMSRNWGQN  201



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 128/212 (60%), Gaps = 25/212 (12%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKS-------------EWKEAHATYYGAPE--GTIGGACGF-EEYK  434
            + I+ +VAL  V A  S              W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAILRLVALASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+NE +SCGACFEIKC +   +C +G   + +T T+ CP + A    
Sbjct  61   QGYGVETAALSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSD  120

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV +
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLI  180

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +V VK      W+ + RNWG+ 
Sbjct  181  TNVAGAGDIVRVSVKGS-RTGWMPLSRNWGQN  211



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 128/215 (60%), Gaps = 20/215 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHK--------SEWKEAHATYYGAPE--GTIGGACGFEE  440
            MA    L++ + LV+A   + A            W+ AHAT+YG  +  GT+GGACG+  
Sbjct  1    MAFRHALAVTVALVLASSALLADARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGN  60

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS ALYN+   CGACFEIKC +   +CK G+  + +T T+ CP + A 
Sbjct  61   LYSQGYGVETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYAL  120

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IAE+  G+VPV +R+V C++ GG++FTI G   FNL
Sbjct  121  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNL  180

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V +TNVAG GD+ +  VK      WI M RNWG+ 
Sbjct  181  VLITNVAGAGDIVRASVKGT-RSGWIAMSRNWGQN  214



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 134/213 (63%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            ++ + + + + LSLL+ L  A +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAAMCLTSIVALSLLLTLAEARIPGVYSGGS-WQNAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFE+KC +  ++C  G   + +T T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALPN  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++F I G   FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      WI + RNWG+ 
Sbjct  180  ITNVAGAGDIVQAWVKGS-RTGWISLSRNWGQN  211



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 132/213 (62%), Gaps = 19/213 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            MAA   +S + ++++       +P V+   ++W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAARATISFISLVLLLSLVEARIPGVYT-GADWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC  E ++C  G   + +T T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPS  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+  GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCREPGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GDL KV VK      W+ M RNWG+ 
Sbjct  180  ITNVAGAGDLVKVSVKGSRTG-WMSMSRNWGQN  211



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 118/181 (65%), Gaps = 13/181 (7%)
 Frame = -3

Query  511  WKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            W  AHAT+YG  +  GT+GGACG+   Y Q Y    AALS  L+N   SCGACFE+KC +
Sbjct  33   WTTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSCGACFELKCTD  92

Query  340  SEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPV  182
             ++C  G+  + VT T+ CP + A        C+PP  HFDL+ P F +IAE+  G+VPV
Sbjct  93   QKWCTPGNPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPV  152

Query  181  KYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK-EWIEMKRNWGE  5
             YR+V C+++GG++FT+ G   FNLV VTNVAG GD++KV VK  G K  WI M RNWG+
Sbjct  153  NYRRVPCRKQGGIRFTVNGFNYFNLVLVTNVAGAGDIQKVYVK--GTKTNWIAMNRNWGQ  210

Query  4    K  2
             
Sbjct  211  N  211



>gb|AGM16361.1| alpha-expansin protein 19 [Brassica rapa]
Length=246

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 131/201 (65%), Gaps = 11/201 (5%)
 Frame = -3

Query  577  MRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAA  407
            M  S+  V+++A+  V    + W++AHAT+YG   G  T+ GACG+ + +++ Y   TAA
Sbjct  1    MNRSMSFVMILAI-LVSVADAAWEDAHATFYGDISGKETMRGACGYGDLFQEGYGLETAA  59

Query  406  LSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDA------RCSPPHVH  245
            LS AL+N  ++CGACFE+ CV S++CK+    + +T T+ CP +         C+PP+ H
Sbjct  60   LSTALFNNGQTCGACFELTCVNSQWCKQNAGTIRITATNFCPPNYTPPVDIHWCNPPNKH  119

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDLS   F  IAE++ G+VPVK+R+V+C+++GGV+F + GNPNF +V V NV G GD+  
Sbjct  120  FDLSMKMFTSIAEYKSGIVPVKFRRVKCQKRGGVRFEVKGNPNFIMVLVYNVGGAGDVNS  179

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            + +K      WI M+RNWG+ 
Sbjct  180  LAIKGHK-SNWISMQRNWGQN  199



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 128/210 (61%), Gaps = 25/210 (12%)
 Frame = -3

Query  559  IVLVVALPCVFAHKSE-------------WKEAHATYYGAPE--GTIGGACGF-EEYKQI  428
            I+ +VAL  + A  S              W+ AHAT+YG  +  GT+GGACG+   Y Q 
Sbjct  3    IMRLVALASILAFFSPAAARIMGVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQG  62

Query  427  YSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-----  266
            Y   TAALS AL+N+ +SCGACFEIKCV E ++C  G   + +T T+ CP + A      
Sbjct  63   YGVETAALSTALFNDGQSCGACFEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSDNG  122

Query  265  --CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTN  92
              C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV +TN
Sbjct  123  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITN  182

Query  91   VAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VAG GD+ +V VK      W+ M RNWG+ 
Sbjct  183  VAGAGDIVRVSVKGS-RTGWMPMSRNWGQN  211



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 131/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +S+    A + +SL+ V    +P V+   + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    VSVSTCIATLLISLMWVAEARIPGVYTGGA-WQGAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   T ALS AL+N   SCGACFEIKC  +  +C  G   + +T T+ CP + A+   
Sbjct  63   QGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSD  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLI  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  183  SNVAGAGDIVRVSVKG-ARTGWMSMSRNWGQN  213



>ref|XP_009419260.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 117/183 (64%), Gaps = 12/183 (7%)
 Frame = -3

Query  517  SEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKC  347
            S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+NE +SCGACFEIKC
Sbjct  30   SPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSCGACFEIKC  89

Query  346  VES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGV  191
             +   +C  G   + +T T+ CP + A        C+PP  HFDLS P F +IAE+  G+
Sbjct  90   ADDLRWCHGGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLSMPMFLKIAEYRAGI  149

Query  190  VPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNW  11
            VPV YR+V C++ GG++FTI G   FNLV +TNVAG GD+ +  VK      W+ M RNW
Sbjct  150  VPVSYRRVPCRKSGGIRFTINGFNYFNLVLITNVAGAGDIIRASVKGS-RTGWMPMSRNW  208

Query  10   GEK  2
            G+ 
Sbjct  209  GQN  211



>ref|XP_010651411.1| PREDICTED: expansin-A10 [Vitis vinifera]
 ref|XP_010651412.1| PREDICTED: expansin-A10 [Vitis vinifera]
 emb|CAN82746.1| hypothetical protein VITISV_024594 [Vitis vinifera]
 emb|CBI16572.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 123/199 (62%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            +++ L+  L  V      W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    IIVALLTGLKSVEGFGGGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCGAC+E+KCV +  +C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  67   LFNNGLSCGACYEVKCVNDKRWCLPG--SITVTATNFCPPNNALTNNAGGWCNPPLQHFD  124

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            LSQP F  IA+++ G+VPV+YR+V CK+ GG++FT+ G+  FNLV +TNV G GD+  V 
Sbjct  125  LSQPVFQHIAQYKAGIVPVQYRRVACKKTGGIRFTVNGHSYFNLVLITNVGGAGDVVSVS  184

Query  58   VKADGVKEWIEMKRNWGEK  2
            +K      W  M RNWG+ 
Sbjct  185  IKGS-KTSWQAMSRNWGQN  202



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 20/213 (9%)
 Frame = -3

Query  583  AEMRLSLLIVLVVALPCVFAHK--------SEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            A  RL LL ++ +    V AH           W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  2    AHHRLGLLCIVFLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLY  61

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC +   +C  G+  + VT T+ CP + A+  
Sbjct  62   SQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFAQPS  121

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IA++  G+VPV +R+V C+++GG++FTI G   FNLV 
Sbjct  122  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVL  181

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VTNVAG GD+  V +K     +W+ M RNWG+ 
Sbjct  182  VTNVAGAGDIVNVWIKGS-ETDWMSMSRNWGQN  213



>ref|NP_001266033.1| expansin-A15-like precursor [Cicer arietinum]
 emb|CAD33924.1| alpha-expansin 4 [Cicer arietinum]
Length=248

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 123/199 (62%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL+  +      FA+   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS +
Sbjct  7    LLVSFLTMFSSAFAYGEGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTS  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCG+C+EI+C  + ++C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  67   LFNNGLSCGSCYEIRCANDHKWCLPG--SIVVTATNFCPPNNALPNNEGGWCNPPLHHFD  124

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            L+QP F  IA+++ G+VPV YR+V C+R+GG++FT+ G+  FNLV +TNV G GD+    
Sbjct  125  LAQPVFLRIAQYKAGIVPVDYRRVSCRRRGGIRFTVNGHSYFNLVLITNVGGAGDVHAAS  184

Query  58   VKADGVKEWIEMKRNWGEK  2
            +K      WI M RNWG+ 
Sbjct  185  IKGSKTG-WISMSRNWGQN  202



>ref|XP_008219462.1| PREDICTED: expansin-A16-like [Prunus mume]
Length=259

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 125/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  511  WKEAHATYYGAPEGTIGGACGFEEYKQI-YSPYTAALSPALYNEAESCGACFEIKCVES-  338
            WK+AHAT+Y    GT GGACG+ +  Q  Y   T ALS AL+N  +SCGAC++IKCV+  
Sbjct  36   WKQAHATFYEGGSGTFGGACGYHDVVQEGYGLETVALSNALFNNGQSCGACYDIKCVDQP  95

Query  337  EFCKKGHKPVEVTVTDSCP-----ASD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVK  179
            ++CK G   + VT T++CP     ASD    C+PP  HFD+++P F  IAE++ G+VPV+
Sbjct  96   QWCKPGSPILHVTATNNCPPNWNQASDNGGWCNPPREHFDIAKPVFINIAEYKAGIVPVE  155

Query  178  YRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            YR+V C++KGG++FTITGNP FN V V NVAG GD+  V+VK + +K W  MKR WG++
Sbjct  156  YRRVPCQKKGGIRFTITGNPYFNEVLVWNVAGAGDVVSVQVKGNKLK-WTMMKRMWGQR  213



>ref|XP_002881669.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57928.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 133/212 (63%), Gaps = 16/212 (8%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYK  434
            +A+   +  +  ++  +A   +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYS-GSAWQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP + A+   
Sbjct  60   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  119

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV +
Sbjct  120  NGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLI  179

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  TNVAGAGDIVRASVKGS-RTGWMSLSRNWGQN  210



>gb|KFK33492.1| hypothetical protein AALP_AA5G020100 [Arabis alpina]
Length=255

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 128/212 (60%), Gaps = 17/212 (8%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPC---VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            + M   + L + ++    + C   V  + + W  AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MFMGKMVPLGVFLMGFAVMVCSVHVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  +  +C  G   + VT T+ CP ++A    
Sbjct  61   QGYGTNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPG--SIVVTATNFCPPNNALPNN  118

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDLSQP F  IA+++ GVVPV YR+V CKR+GG++FTI G+  FNLV V
Sbjct  119  AGGWCNPPLHHFDLSQPIFQHIAQYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLV  178

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNV G GD+  V VK      W +M RNWG+ 
Sbjct  179  TNVGGAGDVHSVAVKGS-RTSWQQMSRNWGQN  209



>ref|NP_001288907.1| expansin-A15-like precursor [Brassica rapa]
 gb|AGM16357.1| alpha-expansin protein 15 [Brassica rapa]
Length=253

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 126/206 (61%), Gaps = 18/206 (9%)
 Frame = -3

Query  574  RLSLLIVLVVALPC----VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPY  416
            ++SLL + ++        V  + + W  AHAT+YG  +  GT+GGACG+   Y Q Y   
Sbjct  5    KMSLLGIFLLGFAAMASSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTN  64

Query  415  TAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CS  260
            TAALS AL+N   SCGACFEI+C  +  +C  G   + VT T+ CP ++A        C+
Sbjct  65   TAALSTALFNNGLSCGACFEIRCQSDGAWCLPG--AIVVTATNFCPPNNALPNTAGGWCN  122

Query  259  PPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGG  80
            PP  HFDLSQP F  IA ++ GVVPV YR+V CKR+GG++FTI G+  FNLV VTNV G 
Sbjct  123  PPLHHFDLSQPIFQRIAHYKAGVVPVSYRRVPCKRRGGIRFTINGHSYFNLVLVTNVGGA  182

Query  79   GDLEKVEVKADGVKEWIEMKRNWGEK  2
            GD+  + VK    K W  M RNWG+ 
Sbjct  183  GDVRSMAVKGSRTK-WQPMSRNWGQN  207



>ref|XP_010505648.1| PREDICTED: expansin-A4 [Camelina sativa]
Length=257

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 133/212 (63%), Gaps = 16/212 (8%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYK  434
            +A+   +  +  ++  +A   +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYS-GSSWQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP + A+   
Sbjct  60   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  119

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNL+ +
Sbjct  120  NGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILI  179

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  TNVAGAGDIVRANVKGS-RTGWMSLSRNWGQN  210



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 131/211 (62%), Gaps = 16/211 (8%)
 Frame = -3

Query  592  AMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQ  431
            A+AA + L L    ++A   +P V+    +W+ AHAT+YG  +  GT+GGACG+   Y Q
Sbjct  7    AVAATVALVLASSALLADARIPGVYT-GGQWQSAHATFYGGSDASGTMGGACGYGNLYSQ  65

Query  430  IYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR----  266
             Y   TAALS AL+N+  SCGACFEIKC +   +CK G   + +T T+ CP + A     
Sbjct  66   GYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYALPSDD  125

Query  265  ---CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVT  95
               C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV +T
Sbjct  126  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLIT  185

Query  94   NVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NVAG GD+ +  VK      W+ M RNWG+ 
Sbjct  186  NVAGAGDIIRATVKGS-RTGWMPMSRNWGQN  215



>gb|AFZ78602.1| expansin protein [Populus tomentosa]
Length=241

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 122/192 (64%), Gaps = 8/192 (4%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL+  +  +  V  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    LLVGFLSIVSSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGANTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFH  218
            L++   SCGACFEI+CV + ++C +G   + +T T+ CP     C PP+ HFDLSQP F 
Sbjct  67   LFDNGLSCGACFEIRCVNDPKWCLRG--SIVITATNFCPPG-GWCDPPNKHFDLSQPVFQ  123

Query  217  EIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK  38
             IA++  G+VPV YR+V+C++ GG++FTI G+  FNLV VTNV G GD+  V +K    +
Sbjct  124  HIAQYRAGIVPVIYRRVRCRKSGGIRFTINGHSYFNLVLVTNVGGAGDVRSVAIKGSRTR  183

Query  37   EWIEMKRNWGEK  2
             W  M RNWG+ 
Sbjct  184  -WQAMSRNWGQN  194



>gb|AGF90536.1| expansin 2 [Ammopiptanthus nanus]
Length=248

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 129/205 (63%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVF----AHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            ++L+ +L+VA   +F    A+   W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MALIGLLLVAFLTMFSSAHAYAEGWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N   SCG+C+EI+CV +  +C  G   + VT T+ CP ++A        C+P
Sbjct  61   AALSTALFNNGLSCGSCYEIRCVSDHRWCLPG--SIMVTATNFCPPNNALPNNAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDL+QP F  IA+++ G+VPV YR++ C+R+GG++FTI G+  FNLV +TNV G G
Sbjct  119  PQHHFDLAQPVFLRIAQYKAGIVPVAYRRMPCRRRGGIRFTINGHSYFNLVLITNVGGAG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+    +K      WI M RNWG+ 
Sbjct  179  DVHAAAIKGS-RTGWISMSRNWGQN  202



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 123/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V++   +W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SC
Sbjct  25   IPGVYS-GGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  370  GACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFE+KC  + ++C  G   + +T T+ CP + A        C+PP  HFDL+ P F +
Sbjct  84   GACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV YR+V C++KGG++FTI G   FNL+ +TNVAG GD+ K  VK     E
Sbjct  144  IAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSKT-E  202

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  203  WMSMSRNWGQN  213



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 134/215 (62%), Gaps = 16/215 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE  440
            ++    AA + ++LL    +    +P V+  +S W++AHAT+YG  +  GT+GGACG+  
Sbjct  1    MAFFHNAATLVMTLLAFATLGDARIPGVYTGES-WQKAHATFYGGSDASGTMGGACGYGN  59

Query  439  -YKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS AL+N+  SCGACFEIKC +  ++C  G   + +T T+ CP + A 
Sbjct  60   LYSQGYGVETAALSTALFNDGLSCGACFEIKCADDPQWCHHGGPSIFITATNFCPPNYAL  119

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F +IA++  G+VPV YR+V C++ GG++FTI G   FNL
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNL  179

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V +TNVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  180  VLITNVAGAGDIVRVSVKGSHTG-WMPMSRNWGQN  213



>ref|XP_003621258.1| Alpha-expansin [Medicago truncatula]
Length=230

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 8/176 (5%)
 Frame = -3

Query  517  SEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKC  347
            + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SCGAC+EIKC
Sbjct  12   ASWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIKC  71

Query  346  V-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRK  170
            V + ++C  G   + VT T+ CP     C PP+ HFDLSQP F  IA++  G+VPV YR+
Sbjct  72   VNDPQWCNPG--SIIVTATNFCPPG-GWCDPPNHHFDLSQPIFQHIAQYRAGIVPVAYRR  128

Query  169  VQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V+CKR+GG++FTI G+  FNLV VTNV G GD+  V +K      W  M RNWG+ 
Sbjct  129  VRCKRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAIKGS-RSRWQAMSRNWGQN  183



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 131/214 (61%), Gaps = 20/214 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVV-------ALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EE  440
            MA+  R+  L+ L++        +P V+     W+ AHAT+YG  +  GT+GGACG+   
Sbjct  49   MASVSRVVGLVSLILFSTLAEARIPGVYT-GGPWQSAHATFYGGSDASGTMGGACGYGNL  107

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-  266
            Y Q Y   TAALS AL+N   SCGACFEIKC  E ++C  G   + VT T+ CP + A  
Sbjct  108  YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALP  167

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV
Sbjct  168  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLV  227

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             VTNVAG GD+ K+ VK      W+ M RNWG+ 
Sbjct  228  LVTNVAGAGDINKLWVKGSKTG-WMSMSRNWGQN  260



>ref|XP_006366709.1| PREDICTED: expansin-A10-like [Solanum tuberosum]
Length=241

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 125/198 (63%), Gaps = 8/198 (4%)
 Frame = -3

Query  583  AEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            A + + L+  L +A       K +W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  2    AHIVIFLVCFLAIASFVKGYGKGKWINAHATFYGGGDASGTMGGACGYGNLYNQGYGTKT  61

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDL  236
            AALS AL+N   SCG+C+EIKCV E ++C  G   ++VT T+ CP     C+PP  HFDL
Sbjct  62   AALSTALFNNGLSCGSCYEIKCVNEHKWCLSG--SIKVTATNLCPP-GGWCNPPLHHFDL  118

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F  IA++  G+VP+ YR++ C+RKGG++FTI G+  FNLV VTNV G GD+  V +
Sbjct  119  SQPIFQHIAQYRAGIVPIAYRRIPCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHAVAI  178

Query  55   KADGVKEWIEMKRNWGEK  2
            K     +W  M RNWG+ 
Sbjct  179  KGSKT-QWQSMSRNWGQN  195



>ref|XP_008219464.1| PREDICTED: expansin-A16-like [Prunus mume]
Length=262

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 123/179 (69%), Gaps = 9/179 (5%)
 Frame = -3

Query  511  WKEAHATYYGAPEGTIGGACGFEEYKQI-YSPYTAALSPALYNEAESCGACFEIKCVES-  338
            WK+AHAT+Y    GT GGACG+ +  Q  Y   T ALS AL+N  +SCGAC++IKCV+  
Sbjct  38   WKQAHATFYEGGSGTFGGACGYHDVVQEGYGLETVALSNALFNNGQSCGACYDIKCVDQP  97

Query  337  EFCKKGHKPVEVTVTDSCP-----ASD--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVK  179
            ++CK G+  + VT T++CP     ASD    C+PP  HFD+++P F  IAE+  G+VP++
Sbjct  98   QWCKPGNPILHVTATNNCPPNWNQASDNGGWCNPPREHFDIAKPVFLNIAEYSAGIVPIE  157

Query  178  YRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            YR+V C++KGG++FTITGNP FN V V NVAG GD+  V+VK     +W  MKR WG++
Sbjct  158  YRRVSCQKKGGIRFTITGNPYFNEVLVWNVAGVGDVVSVQVKGHDKLKWTMMKRMWGQR  216



>ref|XP_006440617.1| hypothetical protein CICLE_v10021897mg [Citrus clementina]
 gb|ESR53857.1| hypothetical protein CICLE_v10021897mg [Citrus clementina]
 gb|KDO55537.1| hypothetical protein CISIN_1g025919mg [Citrus sinensis]
Length=246

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 119/181 (66%), Gaps = 14/181 (8%)
 Frame = -3

Query  511  WKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCV-  344
            W +AHAT+YG  +  GT+GGACG+   Y + Y   TAALS AL+N   SCGACFEIKCV 
Sbjct  23   WTDAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTAALSTALFNNGMSCGACFEIKCVN  82

Query  343  ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVP  185
            +  +C+ G   + VT T+ CP ++A        C+PP  HFDLSQP F +IA+++ G+VP
Sbjct  83   DPRWCRPGS--IFVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFEQIAQYKAGIVP  140

Query  184  VKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            V YR+V C RKGG++FTI G+  FNLV +TNV G GD+  V +K     +W  M RNWG+
Sbjct  141  VSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGS-RTDWQPMSRNWGQ  199

Query  4    K  2
             
Sbjct  200  N  200



>gb|ABN09939.1| expansin A4 [Musa acuminata AAA Group]
Length=258

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 124/191 (65%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V+    +W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+NE +SC
Sbjct  23   IPGVYT-GGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSC  81

Query  370  GACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFEIKC E  ++C +G   + +T T+ CP + A        C+PP  HFDL+ PAF +
Sbjct  82   GACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLK  141

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV +R+V C++ GG++FTI G   FNLV +TNVAG GD+ +  VK      
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRASVKGS-RTG  200

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  201  WMPMSRNWGQN  211



>gb|KDP31268.1| hypothetical protein JCGZ_11644 [Jatropha curcas]
Length=248

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 122/199 (61%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
             L+  +  +  V      W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  8    FLVGFLSLISFVSGDNGGWVNAHATFYGGGDASGTMGGACGYGNLYNQGYGTNTAALSTA  67

Query  394  LYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCGACFEIKC +  ++C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  68   LFNNGFSCGACFEIKCTDDPKWCLPGS--IVVTATNFCPPNNALPNNAGGWCNPPQHHFD  125

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            LSQP F  IA++  G+VPV YR+V C+R+GG++FTI G+  FNLV +TNV G GD++ V 
Sbjct  126  LSQPIFQRIAQYRAGIVPVSYRRVPCQRRGGIRFTINGHSYFNLVLITNVGGAGDVQAVS  185

Query  58   VKADGVKEWIEMKRNWGEK  2
            VK     +W  M RNWG+ 
Sbjct  186  VKGS-RTDWQPMSRNWGQN  203



>ref|XP_011035781.1| PREDICTED: expansin-A10 [Populus euphratica]
Length=241

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 122/192 (64%), Gaps = 8/192 (4%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            LL+  +  +  V  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    LLVGFLSIVSSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGANTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFH  218
            L++   SCGACFEI+CV + ++C +G   + VT T+ CP     C PP+ HFDLSQP F 
Sbjct  67   LFDNGLSCGACFEIRCVNDPKWCLRG--SIVVTATNFCPPG-GWCDPPNKHFDLSQPVFQ  123

Query  217  EIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK  38
             IA++  G+VPV YR+V+C++ GG++FTI G+  FNLV +TNV G GD+  V +K    +
Sbjct  124  HIAQYRAGIVPVIYRRVRCRKSGGIRFTINGHSYFNLVLITNVGGAGDVRSVAIKGSRTR  183

Query  37   EWIEMKRNWGEK  2
             W  M RNWG+ 
Sbjct  184  -WQAMSRNWGQN  194



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 126/203 (62%), Gaps = 15/203 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPYTAALS  401
            L  L      +P V+A    W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  15   LCFLTSAQARIPGVYA-GGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  73

Query  400  PALYNEAESCGACFEIKC---VESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPH  251
             AL+N   SCGACFEIKC    +S++C  G   + VT T+ CP + A        C+PP 
Sbjct  74   TALFNNGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFALPNDNGGWCNPPR  133

Query  250  VHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDL  71
             HFDL+ P F +IA++  G+VPV +R++ C+++GG++FTI G   FNLV VTNVAG GD+
Sbjct  134  THFDLAMPMFLKIAQYRAGIVPVNFRRIPCRKQGGMRFTINGFRYFNLVLVTNVAGAGDI  193

Query  70   EKVEVKADGVKEWIEMKRNWGEK  2
             +V +K     +WI M RNWG+ 
Sbjct  194  VRVSIKGTNT-QWISMSRNWGQN  215



>ref|XP_010508990.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 133/212 (63%), Gaps = 16/212 (8%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYK  434
            +A+   +  +  ++  +A   +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAIKLAILFTTFVLFNLADARIPGVYS-GSSWQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP + A+   
Sbjct  60   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  119

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNL+ +
Sbjct  120  NGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILI  179

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  TNVAGAGDIVRANVKGS-RTGWMSLSRNWGQN  210



>ref|XP_006650810.1| PREDICTED: expansin-A7-like [Oryza brachyantha]
Length=264

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 118/184 (64%), Gaps = 14/184 (8%)
 Frame = -3

Query  514  EWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCV  344
            +W+ AHAT+YG  +  GT+GGACG+   Y Q Y    AALS AL+NE +SCGACFEIKCV
Sbjct  35   DWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGQSCGACFEIKCV  94

Query  343  ES---EFCKKGHKPVEVTVTDSCPASDA-------RCSPPHVHFDLSQPAFHEIAEHEGG  194
                 ++C  G   + +T T+ CP + A        C+PP  HFDL+ P F  IAE+  G
Sbjct  95   NQPGWKWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLHIAEYRAG  154

Query  193  VVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRN  14
            +VPV YR+V C++KGGV+FTI G   FNLV +TNVAG GD+ +  VK  G   W+ M RN
Sbjct  155  IVPVSYRRVPCRKKGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKG-GSTGWMPMSRN  213

Query  13   WGEK  2
            WG+ 
Sbjct  214  WGQN  217



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 132/212 (62%), Gaps = 20/212 (9%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +SLIA+A+        ++   +P V++  + W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  10   VSLIALAST-------IVEARIPGVYSGGA-WQGAHATFYGGSDASGTMGGACGYGNLYS  61

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + VT T+ CP + A    
Sbjct  62   QGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPND  121

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G   FNLV +
Sbjct  122  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLI  181

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ KV VK      W+ + RNWG+ 
Sbjct  182  TNVAGAGDIVKVSVKGSKTG-WMSLSRNWGQN  212



>gb|AEQ55280.1| expansin [Breonia chinensis]
 gb|AEQ55295.1| expansin [Breonia chinensis]
Length=246

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            + L ++  +A+         W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS
Sbjct  4    VGLFLIGFLAMVTNVHGYGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS  63

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
             AL+N   SCG+CF I+CV +++C  G   + VT T+ CP ++A        C+PP  HF
Sbjct  64   TALFNNGLSCGSCFAIRCVNAKWCLPG--AIVVTATNFCPPNNALPNNAGGWCNPPLHHF  121

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DLSQP F  IA+++ G+VPV YR+V C+R+GG++FTI G+  FNLV VTNV G GD+  V
Sbjct  122  DLSQPVFQHIAQYKAGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVYSV  181

Query  61   EVKADGVKEWIEMKRNWGEK  2
             +K      W +M RNWG+ 
Sbjct  182  AIKGS-RTGWQQMSRNWGQN  200



>ref|XP_006401349.1| hypothetical protein EUTSA_v10014463mg [Eutrema salsugineum]
 gb|ESQ42802.1| hypothetical protein EUTSA_v10014463mg [Eutrema salsugineum]
Length=255

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 124/193 (64%), Gaps = 14/193 (7%)
 Frame = -3

Query  547  VALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAE  377
            V   CV  + S W  A AT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N  +
Sbjct  17   VMWKCVDGYSSGWVSARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQ  76

Query  376  SCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAF  221
            SCGACF+IKCV + ++C  G   + VT T+ CP + A+       C+PP  HFDL+QP F
Sbjct  77   SCGACFQIKCVNDPKWCLGG--TITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIF  134

Query  220  HEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGV  41
              IA+++ GVVPV+YR+V C+RKGG++FTI G+  FNLV VTNVAG GD+  V +K    
Sbjct  135  LRIAKYKAGVVPVQYRRVACRRKGGMRFTINGHSYFNLVLVTNVAGAGDVVSVSIKGT-R  193

Query  40   KEWIEMKRNWGEK  2
              W  M RNWG+ 
Sbjct  194  TGWQSMSRNWGQN  206



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = -3

Query  568  SLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSP  398
            SL +     +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS 
Sbjct  14   SLFVSTSARIPGVYTGGS-WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  72

Query  397  ALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
            AL+N   SCGACFEIKC +   +C  G+  + +T T+ CP + A        C+PP  HF
Sbjct  73   ALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPNDNGGWCNPPRPHF  132

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DL+ P F +IA++  G+VPV +R+V C++ GG++FTI G   FNLV +TNVAG GD+ +V
Sbjct  133  DLAMPMFLKIAQYRAGIVPVAFRRVACRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRV  192

Query  61   EVKADGVKEWIEMKRNWGEK  2
             VK      W+ M RNWG+ 
Sbjct  193  SVKGSKT-AWLSMSRNWGQN  211



>ref|XP_011071693.1| PREDICTED: expansin-A1-like [Sesamum indicum]
Length=250

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 132/206 (64%), Gaps = 19/206 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVF--AHKSE---WKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPY  416
            +SL+  ++     +F  AH  +   W +AHAT+YG  +  GT+GGACG+   Y + Y   
Sbjct  1    MSLITQILACFFSLFFLAHGGDEDGWSQAHATFYGGGDASGTMGGACGYGNLYSEGYGTN  60

Query  415  TAALSPALYNEAESCGACFEIKCVESE-FCKKGHKPVEVTVTDSCPASDAR-------CS  260
            TAALS  L++E + CGACFE+KCV  E +C +    + VT T+ CP +DA        C+
Sbjct  61   TAALSTTLFDEGQRCGACFELKCVNDEQWCLR--NSIVVTATNFCPPNDALPNDNGGWCN  118

Query  259  PPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGG  80
            PP+ HFDLSQP F ++A+++ G+VPV YR+V C++KGG++FTI G+  FNLV +TNVAG 
Sbjct  119  PPNHHFDLSQPVFQKLAKYQAGIVPVLYRRVACQKKGGIRFTINGHTYFNLVLITNVAGA  178

Query  79   GDLEKVEVKADGVKEWIEMKRNWGEK  2
            GD++ V VK      W  M RNWG+ 
Sbjct  179  GDVQSVSVKGSNTG-WQPMSRNWGQN  203



>ref|XP_010517323.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 133/212 (63%), Gaps = 16/212 (8%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVA---LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYK  434
            +A+   +  +  ++  +A   +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAIKLAILFTTFVLFNLADARIPGVYS-GSSWQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP + A+   
Sbjct  60   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  119

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNL+ +
Sbjct  120  NGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILI  179

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  TNVAGAGDIVRANVKGS-RTGWMSLSRNWGQN  210



>ref|XP_011011315.1| PREDICTED: expansin-A8-like [Populus euphratica]
Length=254

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 130/212 (61%), Gaps = 14/212 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            +++ AM   + + L +VL   L  ++     W+  HAT+YG  +  GT+GGACG+   Y 
Sbjct  1    MAIKAMQDFVFVQLYLVLSFLLHGIYGDYGGWQVGHATFYGGSDASGTMGGACGYGNLYS  60

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACF+I+C  S ++C  G   + VT T+ CP + A    
Sbjct  61   QGYGTSTAALSTALFNNGLSCGACFQIRCNNSPKWCHSG--TITVTATNFCPPNYALSND  118

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+QPAF +IA++  G+VPV +R+V C +KGG++FTI G+  FNLV +
Sbjct  119  NGGWCNPPLQHFDLAQPAFLQIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLI  178

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+  V +K      W  M RNWG+ 
Sbjct  179  TNVAGAGDVHAVSIKGS-RTGWQTMSRNWGQN  209



>ref|XP_008458865.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=263

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 119/181 (66%), Gaps = 12/181 (7%)
 Frame = -3

Query  511  WKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPYTAALSPALYNEAESCGACFEIKCV-  344
            W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N+  SCGACFEIKCV 
Sbjct  39   WQNAHATFYGGNDAAGTMGGACGYGNLYSQGYGVNTAALSTALFNDGYSCGACFEIKCVN  98

Query  343  ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAEHEGGVVP  185
            + ++C  G+  + VT T+ CP + A        C+PP  HFDLS P F +IA++  G+VP
Sbjct  99   DPQWCHAGNPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLSMPMFLKIAQYRAGIVP  158

Query  184  VKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            V +R+V C+R+GG++FTI G   FNLV +TNVAG GD+  V +K      W+ M RNWG+
Sbjct  159  VSFRRVACRREGGMRFTINGFKYFNLVLITNVAGAGDIASVSIKGSKTG-WMSMTRNWGQ  217

Query  4    K  2
             
Sbjct  218  N  218



>ref|NP_001159250.1| hypothetical protein precursor [Zea mays]
 gb|ACN25588.1| unknown [Zea mays]
 tpg|DAA48582.1| TPA: hypothetical protein ZEAMMB73_726580 [Zea mays]
Length=274

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGFEEYK-QIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            WK AHAT+YG  +G  T  GACG+++ + Q Y   T A+S  L+ +  +CG C+E++CV+
Sbjct  55   WKPAHATFYGGRDGSGTTAGACGYKDTRTQGYGVQTVAVSTVLFGDGTACGGCYEVRCVD  114

Query  340  S-EFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQ  164
            S   CK     + VTVTD CP  D  C PP  HFDLS PAF +IA+ + G+VP+ YR+V 
Sbjct  115  SPSGCKPDAAALVVTVTDLCPPKDQWCKPPREHFDLSMPAFLQIAQEKAGIVPISYRRVA  174

Query  163  CKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            C ++GG+++TITGN  FN+VT+TNV G GD+  V VK     +W EMKRNWG+
Sbjct  175  CVKQGGIRYTITGNKYFNMVTITNVGGAGDIAAVSVKGSKRVKWTEMKRNWGQ  227



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 124/200 (62%), Gaps = 12/200 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LS L      +P V+     W+ AHAT+YG  +  GT+GGACG+   Y   Y    AALS
Sbjct  13   LSFLTGANAKVPGVYT-SGPWESAHATFYGGADASGTMGGACGYGNLYSAGYGVNNAALS  71

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
             AL+N   SCGACFEI+C + ++C  G+  + VT T+ CP + A        C+PP  HF
Sbjct  72   TALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHF  131

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DL++P F + A++  G+VPV YR+V CK+ GG+KFTI G   FN+V VTNVAG GD++KV
Sbjct  132  DLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIKFTINGFNYFNMVIVTNVAGAGDIQKV  191

Query  61   EVKADGVKEWIEMKRNWGEK  2
             VK    K W+ M RNWG+ 
Sbjct  192  FVKGTNTK-WMAMSRNWGQN  210



>ref|NP_195846.1| expansin A9 [Arabidopsis thaliana]
 sp|Q9LZ99.1|EXPA9_ARATH RecName: Full=Expansin-A9; Short=AtEXPA9; AltName: Full=Alpha-expansin-9; 
Short=At-EXP9; Short=AtEx9; AltName: Full=Ath-ExpAlpha-1.10; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB85531.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAK96777.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAL47389.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAM63290.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AED90451.1| expansin A9 [Arabidopsis thaliana]
Length=258

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 135/213 (63%), Gaps = 19/213 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            MAA++   + +++V A      +P V+     W  AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAAKVITFMAVMVVTAFTANAKIPGVYT-GGPWINAHATFYGEADASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCG+CFE+KC+ +  +C  G+  + +T T+ CP     AS
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFNQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F  IA+++ G+VPV YR++ C++KGG++FTI G   FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VTNVAG GD+ KV VK     +W+++ RNWG+ 
Sbjct  180  VTNVAGAGDVIKVSVKGSNT-QWLDLSRNWGQN  211



>gb|KFK34800.1| hypothetical protein AALP_AA5G194900, partial [Arabis alpina]
Length=222

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 131/204 (64%), Gaps = 17/204 (8%)
 Frame = -3

Query  571  LSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPEG---TIGGACGFEE-YKQIYSPYTAA  407
            L LL+ L  A +P V++  S W+ AHAT+YG  +    T+GGACG++  Y Q Y   TAA
Sbjct  14   LFLLLSLAEAGIPGVYS-GSSWQTAHATFYGGGDDASRTMGGACGYDNLYSQGYGTNTAA  72

Query  406  LSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPH  251
            LS AL+N   +CGACFEIKCV + ++C  G   V VT T+ CP + A+       C+PP 
Sbjct  73   LSTALFNSGLTCGACFEIKCVNDPKWCHSGAPSVFVTATNFCPPNLAQPSDNGGWCNPPR  132

Query  250  VHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDL  71
             HFDL+ P F +IAE+  G+VP+ YR+V CK+ GG++FTI G+  FNLV +TNVAG GD+
Sbjct  133  AHFDLAMPVFLKIAEYRAGIVPISYRRVACKKSGGIRFTIKGHRYFNLVLITNVAGAGDI  192

Query  70   EKVEVKADGVKE-WIEMKRNWGEK  2
             K  VK  G K  W+ + R WG+ 
Sbjct  193  VKTSVK--GTKTGWMSLTRKWGQN  214



>ref|XP_010918818.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=508

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 125/182 (69%), Gaps = 12/182 (7%)
 Frame = -3

Query  517  SEWKEAHATYYGAPEG--TIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKC  347
            S+W  AHAT+YG  +G  T  GACG+++   Q Y   TAALS AL+N+  SCGACFEIKC
Sbjct  280  SQWNFAHATFYGGSDGSDTRAGACGYQDTVSQGYGLQTAALSNALFNDGLSCGACFEIKC  339

Query  346  VES-EFCKKGHKPVEVTVTDSCPAS-------DARCSPPHVHFDLSQPAFHEIAEHEGGV  191
             +  ++CK G+  + VT T+ CP +          C+PP VHFDL+QPAF +IAE++ G+
Sbjct  340  HDDPKWCKPGNPSIFVTATNQCPPNYYLPSDNGGWCNPPRVHFDLTQPAFLQIAEYKAGI  399

Query  190  VPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNW  11
            VPV YR+V CKR+GG++FTITGN  FNLV V NVAG GD+  V VK + +  W+ M RNW
Sbjct  400  VPVAYRRVPCKRQGGIRFTITGNRYFNLVLVWNVAGAGDVHNVLVKGNKL-PWVTMSRNW  458

Query  10   GE  5
            G+
Sbjct  459  GQ  460



>ref|NP_001288870.1| expansin-A14 precursor [Brassica rapa]
 ref|XP_009126950.1| PREDICTED: expansin-A14 [Brassica rapa]
 ref|XP_009126951.1| PREDICTED: expansin-A14 [Brassica rapa]
 gb|AGM16356.1| alpha-expansin protein 14 [Brassica rapa]
Length=253

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 125/188 (66%), Gaps = 14/188 (7%)
 Frame = -3

Query  532  VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGAC  362
            V  + S W  A AT+YG  +  GT+GGACG+   Y Q Y+  TAALS AL+N  +SCGAC
Sbjct  22   VDGYSSGWVNARATFYGGADASGTMGGACGYGNLYSQGYNTNTAALSTALFNGGQSCGAC  81

Query  361  FEIKCVES-EFCKKGHKPVEVTVTDSCP-----ASDA--RCSPPHVHFDLSQPAFHEIAE  206
            F+IKCV   ++C++G   + VT T+ CP     A+DA   C+PP  HFDL+QP F  IA+
Sbjct  82   FQIKCVNDPKWCRRG--TITVTGTNFCPPNFAQANDAGGWCNPPQHHFDLAQPIFLRIAQ  139

Query  205  HEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIE  26
            ++ GVVPV+YR+V C+R+GG++FTI G+  FNLV +TNVAG GD+  V VK      W  
Sbjct  140  YKAGVVPVQYRRVACRRRGGMRFTINGHSYFNLVLITNVAGAGDVVSVSVKGT-RTGWQS  198

Query  25   MKRNWGEK  2
            M RNWG+ 
Sbjct  199  MSRNWGQN  206



>ref|NP_001267685.1| expansin-A16-like [Cucumis sativus]
 gb|AAL31475.1|AF319470_1 alpha-expansin 4 precursor [Cucumis sativus]
Length=242

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 118/179 (66%), Gaps = 10/179 (6%)
 Frame = -3

Query  511  WKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGACFEIKCV-  344
            W  AHAT+YG  +  GT+GGACG+   Y Q Y+  TAALS AL+N+  SCGACFEIKCV 
Sbjct  20   WHNAHATFYGGNDAAGTMGGACGYGNLYSQGYAVNTAALSTALFNDGYSCGACFEIKCVN  79

Query  343  ESEFCKKGHKPVEVTVTDSCPAS-----DARCSPPHVHFDLSQPAFHEIAEHEGGVVPVK  179
            + ++C  G+  + VT T+ CP +     D  C+PP  HFDLS P F +IA++  G+VPV 
Sbjct  80   DPQWCHAGNPSIFVTATNFCPPNYALPNDGWCNPPRPHFDLSMPMFLKIAQYRAGIVPVS  139

Query  178  YRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +R+V C+R+GG++FTI G   FNLV +TNV G GD+  V +K      W+ M RNWG+ 
Sbjct  140  FRRVACRREGGMRFTINGFKYFNLVLITNVGGAGDIVSVSIKGSKTG-WMSMTRNWGQN  197



>emb|CDY44070.1| BnaA02g14340D [Brassica napus]
Length=241

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 121/198 (61%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            ++VL V    V  +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  1    MVVLAVMTSRVNGYGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAL  60

Query  391  YNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N   SCGACFEI+C  + ++C  G   + VT T+ CP ++A        C+PP  HFDL
Sbjct  61   FNNGLSCGACFEIRCQNDGKWCLPG--SIVVTATNFCPPNNALPNNAGGWCNPPQQHFDL  118

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F  IA+++ G+VPV YR+V C R+GG++FTI G+  FNLV +TNV G GD+    V
Sbjct  119  SQPVFQRIAQYKAGIVPVAYRRVSCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSALV  178

Query  55   KADGVKEWIEMKRNWGEK  2
            K      W  M RNWG+ 
Sbjct  179  KGS-RTGWQAMSRNWGQN  195



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 128/209 (61%), Gaps = 13/209 (6%)
 Frame = -3

Query  595  IAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIY  425
            +A    + L +L+ +   +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y
Sbjct  7    VACVTSLVLLMLLTVEARIPGVYS-GGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  65

Query  424  SPYTAALSPALYNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR------  266
                 ALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A       
Sbjct  66   GVNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNGG  125

Query  265  -CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNV  89
             C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV VTNV
Sbjct  126  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNV  185

Query  88   AGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            AG GD+ +V VK      WI + RNWG+ 
Sbjct  186  AGAGDIVRVRVKGSKT-NWITLSRNWGQN  213



>gb|AFK34543.1| unknown [Medicago truncatula]
Length=248

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 123/199 (62%), Gaps = 14/199 (7%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPA  395
            +L+  +     V+A+   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS A
Sbjct  7    VLVCSLTMFSSVYAYGGGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  66

Query  394  LYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFD  239
            L+N   SCG+C+EI+C  +  +C  G   + VT T+ CP ++A        C+PP  HFD
Sbjct  67   LFNNGLSCGSCYEIRCANDHRWCLPG--SIVVTATNFCPPNNALPNNDGGWCNPPLQHFD  124

Query  238  LSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVE  59
            L+QP F  IA+++ G+VPV +R+V C+RKGG++FTI G+  FNLV +TNV G GD+    
Sbjct  125  LAQPVFLRIAQYKAGIVPVDFRRVSCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAAS  184

Query  58   VKADGVKEWIEMKRNWGEK  2
            +K      WI M RNWG+ 
Sbjct  185  IKGSKTG-WISMSRNWGQN  202



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 131/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            L++IA  A +   L   +   +P V++    W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  4    LAVIACIATIVSVLPPPIEARIPGVYS-GGGWQGAHATFYGGSDASGTMGGACGYGNLYS  62

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS AL+N   SCGACFEIKC  E ++C  G   + VT T+ CP + A    
Sbjct  63   QGYGVNTAALSTALFNNGFSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNYALPND  122

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV +R+V C+++GG++FTI G   FNLV V
Sbjct  123  NGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVACRKQGGIRFTINGFRYFNLVLV  182

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG GD+ ++ +K      W+ M RNWG+ 
Sbjct  183  TNVAGAGDIVRLSIKGT-RTGWMSMSRNWGQN  213



>emb|CDX76090.1| BnaA04g03540D [Brassica napus]
Length=260

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 124/192 (65%), Gaps = 13/192 (7%)
 Frame = -3

Query  544  ALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAES  374
             +P V++  S W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   +
Sbjct  24   GIPGVYS-GSSWQTAHATFYGGDDASGTMGGACGYGNLYSQGYGTNTAALSTALFNTGLT  82

Query  373  CGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFH  218
            CGACFEIKCV + ++C  G   V VT T+ CP + A+       C+PP  HFDL+ P F 
Sbjct  83   CGACFEIKCVNDPKWCHSGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFL  142

Query  217  EIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVK  38
            +IAE+  G+VP+ YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ +  V+     
Sbjct  143  KIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVRGSKTG  202

Query  37   EWIEMKRNWGEK  2
             W+ + RNWG+ 
Sbjct  203  -WMGLTRNWGQN  213



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 132/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEY  437
            +++  +A      +L  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYS-GGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGSKTG-WMSLSRNWGQN  211



>ref|XP_010678409.1| PREDICTED: expansin-A23-like [Beta vulgaris subsp. vulgaris]
Length=245

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPEG--TIGGACGFEEYKQIYSPY  416
            M+ + ++ L  + ++A   +   +  W +AHAT+YG  +G  T  GACG++ +K+ Y   
Sbjct  1    MSLQSQIILGFLAIIAFVTMVTAQG-WTDAHATFYGDMKGGETEMGACGYDTFKEGYGLQ  59

Query  415  TAALSPALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASD---ARCSPPHVH  245
            T ALS AL+     CGACFEI+C  S++CK+G   ++VT T+ CP S    A C+PP  H
Sbjct  60   TTALSTALFESGAKCGACFEIQCANSQWCKQGAGTIKVTATNLCPPSTGPAAWCNPPLQH  119

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDL++  F  IAE++ G+VPV+YR+V C ++GGVKF I GNPNF LV V NV G GD+  
Sbjct  120  FDLTELMFVTIAEYKAGIVPVQYRRVSCAKQGGVKFFINGNPNFLLVLVFNVGGAGDVTS  179

Query  64   VEVKADGVKEWIEMKRNWG  8
            +++K      W  M RNWG
Sbjct  180  MKIKGLS-NTWTTMSRNWG  197



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V++    W++AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SC
Sbjct  24   IPGVYS-GGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  370  GACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFEIKC  +  +C  G   + +T T+ CP + A        C+PP  HFDL+ P F +
Sbjct  83   GACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMFLK  142

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV YR+V C+++GG++FTI G   FNLV +TNVAG GD+ KV VK      
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNTG-  201

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  202  WMSMSRNWGQN  212



>gb|ABN09940.1| expansin A5 [Musa acuminata AAA Group]
Length=257

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 123/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P ++A   +W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+NE +SC
Sbjct  22   IPGLYA-GGQWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSC  80

Query  370  GACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFE+KC  + ++C  G   + +T T+ CP + A        C+PP  HFDLS P F +
Sbjct  81   GACFEVKCAGDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFLK  140

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV +R+V C+R GG++FTI G   FNLV +TNVAG GD+ +  VK      
Sbjct  141  IAEYRAGIVPVSHRRVPCRRSGGIRFTINGFEYFNLVLITNVAGAGDIVRASVKGS-RTG  199

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  200  WMPMSRNWGQN  210



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 132/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEY  437
            +++  +A      +L  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAITKIAILFTTFVLFSLADAKIPGVYS-GGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGS-RTGWMSLSRNWGQN  211



>gb|ACF83087.1| unknown [Zea mays]
Length=255

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = -3

Query  511  WKEAHATYYGAPEG--TIGGACGFEEYK-QIYSPYTAALSPALYNEAESCGACFEIKCVE  341
            WK AHAT+YG  +G  T  GACG+++ + Q Y   T A+S  L+ +  +CG C+E++CV+
Sbjct  36   WKPAHATFYGGRDGSGTTAGACGYKDTREQGYGVQTVAVSTVLFGDGAACGGCYEVRCVD  95

Query  340  S-EFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQ  164
            S   CK     + VT TD CP  D  C PP  HFDLS PAF +IA+ + G+VP+ YR+V 
Sbjct  96   SPSGCKPDVAALVVTATDLCPPKDKWCKPPQEHFDLSMPAFLQIAQEKAGIVPISYRRVA  155

Query  163  CKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGE  5
            C ++GG+++TITGN  FN+VT+TNV G GD+  V VK     +W EMKRNWG+
Sbjct  156  CAKQGGIRYTITGNKYFNMVTITNVGGAGDIAAVSVKGSKRVKWTEMKRNWGQ  208



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 131/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEY  437
            +++  +A      +L  L  A +P V++    W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYS-GGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KC  + ++C  G   + +T T+ CP     AS
Sbjct  60   SQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F +IA++  G+VPV YR+V C+++GG++FTI G+  FNL  
Sbjct  120  DNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLFL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      W+ + RNWG+ 
Sbjct  180  ITNVAGAGDIVRTSVKGS-RTGWMSLSRNWGQN  211



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 128/201 (64%), Gaps = 13/201 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LSL +     +P V+     W+ AHAT+YG  +  GT+GGACG+   Y + Y   TAALS
Sbjct  13   LSLFMAANARIPGVYT-GGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALS  71

Query  400  PALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVH  245
             AL+N   SCGACFEIKC +  ++C  G+  + +T T+ CP + A        C+PP  H
Sbjct  72   TALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTH  131

Query  244  FDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEK  65
            FDL+ P F +IAE++ G+VPV +R+V C+++GGV+FTI G   FNLV +TNVAG GD+ +
Sbjct  132  FDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVR  191

Query  64   VEVKADGVKEWIEMKRNWGEK  2
            V VK     EW+ M RNWG+ 
Sbjct  192  VSVKGANT-EWMPMSRNWGQN  211



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 132/213 (62%), Gaps = 19/213 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            MAA   +S + ++++       +P V+   + W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAARATISFISLVLLLSLVEARIPGVYT-GAAWQSAHATFYGGNDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCGACFEIKC  E ++C  G   + +T T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPS  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F +IAE+  G+VPV YR+V C++ GG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  180  ITNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQN  211



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 133/213 (62%), Gaps = 19/213 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            MAA++   +++  +VA      +P V+     W  AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAAKIMTLMVVAALVATTVNARIPGVYT-GGPWVNAHATFYGEADASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KCV +  +C  G+  + +T T+ CP     AS
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F  IA++  G+VPV YR+V C++KGGV+FTI G+  FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRKKGGVRFTINGSKYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VTNVAG G+++ V VK      W+ + RNWG+ 
Sbjct  180  VTNVAGAGNVQMVSVKGSNTG-WLGLSRNWGQN  211



>gb|EYU28773.1| hypothetical protein MIMGU_mgv1a012521mg [Erythranthe guttata]
Length=248

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 125/205 (61%), Gaps = 18/205 (9%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAH----KSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYT  413
            +++L++ +V    + +H       W  AHAT+YG  +  GT+GGACG+   Y Q Y   T
Sbjct  1    MAILVLFLVGFLAMASHVNGYGGGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNT  60

Query  412  AALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSP  257
            AALS AL+N   SCGAC++I+C  E  +C  G   + VT T+ CP ++A        C+P
Sbjct  61   AALSTALFNNGLSCGACYQIRCANERRWCLPG--SILVTATNFCPPNNALPNNAGGWCNP  118

Query  256  PHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGG  77
            P  HFDLSQP F  IA++  G+VPV YR+V C+R+GG++FTI G+  FNLV +TNV G G
Sbjct  119  PLHHFDLSQPVFQRIAQYRAGIVPVAYRRVACRRRGGIRFTINGHSYFNLVLITNVGGAG  178

Query  76   DLEKVEVKADGVKEWIEMKRNWGEK  2
            D+  V VK      W  M RNWG+ 
Sbjct  179  DVHAVSVKGS-RTGWQPMSRNWGQN  202



>ref|XP_010910535.1| PREDICTED: expansin-A1-like [Elaeis guineensis]
Length=250

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 125/204 (61%), Gaps = 19/204 (9%)
 Frame = -3

Query  565  LLIVLVVALPCV-----FAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            L  +LV  LP       + H   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TA
Sbjct  4    LGFLLVSLLPLFSPAHGYGHGWGWSRAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTA  63

Query  409  ALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CSPP  254
            ALS AL+N+  SCGAC+EI+CV+   +C  G   + VT T+ CP ++A        C+PP
Sbjct  64   ALSTALFNDGLSCGACYEIRCVDDHRWCLPG--SIVVTATNFCPPNNALPNNAGGWCNPP  121

Query  253  HVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGD  74
              HFDLSQP F  IA+++ G+VPV YR+V CK+KGG++FTI G+  FNLV +TNV G GD
Sbjct  122  LQHFDLSQPVFQHIAQYKAGIVPVAYRRVPCKKKGGIRFTINGHSYFNLVLITNVGGAGD  181

Query  73   LEKVEVKADGVKEWIEMKRNWGEK  2
            +  V +K      W  M RNWG+ 
Sbjct  182  VHAVSIKGS-RTGWQPMSRNWGQN  204



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
Length=259

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 130/214 (61%), Gaps = 20/214 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLV-------VALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EE  440
            MA    +S+LI +          +P V++    W+ AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYS-GGAWQNAHATFYGGADASGTMGGACGYGNL  59

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-  266
            Y Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A  
Sbjct  60   YSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALP  119

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV
Sbjct  120  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  179

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             ++NVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  180  LISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQN  212



>dbj|BAH36863.1| alpha expansin [Rosa hybrid cultivar]
Length=242

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 123/193 (64%), Gaps = 9/193 (5%)
 Frame = -3

Query  565  LLIVLVVALPCVFAHK-SEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSP  398
            LLI  V  L  V  +  + W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS 
Sbjct  7    LLIGFVSVLSSVNGYYYAGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  66

Query  397  ALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHFDLSQPAF  221
            AL+N   +CGAC+E++CV + ++C  G   + VT T+ CP     C PP  HFDLSQP F
Sbjct  67   ALFNNGLTCGACYELRCVNDPQWCLPG--TIVVTATNFCPPG-GWCDPPQQHFDLSQPVF  123

Query  220  HEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGV  41
             +IA++  GVVPV YR+V+C+R GG++FT+ G+  FNLV VTNV G GD++ V +K    
Sbjct  124  LKIAQYRAGVVPVSYRRVRCRRAGGIRFTVNGHSYFNLVLVTNVGGAGDVQSVAIKGSRT  183

Query  40   KEWIEMKRNWGEK  2
            + W  M RNWG+ 
Sbjct  184  R-WQLMSRNWGQN  195



>gb|KEH33311.1| expansin A10 [Medicago truncatula]
Length=247

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 121/188 (64%), Gaps = 14/188 (7%)
 Frame = -3

Query  532  VFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESCGAC  362
            VFA    W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SCGAC
Sbjct  18   VFASNDGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGAC  77

Query  361  FEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHEIAE  206
            FEIKCV + ++C    K + VT T+ CP ++A        C+PP  HFDLSQP F +IA+
Sbjct  78   FEIKCVNDQKWCLP--KSIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQ  135

Query  205  HEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIE  26
            ++ G+VPV Y++V C++KGG++FTI G+  FNLV +TNV G GD+  V +K      W  
Sbjct  136  YKAGIVPVAYKRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVTAVSIKGSKT-NWQP  194

Query  25   MKRNWGEK  2
            M RNWG+ 
Sbjct  195  MSRNWGQN  202



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SC
Sbjct  24   IPGVYS-GGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  370  GACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFEIKC  + ++C  G   + +T T+ CP + A        C+PP  HFDL+ P F +
Sbjct  83   GACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMFLK  142

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV YR+V C+++GG++FTI G   FNLV ++NVAG GDL KV VK      
Sbjct  143  IAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDLVKVSVKGS-RTG  201

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  202  WMSMSRNWGQN  212



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 131/217 (60%), Gaps = 22/217 (10%)
 Frame = -3

Query  589  MAAEMRLSL-LIVLVVALPCVFAHKSE---------WKEAHATYYGAPE--GTIGGACGF  446
            MAA   ++L L  L VAL      ++          W+ AHAT+YG  +  GT+GGACG+
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGY  60

Query  445  EE-YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASD  272
               Y Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + VT T+ CP + 
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNY  120

Query  271  AR-------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNF  113
            A+       C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   F
Sbjct  121  AQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYF  180

Query  112  NLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            NLV ++NVAG GD+ +V VK      W+ M RNWG+ 
Sbjct  181  NLVLISNVAGAGDIVRVSVKGS-RTGWMSMSRNWGQN  216



>ref|XP_009122794.1| PREDICTED: expansin-A9 [Brassica rapa]
 emb|CDY40344.1| BnaA10g27240D [Brassica napus]
Length=258

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 133/213 (62%), Gaps = 19/213 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            MAA++   +++  +VA      +P V+     W  AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAAKIMTLMVVAALVATTVNARIPGVYT-GGPWVNAHATFYGEADASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCP-----AS  275
             Q Y   TAALS AL+N   SCGACFE+KCV +  +C  G+  + +T T+ CP     AS
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQAS  119

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDL+ P F  IA++  G+VPV YR+V C++KGG++FTI G+  FNLV 
Sbjct  120  DNGGWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRKKGGIRFTINGSKYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            VTNVAG G+++ V VK      W+ + RNWG+ 
Sbjct  180  VTNVAGAGNVQMVSVKGSNT-AWLGLSRNWGQN  211



>ref|XP_006364587.1| PREDICTED: expansin-A15-like [Solanum tuberosum]
Length=250

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 131/204 (64%), Gaps = 15/204 (7%)
 Frame = -3

Query  577  MRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTA  410
            +  S++ V  +  + CV  ++  W EAHAT+YG  +  GT+GGACG+   Y + Y   TA
Sbjct  4    LWFSVICVFCIQFINCVHGNEQGWIEAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTA  63

Query  409  ALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPP  254
            ALS AL+N   SCG+CFE+KCV +S++C  G   + VT T+ CP + A        C+PP
Sbjct  64   ALSTALFNNGLSCGSCFELKCVGDSKWCLPG--SIVVTATNFCPPNFALPNNAGGWCNPP  121

Query  253  HVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGD  74
              HFDL+QP F ++A++  G+VPV YR+V C++KGG++FT+ G+  FNLV VTNV G GD
Sbjct  122  LHHFDLAQPVFQKMAQYRAGIVPVAYRRVPCQKKGGIRFTMNGHSYFNLVLVTNVGGSGD  181

Query  73   LEKVEVKADGVKEWIEMKRNWGEK  2
            +  V +K     EWI M RNWG+ 
Sbjct  182  VNAVSIKGS-RTEWIAMSRNWGQN  204



>ref|XP_011000095.1| PREDICTED: expansin-A23-like [Populus euphratica]
Length=244

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 121/180 (67%), Gaps = 9/180 (5%)
 Frame = -3

Query  517  SEWKEAHATYYGAPEG--TIGGACGF-EEYKQIYSPYTAALSPALYNEAESCGACFEIKC  347
            S W +AHAT+YG   G  T+ GACG+ + +KQ Y   TAALS AL+N  ++CGACFE+KC
Sbjct  20   SSWHDAHATFYGDINGGQTMMGACGYGDLFKQGYGLQTAALSTALFNNGQTCGACFELKC  79

Query  346  V-ESEFCKKGHKPVEVTVTDSCP----ASDARCSPPHVHFDLSQPAFHEIAEHEGGVVPV  182
            V + ++CK     +++T T+ CP    A +A C+PP  HFDLS P F  IA++  G+VPV
Sbjct  80   VNDPQWCKNHAGSIKITATNLCPPNYGAPNAWCNPPQQHFDLSMPMFLTIAQYRAGIVPV  139

Query  181  KYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            KYR++ C ++GGVKF I GNP + LV V NVAG G++  V +K    + WI+M RNWG+ 
Sbjct  140  KYRRISCSKEGGVKFDIHGNPYWMLVLVRNVAGAGEVINVRIKGSQTR-WIQMSRNWGQN  198



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 132/215 (61%), Gaps = 24/215 (11%)
 Frame = -3

Query  580  EMRLSLLI------VLVVA-----LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-E  443
            EMR  +L+      VL  +     +P V++    W+ AHAT+YG  +  GT+GGACG+  
Sbjct  2    EMRQRILLNTLPLFVLFFSFADARIPGVYS-GGAWQSAHATFYGGNDASGTMGGACGYGN  60

Query  442  EYKQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR  266
             Y Q Y   TAALS AL+N   SCGACFEIKC +  ++C  G   + +T T+ CP + A+
Sbjct  61   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQ  120

Query  265  -------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNL  107
                   C+PP  HFDL+ P F ++AE+  G+VPV YR+V C+++GG++FTI G+  FNL
Sbjct  121  PSDNGGWCNPPRAHFDLAMPMFLKLAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNL  180

Query  106  VTVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            V +TNVAG GD+ +  VK      W+ M RNWG+ 
Sbjct  181  VLITNVAGAGDIVRASVKGSKTG-WMSMSRNWGQN  214



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 124/200 (62%), Gaps = 12/200 (6%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            LS L      +P V+     W+ AHAT+YG  +  GT+GGACG+   Y   Y    AALS
Sbjct  13   LSFLTGANAKVPGVYT-SGPWESAHATFYGGADASGTMGGACGYGNLYSAGYGVNNAALS  71

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
             AL+N   SCGACFEI+C + ++C  G+  + VT T+ CP + A        C+PP  HF
Sbjct  72   TALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHF  131

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DL++P F + A++  G+VPV YR+V CK+ GG++FTI G   FN+V VTNVAG GD++KV
Sbjct  132  DLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVTNVAGAGDIQKV  191

Query  61   EVKADGVKEWIEMKRNWGEK  2
             VK    K W+ M RNWG+ 
Sbjct  192  FVKGTNTK-WMAMSRNWGQN  210



>ref|XP_009406842.1| PREDICTED: expansin-A15-like [Musa acuminata subsp. malaccensis]
Length=247

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = -3

Query  571  LSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALS  401
            L   + L++           W +AHAT+YG  +  GT+GGACG+   Y Q Y   +AALS
Sbjct  6    LFSFVTLLIMFGVAHGGDGGWIDAHATFYGGGDASGTMGGACGYGNLYDQGYGTESAALS  65

Query  400  PALYNEAESCGACFEIKCVESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHF  242
             AL+N  +SCGACFEIKC   ++C KG   + +T T+ CP ++A        C+PP  HF
Sbjct  66   TALFNNGQSCGACFEIKCAGGQWCLKGS--IVITATNFCPPNNALPNDDGGWCNPPRHHF  123

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DLSQP F +IA+++ G+VP++Y++V C +KGG++FTI G+  FNLV +TNV G GD+  V
Sbjct  124  DLSQPVFEKIAQYKAGIVPIQYKRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVVAV  183

Query  61   EVKADGVKEWIEMKRNWGEK  2
             VK      W  M RNWG+ 
Sbjct  184  SVKGS-RTGWQPMSRNWGQN  202



>ref|XP_009399925.1| PREDICTED: expansin-A15-like [Musa acuminata subsp. malaccensis]
Length=247

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  562  LIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPAL  392
            L  L++       +   W  AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL
Sbjct  8    LFALLIMFGAARGYSGGWSSAHATFYGGSDASGTMGGACGYGNLYSQGYGTDTAALSTAL  67

Query  391  YNEAESCGACFEIKC-VESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDL  236
            +N  +SCGACFEI C  ++ +C +G   + VT T+ CP ++A        C+PP  HFDL
Sbjct  68   FNNGQSCGACFEIMCGSDNGWCLQGS--IIVTATNFCPPNNALPSDNGGWCNPPRQHFDL  125

Query  235  SQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEV  56
            SQP F  IA+++ G+VPV+YR+V C +KGG++FTI G+  FNLV +TNV G GD+  V +
Sbjct  126  SQPVFQRIAQYKAGIVPVQYRRVPCAKKGGIRFTINGHSYFNLVLITNVGGAGDVVAVSI  185

Query  55   KADGVKEWIEMKRNWGEK  2
            K      W  M RNWG+ 
Sbjct  186  KGS-RTGWQPMSRNWGQN  202



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 130/214 (61%), Gaps = 20/214 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLV-------VALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EE  440
            MA    +S+LI +          +P V++    W+ AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYS-GGAWQNAHATFYGGADASGTMGGACGYGNL  59

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-  266
            Y Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A  
Sbjct  60   YSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFALP  119

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV
Sbjct  120  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  179

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             ++NVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  180  LISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQN  212



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 130/214 (61%), Gaps = 20/214 (9%)
 Frame = -3

Query  589  MAAEMRLSLLIVLV-------VALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EE  440
            MA    +S+LI +          +P V++    W+ AHAT+YG  +  GT+GGACG+   
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYS-GGAWQNAHATFYGGADASGTMGGACGYGNL  59

Query  439  YKQIYSPYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-  266
            Y Q Y   TAALS AL+N   SCGACFEIKC  + ++C  G   + +T T+ CP + A  
Sbjct  60   YSQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALP  119

Query  265  ------CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLV  104
                  C+PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV
Sbjct  120  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  179

Query  103  TVTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
             ++NVAG GD+ KV VK      W+ M RNWG+ 
Sbjct  180  LISNVAGAGDIVKVSVKGS-RTGWMSMSRNWGQN  212



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 123/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V++   +W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SC
Sbjct  24   IPGVYS-GGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  370  GACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFE+KC  + ++C  G   + +T T+ CP + A        C+PP  HFDL+ P F +
Sbjct  83   GACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV YR+V C+++GG++FTI G   FNL+ +TNVAG GD+ K  VK     E
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSKT-E  201

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  202  WMSMSRNWGQN  212



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 122/191 (64%), Gaps = 13/191 (7%)
 Frame = -3

Query  541  LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSPYTAALSPALYNEAESC  371
            +P V+   + W+ AHAT+YG  +  GT+GGACG+   Y Q Y   TAALS AL+N   SC
Sbjct  23   IPGVYT-GAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  370  GACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------CSPPHVHFDLSQPAFHE  215
            GACFEIKC  E ++C  G   + +T T+ CP + A        C+PP  HFDL+ P F +
Sbjct  82   GACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  214  IAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKVEVKADGVKE  35
            IAE+  G+VPV YR+V C++ GG++FTI G+  FNLV +TNVAG GD+ KV VK      
Sbjct  142  IAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGS-RTG  200

Query  34   WIEMKRNWGEK  2
            W+ M RNWG+ 
Sbjct  201  WMSMSRNWGQN  211



>ref|XP_010470942.1| PREDICTED: expansin-A1-like [Camelina sativa]
Length=251

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 15/208 (7%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHKSE-WKEAHATYYGAPE--GTIGGACGFEE-YKQIYS  422
            MA  +    + +L V   CV  +    W  AHAT+YG  +  GT+GGACG+   Y Q Y 
Sbjct  1    MALVVAFLFMAILGVMTSCVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYG  60

Query  421  PYTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDAR-------  266
              TAALS AL+N   SCGACFE++C  + ++C  G   + VT T+ CP ++A        
Sbjct  61   TNTAALSTALFNNGLSCGACFELRCQNDGKWCLPGS--IVVTATNFCPPNNALPNNAGGW  118

Query  265  CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVA  86
            C+PP  HFDLSQP F  IA++  G+VPV YR+V C R+GG++FTI G+  FNLV +TNV 
Sbjct  119  CNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVG  178

Query  85   GGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            G GD+  V VK      W  M RNWG+ 
Sbjct  179  GAGDVHSVMVKGS-RTGWQAMSRNWGQN  205



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 131/213 (62%), Gaps = 14/213 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVA-LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-Y  437
            ++ + +   + LSLL+ L  A +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y
Sbjct  1    MAAMGLTCIVALSLLLTLTEARIPGVYTGDS-WESAHATFYGGSDASGTMGGACGYGNLY  59

Query  436  KQIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR--  266
             Q Y   TAALS AL+N   SCG+CFE+KC +  ++C  G   + +T T+ CP + A   
Sbjct  60   SQGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPN  119

Query  265  -----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
                 C+PP  HFDL+ P F  IAE+  G+VPV YR+V C+++GG++F I G   FNLV 
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVL  179

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNVAG GD+ +  VK      WI + RNWG+ 
Sbjct  180  ITNVAGAGDIVQASVKGSKTG-WITLSRNWGQN  211



>gb|KHG20514.1| Expansin-A15 -like protein [Gossypium arboreum]
Length=262

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 131/213 (62%), Gaps = 17/213 (8%)
 Frame = -3

Query  598  LIAMAAEM---RLSLLIVLVVALPCVFA----HKSEWKEAHATYYGAPE--GTIGGACGF  446
            LIAM A +   ++    VL++    + +    +   W  A AT+YG  +  GT+GGACG+
Sbjct  7    LIAMFACLVCRKMGFAGVLLLGFLAIVSSGHGYDGGWINARATFYGGSDASGTMGGACGY  66

Query  445  EE-YKQIYSPYTAALSPALYNEAESCGACFEIKCV--ESEFCKKGHKPVEVTVTDSCPAS  275
               Y Q Y   TAALS AL+N+  +CG+C+EIKC+  + ++C +G   + VT T+ CP +
Sbjct  67   GNLYSQCYGTNTAALSTALFNDGLNCGSCYEIKCLNGDGKWCLRG--SIVVTATNFCPPN  124

Query  274  D--ARCSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVT  101
            D    C+PP  HFDLSQP F  IA+++ G+VP+ YR+V CKR GG++FTI GN  FNLV 
Sbjct  125  DVGGWCNPPQHHFDLSQPVFQHIAQYKAGIVPIAYRRVPCKRNGGIRFTINGNSYFNLVL  184

Query  100  VTNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            +TNV G GD+  V +K      W  M RNWG+ 
Sbjct  185  ITNVGGAGDVHAVAIKGT-RTGWQTMSRNWGQN  216



>ref|XP_008459328.1| PREDICTED: expansin-A5-like [Cucumis melo]
Length=243

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 122/200 (61%), Gaps = 8/200 (4%)
 Frame = -3

Query  589  MAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YKQIYSP  419
            MA    +  L++       V A    W  AHAT+YG  +  GT+GGACG+   Y Q Y  
Sbjct  1    MAIITTILQLLLFFSIFSSVNADYGGWISAHATFYGGSDASGTMGGACGYGNLYSQGYGT  60

Query  418  YTAALSPALYNEAESCGACFEIKCV-ESEFCKKGHKPVEVTVTDSCPASDARCSPPHVHF  242
             TAALS AL++   SCGACFE++CV + ++C  G   + VT T+ CP     C PP+ HF
Sbjct  61   NTAALSTALFDNGLSCGACFELRCVNDPQWCIPG--TIVVTATNFCPPGGC-CDPPNHHF  117

Query  241  DLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGGGDLEKV  62
            DLSQP F  IA++  G++PV YR+V+C+R GG++FTI G+  FNLV +TNV G GD+  V
Sbjct  118  DLSQPIFQHIAQYRAGIIPVAYRRVRCRRSGGIRFTINGHSYFNLVLITNVGGAGDIHAV  177

Query  61   EVKADGVKEWIEMKRNWGEK  2
             +K    + W  M RNWG+ 
Sbjct  178  AIKGSKTR-WQPMSRNWGQN  196



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 132/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  604  LSLIAMAAEMRLSLLIVLVVALPCVFAHKSEWKEAHATYYGAPE--GTIGGACGFEE-YK  434
            L+L+  A+ M   L  ++   +P V+   S W+ AHAT+YG  +  GT+GGACG+   Y 
Sbjct  10   LTLLCFASLM--CLFGMVNARIPGVYTGGS-WESAHATFYGGSDASGTMGGACGYGNLYS  66

Query  433  QIYSPYTAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR---  266
            Q Y   TAALS A++N   SCGACFEIKC +   +C  G+  + +T T+ CP + A    
Sbjct  67   QGYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSD  126

Query  265  ----CSPPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTV  98
                C+PP  HFDL+ P F +IAE+  G+VPV +R+V C+++GG++FTI G   FNLV V
Sbjct  127  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLV  186

Query  97   TNVAGGGDLEKVEVKADGVKEWIEMKRNWGEK  2
            TNVAG G++ KV VK      W+ M RNWG+ 
Sbjct  187  TNVAGAGNIVKVSVKGTNTG-WLSMSRNWGQN  217



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 129/206 (63%), Gaps = 19/206 (9%)
 Frame = -3

Query  568  SLLIVLVVA------LPCVFAHKSEWKEAHATYYGAPE--GTIGGACGF-EEYKQIYSPY  416
            SLLI++ +       +P V++    W+ AHAT+YG  +  GT+GGACG+   Y Q Y   
Sbjct  12   SLLIMMSLMWKGEARIPGVYS-GGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVS  70

Query  415  TAALSPALYNEAESCGACFEIKCVES-EFCKKGHKPVEVTVTDSCPASDAR-------CS  260
            TAALS AL+N   SCGACFEIKC +  ++C  G   + +T T+ CP + A        C+
Sbjct  71   TAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCN  130

Query  259  PPHVHFDLSQPAFHEIAEHEGGVVPVKYRKVQCKRKGGVKFTITGNPNFNLVTVTNVAGG  80
            PP  HFDL+ P F +IAE+  G+VPV YR+V C+++GG++FTI G   FNLV ++NVAG 
Sbjct  131  PPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGA  190

Query  79   GDLEKVEVKADGVKEWIEMKRNWGEK  2
            GD+ +V VK      W+ M RNWG+ 
Sbjct  191  GDIVQVSVKGSKTG-WMSMSRNWGQN  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1166488890696