BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30908_g1_i1 len=1572 path=[1:0-1571]

Length=1572
                                                                      Score     E

ref|XP_009792620.1|  PREDICTED: UPF0481 protein At3g47200-like          325   7e-101   
ref|XP_009603759.1|  PREDICTED: UPF0481 protein At3g47200-like          321   1e-99    
gb|EYU33527.1|  hypothetical protein MIMGU_mgv1a020659mg                320   3e-99    
ref|XP_009628169.1|  PREDICTED: putative UPF0481 protein At3g02645      317   3e-98    
ref|XP_009600725.1|  PREDICTED: putative UPF0481 protein At3g02645      318   4e-98    
ref|XP_009781968.1|  PREDICTED: putative UPF0481 protein At3g02645      313   1e-96    
ref|XP_009792233.1|  PREDICTED: putative UPF0481 protein At3g02645      311   7e-96    
ref|XP_009789237.1|  PREDICTED: UPF0481 protein At3g47200-like is...    311   1e-95    
ref|XP_009789236.1|  PREDICTED: UPF0481 protein At3g47200-like is...    312   1e-95    
ref|XP_009789235.1|  PREDICTED: UPF0481 protein At3g47200-like is...    312   2e-95    
ref|XP_009779907.1|  PREDICTED: putative UPF0481 protein At3g02645      310   5e-95    
ref|XP_009788155.1|  PREDICTED: putative UPF0481 protein At3g0264...    309   8e-95    
ref|XP_009626723.1|  PREDICTED: UPF0481 protein At3g47200-like          308   3e-94    
ref|XP_009788156.1|  PREDICTED: putative UPF0481 protein At3g0264...    301   5e-93    
ref|XP_009602424.1|  PREDICTED: UPF0481 protein At3g47200-like          305   6e-93    
ref|XP_009769940.1|  PREDICTED: UPF0481 protein At3g47200-like          298   2e-90    
ref|XP_009588978.1|  PREDICTED: putative UPF0481 protein At3g02645      296   1e-89    
ref|XP_009614330.1|  PREDICTED: UPF0481 protein At3g47200-like is...    294   6e-89    
ref|XP_009614328.1|  PREDICTED: UPF0481 protein At3g47200-like is...    294   7e-89    
ref|XP_009759887.1|  PREDICTED: putative UPF0481 protein At3g02645      290   7e-88    
ref|XP_006360885.1|  PREDICTED: putative UPF0481 protein At3g0264...    288   1e-87    
ref|XP_009777972.1|  PREDICTED: UPF0481 protein At3g47200-like          289   8e-87    
ref|XP_006360875.1|  PREDICTED: putative UPF0481 protein At3g0264...    285   9e-87    
ref|XP_006360879.1|  PREDICTED: putative UPF0481 protein At3g0264...    285   1e-86    
ref|XP_009759601.1|  PREDICTED: UPF0481 protein At3g47200-like          285   1e-85    
ref|XP_009792070.1|  PREDICTED: putative UPF0481 protein At3g0264...    286   2e-85    
ref|XP_009792068.1|  PREDICTED: putative UPF0481 protein At3g0264...    286   3e-85    
ref|XP_009792069.1|  PREDICTED: putative UPF0481 protein At3g0264...    286   3e-85    
ref|XP_009620089.1|  PREDICTED: UPF0481 protein At3g47200-like          284   3e-85    
ref|XP_009611558.1|  PREDICTED: UPF0481 protein At3g47200-like is...    285   4e-85    
ref|XP_009590369.1|  PREDICTED: LOW QUALITY PROTEIN: putative UPF...    283   7e-85    
ref|XP_009611559.1|  PREDICTED: UPF0481 protein At3g47200-like is...    285   8e-85    
ref|XP_006367795.1|  PREDICTED: UPF0481 protein At3g47200-like          282   1e-84    
ref|XP_009605192.1|  PREDICTED: putative UPF0481 protein At3g02645      282   2e-84    
ref|XP_009795427.1|  PREDICTED: UPF0481 protein At3g47200-like          281   4e-84    
ref|XP_006360835.1|  PREDICTED: putative UPF0481 protein At3g0264...    280   7e-84    
ref|XP_006360881.1|  PREDICTED: UPF0481 protein At3g47200-like          282   3e-83    
ref|XP_006360878.1|  PREDICTED: UPF0481 protein At3g47200-like          280   4e-82    
ref|XP_010319348.1|  PREDICTED: putative UPF0481 protein At3g02645      272   5e-81    
ref|XP_006360883.1|  PREDICTED: putative UPF0481 protein At3g0264...    270   1e-80    
ref|XP_010271392.1|  PREDICTED: UPF0481 protein At3g47200-like          270   1e-80    
ref|XP_006350416.1|  PREDICTED: putative UPF0481 protein At3g0264...    266   3e-78    
ref|XP_002518141.1|  conserved hypothetical protein                     256   2e-75    Ricinus communis
ref|XP_006360837.1|  PREDICTED: putative UPF0481 protein At3g0264...    255   2e-75    
ref|XP_006360884.1|  PREDICTED: putative UPF0481 protein At3g0264...    253   3e-74    
ref|XP_006360871.1|  PREDICTED: putative UPF0481 protein At3g0264...    252   5e-74    
ref|XP_011020607.1|  PREDICTED: UPF0481 protein At3g47200-like is...    251   1e-73    
ref|XP_004236861.1|  PREDICTED: putative UPF0481 protein At3g0264...    252   1e-73    
ref|XP_002303847.2|  hypothetical protein POPTR_0003s18000g             248   3e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009590371.1|  PREDICTED: UPF0481 protein At3g47200-like          243   3e-71    
ref|XP_010319551.1|  PREDICTED: uncharacterized protein LOC104646793    253   1e-70    
ref|XP_008394063.1|  PREDICTED: UPF0481 protein At3g47200-like          243   1e-70    
ref|XP_009348601.1|  PREDICTED: UPF0481 protein At3g47200-like          242   4e-70    
ref|XP_008371667.1|  PREDICTED: UPF0481 protein At3g47200-like          241   7e-70    
ref|XP_009353385.1|  PREDICTED: UPF0481 protein At3g47200-like          241   1e-69    
ref|XP_006420142.1|  hypothetical protein CICLE_v10004874mg             242   1e-69    
ref|XP_010696171.1|  PREDICTED: UPF0481 protein At3g47200-like          240   3e-69    
ref|XP_009334803.1|  PREDICTED: putative UPF0481 protein At3g02645      239   6e-69    
ref|XP_007034456.1|  Uncharacterized protein TCM_020392                 238   1e-68    
ref|XP_011069627.1|  PREDICTED: UPF0481 protein At3g47200-like          238   1e-68    
ref|XP_009353391.1|  PREDICTED: UPF0481 protein At3g47200-like          238   2e-68    
ref|XP_007224381.1|  hypothetical protein PRUPE_ppa021638mg             238   3e-68    
ref|XP_006489552.1|  PREDICTED: UPF0481 protein At3g47200-like is...    237   4e-68    
ref|XP_007034457.1|  Uncharacterized protein isoform 1                  236   6e-68    
ref|XP_010696170.1|  PREDICTED: UPF0481 protein At3g47200-like          236   1e-67    
ref|XP_006489551.1|  PREDICTED: UPF0481 protein At3g47200-like is...    237   2e-67    
ref|XP_006489608.1|  PREDICTED: UPF0481 protein At3g47200-like          235   3e-67    
ref|XP_008337123.1|  PREDICTED: UPF0481 protein At3g47200-like          234   4e-67    
ref|XP_010040032.1|  PREDICTED: UPF0481 protein At3g47200-like          234   4e-67    
ref|XP_002515544.1|  conserved hypothetical protein                     234   5e-67    Ricinus communis
gb|ACH87183.1|  unknown protein                                         233   6e-67    Camellia sinensis [black tea]
ref|XP_006360882.1|  PREDICTED: UPF0481 protein At3g47200-like          239   1e-66    
ref|XP_006360880.1|  PREDICTED: UPF0481 protein At3g47200-like          233   1e-66    
emb|CAN68458.1|  hypothetical protein VITISV_031449                     233   2e-66    Vitis vinifera
ref|XP_010654754.1|  PREDICTED: UPF0481 protein At3g47200-like          233   2e-66    
ref|XP_002303850.2|  hypothetical protein POPTR_0003s18020g             232   2e-66    Populus trichocarpa [western balsam poplar]
ref|XP_009355715.1|  PREDICTED: putative UPF0481 protein At3g02645      232   4e-66    
ref|XP_004293001.1|  PREDICTED: UPF0481 protein At3g47200-like          232   4e-66    
ref|XP_010670655.1|  PREDICTED: UPF0481 protein At3g47200               231   5e-66    
ref|XP_010696165.1|  PREDICTED: UPF0481 protein At3g47200-like          231   5e-66    
gb|KDO36306.1|  hypothetical protein CISIN_1g014530mg                   231   5e-66    
ref|XP_009353518.1|  PREDICTED: UPF0481 protein At3g47200-like          231   9e-66    
ref|XP_006420574.1|  hypothetical protein CICLE_v10004982mg             231   1e-65    
ref|XP_010447464.1|  PREDICTED: UPF0481 protein At3g47200-like is...    229   1e-65    
ref|XP_008219470.1|  PREDICTED: UPF0481 protein At3g47200-like          229   3e-65    
ref|XP_010026745.1|  PREDICTED: UPF0481 protein At3g47200-like          227   5e-65    
ref|XP_006487607.1|  PREDICTED: UPF0481 protein At3g47200-like          229   6e-65    
emb|CDO99352.1|  unnamed protein product                                228   8e-65    
ref|XP_010432794.1|  PREDICTED: UPF0481 protein At3g47200-like is...    227   1e-64    
ref|XP_006432624.1|  hypothetical protein CICLE_v10001225mg             228   1e-64    
gb|EYU31471.1|  hypothetical protein MIMGU_mgv1a022973mg                227   2e-64    
ref|XP_007226756.1|  hypothetical protein PRUPE_ppa018811mg             226   2e-64    
ref|XP_010447461.1|  PREDICTED: UPF0481 protein At3g47200-like is...    226   2e-64    
ref|XP_002324850.2|  hypothetical protein POPTR_0018s01500g             226   3e-64    Populus trichocarpa [western balsam poplar]
ref|XP_010023544.1|  PREDICTED: UPF0481 protein At3g47200-like          226   4e-64    
ref|XP_006446057.1|  hypothetical protein CICLE_v10015331mg             226   4e-64    
ref|XP_006487605.1|  PREDICTED: UPF0481 protein At3g47200-like          226   1e-63    
ref|XP_009355871.1|  PREDICTED: UPF0481 protein At3g47200-like          224   2e-63    
ref|XP_009395234.1|  PREDICTED: UPF0481 protein At3g47200-like          225   3e-63    
ref|XP_010432792.1|  PREDICTED: UPF0481 protein At3g47200-like is...    223   4e-63    
ref|XP_004292997.1|  PREDICTED: UPF0481 protein At3g47200-like          224   5e-63    
ref|XP_006368926.1|  hypothetical protein POPTR_0001s14920g             223   5e-63    
emb|CAB96664.1|  putative protein                                       223   6e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086479.1|  PREDICTED: UPF0481 protein At3g47200-like is...    223   9e-63    
ref|XP_007022358.1|  Uncharacterized protein TCM_032589                 227   1e-62    
gb|KDO58836.1|  hypothetical protein CISIN_1g014434mg                   221   2e-62    
ref|XP_008245592.1|  PREDICTED: UPF0481 protein At3g47200-like          222   2e-62    
ref|XP_009608055.1|  PREDICTED: UPF0481 protein At3g47200-like          222   3e-62    
ref|XP_006420579.1|  hypothetical protein CICLE_v10005049mg             221   3e-62    
ref|XP_006293111.1|  hypothetical protein CARUB_v10019405mg             223   4e-62    
ref|XP_010431199.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0481 prot...    221   6e-62    
ref|XP_010242713.1|  PREDICTED: UPF0481 protein At3g47200-like          225   6e-62    
ref|XP_002515541.1|  conserved hypothetical protein                     220   7e-62    Ricinus communis
ref|XP_002282564.2|  PREDICTED: UPF0481 protein At3g47200               220   8e-62    Vitis vinifera
ref|XP_007206473.1|  hypothetical protein PRUPE_ppa1027120mg            223   1e-61    
ref|XP_010100242.1|  hypothetical protein L484_000653                   220   1e-61    
ref|XP_010696168.1|  PREDICTED: UPF0481 protein At3g47200-like is...    219   1e-61    
ref|XP_010696167.1|  PREDICTED: UPF0481 protein At3g47200-like is...    219   2e-61    
ref|XP_010696166.1|  PREDICTED: UPF0481 protein At3g47200-like is...    219   2e-61    
ref|XP_008238889.1|  PREDICTED: UPF0481 protein At3g47200               222   2e-61    
ref|NP_194926.1|  uncharacterized protein                               224   2e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270826.1|  PREDICTED: UPF0481 protein At3g47200-like          222   2e-61    
ref|XP_010042668.1|  PREDICTED: UPF0481 protein At3g47200-like is...    218   2e-61    
ref|XP_009334804.1|  PREDICTED: putative UPF0481 protein At3g02645      219   4e-61    
ref|XP_010042667.1|  PREDICTED: UPF0481 protein At3g47200-like is...    218   6e-61    
ref|XP_009128936.1|  PREDICTED: UPF0481 protein At3g47200-like is...    220   7e-61    
ref|XP_008378370.1|  PREDICTED: UPF0481 protein At3g47200-like          218   8e-61    
ref|XP_009368238.1|  PREDICTED: UPF0481 protein At3g47200               220   8e-61    
ref|XP_010093525.1|  hypothetical protein L484_007240                   219   1e-60    
gb|KCW60069.1|  hypothetical protein EUGRSUZ_H02798                     214   2e-60    
ref|XP_011100122.1|  PREDICTED: UPF0481 protein At3g47200-like          216   2e-60    
ref|XP_009345288.1|  PREDICTED: UPF0481 protein At3g47200-like          216   2e-60    
ref|XP_010050240.1|  PREDICTED: UPF0481 protein At3g47200-like          216   2e-60    
ref|NP_190584.1|  uncharacterized protein                               218   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007030490.1|  Uncharacterized protein TCM_026256                 216   3e-60    
ref|XP_010088614.1|  hypothetical protein L484_004014                   216   4e-60    
ref|XP_010503687.1|  PREDICTED: UPF0481 protein At3g47200-like          218   5e-60    
ref|XP_006420573.1|  hypothetical protein CICLE_v10007039mg             214   7e-60    
ref|XP_010088613.1|  hypothetical protein L484_004013                   215   7e-60    
ref|XP_010503686.1|  PREDICTED: UPF0481 protein At3g47200-like          218   7e-60    
ref|XP_006478631.1|  PREDICTED: putative UPF0481 protein At3g0264...    215   8e-60    
ref|XP_007203945.1|  hypothetical protein PRUPE_ppa017935mg             215   8e-60    
ref|XP_010045492.1|  PREDICTED: UPF0481 protein At3g47200-like          214   9e-60    
ref|XP_010048250.1|  PREDICTED: UPF0481 protein At3g47200-like          214   1e-59    
gb|KCW78764.1|  hypothetical protein EUGRSUZ_C00198                     214   1e-59    
ref|XP_010426559.1|  PREDICTED: UPF0481 protein At3g47200-like          216   1e-59    
emb|CAN69719.1|  hypothetical protein VITISV_026312                     215   2e-59    Vitis vinifera
ref|XP_008340394.1|  PREDICTED: UPF0481 protein At3g47200               216   2e-59    
ref|XP_002513460.1|  conserved hypothetical protein                     213   3e-59    Ricinus communis
ref|XP_002513461.1|  conserved hypothetical protein                     213   4e-59    Ricinus communis
gb|AAU44488.1|  hypothetical protein AT3G50170                          216   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244239.1|  PREDICTED: UPF0481 protein At3g47200-like          215   5e-59    
ref|XP_009136540.1|  PREDICTED: UPF0481 protein At3g47200-like          216   6e-59    
ref|XP_008241187.1|  PREDICTED: UPF0481 protein At3g47200-like          213   7e-59    
ref|NP_190586.1|  uncharacterized protein                               215   8e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244181.1|  PREDICTED: UPF0481 protein At3g47200-like          214   9e-59    
emb|CDO99351.1|  unnamed protein product                                212   1e-58    
ref|XP_008352183.1|  PREDICTED: UPF0481 protein At3g47200-like          212   1e-58    
ref|XP_009334781.1|  PREDICTED: UPF0481 protein At3g47200-like          212   1e-58    
emb|CDY23018.1|  BnaC07g31690D                                          211   1e-58    
ref|XP_002278393.1|  PREDICTED: UPF0481 protein At3g47200               213   2e-58    Vitis vinifera
gb|KDP22062.1|  hypothetical protein JCGZ_25893                         211   3e-58    
ref|XP_007022372.1|  Uncharacterized protein TCM_032631                 213   3e-58    
ref|XP_010558850.1|  PREDICTED: UPF0481 protein At3g47200               213   3e-58    
ref|XP_002869301.1|  predicted protein                                  216   3e-58    
emb|CDP21269.1|  unnamed protein product                                210   3e-58    
gb|KHG28877.1|  hypothetical protein F383_02198                         211   3e-58    
ref|XP_011099100.1|  PREDICTED: UPF0481 protein At3g47200               213   4e-58    
ref|XP_009345303.1|  PREDICTED: UPF0481 protein At3g47200-like          211   4e-58    
emb|CDO99349.1|  unnamed protein product                                210   5e-58    
ref|XP_008367714.1|  PREDICTED: UPF0481 protein At3g47200-like          210   7e-58    
ref|XP_010026753.1|  PREDICTED: UPF0481 protein At3g47200-like          209   7e-58    
ref|XP_007047372.1|  Uncharacterized protein TCM_000684                 212   7e-58    
ref|XP_006404051.1|  hypothetical protein EUTSA_v10011143mg             212   7e-58    
ref|XP_003601320.1|  hypothetical protein MTR_3g079390                  210   8e-58    
ref|XP_006404054.1|  hypothetical protein EUTSA_v10011061mg             212   9e-58    
ref|XP_002877733.1|  hypothetical protein ARALYDRAFT_485374             212   1e-57    
emb|CDY02089.1|  BnaA03g40780D                                          211   1e-57    
gb|EYU32623.1|  hypothetical protein MIMGU_mgv11b017063mg               208   1e-57    
ref|XP_008352050.1|  PREDICTED: UPF0481 protein At3g47200-like is...    209   1e-57    
ref|XP_009346196.1|  PREDICTED: UPF0481 protein At3g47200-like          210   1e-57    
ref|XP_006285485.1|  hypothetical protein CARUB_v10006919mg             214   2e-57    
ref|XP_009355878.1|  PREDICTED: UPF0481 protein At3g47200-like          209   2e-57    
ref|XP_009136541.1|  PREDICTED: UPF0481 protein At3g47200-like          210   2e-57    
ref|XP_008352049.1|  PREDICTED: UPF0481 protein At3g47200-like is...    209   2e-57    
ref|XP_006420575.1|  hypothetical protein CICLE_v10006659mg             209   3e-57    
emb|CDY02090.1|  BnaA03g40770D                                          211   3e-57    
ref|XP_010259276.1|  PREDICTED: UPF0481 protein At3g47200-like          210   3e-57    
emb|CDP16142.1|  unnamed protein product                                207   4e-57    
emb|CDY23015.1|  BnaC07g31720D                                          209   4e-57    
ref|XP_010503688.1|  PREDICTED: UPF0481 protein At3g47200-like          210   4e-57    
ref|XP_002877732.1|  hypothetical protein ARALYDRAFT_485373             209   5e-57    
ref|NP_190583.4|  uncharacterized protein                               210   5e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010023720.1|  PREDICTED: UPF0481 protein At3g47200-like          207   6e-57    
ref|XP_010030535.1|  PREDICTED: UPF0481 protein At3g47200-like          209   6e-57    
gb|KCW60073.1|  hypothetical protein EUGRSUZ_H02803                     206   8e-57    
ref|XP_010426560.1|  PREDICTED: UPF0481 protein At3g47200-like          209   1e-56    
ref|XP_006293039.1|  hypothetical protein CARUB_v10019318mg             208   2e-56    
gb|KDP31987.1|  hypothetical protein JCGZ_12448                         208   2e-56    
ref|XP_006404053.1|  hypothetical protein EUTSA_v10010906mg             209   2e-56    
ref|XP_002877730.1|  predicted protein                                  209   3e-56    
ref|XP_010046511.1|  PREDICTED: UPF0481 protein At3g47200-like          204   3e-56    
gb|KCW80455.1|  hypothetical protein EUGRSUZ_C01795                     204   3e-56    
ref|XP_006292637.1|  hypothetical protein CARUB_v10018880mg             207   3e-56    
gb|ABK28593.1|  unknown                                                 207   4e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136538.1|  PREDICTED: UPF0481 protein At3g47200               207   4e-56    
emb|CDY17749.1|  BnaC08g21570D                                          207   4e-56    
emb|CDY30604.1|  BnaAnng03790D                                          207   4e-56    
ref|XP_011101987.1|  PREDICTED: UPF0481 protein At3g47200-like          205   5e-56    
ref|XP_006487629.1|  PREDICTED: UPF0481 protein At3g47200-like          204   5e-56    
ref|XP_008231146.1|  PREDICTED: UPF0481 protein At3g47200-like          205   5e-56    
emb|CDY02093.1|  BnaA03g40740D                                          207   6e-56    
ref|NP_190585.2|  uncharacterized protein                               206   7e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293002.1|  PREDICTED: UPF0481 protein At3g47200-like          205   8e-56    
ref|XP_011091074.1|  PREDICTED: UPF0481 protein At3g47200-like          204   9e-56    
ref|XP_010050754.1|  PREDICTED: UPF0481 protein At3g47200-like          204   1e-55    
ref|XP_008445188.1|  PREDICTED: UPF0481 protein At3g47200-like          205   1e-55    
gb|KFK34276.1|  hypothetical protein AALP_AA5G123900                    206   1e-55    
gb|KEH17301.1|  DUF247 domain protein                                   203   1e-55    
ref|XP_006420587.1|  hypothetical protein CICLE_v10005017mg             203   2e-55    
ref|XP_007203413.1|  hypothetical protein PRUPE_ppa021442mg             204   2e-55    
ref|XP_011091070.1|  PREDICTED: UPF0481 protein At3g47200-like          203   2e-55    
ref|XP_007224915.1|  hypothetical protein PRUPE_ppa021930mg             202   2e-55    
gb|KDO79087.1|  hypothetical protein CISIN_1g009939mg                   205   2e-55    
ref|XP_006442795.1|  hypothetical protein CICLE_v10020219mg             203   2e-55    
ref|XP_006478644.1|  PREDICTED: UPF0481 protein At3g47200-like          202   3e-55    
ref|XP_008394044.1|  PREDICTED: UPF0481 protein At3g47200-like is...    203   3e-55    
ref|XP_004501993.1|  PREDICTED: UPF0481 protein At3g47200-like          203   3e-55    
ref|XP_006425970.1|  hypothetical protein CICLE_v10025336mg             205   3e-55    
ref|XP_006494486.1|  PREDICTED: UPF0481 protein At3g47200-like          204   4e-55    
ref|XP_009395231.1|  PREDICTED: UPF0481 protein At3g47200-like          207   4e-55    
ref|XP_003618477.1|  hypothetical protein MTR_6g011060                  202   4e-55    
ref|XP_010927499.1|  PREDICTED: UPF0481 protein At3g47200-like is...    204   4e-55    
ref|XP_011069330.1|  PREDICTED: UPF0481 protein At3g47200-like          202   4e-55    
ref|XP_006430221.1|  hypothetical protein CICLE_v10013891mg             202   4e-55    
ref|XP_002298611.2|  hypothetical protein POPTR_0001s34060g             202   5e-55    Populus trichocarpa [western balsam poplar]
ref|XP_008800520.1|  PREDICTED: UPF0481 protein At3g47200-like          203   5e-55    
emb|CDO99347.1|  unnamed protein product                                205   5e-55    
gb|KCW86090.1|  hypothetical protein EUGRSUZ_B02788                     200   6e-55    
ref|XP_008394043.1|  PREDICTED: UPF0481 protein At3g47200-like is...    202   6e-55    
ref|XP_007137039.1|  hypothetical protein PHAVU_009G094600g             201   6e-55    
ref|XP_009115692.1|  PREDICTED: UPF0481 protein At3g47200-like          204   6e-55    
ref|XP_004231874.1|  PREDICTED: UPF0481 protein At3g47200               204   7e-55    
gb|KHN41217.1|  UPF0481 protein                                         201   8e-55    
ref|XP_009614262.1|  PREDICTED: UPF0481 protein At3g47200-like          200   8e-55    
ref|XP_003523693.1|  PREDICTED: putative UPF0481 protein At3g0264...    201   8e-55    
emb|CDY23020.1|  BnaC07g31670D                                          204   8e-55    
ref|XP_007022376.1|  Uncharacterized protein TCM_032646                 202   9e-55    
ref|XP_011045459.1|  PREDICTED: UPF0481 protein At3g47200-like          201   1e-54    
ref|XP_006404055.1|  hypothetical protein EUTSA_v10010280mg             203   1e-54    
ref|XP_004308956.1|  PREDICTED: UPF0481 protein At3g47200-like          201   1e-54    
ref|XP_007022373.1|  Uncharacterized protein TCM_032632                 204   1e-54    
emb|CDO99346.1|  unnamed protein product                                201   1e-54    
ref|XP_003526331.1|  PREDICTED: putative UPF0481 protein At3g0264...    201   1e-54    
emb|CDO99348.1|  unnamed protein product                                200   1e-54    
gb|KDO40828.1|  hypothetical protein CISIN_1g038549mg                   199   1e-54    
emb|CDO99341.1|  unnamed protein product                                200   2e-54    
ref|XP_010648645.1|  PREDICTED: UPF0481 protein At3g47200-like is...    201   2e-54    
ref|XP_009367549.1|  PREDICTED: UPF0481 protein At3g47200-like          202   2e-54    
ref|XP_007203065.1|  hypothetical protein PRUPE_ppa023443mg             200   2e-54    
ref|XP_010648644.1|  PREDICTED: UPF0481 protein At3g47200-like is...    201   2e-54    
ref|XP_006605634.1|  PREDICTED: UPF0481 protein At3g47200-like is...    201   2e-54    
ref|XP_010026748.1|  PREDICTED: UPF0481 protein At3g47200-like          200   2e-54    
gb|KDO64013.1|  hypothetical protein CISIN_1g013957mg                   200   2e-54    
ref|XP_004138864.1|  PREDICTED: UPF0481 protein At3g47200-like          202   2e-54    
ref|XP_006339855.1|  PREDICTED: UPF0481 protein At3g47200-like          203   2e-54    
ref|XP_010259810.1|  PREDICTED: UPF0481 protein At3g47200-like          201   2e-54    
ref|XP_003526321.1|  PREDICTED: UPF0481 protein At3g47200-like          200   2e-54    
ref|XP_002282530.2|  PREDICTED: UPF0481 protein At3g47200-like is...    201   2e-54    Vitis vinifera
gb|KHN41213.1|  UPF0481 protein                                         199   2e-54    
ref|XP_003556824.2|  PREDICTED: UPF0481 protein At3g47200-like is...    201   3e-54    
emb|CAB62124.1|  putative protein                                       202   3e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541628.1|  PREDICTED: UPF0481 protein At3g47200-like          201   3e-54    
gb|KCW60065.1|  hypothetical protein EUGRSUZ_H02794                     199   3e-54    
gb|KCW80417.1|  hypothetical protein EUGRSUZ_C01774                     199   3e-54    
ref|XP_010023718.1|  PREDICTED: UPF0481 protein At3g47200-like          200   3e-54    
ref|XP_009785365.1|  PREDICTED: UPF0481 protein At3g47200-like          202   4e-54    
ref|XP_011003945.1|  PREDICTED: UPF0481 protein At3g47200-like          200   4e-54    
ref|XP_006387640.1|  hypothetical protein POPTR_0735s00210g             199   4e-54    
ref|XP_006582344.1|  PREDICTED: putative UPF0481 protein At3g0264...    199   4e-54    
ref|XP_008367816.1|  PREDICTED: UPF0481 protein At3g47200-like          200   4e-54    
gb|KHN08112.1|  UPF0481 protein                                         199   4e-54    
ref|XP_010048226.1|  PREDICTED: UPF0481 protein At3g47200-like is...    200   4e-54    
ref|XP_011047474.1|  PREDICTED: UPF0481 protein At3g47200-like          199   4e-54    
gb|KCW60071.1|  hypothetical protein EUGRSUZ_H02801                     200   5e-54    
ref|XP_010426554.1|  PREDICTED: UPF0481 protein At3g47200               202   5e-54    
ref|XP_006467199.1|  PREDICTED: UPF0481 protein At3g47200-like          199   5e-54    
gb|KCW60072.1|  hypothetical protein EUGRSUZ_H02801                     200   5e-54    
ref|XP_010503685.1|  PREDICTED: UPF0481 protein At3g47200-like          202   5e-54    
ref|XP_010026740.1|  PREDICTED: UPF0481 protein At3g47200-like          199   6e-54    
ref|XP_010048229.1|  PREDICTED: UPF0481 protein At3g47200-like is...    199   6e-54    
gb|KCW60063.1|  hypothetical protein EUGRSUZ_H02792                     199   7e-54    
gb|AAU44487.1|  hypothetical protein AT3G50120                          201   8e-54    
gb|KCW60062.1|  hypothetical protein EUGRSUZ_H02792                     199   8e-54    
ref|XP_003523695.1|  PREDICTED: UPF0481 protein At3g47200-like          198   8e-54    
ref|XP_006582345.1|  PREDICTED: putative UPF0481 protein At3g0264...    198   9e-54    
ref|XP_010503684.1|  PREDICTED: UPF0481 protein At3g47200-like          201   1e-53    
ref|NP_190581.1|  uncharacterized protein                               201   1e-53    
gb|AES74688.2|  DUF247 domain protein                                   197   1e-53    
ref|XP_011006928.1|  PREDICTED: UPF0481 protein At3g47200-like          198   2e-53    
ref|XP_011006903.1|  PREDICTED: UPF0481 protein At3g47200-like          197   2e-53    
ref|XP_007217420.1|  hypothetical protein PRUPE_ppa026411mg             198   2e-53    
ref|XP_002877729.1|  hypothetical protein ARALYDRAFT_485370             199   3e-53    
gb|KCW80414.1|  hypothetical protein EUGRSUZ_C01771                     196   3e-53    
ref|XP_002525523.1|  conserved hypothetical protein                     197   3e-53    
ref|XP_010426555.1|  PREDICTED: UPF0481 protein At3g47200               200   3e-53    
gb|KDP22057.1|  hypothetical protein JCGZ_25888                         197   3e-53    
ref|XP_006371611.1|  hypothetical protein POPTR_0019s13650g             197   3e-53    
ref|XP_010048224.1|  PREDICTED: UPF0481 protein At3g47200-like          197   4e-53    
ref|XP_003618470.1|  hypothetical protein MTR_6g010920                  196   4e-53    
ref|XP_006446060.1|  hypothetical protein CICLE_v10015312mg             197   4e-53    
ref|XP_010032797.1|  PREDICTED: UPF0481 protein At3g47200-like          197   4e-53    
ref|XP_011048460.1|  PREDICTED: UPF0481 protein At3g47200-like is...    196   5e-53    
ref|XP_004288002.1|  PREDICTED: UPF0481 protein At3g47200-like          198   6e-53    
ref|XP_011048459.1|  PREDICTED: UPF0481 protein At3g47200-like is...    196   6e-53    
ref|XP_010028186.1|  PREDICTED: UPF0481 protein At3g47200-like          199   6e-53    
gb|KCW54863.1|  hypothetical protein EUGRSUZ_I00808                     199   7e-53    
ref|XP_006480454.1|  PREDICTED: putative UPF0481 protein At3g0264...    196   8e-53    
ref|XP_006290339.1|  hypothetical protein CARUB_v10016996mg             198   8e-53    
gb|KDP22060.1|  hypothetical protein JCGZ_25891                         196   9e-53    
ref|XP_007052257.1|  Uncharacterized protein TCM_005662                 195   1e-52    
ref|XP_011007399.1|  PREDICTED: UPF0481 protein At3g47200-like          196   2e-52    
ref|XP_006428634.1|  hypothetical protein CICLE_v10011671mg             196   2e-52    
ref|XP_006492690.1|  PREDICTED: putative UPF0481 protein At3g0264...    195   2e-52    
ref|XP_010026742.1|  PREDICTED: UPF0481 protein At3g47200-like          195   2e-52    
ref|NP_190582.1|  uncharacterized protein                               198   2e-52    
ref|XP_004511891.1|  PREDICTED: UPF0481 protein At3g47200-like          197   2e-52    
ref|XP_006446065.1|  hypothetical protein CICLE_v10015137mg             196   2e-52    
ref|XP_009619623.1|  PREDICTED: UPF0481 protein At3g47200-like          197   2e-52    
gb|EYU44433.1|  hypothetical protein MIMGU_mgv1a004084mg                197   2e-52    
ref|XP_003526324.1|  PREDICTED: UPF0481 protein At3g47200-like          194   2e-52    
gb|KHN36255.1|  UPF0481 protein                                         197   2e-52    
ref|XP_011090643.1|  PREDICTED: putative UPF0481 protein At3g02645      195   3e-52    
ref|XP_007156767.1|  hypothetical protein PHAVU_002G015900g             197   3e-52    
ref|XP_006290309.1|  hypothetical protein CARUB_v10019135mg             197   3e-52    
ref|XP_002310707.1|  hypothetical protein POPTR_0007s10640g             196   4e-52    
ref|XP_010921579.1|  PREDICTED: UPF0481 protein At3g47200-like          195   4e-52    
ref|XP_009136539.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0481 prot...    197   5e-52    
ref|XP_010259809.1|  PREDICTED: UPF0481 protein At3g47200-like          194   5e-52    
gb|ABK28592.1|  unknown                                                 197   5e-52    
ref|XP_006445876.1|  hypothetical protein CICLE_v10015467mg             193   5e-52    
ref|XP_006432609.1|  hypothetical protein CICLE_v10003209mg             192   5e-52    
ref|XP_007031820.1|  Uncharacterized protein isoform 2                  194   6e-52    
ref|XP_009355716.1|  PREDICTED: UPF0481 protein At3g47200-like          194   6e-52    
emb|CBI21014.3|  unnamed protein product                                193   6e-52    
ref|XP_011041405.1|  PREDICTED: UPF0481 protein At3g47200-like          193   8e-52    
emb|CAN82114.1|  hypothetical protein VITISV_031339                     194   8e-52    
emb|CDY23019.1|  BnaC07g31680D                                          196   8e-52    
ref|XP_008341318.1|  PREDICTED: UPF0481 protein At3g47200-like          194   1e-51    
ref|XP_007210008.1|  hypothetical protein PRUPE_ppa016155mg             193   1e-51    
ref|XP_006446049.1|  hypothetical protein CICLE_v10017796mg             192   1e-51    
ref|XP_009371668.1|  PREDICTED: UPF0481 protein At3g47200-like          193   2e-51    
ref|XP_007031819.1|  Uncharacterized protein isoform 1                  193   2e-51    
ref|XP_006404052.1|  hypothetical protein EUTSA_v10011018mg             195   2e-51    
ref|XP_010657662.1|  PREDICTED: UPF0481 protein At3g47200-like          192   2e-51    
gb|KDO64821.1|  hypothetical protein CISIN_1g038807mg                   192   2e-51    
ref|XP_008243641.1|  PREDICTED: UPF0481 protein At3g47200-like          194   2e-51    
ref|XP_004165720.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0481 prot...    193   2e-51    
ref|XP_004142002.1|  PREDICTED: UPF0481 protein At3g47200-like          193   3e-51    
ref|XP_006376523.1|  hypothetical protein POPTR_0013s14250g             192   3e-51    
emb|CDY17818.1|  BnaC08g04320D                                          191   3e-51    
emb|CDP02532.1|  unnamed protein product                                194   3e-51    
ref|XP_007137038.1|  hypothetical protein PHAVU_009G094500g             191   3e-51    
ref|XP_006420599.1|  hypothetical protein CICLE_v10005005mg             192   3e-51    
ref|XP_008779685.1|  PREDICTED: UPF0481 protein At3g47200-like          192   3e-51    
ref|XP_010683795.1|  PREDICTED: putative UPF0481 protein At3g02645      193   4e-51    
ref|XP_011005812.1|  PREDICTED: UPF0481 protein At3g47200               193   4e-51    
ref|XP_008440314.1|  PREDICTED: UPF0481 protein At3g47200               193   4e-51    
ref|XP_010050752.1|  PREDICTED: UPF0481 protein At3g47200-like          191   5e-51    
ref|XP_007031831.1|  Uncharacterized protein TCM_017159                 191   5e-51    
ref|XP_002877734.1|  hypothetical protein ARALYDRAFT_323593             194   5e-51    
ref|XP_003618462.1|  hypothetical protein MTR_6g010810                  191   5e-51    
ref|XP_006389077.1|  hypothetical protein POPTR_0048s00270g             191   7e-51    
ref|XP_002509542.1|  conserved hypothetical protein                     191   7e-51    
gb|KGN48549.1|  hypothetical protein Csa_6G491610                       192   9e-51    
emb|CDY02091.1|  BnaA03g40760D                                          192   9e-51    
ref|XP_006492735.1|  PREDICTED: putative UPF0481 protein At3g0264...    190   1e-50    
ref|XP_010030530.1|  PREDICTED: UPF0481 protein At3g47200-like          192   1e-50    
gb|KDO64811.1|  hypothetical protein CISIN_1g045513mg                   190   1e-50    
gb|EMT22830.1|  hypothetical protein F775_06140                         191   1e-50    
ref|XP_008445187.1|  PREDICTED: UPF0481 protein At3g47200-like          191   1e-50    
gb|AES74694.2|  DUF247 domain protein                                   189   1e-50    
gb|KCW54853.1|  hypothetical protein EUGRSUZ_I00798                     192   1e-50    
ref|XP_010248039.1|  PREDICTED: UPF0481 protein At3g47200-like          191   2e-50    
ref|XP_011037845.1|  PREDICTED: UPF0481 protein At3g47200-like          190   2e-50    
emb|CDX84124.1|  BnaC04g08860D                                          190   2e-50    
ref|XP_003618476.1|  hypothetical protein MTR_6g011050                  189   2e-50    
gb|EPS58948.1|  hypothetical protein M569_15864                         190   2e-50    
emb|CAN59797.1|  hypothetical protein VITISV_038869                     194   2e-50    
gb|KDP46304.1|  hypothetical protein JCGZ_10144                         189   3e-50    
gb|KDP35993.1|  hypothetical protein JCGZ_08388                         189   3e-50    
ref|XP_006369853.1|  hypothetical protein POPTR_0001s34050g             189   3e-50    
ref|XP_010050753.1|  PREDICTED: UPF0481 protein At3g47200-like          189   3e-50    
emb|CDX75037.1|  BnaA05g07830D                                          189   3e-50    
ref|XP_008445583.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0481 prot...    192   4e-50    
ref|XP_006445882.1|  hypothetical protein CICLE_v10015342mg             188   4e-50    
ref|XP_004160795.1|  PREDICTED: UPF0481 protein At3g47200-like          189   4e-50    
ref|XP_003548087.2|  PREDICTED: UPF0481 protein At3g47200-like          188   5e-50    
emb|CDP11189.1|  unnamed protein product                                189   5e-50    
gb|AFK38916.1|  unknown                                                 191   5e-50    
ref|XP_003611672.1|  hypothetical protein MTR_5g016570                  190   6e-50    
gb|KCW75530.1|  hypothetical protein EUGRSUZ_E04295                     187   7e-50    
ref|XP_009143584.1|  PREDICTED: UPF0481 protein At3g47200               188   9e-50    
ref|XP_010059735.1|  PREDICTED: UPF0481 protein At3g47200-like          189   9e-50    
ref|XP_002303881.2|  hypothetical protein POPTR_0003s20550g             188   1e-49    
ref|XP_003548089.1|  PREDICTED: UPF0481 protein At3g47200-like is...    187   1e-49    
ref|XP_009352705.1|  PREDICTED: UPF0481 protein At3g47200-like          187   1e-49    
gb|KGN62930.1|  hypothetical protein Csa_2G380590                       188   2e-49    
ref|XP_006840961.1|  hypothetical protein AMTR_s00085p00029680          189   2e-49    
ref|XP_006447098.1|  hypothetical protein CICLE_v10018152mg             187   2e-49    
ref|XP_006388494.1|  hypothetical protein POPTR_0172s00210g             187   2e-49    
ref|XP_009404204.1|  PREDICTED: UPF0481 protein At3g47200-like          187   2e-49    
ref|XP_008781329.1|  PREDICTED: UPF0481 protein At3g47200-like          187   2e-49    
ref|NP_001141639.2|  uncharacterized protein LOC100273762               187   2e-49    
ref|XP_003548088.2|  PREDICTED: UPF0481 protein At3g47200-like          186   3e-49    
ref|XP_002298612.1|  hypothetical protein POPTR_0001s34040g             186   3e-49    
ref|XP_011020609.1|  PREDICTED: UPF0481 protein At3g47200-like is...    184   3e-49    
ref|XP_006487606.1|  PREDICTED: UPF0481 protein At3g47200-like          184   3e-49    
gb|AFW64916.1|  hypothetical protein ZEAMMB73_820356                    186   3e-49    
ref|XP_006446058.1|  hypothetical protein CICLE_v10015351mg             186   3e-49    
gb|KDO55609.1|  hypothetical protein CISIN_1g012835mg                   186   4e-49    
ref|XP_003518455.1|  PREDICTED: UPF0481 protein At3g47200-like          186   4e-49    
ref|XP_010041447.1|  PREDICTED: UPF0481 protein At3g47200-like          186   6e-49    
ref|XP_011048457.1|  PREDICTED: UPF0481 protein At3g47200-like          185   7e-49    
ref|XP_006446061.1|  hypothetical protein CICLE_v10015310mg             185   7e-49    
gb|KHN32829.1|  UPF0481 protein                                         185   8e-49    
ref|XP_002512705.1|  conserved hypothetical protein                     186   8e-49    
ref|XP_007202944.1|  hypothetical protein PRUPE_ppa016383mg             185   9e-49    
ref|XP_007203930.1|  hypothetical protein PRUPE_ppa018818mg             187   1e-48    
gb|KDO64815.1|  hypothetical protein CISIN_1g014668mg                   184   1e-48    
ref|XP_008242397.1|  PREDICTED: putative UPF0481 protein At3g02645      184   1e-48    
ref|XP_003603426.1|  hypothetical protein MTR_3g107590                  184   2e-48    
gb|EYU24251.1|  hypothetical protein MIMGU_mgv1a019478mg                182   2e-48    
ref|XP_006467196.1|  PREDICTED: UPF0481 protein At3g47200-like          184   2e-48    
gb|KDO38529.1|  hypothetical protein CISIN_1g035777mg                   184   2e-48    
ref|XP_008245116.1|  PREDICTED: UPF0481 protein At3g47200-like          184   2e-48    
ref|XP_006481874.1|  PREDICTED: UPF0481 protein At3g47200-like          184   2e-48    
ref|XP_002309780.2|  hypothetical protein POPTR_0007s01630g             185   2e-48    
ref|XP_008378638.1|  PREDICTED: UPF0481 protein At3g47200-like          184   3e-48    
ref|XP_006372813.1|  hypothetical protein POPTR_0017s05300g             184   3e-48    
gb|KCW52283.1|  hypothetical protein EUGRSUZ_J01703                     184   3e-48    
ref|XP_007049922.1|  Uncharacterized protein TCM_003171                 185   3e-48    
ref|XP_009380009.1|  PREDICTED: UPF0481 protein At3g47200-like          184   3e-48    
ref|XP_006481786.1|  PREDICTED: UPF0481 protein At3g47200-like is...    184   3e-48    
ref|XP_006430217.1|  hypothetical protein CICLE_v10011743mg             184   3e-48    
ref|XP_008337775.1|  PREDICTED: putative UPF0481 protein At3g02645      184   4e-48    
ref|XP_006410820.1|  hypothetical protein EUTSA_v10016644mg             183   5e-48    
ref|XP_010679532.1|  PREDICTED: UPF0481 protein At3g47200               185   5e-48    
ref|XP_006292406.1|  hypothetical protein CARUB_v10018618mg             185   6e-48    
ref|XP_006386037.1|  hypothetical protein POPTR_0003s20630g             183   6e-48    
ref|XP_010250414.1|  PREDICTED: UPF0481 protein At3g47200-like          183   6e-48    
gb|EYU23678.1|  hypothetical protein MIMGU_mgv1a006652mg                183   6e-48    
ref|XP_006420597.1|  hypothetical protein CICLE_v10004996mg             182   6e-48    
gb|KHN41210.1|  UPF0481 protein                                         182   9e-48    
gb|KCW45548.1|  hypothetical protein EUGRSUZ_L00729                     180   9e-48    
ref|XP_007031811.1|  Uncharacterized protein TCM_017122                 182   1e-47    
gb|KDO62950.1|  hypothetical protein CISIN_1g044983mg                   182   1e-47    
ref|XP_011026646.1|  PREDICTED: UPF0481 protein At3g47200-like          181   1e-47    
gb|KCW54887.1|  hypothetical protein EUGRSUZ_I00852                     184   1e-47    
ref|XP_004292995.1|  PREDICTED: UPF0481 protein At3g47200-like          182   1e-47    
ref|XP_006574779.1|  PREDICTED: putative UPF0481 protein At3g0264...    182   1e-47    
gb|AFK44688.1|  unknown                                                 182   1e-47    
ref|XP_010272333.1|  PREDICTED: UPF0481 protein At3g47200-like          182   1e-47    
ref|XP_010059734.1|  PREDICTED: UPF0481 protein At3g47200-like          183   1e-47    
ref|XP_010028193.1|  PREDICTED: UPF0481 protein At3g47200-like          184   1e-47    
ref|XP_006388988.1|  hypothetical protein POPTR_0063s00210g             181   2e-47    
ref|XP_010447465.1|  PREDICTED: UPF0481 protein At3g47200-like is...    179   2e-47    
ref|XP_006445879.1|  hypothetical protein CICLE_v10015398mg             181   2e-47    
emb|CDP11192.1|  unnamed protein product                                181   2e-47    
ref|XP_006422894.1|  hypothetical protein CICLE_v10029965mg             181   2e-47    
ref|XP_002304623.1|  hypothetical protein POPTR_0003s15770g             181   2e-47    
ref|XP_009350461.1|  PREDICTED: UPF0481 protein At3g47200-like          181   3e-47    
gb|KDO62949.1|  hypothetical protein CISIN_1g038328mg                   181   3e-47    
ref|XP_010942387.1|  PREDICTED: UPF0481 protein At3g47200-like          181   3e-47    
ref|XP_006430214.1|  hypothetical protein CICLE_v10013563mg             181   4e-47    
ref|XP_006481873.1|  PREDICTED: putative UPF0481 protein At3g0264...    181   4e-47    
ref|XP_010917610.1|  PREDICTED: UPF0481 protein At3g47200-like          181   4e-47    
ref|XP_006492693.1|  PREDICTED: putative UPF0481 protein At3g0264...    180   5e-47    
ref|XP_003580099.1|  PREDICTED: UPF0481 protein At3g47200-like          182   5e-47    
gb|KGN62928.1|  hypothetical protein Csa_2G380080                       180   6e-47    
ref|XP_006420593.1|  hypothetical protein CICLE_v10004986mg             180   6e-47    
ref|XP_006487609.1|  PREDICTED: UPF0481 protein At3g47200-like          180   7e-47    
ref|XP_006445875.1|  hypothetical protein CICLE_v10018254mg             179   7e-47    
ref|XP_010263404.1|  PREDICTED: UPF0481 protein At3g47200-like          182   9e-47    
ref|XP_007226514.1|  hypothetical protein PRUPE_ppa025832mg             179   9e-47    
gb|KDO62945.1|  hypothetical protein CISIN_1g044114mg                   179   1e-46    
gb|KDP28573.1|  hypothetical protein JCGZ_14344                         183   1e-46    
ref|XP_009368170.1|  PREDICTED: UPF0481 protein At3g47200-like          181   1e-46    
gb|ABD83313.1|  Fgenesh protein 60                                      180   1e-46    
gb|KDO62960.1|  hypothetical protein CISIN_1g041721mg                   178   1e-46    
ref|XP_011020931.1|  PREDICTED: UPF0481 protein At3g47200-like          179   1e-46    
ref|XP_002283339.2|  PREDICTED: UPF0481 protein At3g47200               179   2e-46    
ref|XP_003618445.1|  hypothetical protein MTR_6g009610                  178   2e-46    
gb|KDP35990.1|  hypothetical protein JCGZ_08385                         178   2e-46    
emb|CBI30256.3|  unnamed protein product                                179   2e-46    
ref|XP_008242396.1|  PREDICTED: putative UPF0481 protein At3g02645      179   2e-46    
ref|XP_006388011.1|  hypothetical protein POPTR_0403s00200g             179   2e-46    
ref|XP_002449645.1|  hypothetical protein SORBIDRAFT_05g020790          179   2e-46    
ref|XP_010034510.1|  PREDICTED: UPF0481 protein At3g47200-like          178   3e-46    
ref|XP_002524913.1|  conserved hypothetical protein                     180   3e-46    



>ref|XP_009792620.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
 ref|XP_009792621.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
Length=519

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 206/521 (40%), Positives = 293/521 (56%), Gaps = 71/521 (14%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDLPIYESLK----------RDIKNLKQLSSEACIFKVHEGL  170
             I E ++   +IE  + D QD P +++ K          +D+ NL   S+   IFKV+ GL
Sbjct  26    IKEGEKVGHLIETNKRDGQDRPGFQTSKSANKILDEIYKDLDNLAIRST--TIFKVNVGL  83

Query  171   RRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKE  350
             R +N DAYTP +ISIGPYH  N +L  ME  KL+YL  FL+R++  ++E C  +L++ K+
Sbjct  84    RESNPDAYTPKMISIGPYHKKNQELHSMEKYKLLYLQRFLRRKEGLNVESCIRELEELKD  143

Query  351   KAASYYGDDEDIQLLLDSAGD--KFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkk  524
             +A   Y   +DI+ L+DS  +  +F+KMLL DGCF+ EF+      +             
Sbjct  144   EALMCY---DDIKDLIDSDNNTGEFLKMLLFDGCFLVEFIREVIGIKPT-----------  189

Query  525   CDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLT  704
                + + +   +  QV RDLLLLENQLPFFVL +LH M  DE       I  I F  M+ 
Sbjct  190   -GEDMIILGGCLDDQVRRDLLLLENQLPFFVLTKLHDMTKDE-------IYDIPFTKMVK  241

Query  705   KVRL--IPPIVP---NLGDNNATEMKGHLLQIVHNLCNPQ-------NGGIQEERHYWTL  848
              +    +P + P   N    NA E+K HLLQ++H  C+P         G I +E  +   
Sbjct  242   WIFFHDLPKLTPASFNESAGNAAEIK-HLLQVIHMSCHPSEMKTNKLTGNISKEAEHSRK  300

Query  849   CFPCSLGKQ--------SQDSKVGSSDIRTATELQEAGVNLKKVVK------------SS  968
                C+L ++         +D+     ++  ATEL EAGV   KV              S+
Sbjct  301   NLCCNLLQRVRPKEMPKDKDNLTWQDNMPNATELCEAGVGFSKVGNIYACLAEDNLGDST  360

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
             SLF I F +  + IP F +TD TET  RN IAYEQHS D +  YF+++A  MD+LI++EK
Sbjct  361   SLFDIGFENGLMSIPCFKVTDNTETLLRNFIAYEQHSPDIDPKYFSEFAVFMDHLIDSEK  420

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVM  1328
             DV L R+ G++ N +G+DKEV +LFN + KGV  SS   F+Y +VC K   H  +PWN M
Sbjct  421   DVTLLRLKGIIANDIGEDKEVANLFNNIGKGVGISS--DFHYKEVCGKAVQHCEQPWNRM  478

Query  1329  MAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
              A LR +YF++PWAG+ST+AAV LL LT+ QTV++ + + K
Sbjct  479   KASLRRNYFHSPWAGVSTVAAVILLLLTVTQTVLSFISVLK  519



>ref|XP_009603759.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana tomentosiformis]
Length=470

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 193/456 (42%), Positives = 269/456 (59%), Gaps = 42/456 (9%)
 Frame = +3

Query  114   KNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             K+L + S+++C IFKV+ GLRR+N+DAYTPLLISIGPYH  N +   MEN KL YL  FL
Sbjct  40    KDLNKWSTKSCTIFKVNAGLRRSNSDAYTPLLISIGPYHKKNPQFCSMENYKLRYLQRFL  99

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             +R K+  +E    +L+  K++    Y D  ++     S   +F++MLLLDGCF+ E+L  
Sbjct  100   QRNKEIDVESYIRELEKLKDEVLKCYDDKGELGSYTSS---QFLEMLLLDGCFVVEYLRE  156

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE  650
              +    ++             + +     M   + RDLLLLENQLPF VL +LH M    
Sbjct  157   VFKIFPER------------EDKIINADWMVNLIDRDLLLLENQLPFLVLTKLHDMTKYP  204

Query  651   SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE  830
             ++  F+ +VK  F   L +V    P   N  + N   +K HLLQ+VH +C    G  + E
Sbjct  205   TE-SFIKMVKYNFCGSLPRV---TPKFLNEANGNVKAIK-HLLQVVH-MC----GTCRPE  254

Query  831   RHYWTLCFPCSLGKQS-QDSKVGSSDIRTATELQEAGVNLKKVVK------------SSS  971
             +HY +L F   L  Q  +D+ +    +R+ATEL EAG+N  KV +            S+S
Sbjct  255   KHY-SLTFEPELEPQIIKDANLWHDLMRSATELDEAGINFSKVSEIYRMLGEDNEGDSTS  313

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
             LF IK+ +  ++IP F + + TET  RN++AYEQHS D    YFTDY   MD LIN+ +D
Sbjct  314   LFDIKYVNGRMKIPCFEVVNGTETVLRNLVAYEQHSSDVYTKYFTDYVIFMDRLINSAED  373

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V L R+ G++ N +GDD +V  +FN+L  GV+ SS   FYY + C K+  H NK WN  M
Sbjct  374   VKLLRLKGIIRNRIGDDSDVASIFNKLGDGVIPSS--NFYYKEECKKVVEHCNKRWNRRM  431

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             A LRH+YFN PW G+ST AAVFLL+LT+ QTV+  +
Sbjct  432   ANLRHNYFNGPWVGLSTAAAVFLLALTLMQTVLTFI  467



>gb|EYU33527.1| hypothetical protein MIMGU_mgv1a020659mg, partial [Erythranthe 
guttata]
Length=471

 Score =   320 bits (819),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 208/490 (42%), Positives = 278/490 (57%), Gaps = 65/490 (13%)
 Frame = +3

Query  75    QDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG---NAKL  245
             Q+L + E LK    N   L S   IFKVH+GLRR+N D+Y P+++SIGPYHH    N  L
Sbjct  12    QNLQLKELLKALRTNQLILPS---IFKVHQGLRRSNPDSYAPMIVSIGPYHHASTANPNL  68

Query  246   SKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVK  425
               MEN+KL YL  FL R  +  + +    L+ SK KA S+Y D    Q   D  GD FV+
Sbjct  69    LPMENIKLSYLHSFLARTSEDDVGRYVLALQQSKHKALSFYAD----QNFDDENGDLFVE  124

Query  426   MLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQL  605
             M+LLDGCFI EF+ R  + E   +          +++ +F    M+ Q+ RDL+L+ENQL
Sbjct  125   MMLLDGCFIVEFVRRYSELENGHD---------LEDDPIFGVDWMRIQICRDLMLIENQL  175

Query  606   PFFVLQELHGM---------VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNAT  758
             P+FVL EL+ +         + DE +P F ++  + F+ M  K  L P  + +  +    
Sbjct  176   PYFVLLELYNLNHDDQFDDVIGDEREP-FANLAMLVFSDMFPK--LCPASIFSSAELFEE  232

Query  759   EMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD------IRTAT  920
                 HLL +VH LC P                    G +S +   G S       +R   
Sbjct  233   REVKHLLHLVHLLCRPPPHSSSS-----------PSGLKSFEGNYGVSGSEVMEPMRCVK  281

Query  921   ELQEAGVNLKKVVK---------------SSSLFHIKFNHAELEIPKFHITDPTETFFRN  1055
             EL+EAG+  KK+ K               + SLF IKF++  +EIP   + D T+TFFRN
Sbjct  282   ELEEAGITFKKIGKVYAGIHSLDADTIDDTISLFDIKFHNGVMEIPSLKVEDSTDTFFRN  341

Query  1056  MIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLC  1235
             +IAYEQHS +    YFTDYA  MD LINT++DVN+ R NG++VN LGDD EV +LFN+L 
Sbjct  342   LIAYEQHSSELRPKYFTDYAMFMDQLINTDEDVNVLRRNGIIVNLLGDDGEVANLFNKLG  401

Query  1236  KGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTI  1415
             +GV+ SS   FYY   CN +N H  K WNV+MAKLRHDYFN+PWA  STIAAV LL LT+
Sbjct  402   EGVITSS--NFYYLGTCNSVNQHCGKIWNVVMAKLRHDYFNSPWATASTIAAVVLLILTV  459

Query  1416  AQTVIAVLDL  1445
              QT+ +V+ L
Sbjct  460   IQTIASVIPL  469



>ref|XP_009628169.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=489

 Score =   317 bits (813),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/461 (41%), Positives = 260/461 (56%), Gaps = 55/461 (12%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV+ GLR +N DAYTP +ISIGPYH+ N +L  M+  KL+YL  FLKR+ +  +E C 
Sbjct  58    IFKVNVGLRESNPDAYTPKIISIGPYHNKNPQLGSMKKYKLLYLQRFLKRKTEIDVESCI  117

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
              KL+ +K++A   Y  + D  ++++     F +M+LLDGCFI EF+      +       
Sbjct  118   SKLEKNKDEALKCYDVNIDSDIVVE-----FSQMMLLDGCFIVEFIRECCGWKPT-----  167

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKIT  686
                    + + +     M  QV RD+LLLENQLP+FVL  LH M     +P  + +VK T
Sbjct  168   -------EEDEIINREWMMLQVCRDMLLLENQLPYFVLTMLHEMTKYPKEPNLIKMVKST  220

Query  687   FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ---------NGGIQEERHY  839
             F        L P   P + D  A +   HLL ++H L  P          NG  ++E   
Sbjct  221   FPD------LFPNKNPEIIDGTAPQQPDHLLDVLHMLSRPSKMKNTSKTTNGSTRKE---  271

Query  840   WTLCFPCSLGKQSQ--------DSKVG--SSDIRTATELQEAGVNLKKV-------VKSS  968
                C    LGK  Q        D   G     I +ATEL EAGV+ +K+       +  +
Sbjct  272   --CCNISFLGKILQIIRSKEMPDEISGWECCQIPSATELYEAGVSFQKLGALGKDSMDRT  329

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
             ++F IKF     EIP F + D  ETF RNMIAYEQHS   +  Y+TDY  +M  LI + K
Sbjct  330   TIFDIKFKDGLFEIPCFAVEDTLETFLRNMIAYEQHSSSLHLRYYTDYGWIMSQLIVSHK  389

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVM  1328
             DVNL R NG+++N +G DK+V  +FN+L +GV+ SS D FY ++ C K+  HY  PWN M
Sbjct  390   DVNLLRQNGIMLNEIGHDKQVATIFNKLTQGVITSSND-FYCNEECIKIIQHYENPWNQM  448

Query  1329  MAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             MAKLRH+YF +PWAG ST+AA+ LL LT+ QTV++++   K
Sbjct  449   MAKLRHNYFQSPWAGASTVAAIVLLLLTVTQTVLSLISALK  489



>ref|XP_009600725.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=508

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 206/511 (40%), Positives = 280/511 (55%), Gaps = 65/511 (13%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDL----------PIYESLKRDIKNLKQLSSEACIFKVHEGL  170
             I E ++   +IE  E + QD            IYE L     ++        IFKV  GL
Sbjct  25    IEEEKKVDHLIEKKETNGQDQVNKSANKIIDEIYEDL-----DMNSAMKSTTIFKVSVGL  79

Query  171   RRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKE  350
             R +N DAY P +ISIGPYH  N +L  ME  KL YL  FL+R++   +E C  +L+D   
Sbjct  80    RESNPDAYKPKVISIGPYHKHNPELRSMEKYKLRYLQRFLRRKEGIDVESCIRELED---  136

Query  351   KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCD  530
             +A + Y D E++    D  G KF K+LLLDGCF+ EF+   Y    +            +
Sbjct  137   EALNCYDDIENLD--SDIVG-KFSKLLLLDGCFLVEFIRERYGIYPE------------E  181

Query  531   NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY-DESKPKFLDIVKITFASMLTK  707
                +     +  QV RDLLL+ENQLPFFVL +LH M   DE +  F  +VK  F   L K
Sbjct  182   EGWIIPGNCISNQVRRDLLLVENQLPFFVLTKLHHMTMDDEDEIPFTTMVKWIFLPSLPK  241

Query  708   VRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ--------NGGIQEERHYWTLCF-PC  860
                + P   N  + NA E+K HLLQ+VH  C+P         N  ++ E  + +LC  P 
Sbjct  242   ---MTPASFNESEGNAAEIK-HLLQVVHMSCHPSEIKTTSLTNPSMETEHSWKSLCCNPL  297

Query  861   SLGKQS-----QDSKVGSSDIRTATELQEAGVNLKKV------------VKSSSLFHIKF  989
              + +       +D   G + +  ATEL EAGV+  KV              ++SLF IKF
Sbjct  298   QIIRSKDKPIDKDHLTGHNVMPNATELSEAGVSFVKVGYIYNKLRKENYGDNTSLFDIKF  357

Query  990   NHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRM  1169
              +  + IP F++TD TET  RN+IAYEQ S      YF+D+A  MD LI++E+DVNL R 
Sbjct  358   ENGLMRIPSFNVTDSTETLLRNLIAYEQQSSHVRPRYFSDFAIFMDYLIDSERDVNLLRH  417

Query  1170  NGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHD  1349
              G++ N +G+DKE+  LFN++ KGV+ SS + FYY + C KL  HY +PWN+M A LR +
Sbjct  418   KGIIRNRIGEDKEIASLFNKIGKGVIVSS-ENFYYKEECRKLVQHYEQPWNLMKASLRRN  476

Query  1350  YFNTPWAGISTIAAVFLLSLTIAQTVIAVLD  1442
             YF++PW G ST+AAV LL LT  QTV+A  D
Sbjct  477   YFSSPWVGASTVAAVILLILTAMQTVLAFTD  507



>ref|XP_009781968.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
 ref|XP_009781969.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=474

 Score =   313 bits (802),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 193/472 (41%), Positives = 267/472 (57%), Gaps = 46/472 (10%)
 Frame = +3

Query  72    QQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLS  248
             Q ++   E      K+L + S+++C IFKV+ GLRR+N+DAYTPLLISIGPYH  N +L 
Sbjct  30    QTNISAKEIFDERFKDLNKWSTKSCTIFKVNAGLRRSNSDAYTPLLISIGPYHKKNPQLC  89

Query  249   KMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKM  428
              MEN KL YL  FL+R  +  ++    +L+  K++    Y D  +   L   A  +F++M
Sbjct  90    SMENYKLRYLQRFLQRNNEIDVKSYIRELQKMKDEVLKCYDDKVE---LGSYASGQFLEM  146

Query  429   LLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLP  608
             LLLDGCF+ E+L   +    +              + +     M   + RDLLLLENQLP
Sbjct  147   LLLDGCFVVEYLREVFKIFPE------------GEDKIINADWMVNLIDRDLLLLENQLP  194

Query  609   FFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG--HLLQ  782
             F VL +LH M    ++  F+ +VK  F   L      P + P         +KG  HLLQ
Sbjct  195   FLVLTKLHDMTKYPTE-SFIKMVKYNFCGSL------PRVTPKFLYEANGNVKGIKHLLQ  247

Query  783   IVHNLCNPQNGGIQEERHYWTLCFPCSLGKQS-QDSKVGSSDIRTATELQEAGVNLKKVV  959
             +VH +C    G  + E+ Y +L F   L  Q  +D+ +    +R+ATEL EAG+N  KV 
Sbjct  248   VVH-MC----GTGRPEKPY-SLTFESELEPQIIKDANLWHDLMRSATELDEAGINFSKVS  301

Query  960   K------------SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYF  1103
             +            ++SLF IK+N+  ++IP F + + TET  RN++AYEQHS D    YF
Sbjct  302   EIYRMLGEDNRGDNTSLFDIKYNNGRMKIPCFEVVNGTETVLRNLVAYEQHSSDVYTKYF  361

Query  1104  TDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDV  1283
             TDY   MD LIN  +DV L RM  ++ N +GDD +V  +FN+L  GV+ SS   FYY + 
Sbjct  362   TDYVIFMDRLINAAEDVKLLRMKEIIRNRIGDDSDVASIFNKLGDGVIPSS--NFYYKEE  419

Query  1284  CNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             C K+  H NK WN  MA LRH+YFN PW G+ST AAVFLL LT+ QTV+  +
Sbjct  420   CKKVVEHCNKRWNRRMANLRHNYFNGPWVGLSTAAAVFLLVLTLMQTVLTFI  471



>ref|XP_009792233.1| PREDICTED: putative UPF0481 protein At3g02645, partial [Nicotiana 
sylvestris]
Length=474

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 204/505 (40%), Positives = 277/505 (55%), Gaps = 64/505 (13%)
 Frame = +3

Query  15    IYISELQRQ*GMIENTEGDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDA  191
             ++I E +    +IE    D Q+ P+++         + L +E+C IFKV  GL  +N DA
Sbjct  1     LHIQEGREADYVIEIKTADGQN-PVFD---------EGLFTESCTIFKVTTGLHESNPDA  50

Query  192   YTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYG  371
             YTP LISIGPYH  N KL  ME  KL Y   FL+R+++  +E C  +L++ +++A   Y 
Sbjct  51    YTPKLISIGPYHKNNPKLRSMEKYKLHYRQRFLRRKERIDLESCIRELEELQDEALKCYD  110

Query  372   DDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMP  551
             D +  Q   + +  KFV+MLLLDGCF+ E++        +              + +   
Sbjct  111   DID--QHFNNGSSRKFVEMLLLDGCFVVEYIREFCKMVPE------------GEDKIIKA  156

Query  552   TGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIV  731
               M+  V RDLLLLENQLPFF+L +LH M  D   P F+++VK  FA+ L KV    P  
Sbjct  157   AWMEVLVDRDLLLLENQLPFFILAKLHEMTTDHDVP-FIEMVKYNFATSLPKV---TPKF  212

Query  732   PNLGDNNATEMKGHLLQIVHNLCNP---------------QNGGIQEERHYWTLCFPCSL  866
                 D NA E+K HLLQ++H  C P               +NG   E+   W L    S 
Sbjct  213   IKKTDGNAKEVK-HLLQVIHVCCCPPGMNASLTGNASNKLKNG---EKSFNWPLQLSWSN  268

Query  867   GKQ--SQDSKVGSSDIRTATELQEAGVNLKKVVK------------SSSLFHIKFNHAEL  1004
              KQ    D  +    +R ATEL EAG+   K  K              SLF IK++   +
Sbjct  269   KKQQIEDDDDIWHDRMRCATELGEAGIEFSKAGKIYRRLNKDNEEDCISLFDIKYDKELI  328

Query  1005  EIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
             EIP F + D TET  RN+IAYEQHS D ++ YFTDY  LMD LIN++KDV LFR+ G++ 
Sbjct  329   EIPCFEVVDSTETVLRNLIAYEQHSIDVHHKYFTDYVILMDRLINSDKDVKLFRLKGIIR  388

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
             N +GDD E   +FNRL +GV+ S+   FYY + C K+  H  KPW+   A   H+YFN P
Sbjct  389   NRIGDDNEAASIFNRLGEGVIPST--QFYYKEACKKVVEHCEKPWSERKASFWHNYFNGP  446

Query  1365  WAGISTIAAVFLLSLTIAQTVIAVL  1439
             W G+ST AAV LLSLT+ QTV+  +
Sbjct  447   WVGLSTAAAVILLSLTVMQTVLTFI  471



>ref|XP_009789237.1| PREDICTED: UPF0481 protein At3g47200-like isoform X3 [Nicotiana 
sylvestris]
Length=509

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 262/466 (56%), Gaps = 52/466 (11%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             + IFKV+ GL  +N DAY P LISIGPYH  N +L  ME  KL Y   FL+R+    +E 
Sbjct  67    STIFKVNVGLCESNPDAYIPKLISIGPYHKKNPRLRSMEKYKLRYQQRFLQRKAWRDVEY  126

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
                +++  K++A   Y D  D++  + S   KF  +LLLDGCF+ E++   Y+   +   
Sbjct  127   YISEMEKLKDEALKCYDDIGDLESDIIS---KFSDLLLLDGCFVVEYIREFYEGVPE---  180

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                        + +     M+  V RDLLLLENQLPFF+L +LH M  D +   F+ +VK
Sbjct  181   ---------GEDKIIDAAWMESLVDRDLLLLENQLPFFILAKLHEMTKDPTDAPFIQMVK  231

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ--NGGIQEERHY-----  839
               F S L KV   P  +    D++A E+K HLLQ+VH  C P   N G+           
Sbjct  232   YNFGSSLPKV--TPKFINATDDDDAEEIK-HLLQVVHMCCCPSEMNTGLTRNSRKKKGSS  288

Query  840   -----WTLCFPCSLGKQSQDSKVGSSDI-----RTATELQEAGVNLKKVVK---------  962
                  W    P  +GK  +  K    D+     R+ATEL EAG+    V K         
Sbjct  289   KKSCNWN---PLRIGKSKKKFKTKDGDLWHDRMRSATELDEAGIRFSNVGKIYRKLNKNN  345

Query  963   ---SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                + SLF IKFN+  LEIP F + + TET  RN+IAYEQHS D +  YFTDY   MD+L
Sbjct  346   KEDAISLFDIKFNNGLLEIPCFEVVNSTETILRNLIAYEQHSSDVHPKYFTDYVIFMDHL  405

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             IN+ KDVNL R+NG++ N +GDD+EV  +FN+L +GV+ S+   F+Y   C K+  H  K
Sbjct  406   INSGKDVNLLRLNGIIRNRIGDDEEVAIMFNKLGEGVIPST--DFFYKVECRKVIEHCEK  463

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             PWN  MA LRH+Y N+PWA IST AA+ LL LT+AQTV+A++   K
Sbjct  464   PWNENMASLRHNYLNSPWAKISTAAAIILLLLTVAQTVLALISTLK  509



>ref|XP_009789236.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Nicotiana 
sylvestris]
Length=525

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 262/466 (56%), Gaps = 52/466 (11%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             + IFKV+ GL  +N DAY P LISIGPYH  N +L  ME  KL Y   FL+R+    +E 
Sbjct  83    STIFKVNVGLCESNPDAYIPKLISIGPYHKKNPRLRSMEKYKLRYQQRFLQRKAWRDVEY  142

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
                +++  K++A   Y D  D++  + S   KF  +LLLDGCF+ E++   Y+   +   
Sbjct  143   YISEMEKLKDEALKCYDDIGDLESDIIS---KFSDLLLLDGCFVVEYIREFYEGVPE---  196

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                        + +     M+  V RDLLLLENQLPFF+L +LH M  D +   F+ +VK
Sbjct  197   ---------GEDKIIDAAWMESLVDRDLLLLENQLPFFILAKLHEMTKDPTDAPFIQMVK  247

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ--NGGIQEERHY-----  839
               F S L KV   P  +    D++A E+K HLLQ+VH  C P   N G+           
Sbjct  248   YNFGSSLPKV--TPKFINATDDDDAEEIK-HLLQVVHMCCCPSEMNTGLTRNSRKKKGSS  304

Query  840   -----WTLCFPCSLGKQSQDSKVGSSDI-----RTATELQEAGVNLKKVVK---------  962
                  W    P  +GK  +  K    D+     R+ATEL EAG+    V K         
Sbjct  305   KKSCNWN---PLRIGKSKKKFKTKDGDLWHDRMRSATELDEAGIRFSNVGKIYRKLNKNN  361

Query  963   ---SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                + SLF IKFN+  LEIP F + + TET  RN+IAYEQHS D +  YFTDY   MD+L
Sbjct  362   KEDAISLFDIKFNNGLLEIPCFEVVNSTETILRNLIAYEQHSSDVHPKYFTDYVIFMDHL  421

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             IN+ KDVNL R+NG++ N +GDD+EV  +FN+L +GV+ S+   F+Y   C K+  H  K
Sbjct  422   INSGKDVNLLRLNGIIRNRIGDDEEVAIMFNKLGEGVIPST--DFFYKVECRKVIEHCEK  479

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             PWN  MA LRH+Y N+PWA IST AA+ LL LT+AQTV+A++   K
Sbjct  480   PWNENMASLRHNYLNSPWAKISTAAAIILLLLTVAQTVLALISTLK  525



>ref|XP_009789235.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Nicotiana 
sylvestris]
Length=540

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 262/466 (56%), Gaps = 52/466 (11%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             + IFKV+ GL  +N DAY P LISIGPYH  N +L  ME  KL Y   FL+R+    +E 
Sbjct  98    STIFKVNVGLCESNPDAYIPKLISIGPYHKKNPRLRSMEKYKLRYQQRFLQRKAWRDVEY  157

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
                +++  K++A   Y D  D++  + S   KF  +LLLDGCF+ E++   Y+   +   
Sbjct  158   YISEMEKLKDEALKCYDDIGDLESDIIS---KFSDLLLLDGCFVVEYIREFYEGVPE---  211

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                        + +     M+  V RDLLLLENQLPFF+L +LH M  D +   F+ +VK
Sbjct  212   ---------GEDKIIDAAWMESLVDRDLLLLENQLPFFILAKLHEMTKDPTDAPFIQMVK  262

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ--NGGIQEERHY-----  839
               F S L KV   P  +    D++A E+K HLLQ+VH  C P   N G+           
Sbjct  263   YNFGSSLPKV--TPKFINATDDDDAEEIK-HLLQVVHMCCCPSEMNTGLTRNSRKKKGSS  319

Query  840   -----WTLCFPCSLGKQSQDSKVGSSDI-----RTATELQEAGVNLKKVVK---------  962
                  W    P  +GK  +  K    D+     R+ATEL EAG+    V K         
Sbjct  320   KKSCNWN---PLRIGKSKKKFKTKDGDLWHDRMRSATELDEAGIRFSNVGKIYRKLNKNN  376

Query  963   ---SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                + SLF IKFN+  LEIP F + + TET  RN+IAYEQHS D +  YFTDY   MD+L
Sbjct  377   KEDAISLFDIKFNNGLLEIPCFEVVNSTETILRNLIAYEQHSSDVHPKYFTDYVIFMDHL  436

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             IN+ KDVNL R+NG++ N +GDD+EV  +FN+L +GV+ S+   F+Y   C K+  H  K
Sbjct  437   INSGKDVNLLRLNGIIRNRIGDDEEVAIMFNKLGEGVIPST--DFFYKVECRKVIEHCEK  494

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             PWN  MA LRH+Y N+PWA IST AA+ LL LT+AQTV+A++   K
Sbjct  495   PWNENMASLRHNYLNSPWAKISTAAAIILLLLTVAQTVLALISTLK  540



>ref|XP_009779907.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
 ref|XP_009779908.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=514

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 206/517 (40%), Positives = 281/517 (54%), Gaps = 78/517 (15%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDL----------PIYESLKRDIKNLKQLSSEACIFKVHEGL  170
             I E ++   +IEN E + QD            IYE L     ++        IFKV  GL
Sbjct  25    IEEGKKLDDIIENKETNGQDQVNKPANKILDEIYEDL-----DMNSAMRSTTIFKVSVGL  79

Query  171   RRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKE  350
             R +N DAY P LISIGPYH  N +L  ME  KL+YL  FL+R+++  +E C  +L+D   
Sbjct  80    RGSNPDAYKPKLISIGPYHKHNPELRSMEKYKLLYLQRFLRRKEEIDVESCIRELED---  136

Query  351   KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCD  530
             +A   Y D E+++   D  G+ F K+LLLDGCF+ E +        +             
Sbjct  137   EALKCYDDIENLER--DIVGN-FSKILLLDGCFLVELIREWCGMCPE------------G  181

Query  531   NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY-DESKPKFLDIVKITFASMLTK  707
                +     +  QV RDLLL+ENQLPFFVL +LH M   +E +  F  +VK  F      
Sbjct  182   EGPIIAINCIINQVCRDLLLVENQLPFFVLAKLHHMTMNEEDEISFTKMVKWFF------  235

Query  708   VRLIPPIVP-----NLGDNNATEMKGHLLQIVHNLCNP----------QNGGIQEERHYW  842
             + L+P + P     + G++ A E+K HLLQ+VH  C+P          +N  ++ E HY 
Sbjct  236   LPLLPKMAPASYFESEGNDIAVEIK-HLLQVVHMSCHPSEIKSTSLTHENPSLEME-HYC  293

Query  843   T---LCFPCSLGKQS-----QDSKVGSSDIRTATELQEAGVNLKKV------------VK  962
                  C P  + +       +D   G + +  ATEL EAGV+  KV              
Sbjct  294   NKSLCCNPLQIIRSKDKPIDKDHVTGHNVMPNATELSEAGVSFVKVGYIYDYLEEENCED  353

Query  963   SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
             ++SLF IKF +  ++IP F +TD TET  RN+IAYEQHS      YF+D+A  MD LI++
Sbjct  354   NTSLFDIKFENGLMKIPSFKVTDSTETLLRNLIAYEQHSSHVRPRYFSDFAIFMDYLIDS  413

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
             EKDVNL R  G++ N +G+DKEV  LFN++ KGV+ SS D FYY   C KL  HY +PWN
Sbjct  414   EKDVNLLRQKGIIRNMIGEDKEVASLFNKIGKGVIVSSED-FYYKQECRKLVHHYKQPWN  472

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             +M A LR +YFN+PW G ST+AAV LL LT  QT++ 
Sbjct  473   LMKASLRRNYFNSPWVGASTVAAVILLILTAMQTILT  509



>ref|XP_009788155.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X1 [Nicotiana 
sylvestris]
Length=495

 Score =   309 bits (791),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 200/495 (40%), Positives = 277/495 (56%), Gaps = 74/495 (15%)
 Frame = +3

Query  51    IENTEG-DQQDLPIYESLK----RDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLIS  212
             IE T G DQ  L   +S K    R+ K+    S ++  IFKV  GL  +N +AY P+LI+
Sbjct  42    IEETNGQDQSRLQAIKSAKQIYDRNFKDFNNPSIKSTTIFKVSAGLSESNPNAYKPMLIT  101

Query  213   IGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQL  392
             IGPYH  N +L  +E  KLMYL  FL+R++   ME    ++++ K++A   Y +  D   
Sbjct  102   IGPYHKHNTELRSIEKYKLMYLQRFLRRKEGIDMESYIREMEELKDEACKCYDNIHD--F  159

Query  393   LLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTG-----  557
               D+ G+ F+ MLLLDGCF+ E++                           +PTG     
Sbjct  160   YNDNIGE-FLLMLLLDGCFVVEYIREC---------------------CGIIPTGEDIII  197

Query  558   ----MKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPP  725
                 +  QV RDLLLLENQLPFFVL +LH M  D  +  F+ +VK  F   L K   I P
Sbjct  198   SGGCLDNQVRRDLLLLENQLPFFVLAKLHDMTMDIDQTSFIIMVKCAFLPSLPK---ITP  254

Query  726   IVPNLGDNNATEMKGHLLQIVHNLCNPQ---NGGIQEERHYWTLCFPCSLGKQSQDSKVG  896
                   + NA  +K H+LQ+VH  C+P    N  I+ E            GK    S + 
Sbjct  255   ASFVENEGNAKNIK-HILQLVHMSCHPSDMNNPSIEIEH----------CGK----SLIW  299

Query  897   SSDIRTATELQEAGVNLKKV------------VKSSSLFHIKFNHAELEIPKFHITDPTE  1040
                +  ATEL EAGV+  KV               +SLF IKF +  ++IP F + D TE
Sbjct  300   IDIMPNATELCEAGVSFTKVGTVYTYLEEDNFEDCTSLFDIKFENGLMKIPCFEVVDDTE  359

Query  1041  TFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDL  1220
             T  RN+IAYEQ S ++++ YF+DYA  MD+LI++EKDVNL R+ GV+ N +G+DKEV +L
Sbjct  360   TILRNLIAYEQQSPNEHSRYFSDYAVFMDHLIDSEKDVNLLRLKGVIRNRIGEDKEVANL  419

Query  1221  FNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFL  1400
             FN++ KGV  SS   FYY + C K+  H  KPWN M A LRH+YF++PWAG+ST+AA+ L
Sbjct  420   FNKIGKGVSISS--DFYYKEECRKVVQHCQKPWNRMKANLRHNYFHSPWAGVSTVAAIIL  477

Query  1401  LSLTIAQTVIAVLDL  1445
             L LT+ QT+++ + +
Sbjct  478   LLLTVIQTILSFISV  492



>ref|XP_009626723.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana tomentosiformis]
Length=525

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 261/466 (56%), Gaps = 53/466 (11%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             + IFKV+ GL  +N DAYTP LISIGPYH+ N +L  ME  KL Y   FL+R+    +E 
Sbjct  84    STIFKVNVGLSESNPDAYTPKLISIGPYHNKNPRLRSMEKYKLRYRQRFLQRKAWRDVEY  143

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
                +++  K++A   Y D  D+   + S   KF  +LLLDGCF+ E++   Y+   +   
Sbjct  144   YINEMEKLKDEALKCYDDIGDLDSDIVS---KFSDLLLLDGCFVVEYIREFYEGVPE---  197

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                        + +     M+  V RDLLLLENQLPFF+L +LH M  D +   F+ +VK
Sbjct  198   ---------GEDKIINAAWMESLVDRDLLLLENQLPFFILAKLHEMTKDPTDAPFIQMVK  248

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ--NGGIQEERHY-----  839
               F S L KV    P   N  D++A E+K HLLQ+VH  C P   N G+           
Sbjct  249   YNFGSSLPKVT---PKFINATDDDAEEIK-HLLQVVHMCCCPSEMNTGLTRNSRKKKGSS  304

Query  840   -----WTLCFPCSLGKQSQDSKVGSSDI-----RTATELQEAGVNLKKVVK---------  962
                  W    P  +GK  +  K   SD+     R+ATEL EAG+    V K         
Sbjct  305   KKSCNWN---PLRIGKSKKKFKTKDSDLWHDRMRSATELDEAGIRFSNVGKIYRKLNKNN  361

Query  963   ---SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                + SLF IKFN   LEIP F + + TET  RN+IAYEQHS D +  YFTDY   MD+L
Sbjct  362   KEDAISLFDIKFNKGLLEIPCFEVVNSTETILRNLIAYEQHSSDVHPKYFTDYIIFMDHL  421

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             IN+ KDVNL R+NG++ N +GDD+EV  +FN+L +GV+ S+   F Y   C K+  H  K
Sbjct  422   INSGKDVNLLRLNGIIRNRIGDDEEVAIMFNKLGEGVIPST--DFLYKVECRKVIEHCEK  479

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             PWN  MA LRH+Y N+PWA IST AA+ LL LT+AQTV+A +   K
Sbjct  480   PWNENMASLRHNYLNSPWAKISTAAAIILLLLTVAQTVLAFISTLK  525



>ref|XP_009788156.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X2 [Nicotiana 
sylvestris]
Length=416

 Score =   301 bits (772),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 185/457 (40%), Positives = 261/457 (57%), Gaps = 68/457 (15%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             + K+++GL  +N +AY P+LI+IGPYH  N +L  +E  KLMYL  FL+R++   ME   
Sbjct  1     MVKINQGLSESNPNAYKPMLITIGPYHKHNTELRSIEKYKLMYLQRFLRRKEGIDMESYI  60

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
              ++++ K++A   Y +  D     D+ G+ F+ MLLLDGCF+ E++              
Sbjct  61    REMEELKDEACKCYDNIHD--FYNDNIGE-FLLMLLLDGCFVVEYIREC-----------  106

Query  507   elnkkkCDNNAVFMPTG---------MKFQVFRDLLLLENQLPFFVLQELHGMVYDESKP  659
                          +PTG         +  QV RDLLLLENQLPFFVL +LH M  D  + 
Sbjct  107   ----------CGIIPTGEDIIISGGCLDNQVRRDLLLLENQLPFFVLAKLHDMTMDIDQT  156

Query  660   KFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ---NGGIQEE  830
              F+ +VK  F   L K   I P      + NA  +K H+LQ+VH  C+P    N  I+ E
Sbjct  157   SFIIMVKCAFLPSLPK---ITPASFVENEGNAKNIK-HILQLVHMSCHPSDMNNPSIEIE  212

Query  831   RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV------------VKSSSL  974
                         GK    S +    +  ATEL EAGV+  KV               +SL
Sbjct  213   H----------CGK----SLIWIDIMPNATELCEAGVSFTKVGTVYTYLEEDNFEDCTSL  258

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             F IKF +  ++IP F + D TET  RN+IAYEQ S ++++ YF+DYA  MD+LI++EKDV
Sbjct  259   FDIKFENGLMKIPCFEVVDDTETILRNLIAYEQQSPNEHSRYFSDYAVFMDHLIDSEKDV  318

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             NL R+ GV+ N +G+DKEV +LFN++ KGV  SS   FYY + C K+  H  KPWN M A
Sbjct  319   NLLRLKGVIRNRIGEDKEVANLFNKIGKGVSISS--DFYYKEECRKVVQHCQKPWNRMKA  376

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              LRH+YF++PWAG+ST+AA+ LL LT+ QT+++ + +
Sbjct  377   NLRHNYFHSPWAGVSTVAAIILLLLTVIQTILSFISV  413



>ref|XP_009602424.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana tomentosiformis]
Length=522

 Score =   305 bits (780),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 203/494 (41%), Positives = 272/494 (55%), Gaps = 54/494 (11%)
 Frame = +3

Query  63    EGDQQDLPIYESLKRDIKNL---KQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             EG + D  I E    D++N    + LS+E+C IFKV+ GL  +N +AY P LISIGPYH 
Sbjct  52    EGREADYVI-EIKTADVQNPVFDEGLSTESCTIFKVNAGLHESNPNAYRPKLISIGPYHK  110

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGD-DEDIQLLLDSA  407
              N KL  ME  KL Y   FL+R+K   +E C  +L+  K++A   Y D DED     + +
Sbjct  111   NNPKLRSMEKYKLRYRQRFLRRKKTIDLESCIRELEGLKDEALKCYDDIDEDFN---NDS  167

Query  408   GDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLL  587
               KFV+MLLLDGCF+ E++        +              + +     M+  V RDLL
Sbjct  168   CRKFVEMLLLDGCFVVEYIREFCKMVPE------------GEDKIIKAAWMEVLVDRDLL  215

Query  588   LLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK  767
             LLENQLPFF+L +LH M  D   P F+++VK  FA+ L KV    P      D NA E+K
Sbjct  216   LLENQLPFFILAKLHEMTTDHDVP-FIEMVKYNFATSLPKV---TPKFIRETDGNAKEVK  271

Query  768   GHLLQIVHNLCNPQ--------NGGIQEERHYWTLCFPCSL---GKQSQ---DSKVGSSD  905
              HLLQ++H  C P         N   + +    +  +P  L    K+ Q   D  +    
Sbjct  272   -HLLQVIHMCCCPSGMNASLTGNASNKLKHGKKSFNWPSQLIWTNKKQQIEEDDDIWHDR  330

Query  906   IRTATELQEAGVNLKKVVK------------SSSLFHIKFNHAELEIPKFHITDPTETFF  1049
             +R ATEL+EAG+   +  K              SLF IK++   +EIP F + D TET  
Sbjct  331   MRCATELEEAGIKFSRTGKIYRRLNKDNEEDCISLFDIKYDKELIEIPCFEVVDSTETVL  390

Query  1050  RNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNR  1229
             RN+IAYEQHS   ++ YFTDY  LMD LIN+EKDV LFR+ G++ N +GDD E   +FNR
Sbjct  391   RNLIAYEQHSIGVHHKYFTDYVILMDRLINSEKDVKLFRLKGIIRNRIGDDNEAASIFNR  450

Query  1230  LCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSL  1409
             L +GV+ S+   FYY + C K+  H  KP +   A   H+YFN PW G+ST AAV LLSL
Sbjct  451   LGEGVIPST--QFYYKEACKKVVEHCEKPCSERKASFWHNYFNGPWVGLSTAAAVILLSL  508

Query  1410  TIAQTVIAVLDLRK  1451
             T+ QTV+  +   K
Sbjct  509   TVMQTVLTFISTLK  522



>ref|XP_009769940.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
 ref|XP_009769941.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
Length=525

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 202/516 (39%), Positives = 289/516 (56%), Gaps = 61/516 (12%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDLP----------IYESLKRDIKNLKQLSSEACIFKVHEGL  170
             I E ++   +IE  E D Q  P          I + +  D++NL   S+   IFKV+  L
Sbjct  32    IKEWEKVDNLIEIKERDGQGRPGWQTNKSTNQILDEIYEDMENLAIKST--TIFKVNVAL  89

Query  171   RRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKE  350
             R +N DAYTP +ISIGPYH    +L  ME  KL+YL  FL+R++   +E C ++L++ K+
Sbjct  90    RESNPDAYTPKMISIGPYHKKYQELHSMEKYKLLYLRRFLRRKEGLDVESCIKELEELKD  149

Query  351   KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCD  530
             KA   Y + ED+ +  D    +F+KMLL DGCF+ E++      +               
Sbjct  150   KALMCYDEIEDL-IDGDHNTGQFLKMLLFDGCFLVEYIRERCGIKPI-------------  195

Query  531   NNAVFMPTG-MKFQVFRDLLLLENQLPFFVLQELHGMVYDESKP-KFLDIVKITFASMLT  704
                + +P G +  QV RDLLLLENQLPFFVL +LH M  +E+    F  +VK  F   L 
Sbjct  196   GEDMIIPGGCLDNQVSRDLLLLENQLPFFVLTKLHDMTKEETDELPFTKMVKWIFFHDLP  255

Query  705   KVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ-------NGGIQEERHYWTLCFPCS  863
             K   + P   N   +NA E+K HLLQ++H  C+P         G I +E  +      C+
Sbjct  256   K---LTPASFNETISNAVEIK-HLLQVIHMSCHPSEMKTNNLTGNISKEAEHSRKSLCCN  311

Query  864   LGK--------QSQDSKVGSSDIRTATELQEAGVNLKKVVK------------SSSLFHI  983
             L +        + +D      ++  ATEL EAGV   KV              S+SLF I
Sbjct  312   LLQIIRSKEMPRDKDKLTWQDNMPNATELHEAGVGFSKVGNIYTCLAKDNLGDSTSLFDI  371

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
             +F +  + IP F ++D TET  RN IAYEQ S + +  YF+++A  MD+LI++EKDV L 
Sbjct  372   RFENGLMTIPCFKVSDNTETVLRNFIAYEQQSPNIDPKYFSEFAVFMDHLIDSEKDVTLL  431

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
             R+ G++ N +GDDKEV +LFN++ KGV  SS   F+Y +VC K+  H  +PWN M A LR
Sbjct  432   RVKGIIANDIGDDKEVANLFNKIGKGVGISS--DFHYKEVCGKVLQHCEQPWNRMKASLR  489

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
              +YF++PWAG+ST+AAV LL LT+ QTV++ + + K
Sbjct  490   RNYFHSPWAGVSTVAAVILLLLTVTQTVLSFISVLK  525



>ref|XP_009588978.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
 gb|AHX24721.1| putative UPF0481 protein [Nicotiana tabacum]
Length=517

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 203/511 (40%), Positives = 278/511 (54%), Gaps = 63/511 (12%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDL-------PIYESLKRDIKNLKQLSSEAC-IFKVHEGLRR  176
             I E ++   +IE  E + QDL       P  E L     +    S++ C IFKV  GLR 
Sbjct  25    IEEGRKLDHLIEIKETNGQDLSGLKTNKPANEILDEIFADFNDSSTKCCTIFKVSAGLRE  84

Query  177   TNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKA  356
             +N DAY P +ISIGPYH  N +L  ME  KL YL  FL+R++   +E C  +L+D   +A
Sbjct  85    SNPDAYRPNVISIGPYHKHNPELRYMEKYKLRYLQRFLRRKEGIDVESCIRELED---EA  141

Query  357   ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNN  536
              + Y   +DI+ L     DKF K+LLLDGCF+ E++        + E         C NN
Sbjct  142   LNCY---DDIENLDRDIVDKFSKILLLDGCFLVEYIRERCGMCPEGECWIIPEN--CINN  196

Query  537   AVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDES-KPKFLDIVKITFASMLTKVR  713
                       QV RDLLL+ENQLPFFVL +LH +  DE  +  F  +VK  F   L K  
Sbjct  197   ----------QVCRDLLLVENQLPFFVLTKLHHLTMDEEDEIPFTKMVKWIFFPYLPK--  244

Query  714   LIPPIVPNLGDNNATEMKGHLLQIVHNLCNP-----------QNGGIQEERHYWT--LCF  854
              + P      + NA + K HLLQ+VH  C+P           +N  ++ E++      C 
Sbjct  245   -MTPASYLESEGNAAKFK-HLLQVVHMSCHPLEIKSSSLTDHENPSLEMEQYCRKSLCCN  302

Query  855   PCSLGKQS-----QDSKVGSSDIRTATELQEAGVNLKKVV------------KSSSLFHI  983
             P  + +       +D   G + +  ATEL EAGV+  KV              ++SLF I
Sbjct  303   PLQIIRSKDKPIDKDHLTGHNVMPNATELSEAGVSFVKVGYIYDYLEEENCGDNTSLFDI  362

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNN-MYFTDYAQLMDNLINTEKDVNL  1160
             KF +  ++IP F +TD TE   RN+IAYEQ S   +   YF+D+A  +D LI+++KDV+L
Sbjct  363   KFENGLMKIPSFRVTDETEALLRNLIAYEQRSSHVHGPTYFSDFAIFIDYLIDSDKDVSL  422

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
              R  G++ N +G+DKE+  LFN++ KGV  SS   FYY + C KL  H  +PWN+M A L
Sbjct  423   LRQKGIIRNRIGEDKEIATLFNKIGKGVGVSS-KNFYYKEECRKLVQHCEQPWNLMKASL  481

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             RH+YFN+PW G ST+AAV LL LT  QTV+A
Sbjct  482   RHNYFNSPWVGASTVAAVILLILTAMQTVLA  512



>ref|XP_009614330.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Nicotiana 
tomentosiformis]
Length=499

 Score =   294 bits (752),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 192/499 (38%), Positives = 267/499 (54%), Gaps = 48/499 (10%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKR----DIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIG  218
             E    DQ  L   +S K+      K+L   S+++C IFKV+  LR +N DAYTP LI IG
Sbjct  15    ETNSEDQSRLQTSKSRKQIFDERFKDLNSWSTKSCTIFKVNVALRESNPDAYTPKLIPIG  74

Query  219   PYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLL  398
             PYH+ N +L  ME  K++YL  FL+R++   ME C  KL++ K++A   Y D +      
Sbjct  75    PYHNKNPELGSMEKYKILYLQQFLQRKEGLDMESCIRKLEELKDEALKCYEDIDYKDFDT  134

Query  399   DSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFR  578
             D +  KFV+MLL+DGCF+ E++  +   +  +               +     M   V R
Sbjct  135   DDSTGKFVEMLLVDGCFVVEYIREDCSADEPR------------EGRIINTDWMVSLVNR  182

Query  579   DLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNAT  758
             DLLLLENQLPF VL +LH M   + +  F   V+ TF S L+   + P  +  +   NA 
Sbjct  183   DLLLLENQLPFSVLTKLHDMTTHQGEMSFTKQVEKTFLSNLSN--MCPAPLSEVTTGNAD  240

Query  759   EMK-GHLLQIVHNLCNPQNGGIQEERHYW-------TLCF-PCSL--GKQSQ-DSK--VG  896
              M+  H+L ++   C P                   +LC+ P  L   K++Q D+K    
Sbjct  241   NMEPKHILHVLLKACQPSKTTTSTTESESESEHSRKSLCWNPLQLFRPKETQGDTKHITL  300

Query  897   SSDIRTATELQEAGVNLKKVV--------------KSSSLFHIKFNHAELEIPKFHITDP  1034
                +  ATEL EAGV   KV               ++ SLF IKF    ++IP F + D 
Sbjct  301   HGSMPNATELCEAGVTFSKVQNVYRSSDTNNTLGNRTVSLFDIKFEKGLMKIPSFEVVDL  360

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             TET  +N+IA+EQH  D     F+DY   MD LI +EKDV+L R+ G++ N +G+DKEV 
Sbjct  361   TETLLQNLIAFEQHWPDVYPTCFSDYVTFMDYLIESEKDVSLLRLKGIIRNRIGEDKEVA  420

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
              +FN++ KGV   SC+ FYY +   KL  H  KPWN M A LRH+YF++PWAG ST+AA 
Sbjct  421   SIFNKMGKGVAV-SCEDFYYKEEYRKLIQHCEKPWNRMKANLRHNYFSSPWAGASTVAAA  479

Query  1395  FLLSLTIAQTVIAVLDLRK  1451
              LL LT  QT++A    RK
Sbjct  480   VLLILTAMQTILAFRADRK  498



>ref|XP_009614328.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Nicotiana 
tomentosiformis]
Length=523

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 192/499 (38%), Positives = 267/499 (54%), Gaps = 48/499 (10%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKR----DIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIG  218
             E    DQ  L   +S K+      K+L   S+++C IFKV+  LR +N DAYTP LI IG
Sbjct  39    ETNSEDQSRLQTSKSRKQIFDERFKDLNSWSTKSCTIFKVNVALRESNPDAYTPKLIPIG  98

Query  219   PYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLL  398
             PYH+ N +L  ME  K++YL  FL+R++   ME C  KL++ K++A   Y D +      
Sbjct  99    PYHNKNPELGSMEKYKILYLQQFLQRKEGLDMESCIRKLEELKDEALKCYEDIDYKDFDT  158

Query  399   DSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFR  578
             D +  KFV+MLL+DGCF+ E++  +   +  +               +     M   V R
Sbjct  159   DDSTGKFVEMLLVDGCFVVEYIREDCSADEPR------------EGRIINTDWMVSLVNR  206

Query  579   DLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNAT  758
             DLLLLENQLPF VL +LH M   + +  F   V+ TF S L+   + P  +  +   NA 
Sbjct  207   DLLLLENQLPFSVLTKLHDMTTHQGEMSFTKQVEKTFLSNLSN--MCPAPLSEVTTGNAD  264

Query  759   EMK-GHLLQIVHNLCNPQNGGIQEERHYW-------TLCF-PCSL--GKQSQ-DSK--VG  896
              M+  H+L ++   C P                   +LC+ P  L   K++Q D+K    
Sbjct  265   NMEPKHILHVLLKACQPSKTTTSTTESESESEHSRKSLCWNPLQLFRPKETQGDTKHITL  324

Query  897   SSDIRTATELQEAGVNLKKVV--------------KSSSLFHIKFNHAELEIPKFHITDP  1034
                +  ATEL EAGV   KV               ++ SLF IKF    ++IP F + D 
Sbjct  325   HGSMPNATELCEAGVTFSKVQNVYRSSDTNNTLGNRTVSLFDIKFEKGLMKIPSFEVVDL  384

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             TET  +N+IA+EQH  D     F+DY   MD LI +EKDV+L R+ G++ N +G+DKEV 
Sbjct  385   TETLLQNLIAFEQHWPDVYPTCFSDYVTFMDYLIESEKDVSLLRLKGIIRNRIGEDKEVA  444

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
              +FN++ KGV   SC+ FYY +   KL  H  KPWN M A LRH+YF++PWAG ST+AA 
Sbjct  445   SIFNKMGKGVAV-SCEDFYYKEEYRKLIQHCEKPWNRMKANLRHNYFSSPWAGASTVAAA  503

Query  1395  FLLSLTIAQTVIAVLDLRK  1451
              LL LT  QT++A    RK
Sbjct  504   VLLILTAMQTILAFRADRK  522



>ref|XP_009759887.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=486

 Score =   290 bits (743),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 189/482 (39%), Positives = 263/482 (55%), Gaps = 43/482 (9%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             E+  G Q    I++   +D+ N    S+++C IFKV+ GLR +N+DAYTP LI IG YH+
Sbjct  19    EDRSGLQTRKEIFDERFKDLNN--NWSTKSCTIFKVNVGLRESNSDAYTPKLIPIGLYHN  76

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
              N +L+ M   KL+YL  FL+R++   ++ C  KL++ K++A   Y DD + +    ++ 
Sbjct  77    KNPQLNSMRKYKLLYLQRFLQRKEGLDVDSCARKLEEMKDEALKCY-DDINYKEFDTNST  135

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
              +FV MLL+DG F+ E++  +  E   +               +     M   V RDLLL
Sbjct  136   KEFVDMLLVDGSFVVEYIREDCLENQPR------------EGRIINTDWMVSLVNRDLLL  183

Query  591   LENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK-  767
             LENQLPF VL +LHGM   + +  F   V+ TF S L    + P  +      NA  M+ 
Sbjct  184   LENQLPFSVLTKLHGMTAHQGEMSFTKQVEKTFLSNLPN--MCPASLSETTTGNADNMEL  241

Query  768   GHLLQIVHNLCNPQNGGIQE---ERHYWTLCF-PCSLGKQSQ---DSK--VGSSDIRTAT  920
              H+L ++H  C P          E     LC+ P  L +  +   D+K      ++  AT
Sbjct  242   KHILHVLHKACQPSQTTTSTTKSEHSRKRLCWNPLQLFRPKETPRDTKHITLHGNMPNAT  301

Query  921   ELQEAGVNLKKVV--------------KSSSLFHIKFNHAELEIPKFHITDPTETFFRNM  1058
             EL EAGV   KV               ++ SLF IKF    +EIP F I D TET  RN+
Sbjct  302   ELCEAGVTFSKVQNVYSLSDTNNSLGNRTVSLFDIKFEKGLMEIPSFEIVDLTETLLRNL  361

Query  1059  IAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCK  1238
             IA+EQH  D     F+DY   MD LI +EKDV+L R+ G++ N +G+DKEV  +FN++ K
Sbjct  362   IAFEQHWPDVYPTCFSDYVIFMDYLIESEKDVSLLRLKGIIRNRIGEDKEVASIFNKMGK  421

Query  1239  GVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIA  1418
             GV   SC+ FYY + C KL  H  KPWN M A LRH+YF++PWAG ST+AA  LL LT  
Sbjct  422   GVAV-SCEDFYYKEECRKLIQHCEKPWNRMKANLRHNYFSSPWAGASTVAAAVLLILTAM  480

Query  1419  QT  1424
             QT
Sbjct  481   QT  482



>ref|XP_006360885.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=422

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 180/445 (40%), Positives = 241/445 (54%), Gaps = 62/445 (14%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV+  LR +N+DAYTP ++SIGPYH  N +L  ME  KL+YL  FL+R++   ++ C 
Sbjct  18    IFKVNVWLRESNSDAYTPKMVSIGPYHKKNPQLDPMEKYKLLYLRRFLQRKEGLDVKSCI  77

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
              +L+  KE+A   Y D E++         +F +MLLLDGCF+ EF+              
Sbjct  78    SELQKLKEEALKCYDDIEEL-----GNDSQFCQMLLLDGCFVVEFIRE------------  120

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV-YDESKPKFLDIVKI  683
                 + C      +       +FRDL+LLENQLPFFVL +LH M   D+  P     ++I
Sbjct  121   --RCEMCPEGENKIININDNYIFRDLMLLENQLPFFVLNQLHDMTKQDDELP-----LRI  173

Query  684   TFASMLTKVRLIPPIVPNLGDNNA--TEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFP  857
                ++ T    +P + P          E   HLL  VH                    F 
Sbjct  174   LANNLFTFFVDLPKMTPESFRKTKCNEENIKHLLHAVH-------------------IFS  214

Query  858   CSLG--KQSQDSKVGSSDIRTATELQEAGVNLKK----------VVKSSSLFHIKFNHAE  1001
             C     K+S  +K     +  ATEL EAGV+  K          +   +SLF IKF    
Sbjct  215   CHGNPMKKSNHNKKRHMIMPNATELSEAGVSFAKIGNINRNKDNIRDMTSLFDIKFEDGL  274

Query  1002  LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVL  1181
             + IP F + D TETF RN+IAYEQ S D    YF+DYA  MD LI+++KDVNL R  G++
Sbjct  275   MTIPCFQVCDDTETFLRNLIAYEQQSSDVQPKYFSDYATFMDYLIDSDKDVNLLRRKGII  334

Query  1182  VNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFN  1358
              NW+G+DKEV  LFN++  GV VYS+   FYY++ C K   H  +PWN M A LRH+YFN
Sbjct  335   ENWIGEDKEVASLFNKIGNGVTVYST---FYYNEECIKAIQHCEQPWNRMKANLRHNYFN  391

Query  1359  TPWAGISTIAAVFLLSLTIAQTVIA  1433
             +PWAG ST+AA+ LL LT  QTV+A
Sbjct  392   SPWAGASTVAAIILLLLTATQTVLA  416



>ref|XP_009777972.1| PREDICTED: UPF0481 protein At3g47200-like, partial [Nicotiana 
sylvestris]
Length=520

 Score =   289 bits (739),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 190/486 (39%), Positives = 265/486 (55%), Gaps = 67/486 (14%)
 Frame = +3

Query  117   NLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLK  293
             +L  LS+++C IF+V  GL  +N DAY P+L+SIGPYH  N +L  MEN KL YL  FL+
Sbjct  49    DLYHLSTKSCTIFRVSVGLSESNPDAYKPMLVSIGPYHKKNLQLRLMENYKLRYLQRFLR  108

Query  294   REKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYRe  473
             R+    ++ C  +L   K++A   Y   EDI    D+   +F+KMLL+DGCF+ EF+   
Sbjct  109   RKDGLDVKTCITELGKLKDEALKCYDGIEDI--YSDNNTGQFLKMLLVDGCFVVEFI---  163

Query  474   ydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE-  650
                       E   +K  + + +   + +  QV RDLLLLENQLPFFVL +LH M  D+ 
Sbjct  164   ---------RERCGRKPTEKDIIIPYSCIDGQVRRDLLLLENQLPFFVLTKLHNMTMDQI  214

Query  651   ----------SKPKFLDI-------VKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLL  779
                         P  LD+       VK TF S   K   + P      + +A  +K HLL
Sbjct  215   NGGFGGWEGGEPPSRLDLIVPFIKLVKETFNSSFLK---MSPTSFLKTEGDAKNIK-HLL  270

Query  780   QIVH---------NLCNPQNGGIQEERHYWTLCF-PCSLGK-----QSQDSKVGSSDIRT  914
             Q+VH             P+N  ++ E    +LC+ P  + +       +D +   +++  
Sbjct  271   QLVHMSYHPLEKKTSLTPENPSLEMEYCRKSLCWNPLQMVRLKNMPNDKDHQTWDTNMPN  330

Query  915   ATELQEAGVNLKKVVK-------------SSSLFHIKFNHAELEIPKFHITDPTETFFRN  1055
             ATEL+EAGV   K+ K             ++SLF IKF +  + IP F + D TET  RN
Sbjct  331   ATELREAGVTFSKIGKIYRRLEGYHNLGDNTSLFDIKFENGVMTIPCFEVFDYTETILRN  390

Query  1056  MIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLC  1235
             ++AYEQ S D +  YF+D++  MD LI++ KDV+L R  G++ N +G+DK V  LFN++ 
Sbjct  391   LVAYEQQSSDVHPRYFSDFSIFMDYLIDSNKDVSLLRQKGIIKNEIGEDKRVASLFNKIG  450

Query  1236  KGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTI  1415
             KGV  S    FYY +    L  H  KPWN M A LRH+YFN+PWAG ST+ AV LL LT 
Sbjct  451   KGVAISY--DFYYKEEYFMLVQHCKKPWNRMKASLRHNYFNSPWAGASTVGAVILLILTA  508

Query  1416  AQTVIA  1433
              QTV+A
Sbjct  509   IQTVLA  514



>ref|XP_006360875.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=420

 Score =   285 bits (730),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 182/459 (40%), Positives = 258/459 (56%), Gaps = 62/459 (14%)
 Frame = +3

Query  114   KNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             ++L + S ++C IFKV+  LR +N DAYTP ++SIGPYH  N +L  ME  KL+YL  FL
Sbjct  3     EDLDKSSFKSCTIFKVNVRLRESNPDAYTPKMVSIGPYHRKNPQLRPMEKYKLLYLRRFL  62

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             KR +   ++    KL++ KE+A   Y   +DI+ L      +F KMLLLDGCF+ EF+  
Sbjct  63    KRREGFDVKYWIGKLEELKEEALKCY---DDIEGLDTDNRHEFCKMLLLDGCFVVEFIRE  119

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE  650
               ++  ++ E++ +N      N          Q+ RDLLLLENQLPFF+L +LH      
Sbjct  120   CSEKYAEEGEDKIINFVDYKYN----------QILRDLLLLENQLPFFILDQLHSWTAKH  169

Query  651   SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNAT-------------EMKGHLLQIVH  791
              + +  ++    F+            V NLG  + T             +MK HLLQ+VH
Sbjct  170   DELQLEELAITLFSH-----------VVNLGYMSVTGVSCLMNLFLFERDMK-HLLQLVH  217

Query  792   NLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIR-TATELQEAGVNLKKVVKSS  968
              +  P+N                   K S D+    + +   ATEL EAGV   K  +++
Sbjct  218   TVSCPRN-----------------FEKSSNDNDTKWNKVMPNATELSEAGVRFAKFNQTT  260

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
             SLF IKF +  + IP   + D TET  RN+IAYEQ S D   +YF+DYA  MD LI+T+K
Sbjct  261   SLFDIKFENGLMTIPSLDVVDGTETLLRNLIAYEQQSIDLQYLYFSDYAIFMDQLIDTDK  320

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVCNKLNGHYN-KPWN  1322
             DV+L R  G++ NW+G+DKEV  LFN++  GV VYS+   FYY +V  K   H + KPWN
Sbjct  321   DVSLLRHKGIIANWIGEDKEVASLFNKMGNGVTVYSN---FYYKEVFTKAVKHCDEKPWN  377

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
              M A L+H+YF++PW G ST+  + LL LT  QT++A++
Sbjct  378   RMKASLKHNYFSSPWVGASTMTVIILLILTTIQTILAII  416



>ref|XP_006360879.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=415

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 180/437 (41%), Positives = 246/437 (56%), Gaps = 45/437 (10%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             + IFKV+  LR +N DAYTP ++SIGPYH  NA+L  M+  KL+YL  FL+RE+   ++ 
Sbjct  13    STIFKVNVRLRESNPDAYTPKMVSIGPYHRKNAQLRPMKKYKLLYLQQFLQREEGLDVQT  72

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
             C + L+D KE     Y D ED+        ++F KMLLLDGCF+ EF+    +  +K   
Sbjct  73    CIKMLEDKKEDLLMCYDDIEDVD------TNEFCKMLLLDGCFVVEFIRERSEIYSK---  123

Query  501   eeelnkkkCDNNAVFMPTGMKF-QVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIV  677
                        + +      K+ Q+ RDLLLLENQLPF VL+ LH M     +   L+ +
Sbjct  124   ---------GEDKIINFVDYKYNQILRDLLLLENQLPFVVLKWLHLMTAKHGELP-LEKL  173

Query  678   KITFASMLTKVRLIPPIVPNLG-DNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCF  854
              IT  S +  +  +   V N   D    EMK HLL++VH    P+N             F
Sbjct  174   AITLFSHVVNLGYLS--VDNFSCDLTYVEMK-HLLKVVHIASCPKN-------------F  217

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
               SL   + D+K     +  ATEL +AGV   KV  ++SLF IKF H  + IP   + D 
Sbjct  218   KKSLN--NNDTKWNKV-MSNATELSQAGVRFAKVNHTTSLFDIKFKHGLMTIPSLDVVDS  274

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             TE   RN IAYEQ S D   +YF+DYA  MD LI+++KDV+L R   ++  W+G+DKEV 
Sbjct  275   TEILLRNFIAYEQQSIDLEYLYFSDYAIFMDQLIDSDKDVSLLRRKKIIATWIGEDKEVA  334

Query  1215  DLFNRLCKGV-VYSSCDGFYYSDVCNKLNGH-YNKPWNVMMAKLRHDYFNTPWAGISTIA  1388
              LFN++  GV VYS+   F Y  V  K   H + KPWN  MA L+H+YF++PW G ST+ 
Sbjct  335   SLFNKIGNGVTVYSN---FSYKKVFLKAAKHCFEKPWNRKMASLKHNYFSSPWVGASTMT  391

Query  1389  AVFLLSLTIAQTVIAVL  1439
             AV LL LT  QT++A++
Sbjct  392   AVILLILTAIQTILAII  408



>ref|XP_009759601.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
 ref|XP_009759602.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
Length=510

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 178/471 (38%), Positives = 259/471 (55%), Gaps = 50/471 (11%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             I++   +D+ N    S+   IFKV+ GLR++N DAYTP+LI IGPYH  N +L  ME  K
Sbjct  62    IFDERFKDLDNTSIKST--TIFKVNMGLRKSNPDAYTPMLICIGPYHKKNPELDTMEKYK  119

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
             L+YL  FL+R++   +E C  +++  K++A   Y D+ D   ++     KF +M+LLDGC
Sbjct  120   LLYLQRFLQRKEGIDVESCISEIEKLKDEALKCYDDNLDSDSVV-----KFSQMMLLDGC  174

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             F+ EF+    + E ++           ++N +     M  QV RD++LLENQLPFFVL  
Sbjct  175   FVVEFIRERCEVEPRE-----------ESNQIINLEWMINQVCRDMVLLENQLPFFVLTM  223

Query  627   LHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNP  806
             L+      ++  FL++ +     +  KV   P     + D NA E   HLL  VH  C P
Sbjct  224   LYDTTKQPTEQSFLNMARRALLDIFPKVTFKP--TSEIDDFNA-EGIDHLLDAVHMFCRP  280

Query  807   QNGGIQEERHYWT--------LCFPCSLGKQSQDSKVGSS-------DIRTATELQEAGV  941
              +     E    +        + F  ++ + ++  ++ +         I + TEL +AGV
Sbjct  281   SHDQKTRESKNASSRGNECCKISFCGNILQLTRSKEIPNVLDLWDCYHIPSVTELYDAGV  340

Query  942   NLKKV-------VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMY  1100
             + KK+          ++LF IKF    ++IP F I D  ETF RN+IAYEQH C     Y
Sbjct  341   SFKKIGTVDEDYKDKTTLFDIKFKKGIMKIPCFTIEDTMETFMRNLIAYEQH-CSDVYPY  399

Query  1101  FTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSD  1280
             F++YA +M  LI + +DVNL R N +++   GDDKEV  +F +L  GV        YY +
Sbjct  400   FSNYAHIMTQLIGSHRDVNLLRQNKIILKDQGDDKEVASIFKKLSSGV------KVYYIE  453

Query  1281  VCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
              C+KL  H  KPW+ MMA LRH+YF +PWAG ST+AAV LL LT+ QTV+A
Sbjct  454   ECSKLIQHCEKPWSQMMASLRHNYFQSPWAGASTVAAVILLILTVIQTVLA  504



>ref|XP_009792070.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X3 [Nicotiana 
sylvestris]
Length=542

 Score =   286 bits (731),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 253/462 (55%), Gaps = 43/462 (9%)
 Frame = +3

Query  105   RDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDL  284
             +D+ N    SS   IFKV+ GLR++N+DAYTP+LI IGPYH  N KL  ME  KL+YL  
Sbjct  99    KDLDNASIKSS--TIFKVNMGLRKSNSDAYTPMLICIGPYHKKNPKLDSMEKYKLLYLQR  156

Query  285   FLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFL  464
             FL+R+    +E C  +++  K++A   Y D+     L      KF +MLLLDGCF+ EF+
Sbjct  157   FLQRKDGIDVESCISEIEILKDEALKCYDDN-----LYSDIVVKFSQMLLLDGCFVVEFI  211

Query  465   YReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY  644
                 + E  ++          ++N +     M  QV RD++LLENQLPFFVL  LH M  
Sbjct  212   RERCEVEPPRK----------ESNEIINLEWMIIQVCRDMVLLENQLPFFVLTMLHDMTK  261

Query  645   DESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQ  824
               ++   L +V+ T  ++   V        +  DN   E   HLL  VH  C P +    
Sbjct  262   QHTEKSLLYMVRETLLNIFPMVTF---KTASEIDNFNAEGIDHLLDAVHKFCRPSHDEKT  318

Query  825   EERH----YWTLCFPCSL-GKQSQDSK----VGSSD---IRTATELQEAGVNLKKV----  956
              E +        C   SL G   Q ++    +G  D   I +ATEL  AGV+  K+    
Sbjct  319   SETNNSDSRGNECCKISLCGNVLQLTRSKEILGFWDCYHIPSATELYNAGVSFSKIGTVA  378

Query  957   ---VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMD  1127
                   ++LF I F    ++IP F I D  E+F RN+IAYEQHS      YF++YA +M 
Sbjct  379   EDSKDKTTLFDINFEKGLMKIPCFTIEDTMESFMRNLIAYEQHSSHVYP-YFSNYAHIMT  437

Query  1128  NLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHY  1307
              LI + KDVNL R N +++  LGDDKEV  +F  L  GV  +    FYY + C+KL  H 
Sbjct  438   QLIGSHKDVNLLRQNKIILKDLGDDKEVATIFKELSSGVRVTD---FYYKEQCSKLVQHC  494

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
              KPW+ MMA LRH+YF +PWAG ST+AA+ LL LT+ QTV+A
Sbjct  495   EKPWSQMMASLRHNYFQSPWAGTSTMAAITLLILTVIQTVLA  536



>ref|XP_009792068.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X1 [Nicotiana 
sylvestris]
Length=564

 Score =   286 bits (732),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 253/462 (55%), Gaps = 43/462 (9%)
 Frame = +3

Query  105   RDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDL  284
             +D+ N    SS   IFKV+ GLR++N+DAYTP+LI IGPYH  N KL  ME  KL+YL  
Sbjct  121   KDLDNASIKSS--TIFKVNMGLRKSNSDAYTPMLICIGPYHKKNPKLDSMEKYKLLYLQR  178

Query  285   FLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFL  464
             FL+R+    +E C  +++  K++A   Y D+     L      KF +MLLLDGCF+ EF+
Sbjct  179   FLQRKDGIDVESCISEIEILKDEALKCYDDN-----LYSDIVVKFSQMLLLDGCFVVEFI  233

Query  465   YReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY  644
                 + E  ++          ++N +     M  QV RD++LLENQLPFFVL  LH M  
Sbjct  234   RERCEVEPPRK----------ESNEIINLEWMIIQVCRDMVLLENQLPFFVLTMLHDMTK  283

Query  645   DESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQ  824
               ++   L +V+ T  ++   V        +  DN   E   HLL  VH  C P +    
Sbjct  284   QHTEKSLLYMVRETLLNIFPMVTF---KTASEIDNFNAEGIDHLLDAVHKFCRPSHDEKT  340

Query  825   EERH----YWTLCFPCSL-GKQSQDSK----VGSSD---IRTATELQEAGVNLKKV----  956
              E +        C   SL G   Q ++    +G  D   I +ATEL  AGV+  K+    
Sbjct  341   SETNNSDSRGNECCKISLCGNVLQLTRSKEILGFWDCYHIPSATELYNAGVSFSKIGTVA  400

Query  957   ---VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMD  1127
                   ++LF I F    ++IP F I D  E+F RN+IAYEQHS      YF++YA +M 
Sbjct  401   EDSKDKTTLFDINFEKGLMKIPCFTIEDTMESFMRNLIAYEQHSSHVYP-YFSNYAHIMT  459

Query  1128  NLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHY  1307
              LI + KDVNL R N +++  LGDDKEV  +F  L  GV  +    FYY + C+KL  H 
Sbjct  460   QLIGSHKDVNLLRQNKIILKDLGDDKEVATIFKELSSGVRVTD---FYYKEQCSKLVQHC  516

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
              KPW+ MMA LRH+YF +PWAG ST+AA+ LL LT+ QTV+A
Sbjct  517   EKPWSQMMASLRHNYFQSPWAGTSTMAAITLLILTVIQTVLA  558



>ref|XP_009792069.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   286 bits (731),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 253/462 (55%), Gaps = 43/462 (9%)
 Frame = +3

Query  105   RDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDL  284
             +D+ N    SS   IFKV+ GLR++N+DAYTP+LI IGPYH  N KL  ME  KL+YL  
Sbjct  119   KDLDNASIKSS--TIFKVNMGLRKSNSDAYTPMLICIGPYHKKNPKLDSMEKYKLLYLQR  176

Query  285   FLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFL  464
             FL+R+    +E C  +++  K++A   Y D+     L      KF +MLLLDGCF+ EF+
Sbjct  177   FLQRKDGIDVESCISEIEILKDEALKCYDDN-----LYSDIVVKFSQMLLLDGCFVVEFI  231

Query  465   YReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY  644
                 + E  ++          ++N +     M  QV RD++LLENQLPFFVL  LH M  
Sbjct  232   RERCEVEPPRK----------ESNEIINLEWMIIQVCRDMVLLENQLPFFVLTMLHDMTK  281

Query  645   DESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQ  824
               ++   L +V+ T  ++   V        +  DN   E   HLL  VH  C P +    
Sbjct  282   QHTEKSLLYMVRETLLNIFPMVTF---KTASEIDNFNAEGIDHLLDAVHKFCRPSHDEKT  338

Query  825   EERH----YWTLCFPCSL-GKQSQDSK----VGSSD---IRTATELQEAGVNLKKV----  956
              E +        C   SL G   Q ++    +G  D   I +ATEL  AGV+  K+    
Sbjct  339   SETNNSDSRGNECCKISLCGNVLQLTRSKEILGFWDCYHIPSATELYNAGVSFSKIGTVA  398

Query  957   ---VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMD  1127
                   ++LF I F    ++IP F I D  E+F RN+IAYEQHS      YF++YA +M 
Sbjct  399   EDSKDKTTLFDINFEKGLMKIPCFTIEDTMESFMRNLIAYEQHSSHVYP-YFSNYAHIMT  457

Query  1128  NLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHY  1307
              LI + KDVNL R N +++  LGDDKEV  +F  L  GV  +    FYY + C+KL  H 
Sbjct  458   QLIGSHKDVNLLRQNKIILKDLGDDKEVATIFKELSSGVRVTD---FYYKEQCSKLVQHC  514

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
              KPW+ MMA LRH+YF +PWAG ST+AA+ LL LT+ QTV+A
Sbjct  515   EKPWSQMMASLRHNYFQSPWAGTSTMAAITLLILTVIQTVLA  556



>ref|XP_009620089.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana tomentosiformis]
 ref|XP_009620090.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana tomentosiformis]
Length=495

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 270/513 (53%), Gaps = 78/513 (15%)
 Frame = +3

Query  30    LQRQ*GMIENTEGDQQD--LPIYESLK--RDIKNLKQLSSE------------ACIFKVH  161
             L RQ    E  +G + D  + I E LK  RD K+L Q+  E              IFKV+
Sbjct  16    LLRQATKDEREDGRKDDYLIEIKERLKLQRD-KSLNQIFDERFEDLDNSSIKSTTIFKVN  74

Query  162   EGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKD  341
               +R +N DAYTP +ISIGPYH  N +L  ME  KL+ L  FL+R++   +E C  +L++
Sbjct  75    AAIRESNPDAYTPKMISIGPYHKKNQELHSMEKYKLLCLRRFLQRKEGLDVESCIGQLEE  134

Query  342   SKEKAASYYGD-DEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnk  518
              K++A   Y D D DI         KF +MLLLDGCF+ EF+                  
Sbjct  135   LKDEAIKCYDDIDSDIV-------GKFSEMLLLDGCFVVEFIRDPLII------------  175

Query  519   kkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY--DESKPKFLDIVKITFA  692
                  NA +M +    QV RDLLLLENQLPFFVL +LH M    ++ +P F+ +VK T  
Sbjct  176   -----NAHWMVS----QVCRDLLLLENQLPFFVLAKLHDMTKRPEDLEPDFIRMVKSTLC  226

Query  693   SMLTKVRLIPPIVPNLGD--NNATEMKGHLLQIVHNLC---------NPQNGGIQEE---  830
                    + P  +P L    +   E   HLL +VH  C            N  I++E   
Sbjct  227   Y------ISPSKIPMLKSEIDGDEEKFDHLLHVVHMFCRLSEMTKTSQISNSSIRKECCN  280

Query  831   -RHYWTLCFPCSLGKQSQDSKVGSS-DIRTATELQEAGVNLKKV-------VKSSSLFHI  983
              + +          K+   S +  S    TATEL EAG +  K+       +  +++F I
Sbjct  281   IKRFLGKILRLFRSKEISTSNIWQSWQAPTATELYEAGASFIKLGSFEANLMDRTTMFDI  340

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
             KF +A ++IP F + D TE F RN+IAYEQHS +     F DY  +M  LI + KDVNL 
Sbjct  341   KFENAAIQIPCFVVGDSTEAFLRNLIAYEQHSTNLYPKCFLDYVDIMGQLIKSRKDVNLL  400

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
             R NG+++N L DD EV ++F +L +G+V  + D  YY +   K++ H  KPWN +MA LR
Sbjct  401   RQNGIILNGLADDGEVANMFKKLGEGIVVVA-DSTYYDEASIKMSQHCKKPWNQIMANLR  459

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLD  1442
              +YF++PWAG ST+AAV LL LT  QTV+A  D
Sbjct  460   QNYFSSPWAGASTVAAVILLILTAMQTVLAFRD  492



>ref|XP_009611558.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Nicotiana 
tomentosiformis]
Length=554

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 185/506 (37%), Positives = 272/506 (54%), Gaps = 58/506 (11%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDL----------PIYESLKRDIKNLKQLSSEACIFKVHEGL  170
             I E+++   +IE  E   QD            I+E   +D+ N    S+   IFKV+  L
Sbjct  63    IEEVRKVAHLIEKKETSGQDQLALQTKKAANQIFEEKVKDMDNSSIKST--TIFKVNVCL  120

Query  171   RRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKE  350
             R +N+ AYTP  ISIGPYH+   +L  ME  K +YL  FLKR+ +  ++    +++  K+
Sbjct  121   RESNSKAYTPKTISIGPYHNKRPQLGSMEKYKWLYLQRFLKRKTEIDVKSYINEMEKLKD  180

Query  351   KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCD  530
             +A   Y D+ D  +++     KF +MLLLDGCF+ EF+    + E +            +
Sbjct  181   EALKCYDDNLDSDIVV-----KFSQMLLLDGCFVVEFIRERCEVEPE------------E  223

Query  531   NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKV  710
             +N +     M  QV  D++LLE QLPFFVL  LH M  + ++  FL++V+ T  ++  KV
Sbjct  224   SNQIINLEWMINQVCLDMVLLEYQLPFFVLTMLHDMTKNPTERSFLNMVRTTLLNIFPKV  283

Query  711   RLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE--------RHYWTLCFPCSL  866
               +PP    + D NA  +  HLL  VH  C P +     E        +    + F  ++
Sbjct  284   TFMPP--SEIDDLNAENI-DHLLDAVHMFCRPSHDQKTRETKNASSRGKECCKISFCGNI  340

Query  867   GKQSQDSKVGSS-------DIRTATELQEAGVNLKK-------VVKSSSLFHIKFNHAEL  1004
              + ++  ++           I +ATEL  AGV+  K       V   ++LF I F    +
Sbjct  341   LQLTRSKEIPDVLDLWDCYHIPSATELYNAGVSFSKIGSVAEDVNDKTTLFDINFEKGLM  400

Query  1005  EIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
             +IP F I D  ETF RN+IAYEQHS      YF++YA +M  LI + +DVNL R N +++
Sbjct  401   KIPCFTIEDTMETFMRNLIAYEQHSSGAYP-YFSNYAHIMTQLIGSHRDVNLLRQNKIIL  459

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
               LGDDKEV  +F +L  GV+ +    FYY + C+KL  H  KPW+ MMA LRH+YF +P
Sbjct  460   KDLGDDKEVASIFKKLSSGVIVTD---FYYREECSKLIQHCEKPWSQMMASLRHNYFQSP  516

Query  1365  WAGISTIAAVFLLSLTIAQTVIAVLD  1442
             WAG ST+AA+ LL LT+ QT++A  D
Sbjct  517   WAGASTVAAITLLILTVIQTILAFKD  542



>ref|XP_009590369.1| PREDICTED: LOW QUALITY PROTEIN: putative UPF0481 protein At3g02645 
[Nicotiana tomentosiformis]
Length=517

 Score =   283 bits (725),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 192/494 (39%), Positives = 262/494 (53%), Gaps = 59/494 (12%)
 Frame = +3

Query  45    GMIENTEGDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGP  221
             GM  N   +Q      + +  DI +    SS+ C IFKV  GL  +N+ AY P +ISIGP
Sbjct  47    GMTTNKPANQIXXNXLDEIFADINDS---SSKCCTIFKVSVGLSESNSGAYEPKVISIGP  103

Query  222   YHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLD  401
             YH  N K   ME  K+ YL  FL+R++   +E C  +L+D   K        +DI+ L  
Sbjct  104   YHKHNPKFRSMEKYKVCYLQRFLRRKEGIDVESCIRELEDEALKCY------DDIENLDR  157

Query  402   SAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTG--MKFQVF  575
                 KF K+LLLDGCF+ E++                    C     ++ +G  +  Q+ 
Sbjct  158   DIVAKFSKILLLDGCFLVEYIRERCGM--------------CPEGEDWIISGGCLDNQIR  203

Query  576   RDLLLLENQLPFFVLQELHGMVYDES-KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNN  752
             RDLLLLENQL FFVL +LH M  DE  K  F+ +VK TF   L K   + P      + N
Sbjct  204   RDLLLLENQLAFFVLTKLHHMTKDEEDKIPFIKMVKRTFFLDLPK---MTPASYLESEGN  260

Query  753   ATEMKGHLLQIVHNLCNPQN-------GGIQEERHYWT--LCFPCSLGKQS-----QDSK  890
             A E+K HLLQ+VH  C+P +           E  H+W    C P  + +       +D  
Sbjct  261   AAEIK-HLLQVVHMSCHPSDIKTTSLTNPSMETEHFWKSLCCNPLRIIRSKDKPIDKDHL  319

Query  891   VGSSDIRTATELQEAGVNLKKVV------------KSSSLFHIKFNHAELEIPKFHITDP  1034
              G + +  AT+L E GV+  KV              ++SLF IKF +  ++IP F +TD 
Sbjct  320   TGHNVMPNATQLSEYGVSFVKVGYIYDYLEEENYGDNTSLFDIKFENGLIKIPSFKVTDD  379

Query  1035  TETFFRNMIAYEQHSCDKNN-MYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
             TET  RN+IAYEQ S   +   YF+D+A  MD LI++EKD+NL R  G++ N +G DKE+
Sbjct  380   TETLLRNLIAYEQQSIHVHGPRYFSDFAIFMDYLIDSEKDLNLLRRKGIIKNRIGKDKEI  439

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAA  1391
               LFN++ KGV  S  D FYY + C KL  H  + WN+M A L+ +YFN+ W G ST+AA
Sbjct  440   ATLFNKIGKGVSISHED-FYYEEECRKLVQHCEQTWNLMKASLKRNYFNSLWVGTSTVAA  498

Query  1392  VFLLSLTIAQTVIA  1433
               LL LT  QTV+A
Sbjct  499   GILLVLTAMQTVLA  512



>ref|XP_009611559.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Nicotiana 
tomentosiformis]
Length=551

 Score =   285 bits (728),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 184/503 (37%), Positives = 271/503 (54%), Gaps = 58/503 (12%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDL----------PIYESLKRDIKNLKQLSSEACIFKVHEGL  170
             I E+++   +IE  E   QD            I+E   +D+ N    S+   IFKV+  L
Sbjct  63    IEEVRKVAHLIEKKETSGQDQLALQTKKAANQIFEEKVKDMDNSSIKST--TIFKVNVCL  120

Query  171   RRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKE  350
             R +N+ AYTP  ISIGPYH+   +L  ME  K +YL  FLKR+ +  ++    +++  K+
Sbjct  121   RESNSKAYTPKTISIGPYHNKRPQLGSMEKYKWLYLQRFLKRKTEIDVKSYINEMEKLKD  180

Query  351   KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCD  530
             +A   Y D+ D  +++     KF +MLLLDGCF+ EF+    + E +            +
Sbjct  181   EALKCYDDNLDSDIVV-----KFSQMLLLDGCFVVEFIRERCEVEPE------------E  223

Query  531   NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKV  710
             +N +     M  QV  D++LLE QLPFFVL  LH M  + ++  FL++V+ T  ++  KV
Sbjct  224   SNQIINLEWMINQVCLDMVLLEYQLPFFVLTMLHDMTKNPTERSFLNMVRTTLLNIFPKV  283

Query  711   RLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE--------RHYWTLCFPCSL  866
               +PP    + D NA  +  HLL  VH  C P +     E        +    + F  ++
Sbjct  284   TFMPP--SEIDDLNAENI-DHLLDAVHMFCRPSHDQKTRETKNASSRGKECCKISFCGNI  340

Query  867   GKQSQDSKVGSS-------DIRTATELQEAGVNLKK-------VVKSSSLFHIKFNHAEL  1004
              + ++  ++           I +ATEL  AGV+  K       V   ++LF I F    +
Sbjct  341   LQLTRSKEIPDVLDLWDCYHIPSATELYNAGVSFSKIGSVAEDVNDKTTLFDINFEKGLM  400

Query  1005  EIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
             +IP F I D  ETF RN+IAYEQHS      YF++YA +M  LI + +DVNL R N +++
Sbjct  401   KIPCFTIEDTMETFMRNLIAYEQHSSGAYP-YFSNYAHIMTQLIGSHRDVNLLRQNKIIL  459

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
               LGDDKEV  +F +L  GV+ +    FYY + C+KL  H  KPW+ MMA LRH+YF +P
Sbjct  460   KDLGDDKEVASIFKKLSSGVIVT---DFYYREECSKLIQHCEKPWSQMMASLRHNYFQSP  516

Query  1365  WAGISTIAAVFLLSLTIAQTVIA  1433
             WAG ST+AA+ LL LT+ QT++A
Sbjct  517   WAGASTVAAITLLILTVIQTILA  539



>ref|XP_006367795.1| PREDICTED: UPF0481 protein At3g47200-like [Solanum tuberosum]
Length=480

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 181/472 (38%), Positives = 254/472 (54%), Gaps = 60/472 (13%)
 Frame = +3

Query  66    GDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             G Q    + +      ++L  LS  +C IFKV+ GLR +N DAYTP +ISIGPYH  N +
Sbjct  47    GSQTKTSVNQIFDEMFEDLNNLSITSCTIFKVNVGLRESNPDAYTPKMISIGPYHKKNPQ  106

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME  KL+YL  FL+R++   +E C  +L+  K++    Y D ED   L D +  +F+
Sbjct  107   LRPMEKYKLLYLQRFLQRKEGLDVESCINELETLKKETIKCYNDIED---LCDDS--QFL  161

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +MLLLDGCF+ EF+    + E              DN    +      Q+ RDL+LLENQ
Sbjct  162   QMLLLDGCFVVEFIRESTEGE--------------DNIINNIDDCAYSQILRDLMLLENQ  207

Query  603   LPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNN----ATEMKG  770
             LPFF+L +LH M                     TK     P+   L DN+    +   K 
Sbjct  208   LPFFILNKLHHM---------------------TKQVDELPLAIQLNDNSFIFYSNLPKM  246

Query  771   HLLQIVHNLCNPQN-GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNL  947
                     +CN +N   +    H ++ C   +  K S++       +  ATEL EAGV+ 
Sbjct  247   FRASYRETICNAENIKHLLHAVHIFS-CHGLNPLKNSKNDITKHKVMPNATELSEAGVSF  305

Query  948   KKV---------VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMY  1100
              +V             SLF IKFN+  + IP F + D TET  RN+IAYEQ SCD    Y
Sbjct  306   VEVGDLLGEVNLEDDISLFDIKFNNGFMAIPSFQVDDDTETILRNLIAYEQQSCDVETKY  365

Query  1101  FTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYS  1277
             F+DYA  +D LI+++KDVNL R  G++ +W+G++K+V  LFN++  GV VY +   FYY 
Sbjct  366   FSDYATFIDYLIDSDKDVNLLRQKGIIESWMGENKDVASLFNKIGNGVGVYYN---FYYH  422

Query  1278  DVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             + C K   +  KPWN M A L+H+YF++PWAG ST+AA+ LL LT  QT++A
Sbjct  423   EECIKAIEYSEKPWNRMKANLKHNYFSSPWAGASTMAAIMLLILTTIQTILA  474



>ref|XP_009605192.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=506

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 192/489 (39%), Positives = 260/489 (53%), Gaps = 59/489 (12%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             E+  G   + P  + +     ++K  SS+ C IFKV  GL  +N DAY P +ISIG YH 
Sbjct  43    EDRSGMTTNKPANQIIDEIFADIKDSSSKCCTIFKVCVGLNESNPDAYKPKVISIGSYHK  102

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
              N +L  ME  KL YL  FL R+    +E C  +L+D   K        +DI+ L     
Sbjct  103   HNPELRFMEKYKLRYLQRFLCRKVGIDVESCIRELEDEALKCY------DDIENLDSDIV  156

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTG-MKFQVFRDLL  587
              KF K+LLLDGCF+ EF+    +                +     +P G +  Q+ RDLL
Sbjct  157   AKFSKILLLDGCFLIEFIRESCEMCP-------------EGEGWIIPGGCLDNQIRRDLL  203

Query  588   LLENQLPFFVLQELHGMVYDES-KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEM  764
             LLENQLPFFVL +LH M  DE  K  F  +VK TF     K   + P   N  + NA E+
Sbjct  204   LLENQLPFFVLTKLHHMTKDEEDKIPFTKMVKKTFLPCFPK---MTPASFNESEGNAAEI  260

Query  765   KGHLLQIVHNLCNPQ--------NGGIQEERHYWTLCF-PCSLGKQS-----QDSKVGSS  902
             K HLLQ++H  C+P         N  ++ E  + +LC  P  + + +     +D   G +
Sbjct  261   K-HLLQVLHMSCHPSVIKTTSLTNPSMETEHSWKSLCCNPLQIIRSNDKPIDKDHLTGHN  319

Query  903   DIRTATELQEAGVNLKKVV------------KSSSLFHIKFNHAELEIPKFHITDPTETF  1046
              +  ATE  E+GV+  KV              ++SLF IKF +  L+IP F +TD TET 
Sbjct  320   VMPNATEFSESGVSFIKVGYINDYLEKENRGDNTSLFDIKFENGLLKIPSFRVTDETETL  379

Query  1047  FRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFN  1226
              RN+IAYEQ S      YF+D+   MD LI+++KDV+L    G+     G+DKE+  LFN
Sbjct  380   LRNLIAYEQQSSHVCPRYFSDFTIFMDYLIDSDKDVSLLSRKGI-----GEDKEIATLFN  434

Query  1227  RLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLS  1406
             ++ K V  SS   F+Y + C KL  H  +P N+M A LRH+YFNTPW G ST+AAV LL 
Sbjct  435   KIGKAVNISS--DFHYKEECRKLVHHCEQPRNLMKASLRHNYFNTPWVGASTLAAVVLLI  492

Query  1407  LTIAQTVIA  1433
             LT  QTV+A
Sbjct  493   LTAMQTVLA  501



>ref|XP_009795427.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana sylvestris]
Length=496

 Score =   281 bits (718),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 189/501 (38%), Positives = 270/501 (54%), Gaps = 76/501 (15%)
 Frame = +3

Query  51    IENTEGDQQDLPIYESLK--RDIKNLKQLSSE------------ACIFKVHEGLRRTNTD  188
             IE+   D   + I E LK  RD K+L Q+  E              IFKV+  +R +N D
Sbjct  26    IEDGRKDDHLIEIKERLKLQRD-KSLNQIFDERFEDLDNSSIKSTTIFKVNAAIRESNPD  84

Query  189   AYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYY  368
             AYTP +ISIGPYH  N +   ME  KL+ L  F++R++   +E C +++++ K++A   Y
Sbjct  85    AYTPKIISIGPYHRKNQEFHSMEKYKLLCLRRFIRRKEGLDVESCIKQMEELKDEALKCY  144

Query  369   GD-DEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVF  545
              D D DI         KF ++LLLDGCF+ EFL                       NA +
Sbjct  145   DDIDSDIV-------GKFSEILLLDGCFVVEFLRDPLII-----------------NAQW  180

Query  546   MPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY--DESKPKFLDIVKITFASMLTKVRLI  719
             M +    QV RDLLLLENQLPFFVL +LH M+   ++ +P F+ +VK           + 
Sbjct  181   MVS----QVCRDLLLLENQLPFFVLAKLHDMIKRPEDLEPDFIRMVKSALC------HIS  230

Query  720   PPIVPNL-GDNNATEMK-GHLLQIVHNLCN----PQNGGIQEERHYWTLC-FPCSLGKQS  878
             P  +P L  + +  E K  HLL +VH  C     P+   I         C     LGK  
Sbjct  231   PSKIPFLKSEIDGDEKKFDHLLHVVHMFCRPSEMPKTSQISNSSTRKECCNIKRFLGKNL  290

Query  879   ---QDSKVGSSDI------RTATELQEAGVNLKK-------VVKSSSLFHIKFNHAELEI  1010
                + +K+ +S+I       +ATEL EAG +  K       ++  +++F IKF +  ++I
Sbjct  291   RIFRSNKISTSNIWQYWQAPSATELYEAGASFLKLGSFEQDLMDRTTMFDIKFENGAIQI  350

Query  1011  PKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNW  1190
             P   + D TE F RN+IAYEQHS +     F DY  +M  LI + KDVNL R+NG+++N 
Sbjct  351   PCLVVGDSTEAFLRNLIAYEQHSTNLYPKCFLDYVDIMGQLIKSRKDVNLLRLNGIILNG  410

Query  1191  LGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
             L DD EV ++FN+L +G+V  +    YY++   K++ H  KPWN ++A LR +YF++PWA
Sbjct  411   LADDGEVANMFNKLGEGIVVVA-GSTYYAEASRKMSQHCKKPWNQIIANLRQNYFSSPWA  469

Query  1371  GISTIAAVFLLSLTIAQTVIA  1433
             G ST+AAV LL LT  QTV+A
Sbjct  470   GASTVAAVILLILTAMQTVLA  490



>ref|XP_006360835.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=476

 Score =   280 bits (715),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 173/441 (39%), Positives = 240/441 (54%), Gaps = 51/441 (12%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV+  LR +N+DAYTP ++SIGPYH  N +L  ME  KL+YL  FL+R K+  ++ C 
Sbjct  71    IFKVNVRLRESNSDAYTPKMVSIGPYHKKNPQLDPMEMYKLLYLRRFLQR-KKLDVKSCI  129

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
              +L+  KE+A   Y   E++         +F +MLLLDGCF+ EF+              
Sbjct  130   SELQKLKEEALKCYDVIEEL-----GNDSQFCQMLLLDGCFVVEFIRE------------  172

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKIT  686
                 + C      +       +FRDL+LLENQLPFFVL +LH M   + +     +V   
Sbjct  173   --RCEMCPKGEDKIININDNYIFRDLMLLENQLPFFVLNQLHDMTKQDDELPLAILVNKV  230

Query  687   FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL-CNPQNGGIQEERHYWTLCFPCS  863
             F   +   ++       + + NA  +K HLL +VH   C+ QN                 
Sbjct  231   FTFFVNWPKMTFESFGKI-ECNAENIK-HLLHVVHIFSCHGQNP----------------  272

Query  864   LGKQSQDSKVGSSDIRTATELQEAGVNLKK----------VVKSSSLFHIKFNHAELEIP  1013
               K+S D+K     +  ATEL EAGV+  K          +   +SLF IKF +  + IP
Sbjct  273   -MKKSNDNKKRHMIMPNATELSEAGVSFAKIGNINRNKDNISDMTSLFDIKFENGLMTIP  331

Query  1014  KFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWL  1193
              F + D TET  RN+IAYEQ S D    YF+DYA  MD LI+++KDVNL R  G + NW+
Sbjct  332   CFQVEDNTETLLRNLIAYEQQSSDVQPKYFSDYATFMDYLIDSDKDVNLLRRKGSIENWM  391

Query  1194  GDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAG  1373
             G+DKEV  +FN++  GV     + FYY++ C K   H  KPWN M A L+H+YFN+PWA 
Sbjct  392   GEDKEVASIFNKIGNGVGVDP-NNFYYNEECLKAIQHCEKPWNRMKANLKHNYFNSPWAA  450

Query  1374  ISTIAAVFLLSLTIAQTVIAV  1436
              ST+AA+ LL LT  QT++A+
Sbjct  451   ASTVAAIILLILTTIQTILAI  471



>ref|XP_006360881.1| PREDICTED: UPF0481 protein At3g47200-like [Solanum tuberosum]
Length=633

 Score =   282 bits (722),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 185/489 (38%), Positives = 258/489 (53%), Gaps = 63/489 (13%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSE--ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             +SL   IKNL + S++    IFKV  GL  +N DAY P L+SIGPYH  ++KL  ME  K
Sbjct  172   KSLNERIKNLNKSSNKIFTTIFKVTVGLSESNPDAYKPKLLSIGPYHKHDSKLGSMEKYK  231

Query  267   LMYLDLFLKREKQ-PSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDG  443
             L YL  FLKR+     +E C  ++   K+ A   Y D   I +   S    F +MLLLDG
Sbjct  232   LCYLQRFLKRKGGIHDVESCISEMDKLKDDALKCYDDIGGIDM---SIVVNFSEMLLLDG  288

Query  444   CFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQ  623
             CF+ E++    +     E          + + +     ++ Q+ RDLLL+ENQLPFFVL 
Sbjct  289   CFVVEYIREHCEFILDCESISI------EEDRIIKRRCIRNQLNRDLLLIENQLPFFVLT  342

Query  624   ELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG------HLLQI  785
             +L+ M  +E +   L++VK TF+                 D ++ E +G      HL  +
Sbjct  343   KLYEMSKEEGEETLLEMVKWTFSL----------------DKSSIETEGNEKNFKHLFHV  386

Query  786   VHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQ-----------DSKVGSSDIRTATELQE  932
             VH   + +    +        C     G QS+           +  +    +  ATEL E
Sbjct  387   VHMCMSCRPSKSKNRPSNMADCRRSLFGIQSKIVRRRRRRNRDEYMMWHKVMPNATELSE  446

Query  933   AGVNLKKVVK----------------SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIA  1064
             AGV+   V                  S+SLF IKF++  + IP F + D TET  RN+IA
Sbjct  447   AGVSFANVGNIFMRSLDKVYDDDLGDSTSLFDIKFDNGLMTIPCFRVVDDTETLMRNLIA  506

Query  1065  YEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV  1244
             YEQ S D    YF+D+   MD LI+++KDV+L RMNG++VN +G+D EV  +FN++ KGV
Sbjct  507   YEQQSSDVCLKYFSDFVVFMDYLIDSDKDVSLLRMNGIIVNKIGEDNEVASVFNKMGKGV  566

Query  1245  VYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQT  1424
             V S  D FYY + C K   H  + WN M A LRH+YFN+PWAGIST+AA+ LL LT  QT
Sbjct  567   VVS--DDFYYEEECRKAVKHCEQSWNRMKANLRHNYFNSPWAGISTVAAIILLLLTATQT  624

Query  1425  VIAVLDLRK  1451
             V+A + + K
Sbjct  625   VLAFISVFK  633


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             M A LRH+YF++PW G ST+AA+ LL LT+ QTV+A
Sbjct  1     MKASLRHNYFSSPWVGASTVAAITLLVLTVIQTVLA  36



>ref|XP_006360878.1| PREDICTED: UPF0481 protein At3g47200-like [Solanum tuberosum]
Length=638

 Score =   280 bits (715),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 182/487 (37%), Positives = 264/487 (54%), Gaps = 57/487 (12%)
 Frame = +3

Query  57    NTEGDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHG  233
             N + D   +   +SL     NL++ S E+  IFKV  GL  +N DAY P L+SIGPYH  
Sbjct  46    NNDEDPLGMQTKKSLNERCMNLEKSSFESTTIFKVTVGLSESNPDAYKPKLLSIGPYHKH  105

Query  234   NAKLSKMENLKLMYLDLFLKREKQ-PSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             ++KL  ME  KL YL  FLKR+     ++ C  ++   K+ A   Y   +DI  L+DS  
Sbjct  106   DSKLGSMEKYKLCYLQRFLKRKGGFHDVKSCISEMDKLKDDALKCY---DDIGGLIDSCN  162

Query  411   --DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDL  584
               + F++MLLLDGCF+ ++L  +                    + +     ++ Q+ RDL
Sbjct  163   IVEFFLEMLLLDGCFVVDYLREQCKILRT------------GEDMIINRDCIRNQLKRDL  210

Query  585   LLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEM  764
             LL+ENQLPFFVL +L+ M  ++ +   +++V+ TF+   + +           + N  + 
Sbjct  211   LLVENQLPFFVLTKLYEMSKEQCEEPLIEMVEWTFSLDKSSIE---------SEGNERKF  261

Query  765   KGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSL-GKQSQDSKVGSSD---------IRT  914
             K HL  +VH   + +   I+       +    SL G  SQ ++  ++          +  
Sbjct  262   K-HLFHVVHICMSCRPSKIKSSNTAEQIIVIGSLFGIPSQTNRRRNNTDQNMMWNKVMPN  320

Query  915   ATELQEAGVNLKKVVK----------------SSSLFHIKFNHAELEIPKFHITDPTETF  1046
             ATEL EAGV+   V                  S+SLF IKF++A + IP F + D TETF
Sbjct  321   ATELSEAGVSFANVGNIFVRSLDNVNDNDLKDSTSLFDIKFDNALMTIPCFRVVDDTETF  380

Query  1047  FRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFN  1226
              RN+IAYEQ   D N+ YF+D+A  M  LI++EKDV+L RMNG++VN +G DKEV   FN
Sbjct  381   MRNLIAYEQQCSDVNHRYFSDFAVFMSCLIDSEKDVSLLRMNGIIVNKIGKDKEVASFFN  440

Query  1227  RLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLS  1406
             ++ KGV  S  D FYY + C K   H  + WN+M A LRH++FN+PW GIST+AA+ LL 
Sbjct  441   KIGKGVAIS--DNFYYEEECKKAVQHCEQSWNIMKANLRHNFFNSPWVGISTVAAIILLL  498

Query  1407  LTIAQTV  1427
             LT  QT+
Sbjct  499   LTATQTM  505


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +3

Query  57   NTEGDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHG  233
            N   D   L   +SL     NL + S E+  IFK   GL  +N DAY P L+SIGPYH  
Sbjct  564  NNGEDPLGLKTKKSLNERCMNLDKSSMESTTIFKGTVGLSESNPDAYKPKLLSIGPYHKH  623

Query  234  NAKLSKMENLKLMYL  278
            ++KL  ME  KL YL
Sbjct  624  DSKLGSMEKYKLCYL  638



>ref|XP_010319348.1| PREDICTED: putative UPF0481 protein At3g02645 [Solanum lycopersicum]
 ref|XP_004237176.2| PREDICTED: putative UPF0481 protein At3g02645 [Solanum lycopersicum]
Length=474

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 255/464 (55%), Gaps = 51/464 (11%)
 Frame = +3

Query  66    GDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             G Q    I +      ++L   S ++C IFKV  GL  +N DAYTP +ISIGPYH  N +
Sbjct  47    GSQTKKSINQIFDEMFEDLDNSSIKSCTIFKVIVGLSESNPDAYTPKMISIGPYHKKNPQ  106

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME  KL+YL  FL+R++   +E C  +LK  +E+A   Y D ED+        ++  
Sbjct  107   LRPMEKYKLLYLRRFLQRKEGLDVESCINELKQLEEEAIKCYEDIEDL-----GNNNQIC  161

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +MLLLDGCF+ EF+ RE  +   +EEEE ++   C              +FRDL+LLENQ
Sbjct  162   QMLLLDGCFVVEFI-RECCKIYPEEEEEIIDVHDC-------------YIFRDLMLLENQ  207

Query  603   LPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQ  782
             LPFFVL +LHGM   + +      V   F   +   ++       + + +A  +K HLL 
Sbjct  208   LPFFVLDKLHGMTKQDDELPLAIQVNSVFTHYVNWPKMTLESFEEI-EYDAENIK-HLLH  265

Query  783   IVHNLCNPQNGGIQEERHYWTLCFPC--SLGKQSQDSKVGSSDIRTATELQEAGVNLKKV  956
             +VH                    F C  +  + S+D       +  ATEL EAGV   KV
Sbjct  266   VVH-------------------IFSCHGTPMENSKDCTTCHKVMPNATELFEAGVTFVKV  306

Query  957   VK---SSSLFH-IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLM  1124
              K   +++LF+ IKF +  ++IP F + D TE   RN+IAYEQ S D    YF+D+A  M
Sbjct  307   DKLGDNTNLFNSIKFENGLMKIPSFQVEDDTEILLRNLIAYEQLSYDVMPKYFSDFATFM  366

Query  1125  DNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVCNKLNG  1301
             D LI+++KDV L R  G++ NW+G+D EV  LFN++  GV +YS    FY+ + C K   
Sbjct  367   DYLIDSDKDVTLLRQKGIIENWIGEDNEVASLFNKIGNGVFIYSE---FYFKEECIKAIE  423

Query  1302  HYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             H  KPWN M A L+H+YF+ PW G ST+AA+ LL LT  QT++A
Sbjct  424   HCKKPWNRMKANLKHNYFSNPWVGASTVAAIILLILTAIQTILA  467



>ref|XP_006360883.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=431

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 169/431 (39%), Positives = 238/431 (55%), Gaps = 44/431 (10%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV+   R +N DAYTP ++SIGPYH  N +L  M+  KL+Y   FL+R K+  ++   
Sbjct  36    IFKVNVWQRESNPDAYTPKMVSIGPYHKKNTQLGPMKKYKLLYRRRFLQRNKRLDVKSYI  95

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
              +L+  KEK    Y   EDI+   + + + F +MLL DGCF+ EF+        K E++ 
Sbjct  96    SELEKVKEKVLKCY---EDIEKFGNDSHE-FCEMLLFDGCFVVEFIRECCGIYPKGEDKI  151

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKIT  686
                     N++          +FRDL+LLENQLPFFVL +LH M           + + +
Sbjct  152   INI-----NDSY---------IFRDLMLLENQLPFFVLNKLHFMTKQ--------VDEFS  189

Query  687   FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTL--CFPC  860
              A +  K+  +  + PN      TE            CN   G I+   H   +  C   
Sbjct  190   LAILADKLFTLQEMSPNYS---FTE---------REYCN--EGNIKHLLHAAHIFSCHGL  235

Query  861   SLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTE  1040
             +  K S++ K   + +  ATEL EAGV+  KV   +SLF IKF +  + IP F + D +E
Sbjct  236   NPMKNSKNDKTSPTVMPNATELSEAGVSYAKVKNMTSLFDIKFENGLMTIPYFQVVDGSE  295

Query  1041  TFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDL  1220
             T  RN+IAYEQ S D +  YF+DYA  MD+LIN+EKDVNL    G++ NW+G+DKEV  L
Sbjct  296   TLLRNLIAYEQQSSDVDPTYFSDYATFMDHLINSEKDVNLLCQKGIIENWIGEDKEVASL  355

Query  1221  FNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFL  1400
             FN++ KGV  ++   FYY +   K   +  KPWN M A L H+YF++PW G ST+AA+ L
Sbjct  356   FNKIGKGV--TTYSNFYYKEEIKKTIEYREKPWNRMKANLMHNYFSSPWVGASTVAAIIL  413

Query  1401  LSLTIAQTVIA  1433
             L LT  QT++ 
Sbjct  414   LILTTIQTILT  424



>ref|XP_010271392.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
Length=439

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 173/456 (38%), Positives = 243/456 (53%), Gaps = 58/456 (13%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S++  + ++  LSSE CIF+V E +R+ N +AY P ++S+GP+H+G  +L++ME  K  Y
Sbjct  26    SIQEKLDDVSPLSSECCIFRVPEQMRKINEEAYRPRMVSLGPFHYGKQRLAEMEEHKKRY  85

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L   L+R     +E     +++ + +A   Y   E I L    + D+FV+M+LLDGCFI 
Sbjct  86    LKSLLRRNPSIKLEAYVNTMRELENRARKCYA--ETISL----SSDQFVEMMLLDGCFII  139

Query  456   EFLYReydeetkkeeeeelnkkkCDN-------NAVFMPTGMKFQVFRDLLLLENQLPFF  614
              + +                   C+N       + VF        ++ D++LLENQ+PFF
Sbjct  140   AYFF------------------MCENPSLRSEFDPVFHAAWTDAGLYHDMVLLENQIPFF  181

Query  615   VLQELHGMVYD--ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIV  788
             VL+ L  +V      K   +++    F   L K   +P   PN     ++++K HLL ++
Sbjct  182   VLEYLFKLVNTTLNYKNSLVELSFSVFEEFLQKEDRVPNQNPN-----SSQVK-HLLDLL  235

Query  789   HNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSS  968
              N   P +     ER            K   D         TATELQEAGV  K ++ S+
Sbjct  236   RNYHLPSS-----ERK-----------KPKGDPMFNLPP--TATELQEAGVKFK-MITSN  276

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
             S   I+FN   LEIP   I D TE F RN++A+EQ     + +YF DY   MD+LINT K
Sbjct  277   SWLDIRFNEGVLEIPNIKIEDATEVFLRNLLAFEQCYMKNSTLYFVDYLLFMDSLINTSK  336

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVM  1328
             DV L R  G++ N LGDD+EV  LFN+L KGVV S  D FYY  +C  +  +Y  P +  
Sbjct  337   DVGLLRGCGIIDNLLGDDEEVAHLFNKLGKGVVMSENDNFYYLRLCQDVQEYYKNPLHRW  396

Query  1329  MAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              AKL HDYFNTPWA IS IAAV LL LT  QT+ +V
Sbjct  397   RAKLVHDYFNTPWAIISFIAAVLLLLLTFIQTIYSV  432



>ref|XP_006350416.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=501

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 179/471 (38%), Positives = 248/471 (53%), Gaps = 60/471 (13%)
 Frame = +3

Query  54    ENTEGDQQDLP--------IYESLKRDIKNLKQLS-SEACIFKVHEGLRRTNTDAYTPLL  206
             + TE + +D P        + +   +  ++L +LS   + IFKV+ GLR +N  AY P +
Sbjct  41    QTTESNDEDPPSGSQTTECVNQIFHKKFEDLDKLSIKSSTIFKVNVGLRESNPAAYVPKM  100

Query  207   ISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDI  386
             +SIGPYH GN++LS ME  KL+YL  FL+R  Q  ++ C  +L    EKA + YGD E  
Sbjct  101   VSIGPYHKGNSQLSSMEKYKLLYLRRFLERNNQLDVKSCISELDKWMEKALNCYGDIEGF  160

Query  387   QLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKF  566
                 D+   +F +MLLLDGCF+ EF+        + + E E        + +    G K+
Sbjct  161   DT--DNDSHEFCQMLLLDGCFVVEFIRERCQIYPQGKREGE------GEDKIINFVGSKY  212

Query  567   -QVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLG  743
              Q+ RDLLLLENQLPFFVL +LH M   + +   + +V I+F   L       PI     
Sbjct  213   NQIVRDLLLLENQLPFFVLNKLHYMTKQDDELPLVILVMISFTHFLGLGCEFTPIFIIET  272

Query  744   DNNATEMKGHLLQIVH-NLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRT--  914
               N   +K H+LQ VH + C+                     G   +DSK G  + +   
Sbjct  273   ICNEENIK-HILQAVHIHSCH---------------------GNPIKDSKHGGMETKVMP  310

Query  915   -ATELQEAGVNLKKV------------VKSSSLFHIKFNHAELEIPKFHITDPTETFFRN  1055
              ATEL EAG++  KV                SLF IKF    ++IP F + D TE   RN
Sbjct  311   NATELSEAGISFIKVGHFDRLLGGGDLEDDISLFDIKFEKGVMKIPCFGVGDGTEILLRN  370

Query  1056  MIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLC  1235
             +IAYEQ S D    YF+D+A  MD+LI++EKDVNL R   ++ NW+G+DKEV  LFN++ 
Sbjct  371   LIAYEQQSSDVKPKYFSDFAFFMDHLIDSEKDVNLLRQKEIIKNWIGEDKEVASLFNKIG  430

Query  1236  KGV-VYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTI  1385
              GV VYS    FYY +   K   H +K WN M   L  +YF++PWAG ST+
Sbjct  431   NGVTVYSD---FYYGEEFKKAVEHCDKTWNKMKTNLMRNYFSSPWAGASTV  478



>ref|XP_002518141.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44274.1| conserved hypothetical protein [Ricinus communis]
Length=422

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 164/456 (36%), Positives = 234/456 (51%), Gaps = 49/456 (11%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+   + +L  LSS+ CIFKV   +R  N  AY P +I+IGPYH G   L  ME  K+ Y
Sbjct  12    SINEKLGSLSPLSSDRCIFKVPNQVRVVNEKAYAPEIIAIGPYHRGKDHLKAMEEHKIRY  71

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL+R  Q S+    + ++  +E A + Y +   +        D+FV+M+++DGCFI 
Sbjct  72    LQRFLRRSHQNSVLGIVQAIRALEETARNCYSEPVSL------TQDEFVEMMVVDGCFIV  125

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             EF YR  +                  + +F    ++ ++  DLLL+ENQLPFFVL +L  
Sbjct  126   EFSYRCVETAD-------------PEDPIFQTNQIQSRLMLDLLLVENQLPFFVLIKLFH  172

Query  636   MVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG---HLLQIVHNLCNP  806
             M+  +          I    +     L+P    N      +E  G   HLL+++H+   P
Sbjct  173   MITGQEN-------SIIKLLLKVFKFLLPGRGYNPKHEYTSEQIGQIRHLLELIHDNWQP  225

Query  807   QNGGIQEERHYWTLCFPCSLGKQ-SQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
                             P  +    +    V  S  R A ELQEAG+  KKV +  +LF I
Sbjct  226   ---------------LPTRMESYLNMRENVKRSFPRCAIELQEAGIKFKKV-EEQNLFDI  269

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
              F +  + IP   I D T+   RN+IAYEQ     + +Y +DY   MD+LIN+EKDV L 
Sbjct  270   SFRNGVMRIPTLTIRDETQCIMRNLIAYEQLIPRSSPIYVSDYMIFMDSLINSEKDVELL  329

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
                G++ NWLGDDK V  L N++   V    CD   Y+++   +N H NK WNV MAKLR
Sbjct  330   CRKGIIENWLGDDKAVAILCNKIGDNVF---CDRALYAEIQYSVNMHCNKRWNVWMAKLR  386

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             H+YF++PWA IS +AA+ LL LT +QT+ +V    K
Sbjct  387   HNYFHSPWALISVLAAIILLFLTFSQTLYSVFSYYK  422



>ref|XP_006360837.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=411

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 167/431 (39%), Positives = 236/431 (55%), Gaps = 48/431 (11%)
 Frame = +3

Query  114   KNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             ++L   S ++C IFKV+   R +N DAYTP ++SIGPYH  N +L  M+  KL+YL  FL
Sbjct  3     EDLDNSSIKSCTIFKVNVWQRESNPDAYTPKMVSIGPYHKKNTQLGPMKKYKLLYLRRFL  62

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             +R K+  ++    +L+  KEK    Y D E       + G +F +MLL DGCF+ EF+  
Sbjct  63    QRNKRLDVKSYISELEKVKEKVLKCYEDLEK----FGNDGHEFCEMLLFDGCFVVEFIRE  118

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE  650
              Y    K E++          N V+        + RDL+LLENQLPFFV+ +LH M   +
Sbjct  119   CYGIYPKGEDKIINI------NHVY--------ILRDLMLLENQLPFFVVNKLHDMTKQD  164

Query  651   SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC---NPQNGGI  821
             ++     +V   F   + +  +     P   + NA  +K HLL +VH +    NP     
Sbjct  165   NELPLAILVNKVFTFFVNRPNMDLE-SPEKIECNAENIK-HLLHLVHIVSCHGNPM----  218

Query  822   QEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAE  1001
                             K+  +S      +  ATEL EAGV+  KV   +SL +IKF +  
Sbjct  219   ----------------KKLNNSIKCQRVMPNATELSEAGVSFAKVKNVTSLLNIKFENGL  262

Query  1002  LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVL  1181
             + IP F + D TET  RN+IAYEQ S D +  YF+DYA  M++LI+++KDVNL    G++
Sbjct  263   MTIPCFLVVDGTETVLRNLIAYEQQSSDVDPRYFSDYATFMNHLIDSDKDVNLLFQKGII  322

Query  1182  VNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFN  1358
              NW+G+DKEV  LFN++ KG+  YSS   FYY +   K   H  KPWN M A L H+YF+
Sbjct  323   ENWIGEDKEVATLFNKIGKGITTYSS---FYYKEEITKAIEHCEKPWNRMKANLMHNYFS  379

Query  1359  TPWAGISTIAA  1391
             +PW G ST+AA
Sbjct  380   SPWVGASTVAA  390



>ref|XP_006360884.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=445

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 185/462 (40%), Positives = 256/462 (55%), Gaps = 62/462 (13%)
 Frame = +3

Query  21    ISELQRQ*GMIENTEGDQQDLPIYESLKRDI--------KNLKQLSSEAC-IFKVHEGLR  173
             I E +    +I+  E + QD P++   K+ +        +NL   S E+C IFKV+ GLR
Sbjct  25    IEEWREVDHLIDIKETNGQD-PLWSQTKKSVNQIFDEMFENLDNSSIESCTIFKVNVGLR  83

Query  174   RTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEK  353
              +N DAYTP +ISIGPYH  N +L  ME  KL+YL  FL+R++   +E C  +LK+ KE+
Sbjct  84    ESNRDAYTPKMISIGPYHKKNPQLRSMEKYKLLYLQRFLQRKEGLDVESCINELKELKEE  143

Query  354   AASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDN  533
             A   Y   EDI  L + +  +F +MLLLDGCF+ EF+ REY E   + EEE +N K C  
Sbjct  144   AIKCY---EDIDKLGNDS--QFCQMLLLDGCFVVEFI-REYCEMCLQGEEEIINIKDC--  195

Query  534   NAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV-YDESKPKFLDIVKITFASMLTKV  710
                         +FRD++LLENQLPFFVL +LH M   D+  P  L I+ I   +    +
Sbjct  196   -----------YIFRDMILLENQLPFFVLDKLHHMTKQDDDLP--LAILAINSFTFFIDL  242

Query  711   RLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPC--SLGKQSQD  884
               + P      + NA  +K HLL ++H                    F C  +  K S+D
Sbjct  243   SKMTPESFGEIECNAENIK-HLLHVIH-------------------IFSCYGNPMKNSKD  282

Query  885   SKVGSSDIRTATELQEAGVNLKKVVK---SSSLF-HIKFNHAELEIPKFHITDPTETFFR  1052
                  + +  ATEL EAGV+  K      +++LF  IKF +  + IP F + D TE   R
Sbjct  283   GITCHTVMPNATELFEAGVSFVKEDNHRYNTNLFDSIKFENGLMTIPCFQVEDDTEILLR  342

Query  1053  NMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRL  1232
             N+IAYEQ S D    YF+D+A  MD LI+++KDVNL R  G++ NW+G+DKEV  +FN++
Sbjct  343   NLIAYEQQSIDVQPKYFSDFATFMDYLIDSDKDVNLLRQKGIIENWIGEDKEVASIFNKI  402

Query  1233  CKGV-VYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
               GV VYS+   FYY + C K   H  KPWN M A L+H+Y 
Sbjct  403   GNGVGVYSN---FYYKEECRKAVEHCEKPWNRMKANLKHNYL  441



>ref|XP_006360871.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=427

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 161/432 (37%), Positives = 221/432 (51%), Gaps = 47/432 (11%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV++ L   N+DAYTP ++SIGPYH  N +L  ME  K+ YL  FL+R +   ++ C 
Sbjct  34    IFKVNKMLHELNSDAYTPKMVSIGPYHKNNPQLDPMEKYKVSYLKRFLQRREGLDVKICI  93

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
              KL   KEKA + Y D +D          +F +MLL+DGCF+ EF+        +     
Sbjct  94    SKLMTLKEKALNCYDDIQD--------NSEFCQMLLIDGCFVVEFIRERSKLCPE-----  140

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKIT  686
                      + + M       +FRDL+LL+NQLPFF+L  LH M     +   L +V   
Sbjct  141   -------GEDRIIMNPNRASYIFRDLMLLDNQLPFFILDHLHHMTKQVDESSLLILVNKL  193

Query  687   FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSL  866
             F      +++  P      + N  E   HLL +VH                    F C  
Sbjct  194   FMR-FANMQVHEPYRET--ECNNVENIKHLLHLVH-------------------IFSCHR  231

Query  867   G--KQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTE  1040
                K+S D  + S  +  A EL EAGV+  K    +SL  IKF +  + IP   +   TE
Sbjct  232   NPKKESNDDIMYSMVMPNAIELSEAGVSFSKSRDMASLMDIKFKNGSMTIPCLRVEGATE  291

Query  1041  TFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF-RMNGVLVNWLGDDKEVTD  1217
             T  +N+IAYEQ S D  + YF+DYA  MD LI ++KDV  F R  G++VNW  DDKE+  
Sbjct  292   TLLQNLIAYEQQSSDVQDTYFSDYATFMDRLIGSDKDVIFFLRQKGIIVNWTTDDKEMAS  351

Query  1218  LFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVF  1397
             LFN++ KG+   S   FYY +   K   H  KPWN M A ++H+YFN  WA  ST+A + 
Sbjct  352   LFNKIIKGITKYSV--FYYKEEFKKAVEHCEKPWNRMRANVKHNYFNKSWARASTVAGII  409

Query  1398  LLSLTIAQTVIA  1433
             L+ LT  QT +A
Sbjct  410   LIILTTIQTNLA  421



>ref|XP_011020607.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Populus 
euphratica]
 ref|XP_011020608.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Populus 
euphratica]
Length=419

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 169/453 (37%), Positives = 240/453 (53%), Gaps = 48/453 (11%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             +Y  + + +++L    S   IFKV   LR  N  A+ P ++SIGPYH G  KL  ME  K
Sbjct  7     LYVQIDKKLRDLPSNHSTCSIFKVPGRLRHVNERAFEPEILSIGPYHRGKDKLKMMEEHK  66

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
               YL   L+R  + S+++    +   + +A  +Y  D+ + L      D+FV+MLLLDGC
Sbjct  67    KRYLQKLLQRRAESSVQRYVTAMIRVEGEARKFY--DQSVSL----GQDEFVEMLLLDGC  120

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             FI E + +  +    ++          DN+ VF  + +   +  D+ LLENQLPFFVL E
Sbjct  121   FIVELIRKYNNIPGVRD----------DNDPVFEVSWILSSIETDMFLLENQLPFFVLWE  170

Query  627   LHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK-GHLLQIVHNLCN  803
             L  M  +     F  +  ++F            I P  G++   E K  HLL+I+++   
Sbjct  171   LFTMTSEVQNEDFFGMA-LSFCQR---------IFPGSGNHRIPENKYEHLLEILYH---  217

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
                 G Q          P +   Q  D       IR A ELQEAG+ LKK   S  LF +
Sbjct  218   ---TGYQP---------PITRASQDNDRYF----IRNAKELQEAGIKLKKREGSERLFDV  261

Query  984   KF-NHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNL  1160
              F  +  +EIP   I D TE+ FRN++AYEQ S  K+ +Y TDY  LMD LI+T++DV +
Sbjct  262   VFLENGTIEIPCLRIYDTTESLFRNLVAYEQCSQSKH-LYVTDYITLMDCLISTQEDVQI  320

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
              R +G++ N LGDD  V  LFN+L   V+ S    FYY  V + +  H N+  NV MAKL
Sbjct  321   LRHSGIIENGLGDDGMVCSLFNKLGINVILSHRRYFYYDKVFDGVKEHCNRKRNVWMAKL  380

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             +H+YFN+PWA +S +AAV LL  T+ QTV  V+
Sbjct  381   QHNYFNSPWALLSFLAAVALLLFTLVQTVFTVM  413



>ref|XP_004236861.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X1 [Solanum 
lycopersicum]
Length=447

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 179/476 (38%), Positives = 270/476 (57%), Gaps = 58/476 (12%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG  233
             +  EG ++  P++E+L      +K +S    IFKV+ GLR +N DAYTP ++SIGPYH+G
Sbjct  20    DEIEGGRKVDPLFENLFN--SRVKPIS----IFKVNVGLRESNPDAYTPKMVSIGPYHNG  73

Query  234   NAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGD  413
               +   M+  KL+YL  FL+R+++  ++ C  +L+   E+A + Y D ED+++       
Sbjct  74    KPQFRPMQKNKLLYLRRFLRRKERLDVDSCINELE---EEARNCYDDIEDLKI----GSR  126

Query  414   KFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLL  593
             +F +MLLLDGCF+ EF+   ++   ++E+E   +   C  N          Q+ RDL+LL
Sbjct  127   EFCEMLLLDGCFVVEFIRERFEIGPRQEDEIIKSDIGCIYN----------QILRDLMLL  176

Query  594   ENQLPFFVLQELHGMV-YDESKPKFLDIVKITFASMLTKVRLI-----PPIVPNLGDNNA  755
             ENQLPFFVL +LH M   D+  P  +  V I+F   +   +LI      P++ N+  +NA
Sbjct  177   ENQLPFFVLDKLHEMTKQDDELPLAIQAV-ISFTFFVDLEKLIDQHKYEPLI-NIA-SNA  233

Query  756   TEMKGHLLQIVHNL-CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQE  932
              ++K HLL  VH L C+       ++   WT   P                   ATEL E
Sbjct  234   RDIK-HLLHAVHILSCHGNPTKTSKDDTTWTKAMP------------------NATELSE  274

Query  933   AGVNLKKVVKSSS-LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTD  1109
             AGV       S++ LF IKF    + IP F + D TE+F RN+IAYEQ S +    YF+D
Sbjct  275   AGVRFSNHTNSNTNLFDIKFEDGLMTIPCFKVADETESFLRNLIAYEQQSSEVQPKYFSD  334

Query  1110  YAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVC  1286
             +A  MD+LI+++KDVNL R  G++ + +G+DKEV  LFN+L  GV VY +   FY+  V 
Sbjct  335   FALFMDHLIDSDKDVNLLRKKGIIEHLMGEDKEVASLFNKLGNGVTVYPN---FYFKQVF  391

Query  1287  NKLNGHYNK-PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
               +  H ++  W+   A L+H+YF++PW G ST+  + LL LT  QTV+A++ + K
Sbjct  392   TNVVKHCDENRWSRRWASLKHNYFSSPWVGASTLTVIILLILTTIQTVLAIVSITK  447



>ref|XP_002303847.2| hypothetical protein POPTR_0003s18000g [Populus trichocarpa]
 gb|EEE78826.2| hypothetical protein POPTR_0003s18000g [Populus trichocarpa]
Length=420

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 166/459 (36%), Positives = 234/459 (51%), Gaps = 57/459 (12%)
 Frame = +3

Query  84    PIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENL  263
             P+   +   + +L    S   IFKV   LR  N  A+ P ++SIGPYH G  KL  ME  
Sbjct  6     PLIVQIDEKLGDLPSSHSTCSIFKVPSRLRHVNERAFEPEILSIGPYHRGKDKLKMMEEH  65

Query  264   KLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDG  443
             K  YL   L+R  + S+E+    +   + +A  +Y  D+ + L      D+FV+MLLLDG
Sbjct  66    KKRYLQKLLQRRGESSVERYVMAMIRVEGEARKFY--DQSVSL----GQDEFVEMLLLDG  119

Query  444   CFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQ  623
             CFI E + +  +    ++           N+ VF  + +   +  D+ LLENQLPFFVL 
Sbjct  120   CFIVELIRKSNNISVVRD----------QNDPVFEVSWILSSIETDMFLLENQLPFFVLW  169

Query  624   ELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK-GHLLQIVHNLC  800
             EL  M  +     F            T +     I P  G++   E +  HLL I++++ 
Sbjct  170   ELFTMTSEVQNEDFFG----------TALSFCQRIFPGSGNHRIPENEYKHLLDILYHI-  218

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD-----IRTATELQEAGVNLKKVVKS  965
                                   G Q+ +S+    D     I  A ELQEAG+  KK   S
Sbjct  219   ----------------------GYQTPNSRESPEDNDRYFIGNAKELQEAGIKFKKREGS  256

Query  966   SSLFHIKFN-HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
               LF + F+ +  +EIP   I D TE+ FRN++AYEQ S  + ++Y TDY +LMD LIN+
Sbjct  257   RRLFDVDFSENGTIEIPCLRIYDTTESLFRNLVAYEQCS-QRKHLYVTDYIRLMDCLINS  315

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
             ++DV + R +G++ N LGDD  V  LFN L   V+ S    FYY  V +    H N+  N
Sbjct  316   QEDVQILRHSGIIENGLGDDGMVCSLFNTLGINVILSHSRYFYYHKVFDGAKEHCNRKRN  375

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             V MAKL+HDYFN+PWA +S +AAV LL  T+ QTV  VL
Sbjct  376   VWMAKLKHDYFNSPWALLSFLAAVALLLFTLVQTVFTVL  414



>ref|XP_009590371.1| PREDICTED: UPF0481 protein At3g47200-like, partial [Nicotiana 
tomentosiformis]
Length=377

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 153/394 (39%), Positives = 216/394 (55%), Gaps = 44/394 (11%)
 Frame = +3

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             E C  KL+  K++A   Y D+ D  +++     KF +M+LLDGCF+ EF+    D E ++
Sbjct  1     ESCISKLEKKKDEALKCYDDNLDSDIVV-----KFSQMMLLDGCFVVEFIRERCDVEPRE  55

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                        ++N V     M  QV RD++LLENQLPFFVL  LH M  + ++  FL++
Sbjct  56    -----------ESNQVINLEWMINQVCRDMVLLENQLPFFVLAMLHDMTKNPTEQSFLNM  104

Query  675   VKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHY---WT  845
             V+ T   +  KV  IP     + D NA ++  HLL  VH  C P +   +E ++      
Sbjct  105   VRRTLLDIFPKVTFIP--TSEIDDFNAEDI-DHLLDAVHMFCCPSHEKTRETKNASNKGN  161

Query  846   LCFPCSLGKQSQDSKVGSS-----------DIRTATELQEAGVNLKKV-------VKSSS  971
              CF  S         +               I +ATEL +AGV+  K+          ++
Sbjct  162   ECFKISFCGNILQLTMAKEIPNVLDLWDCYHIPSATELYDAGVSFSKIGTVNEDIKDKTT  221

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
             LF IKF    +++P F I D  ETF RN+IAYEQHS D  + YF++YA +M  LI + +D
Sbjct  222   LFDIKFKKGVMKVPCFTIEDTMETFMRNLIAYEQHSSDVYS-YFSNYAHIMTQLIGSHRD  280

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             VNL R N +++   GDDKEV  +F +L  GV  +    FYY + C+KL  H  KPW+ MM
Sbjct  281   VNLLRQNKIILKDQGDDKEVASIFKKLSSGVKVTD---FYYIEECSKLIQHCEKPWSQMM  337

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             A LRH+YF +PWAG ST+AA+ LL LT+ QTV+A
Sbjct  338   ASLRHNYFQSPWAGASTMAAIILLILTVIQTVLA  371



>ref|XP_010319551.1| PREDICTED: uncharacterized protein LOC104646793 [Solanum lycopersicum]
Length=826

 Score =   253 bits (645),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 176/468 (38%), Positives = 260/468 (56%), Gaps = 55/468 (12%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG  233
             +  EG  +  P++E+L      +K +S    IFKV+ GLR +N DAYTP ++SIGPYH+G
Sbjct  20    DEIEGGMKVDPLFENLFN--SRVKPIS----IFKVNVGLRESNPDAYTPKMVSIGPYHNG  73

Query  234   NAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGD  413
               +   M+  KL+YL  FL+R++   ++ C  +L+   E+A + Y D ED+ +       
Sbjct  74    KPQFRPMQKNKLLYLRRFLRRKESLDLDSCINELE---EEARNCYDDIEDLNI----GSR  126

Query  414   KFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLL  593
             +F KMLLLDGCF+ EF+    +   + E+E   +   C          +  Q+ RDL+LL
Sbjct  127   EFCKMLLLDGCFVVEFIRERVEIGPRLEDEIIKSDIGC----------IYKQILRDLMLL  176

Query  594   ENQLPFFVLQELHGMV-YDESKPKFLDIVKITFASMLTKVRLI-----PPIVPNLGDNNA  755
             +NQLPFFVL +LH M   D+  P  +  VK +F S +    +I      P++     +NA
Sbjct  177   KNQLPFFVLDKLHEMTKQDDDIPLAIQAVK-SFTSFVDIEEIIHKHSDSPLIKIA--SNA  233

Query  756   TEMKGHLLQIVHNL-CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQE  932
              ++K HLL  VH L C+       ++   WT   P                   ATEL E
Sbjct  234   GDIK-HLLHAVHILSCHGNPTKTSKDDTTWTKAMP------------------NATELSE  274

Query  933   AGVNLKKVVKSSS-LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTD  1109
             AGV       S++ LF IKF    + IP F + D TE+F RN+IAYEQ + +    YF+D
Sbjct  275   AGVRFSNHTNSNTNLFDIKFEDGLMTIPCFEVVDETESFVRNLIAYEQQTSEVQPKYFSD  334

Query  1110  YAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCN  1289
             YA  MD+LI+++KDVNL R  G++ + +G+DK+V+ LFN++  GV   S   FYY +   
Sbjct  335   YALFMDHLIDSDKDVNLLRQKGIIKHRMGEDKDVSSLFNKIGNGVTMYST--FYYHNESL  392

Query  1290  KLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             K + H  K +N +MA L  +YF++PW G ST+AA+ LL LT  QT++A
Sbjct  393   KTSQHCQKRFNRLMANLLRNYFSSPWVGASTVAAIILLILTTIQTILA  440


 Score =   169 bits (429),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 122/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query  849   CFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVK---SSSLFH-IKFNHAELEIPK  1016
             C+       S+DS +    +  ATEL EAGV   K  K   +++LF+ IKF +  ++IP 
Sbjct  623   CYEDKEDLDSKDSTISHKVMPNATELFEAGVTFVKEDKLGDNTNLFNSIKFENGLMKIPS  682

Query  1017  FHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLG  1196
             F + D TE   RN+IAYEQ S D    YF+D+A  MD LI+++KDV L R  G++ NW+G
Sbjct  683   FRVEDDTEILLRNLIAYEQQSYDVMPKYFSDFATFMDYLIDSDKDVTLLRQKGIIENWIG  742

Query  1197  DDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGI  1376
             +D EV  LFN++  GV   S   FY+ + C K   H  KPWN M A L+H+YF+ PW G 
Sbjct  743   EDNEVATLFNKIGNGVFIDS--EFYFKEECIKAIEHCKKPWNRMKANLKHNYFSNPWVGA  800

Query  1377  STIAAVFLLSLTIAQTVIA  1433
             ST+AA+ LL LT  QT++A
Sbjct  801   STVAAIILLILTAIQTILA  819


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  66   GDQQDLPIYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
            G Q    I +      ++L   S ++C I KV   L  +N  AYTP +ISIG YH  N +
Sbjct  523  GSQTKKSINQIFDEMFEDLDNSSIKSCTISKVIVVLCESNPYAYTPKMISIGLYHKKNPQ  582

Query  243  LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDI  386
            L  ME  KL+YL  FL+R++   +E+C  +LK+ KE+A   Y D ED+
Sbjct  583  LRPMEKHKLLYLRRFLQRKEGLDVERCINELKELKEEAIKCYEDKEDL  630



>ref|XP_008394063.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
Length=428

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/448 (36%), Positives = 228/448 (51%), Gaps = 43/448 (10%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+ +++  L  LS+  CI+KV E LR  N  AYTP ++SIGP HHG   L  ME  K  Y
Sbjct  21    SMSQELDGLTPLSASCCIYKVPEQLRCVNEKAYTPQVVSIGPIHHGKKGLEDMEEHKKRY  80

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL R    S+E    K+K  +EK  S Y         ++   D+FV+++L+D  FI 
Sbjct  81    LQYFLYRTGV-SLEDYVTKIKGKEEKLRSCYAHT------IELCSDEFVRIILVDAAFII  133

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L R                    N+ +F    +   +  D+LLLENQLPFF+ ++L  
Sbjct  134   ELLLRYGGYIVHD-----------SNDRIFNKPWLINIICPDMLLLENQLPFFIXEDLFA  182

Query  636   MV-YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
                   + P   D+   T+  + T + +       LG +++ +++ H + +V  L  P +
Sbjct  183   TAEVPATVPSVFDL-SYTYCKVSTSLYVKRD---GLGSSSSFKVE-HFVDLVRTLNLPTD  237

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
                 E R                   V S  + + T+L +AGV  K    S +LF + F 
Sbjct  238   QEENENR-----------------GSVESLAVPSMTKLHQAGVKFK-ARSSKNLFDMCFQ  279

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
                LEIP  +I+D TE   RN++A+EQ  C  N  YF DY  LMD L+NT  DV L   N
Sbjct  280   EGILEIPNLNISDSTELVLRNLVAFEQCHCTPNTRYFNDYIFLMDYLVNTPNDVELLVKN  339

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ N LGD+ EV+ L N L KGV+    D FYY+ +   LN +Y KPWN   A L+H Y
Sbjct  340   GIVENMLGDNNEVSTLINSLGKGVLVFR-DEFYYATLMKDLNKYYEKPWNKWKADLKHKY  398

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             FNTPW  IS IAA F++ LT+ QTV ++
Sbjct  399   FNTPWKIISVIAATFIIILTLIQTVSSI  426



>ref|XP_009348601.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=427

 Score =   242 bits (618),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 160/449 (36%), Positives = 227/449 (51%), Gaps = 47/449 (10%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
              P   S+ +++  L  LS+  CI+KV E LR  N  AYTP L+SIGP HHG   L  ME 
Sbjct  15    FPFATSMSQELDGLPTLSNSCCIYKVPEQLRCVNEKAYTPQLVSIGPLHHGKEGLKDMEE  74

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL+R K  S+E   +K+K  + +  + Y         ++   DKFV+++L+D
Sbjct  75    QKKRYLRYFLRRTKV-SLEDYVKKIKGKEAELRNCYAHT------IELCSDKFVRIILVD  127

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI EFL R                    N+ +F    +   +  D+LLLENQLPFF+L
Sbjct  128   AAFIIEFLLRVQKHIVPD-----------SNDRIFHKPRLINYLVPDMLLLENQLPFFIL  176

Query  621   QELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
             ++L     +  +    D+     +    KV     +  +   ++++    H + ++  L 
Sbjct  177   EDLFATA-EVPRTTVFDL-----SYTFCKVSTSSYVKRDGSGSSSSSKVEHFVDLIRTLN  230

Query  801   NPQNGGIQEER-HYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF  977
              P +   +E R    TL  PC                   TEL +AG+   KV  S +LF
Sbjct  231   LPTDQEEKENRGSVETLAVPC------------------MTELHQAGIKF-KVRSSKNLF  271

Query  978   HIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              + F    LEIP  +I+D TE   RN+IA+EQ  CD N  YF DY  LMDN +NT  DV 
Sbjct  272   DMCFQDGILEIPNLNISDSTELVLRNLIAFEQCHCDCN--YFGDYIVLMDNFVNTPNDVE  329

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L   NG++ N LG++ EV+ LFN L KG + S  +GFYY+ +   LN +Y KPWN   A 
Sbjct  330   LLVKNGIVENLLGNNNEVSTLFNSLGKGNLVSR-NGFYYATLTKVLNKYYKKPWNKRKAD  388

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQT  1424
             L+  YFN+PW  +S IAA  ++ LT  QT
Sbjct  389   LKQKYFNSPWRTVSLIAATLIIILTFIQT  417



>ref|XP_008371667.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
Length=431

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 162/453 (36%), Positives = 227/453 (50%), Gaps = 48/453 (11%)
 Frame = +3

Query  84    PIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENL  263
             P+  S+ +++  L  LS+  CI++V E LRR N  AYTP ++SIGP HHG   L  ME  
Sbjct  17    PLLTSMSKELHGLLPLSNSCCIYRVPEELRRVNEKAYTPQVVSIGPLHHGKEGLEDMEEH  76

Query  264   KLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDG  443
             K  YL  FL R    S+  C +K+KD + +    Y         +    D+FV+++L+D 
Sbjct  77    KKRYLKYFLDRTGV-SLAGCVQKIKDKEAELRGCYAHT------IGLCSDEFVRIILVDA  129

Query  444   CFIAEFLYReydeetkkeeeeelnkkkCDNNAVF-MPTGMKFQVFRDLLLLENQLPFFVL  620
              FI E L R      +             N+ +F  P  +KF +  D+LLLENQLP F+L
Sbjct  130   VFIIELLLRYEGYVVRD-----------SNDRIFNKPWLLKF-IVPDMLLLENQLPLFIL  177

Query  621   QELHGMV-YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK-GHLLQIVHN  794
             ++L        S P  LD+    F    T   +        G+      K  H + +V  
Sbjct  178   EDLFATAEVPASVPSVLDLF-YEFCKESTNFYM------EKGNWERPSFKVEHFVDLVR-  229

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                             TL  P           V +  + + T+L++AGV  K      +L
Sbjct  230   ----------------TLHLPTPEENLKNGESVETLAVPSMTKLRQAGVKFK-ARSGKNL  272

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             F I F    LEIPK +I D TE   RN+IA+EQ  C +N  YF+DY  LMDNL+NT  DV
Sbjct  273   FDICFKDGILEIPKLYIYDNTELVLRNLIAFEQCHCTRNTFYFSDYIILMDNLVNTPNDV  332

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
              L   NG++ + LGD+ EV+ L N L KG ++   D FYY+ +  +LN +Y KPWN   A
Sbjct  333   ELLVKNGIVEHLLGDNNEVSTLINSLGKG-LFVFRDEFYYATLLKELNIYYEKPWNKWKA  391

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
              L+  YFN+PW  IS IAA F++ LT+ QTV +
Sbjct  392   DLKQKYFNSPWTTISVIAATFIIILTLIQTVCS  424



>ref|XP_009353385.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=426

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/448 (36%), Positives = 227/448 (51%), Gaps = 45/448 (10%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S++ ++  L  LS   CI+KV E LR  N  AYTP  +SIGP HHG   L  ME  K+ Y
Sbjct  21    SMREELNGLTPLSDSCCIYKVPEVLRCVNEKAYTPRAVSIGPIHHGKEGLEDMEEHKMRY  80

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL R     +E   +KLK  + +  S Y         ++   DKFV+++L+D  FI 
Sbjct  81    LQYFLDRTGV-GLEDYVKKLKGKEAELRSCYAHP------IELCSDKFVRIILVDAAFII  133

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L R                    ++ +F    ++  V  D+LLLENQLPFF+L++L  
Sbjct  134   EHLLRSEGHVEPD-----------SHDRIFNKPWLRNYVEPDMLLLENQLPFFILEDLFA  182

Query  636   MV-YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
                   + P   D+   TF  + T + +        G +++ E+K H + ++        
Sbjct  183   TAEVPATMPSVFDL-SYTFCKVSTSLYVKREYS---GSSSSFEVK-HFVDLIR-------  230

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
                       TL  P           V +  + + T+L +AGV  K    S +LF I F 
Sbjct  231   ----------TLNLPTEEENSKNRGSVDTLAVPSMTKLHQAGVKFK-ARSSKNLFDICFK  279

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
             +  LEIP  +I+D TE   RN+IA+EQ  C      F+DY  LMDNL+NT  DV L   N
Sbjct  280   NGILEIPNLNISDDTEFALRNLIAFEQ--CHYGCSCFSDYVNLMDNLVNTPNDVELLVKN  337

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ + LGD+ EV+ L N LCKGV+ +  D FYY+ +   +N +Y KPWN   A L+  Y
Sbjct  338   GIVESMLGDNNEVSTLINSLCKGVLLTR-DDFYYATLAKDINDYYKKPWNKWKADLKQKY  396

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             FNTPW  IS IAA FL+ LT+ QTV ++
Sbjct  397   FNTPWTIISVIAATFLIILTLIQTVWSI  424



>ref|XP_006420142.1| hypothetical protein CICLE_v10004874mg [Citrus clementina]
 gb|ESR33382.1| hypothetical protein CICLE_v10004874mg [Citrus clementina]
Length=477

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 168/446 (38%), Positives = 233/446 (52%), Gaps = 60/446 (13%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV + LR+ N  AY P +++IGPYHHG  +LS  E  K  YL   L R  +P +    
Sbjct  68    IFKVPDVLRKLNEKAYEPKMLAIGPYHHGKEELSTFEVHKTRYLRELLDRTSKP-LPDYV  126

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
               ++  +E+A + YG        L    DKFV M+LLDGCFI E + +      +     
Sbjct  127   MAMRAMEERAKNCYGGS------LSLETDKFVLMMLLDGCFIVEVIRKFALTRLR-----  175

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY---DESKPKFLDIV  677
                     N+ +F  + M   + RD++LLENQLPFFVL EL  M     D+   KFL   
Sbjct  176   -------GNDPIFELSWMLPSIARDMILLENQLPFFVLWELFTMTKMPNDQDSDKFL---  225

Query  678   KITFASMLTKVRLIPPIVPNLGDNNAT----------EMKGHLLQIVHNLCNPQNGGIQE  827
                    L  +R    I+P  G    T          E+K HL+ ++H+   P + GI  
Sbjct  226   -------LMILRFFNGILPGKGCREDTVRRDNLYPINEIK-HLVHLIHDNWLPSSAGINA  277

Query  828   ERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAG--VNLKKVVKSSSLFHIKFNHAE  1001
              R+          GK + D     S I +AT +QEAG    + +V K  SLF IKF +  
Sbjct  278   FRNN---------GKNNSDW----SFICSATGIQEAGGQFGMFEVHKDDSLFDIKFENGV  324

Query  1002  LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVL  1181
             ++IP   ITD TET F+N+I +EQ S D N  +  DY +L+  LIN+ KD  L R  G++
Sbjct  325   MKIPSLEITDATETIFQNLITFEQCSQDINPKHVIDYVELLGCLINSSKDAELLRHRGII  384

Query  1182  VNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNT  1361
              N+LG+D+ +  L ++L  G V      FYY +V NK+N H ++  N  MA LRH+YFNT
Sbjct  385   DNFLGEDEVIVTLMHKLGDGAVLGK--QFYYWEVFNKVNFHRSRRRNKWMANLRHNYFNT  442

Query  1362  PWAGISTIAAVFLLSLTIAQTVIAVL  1439
             PWA IS +AA  +L LT+ Q + AVL
Sbjct  443   PWAIISVLAAFAILLLTMVQALFAVL  468



>ref|XP_010696171.1| PREDICTED: UPF0481 protein At3g47200-like [Beta vulgaris subsp. 
vulgaris]
Length=443

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 157/456 (34%), Positives = 239/456 (52%), Gaps = 43/456 (9%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             +S+++  + L  LSS+ CI++V   LR  N  AY P LISIGP +HG  +L  M+  KL 
Sbjct  28    KSIRKRFEKLPPLSSKCCIYRVPRTLRNVNLSAYKPCLISIGPLNHGMKRLQGMQEQKLR  87

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL  FL+R +  +++     +K  ++ A   Y   E I L    + ++FV+M+LLDGCFI
Sbjct  88    YLQNFLRRNEDKTLQDYLRMIKMWEKDARECYI--ESISL----SSNEFVEMMLLDGCFI  141

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EF    Y E               +++ +F    ++  + RDLLL+ENQLPFFVL+EL+
Sbjct  142   IEFFLNWYWETLD------------EDDRIFGKPSLEHVIRRDLLLIENQLPFFVLEELY  189

Query  633   GMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
              +V+D++   F     I    + ++V +    +PN           HL+  +     P++
Sbjct  190   SLVFDDNGECFQS--SIPLIHLTSEVVIGKRELPNKFKRREI---LHLVDFLRTYLLPKH  244

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
                        L  P  +   S+D            +L ++G+    + KS SL  I+F 
Sbjct  245   -----------LRDPNYVSTSSRDGAACWEFPPGVGDLHDSGIKFV-LHKSDSLLDIEFK  292

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQ---HSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
                L IPK  + D TE+   N+ AYEQ   HS    + Y  DY  +MD LI T KDV++ 
Sbjct  293   DGVLYIPKLEVEDHTESILLNLSAYEQCHYHS----DSYIVDYVLMMDVLITTLKDVDIL  348

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
               +G++ N LG++ EV +LFN +C+   Y +   FYY+D+C +L  H   PWN   A L+
Sbjct  349   LSSGIITNALGNNDEVANLFNTICRETNYEA-HNFYYTDICRRLVAHSKAPWNKWKATLK  407

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             HDYFN PW  IS +AA+ LL LT+ QT  +V+ L++
Sbjct  408   HDYFNNPWTIISVVAAIVLLILTVVQTGCSVIALKR  443



>ref|XP_009334803.1| PREDICTED: putative UPF0481 protein At3g02645 [Pyrus x bretschneideri]
Length=448

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 162/474 (34%), Positives = 236/474 (50%), Gaps = 67/474 (14%)
 Frame = +3

Query  84    PIYESLKRDIKN-LKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             P+  S+ +  +N L   S   CI++V E +R  N  AYTP ++SIGP+HHG   L +ME 
Sbjct  17    PLLTSMGQSQENDLPPSSDPCCIYRVPEPVRCVNEKAYTPQIVSIGPFHHGKEGLEEMEG  76

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL+R    S +    K+K  + +  S Y         ++ + +KFV+++L+D
Sbjct  77    HKRRYLQYFLERTGV-SEKDYVTKIKGKEAELRSCYAH------TIEFSSEKFVEIILVD  129

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI E L R   E  K +           N+ +F   G    +  D+LLLENQLPFF+L
Sbjct  130   AAFIIELLLRRDGEHIKPD----------SNDRIFYKPGFINFIVPDMLLLENQLPFFIL  179

Query  621   QELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
             ++L  +   E                         + P      AT++   +L + +  C
Sbjct  180   EDLFSLTKKEED-----------------------LFPTADQVPATKLS--VLDLSYKFC  214

Query  801   NPQNGGIQEERHYW---------------TLCFPCSLGKQSQDSKVGSSDIRTATELQEA  935
               ++ G   E+  W               TL  P + G   +  ++G   I  +T+L  A
Sbjct  215   K-KSTGFYMEKDNWKCPTSVVHHFVDLVRTLHLPTAKGNSEKGEQLGFLGIPPSTKLHRA  273

Query  936   GVNLKKVVKSSSLFHIKFNHAE--LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTD  1109
             GV  + V  S +LF I+FN  +  L+IP   I D TE   RN+IA+EQ  C  N+ +F+D
Sbjct  274   GVKFRPVRSSENLFDIRFNDQDGILKIPHLIIDDDTELVLRNVIAFEQCHCTPNSYFFSD  333

Query  1110  YAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVC-  1286
             Y  L+D+L+NT  DV L     ++ N LGD+ EV+ L NRLCKGVV+   D F Y+ +  
Sbjct  334   YIILIDHLVNTPNDVELLVKEEIVENLLGDNNEVSTLINRLCKGVVFDR-DKFSYAKLTR  392

Query  1287  ----NKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
                   LN +Y KPWN   A L+  YFNTPW  IS IAA FL+ LT+ QTV ++
Sbjct  393   DLDKTSLNKYYKKPWNKWKANLKQKYFNTPWTTISVIAATFLIILTLIQTVWSI  446



>ref|XP_007034456.1| Uncharacterized protein TCM_020392 [Theobroma cacao]
 gb|EOY05382.1| Uncharacterized protein TCM_020392 [Theobroma cacao]
Length=425

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 158/465 (34%), Positives = 244/465 (52%), Gaps = 49/465 (11%)
 Frame = +3

Query  66    GDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKL  245
               +++ P+  S+   +++L  LS + CI +V   LR+ N  AY P LI+IGPYHH    L
Sbjct  2     ATEREDPVSISIGEMLQSLSPLSPDCCIARVPNYLRKANEQAYEPELIAIGPYHHAKPHL  61

Query  246   SKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVK  425
               ME  K+ Y  L L+  ++  + +    ++  +EKA   Y D   ++       D FVK
Sbjct  62    KAMEEHKIRYFQLLLQERRENDVSRYVMIIRSLEEKARKCYSDPFALE------SDDFVK  115

Query  426   MLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQL  605
             MLLLDGCFI + + +  +   +            +++ +F    ++  + RD LL+ENQL
Sbjct  116   MLLLDGCFIVQLIRKFSEIRLRD-----------ESDPIFKLVSLRGTIRRDTLLVENQL  164

Query  606   PFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLG----DNNATEMKGH  773
             P FVL EL+ M+    +  F+ IV   F            I+P  G      N+  +  H
Sbjct  165   PLFVLWELYAMIEYPDQRTFMAIVFSFFCH----------ILPGEGWPQNSLNSIRVIKH  214

Query  774   LLQIVHNLCNPQNGGIQEERHYWTLCFPCSL-GKQSQDSKVGSSDIRTATELQEAGVNLK  950
             L+ +VH   +P                P  L   Q+ +  V  + I   TEL+EAG+  +
Sbjct  215   LVDLVHECWHPS---------------PLELKAYQNLNKNVPWNFIHCVTELKEAGIKFQ  259

Query  951   KVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDN  1130
              + + +SLF +KF +  ++IP   I D  E   RN+IA+EQ S  +   + TDY  L   
Sbjct  260   -MKRGNSLFDLKFENGTMKIPTLRIYDSLEGTLRNLIAFEQFSSHRGLNHVTDYVLLFHC  318

Query  1131  LINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYN  1310
             L+N+ KDV + R +G++ N LGDD+EV  + NRL   V +S  D FYYS++ NK+N + +
Sbjct  319   LVNSTKDVEILRQSGIIENMLGDDEEVARMLNRLGVSVFFSP-DNFYYSELFNKVNKYCD  377

Query  1311  KPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             + WN  +A L+H+Y N+PWA IS +AAV LL LT+ QT+ +VL  
Sbjct  378   RRWNKWIANLKHNYLNSPWALISFLAAVVLLLLTLVQTIFSVLSF  422



>ref|XP_011069627.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
Length=432

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 161/445 (36%), Positives = 234/445 (53%), Gaps = 41/445 (9%)
 Frame = +3

Query  120   LKQLSSEAC---IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             L +L S  C   IF+V+  +R TN   Y P +ISIGP+HHG   L  ME  K  YL L L
Sbjct  16    LLELPSSRCKPSIFRVNNDIRYTNEKLYVPKVISIGPFHHGKDHLRDMEQHKFRYLKLLL  75

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             KR  + S+++    ++  ++KA   Y         ++ + + FV+MLLLDGCFI E + +
Sbjct  76    KRRNESSVDKYVMAMRSLEQKARKCYAGP------VEFSPEDFVQMLLLDGCFIVELIRK  129

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE  650
                +E ++            ++ VF    +  Q+  DL+L+ENQ+PFFV+ +L  M    
Sbjct  130   YGMDEWRE-----------SDDIVFQYEQVLSQLRHDLMLVENQVPFFVVDQLFSMTRTG  178

Query  651   SKPKFLDIVKITFASMLTKVRLIP-PIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQE  827
             +         I F   L    + P P    +  N + +   HLL +V+ +       I  
Sbjct  179   NPDD-----HILFLMQLFIGDISPWPEASEMTGNISVKNVDHLLGLVYTIWCSSFAKITA  233

Query  828   ERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELE  1007
              R       P  + ++          I +ATELQEAG+ L++  +S+ L  IKF    + 
Sbjct  234   NR-------PIEILEEEHKMVA----INSATELQEAGIKLEQDTESNCL-DIKFIKGVIR  281

Query  1008  IPKFHITDPTETFFRNMIAYEQHSCDKN-NMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
             IP  +++D TE+ FRN++AYE    DKN + Y TDYA  +  LIN+  DV + R +G+L 
Sbjct  282   IPGLNVSDETESIFRNIMAYEHFLIDKNQSKYVTDYAFFLHCLINSSNDVEILRRHGILT  341

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
             N LGDD+ V  +FNRL   ++ S    F Y+DV  K+N +Y + WN  MA LR +YFNTP
Sbjct  342   NLLGDDEMVYHMFNRLGTNILMSP--HFCYADVYKKVNEYYGRRWNKWMANLRRNYFNTP  399

Query  1365  WAGISTIAAVFLLSLTIAQTVIAVL  1439
             WA IS  AA+ LLS T  QTV  VL
Sbjct  400   WAYISFFAALILLSFTFIQTVFTVL  424



>ref|XP_009353391.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
 ref|XP_009353396.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=439

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 157/458 (34%), Positives = 232/458 (51%), Gaps = 35/458 (8%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             +P+  S+++ +++L  LS   CI++  + LR  N  AYTP ++SIGP HHG   L  ME 
Sbjct  11    IPLVTSVEKALEDLPVLSDSCCIYRTPQRLRFANEKAYTPQVVSIGPIHHGKEGLEDMEE  70

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL+R K  S+E   +K+K  + +  S Y    ++      + D+F +++L+D
Sbjct  71    HKTRYLQYFLRRSKV-SLEDYVKKIKGKEAELRSCYAHTFEL------SSDEFARIILVD  123

Query  441   GCFIAEFLYReydeetkkee---eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPF  611
               FI E L R                   K   N+ +F    +   +  D+LLLENQLPF
Sbjct  124   AAFIIELLLRCCSLIEPDSNRCCSVIKPDKPDSNDRIFNKPWLMLDIAPDMLLLENQLPF  183

Query  612   FVLQELHGMVYDESKPKFLDIVKIT--FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQI  785
             F+L++L   +  E  P  + +++++  F    T + +    + ++   +      H + +
Sbjct  184   FILKDLFATL--EVPPTNVSVLELSYWFCKQSTSLHVGKDQLESILCRDPCFTVKHFVDL  241

Query  786   VHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
             +  L  P      E R                   V S  I + T+L +AGV   +V  S
Sbjct  242   IRTLHLPAEAKNSENR-----------------GSVESLAIPSLTKLHQAGVKF-EVSSS  283

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
              +LF I F    LE PK  I D TE   RN+IA+EQ  C  +  +FTDY  LMDNL+NT 
Sbjct  284   KNLFDISFQDGTLEFPKLEIDDYTEQALRNLIAFEQ--CHLSRKHFTDYIFLMDNLVNTS  341

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
              DV L   NG++ N LGD+ EV+ L N L KG V  +   FY++ +   LN +Y KPWN 
Sbjct  342   NDVELLVKNGIVENLLGDNNEVSTLINSLGKG-VEGNKKNFYFATLSKALNKYYEKPWNK  400

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
               A+LR  YF TPW  IS IAA F++ LT+ QTV  V+
Sbjct  401   SKAELRQKYFETPWKTISVIAATFIIILTLIQTVWTVV  438



>ref|XP_007224381.1| hypothetical protein PRUPE_ppa021638mg [Prunus persica]
 gb|EMJ25580.1| hypothetical protein PRUPE_ppa021638mg [Prunus persica]
Length=459

 Score =   238 bits (607),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 160/470 (34%), Positives = 243/470 (52%), Gaps = 43/470 (9%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             +P+  S+++++  L  +SS  CI++V E  RR N +AYTP ++SIGP HHG   L  ME 
Sbjct  17    IPLETSMRQELGRLSPISSSCCIYRVPERFRRVNENAYTPQVVSIGPLHHGKKGLEAMEE  76

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL R K  S+E C +K++D + +  S Y +          + D+FV+++L+D
Sbjct  77    HKKRYLQEFLCRTK-VSLEDCIKKIRDREARLRSCYAETNGF------SSDEFVRIILVD  129

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI E L +       K           +N+A+F    +   +  D+ LLENQLP F+L
Sbjct  130   AAFIVELLLKHNGRTPIK-----------ENDAIFKKPKIILDLETDMQLLENQLPIFIL  178

Query  621   QEL----HGMVYDESKPKF----LDIVKITFASMLTKVRLI--PPIVPNLGDNNATEMKG  770
             ++L     G +  +S  +      D+    F S +T +R      I+  L      E   
Sbjct  179   EDLFYLQQGTLPSDSDDRLSTFVTDLSLKFFTSRMTLMRDADQESILDRLSSTKKVE---  235

Query  771   HLLQ-IVHNLCNPQNG----GIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEA  935
             H L  I+ +LC  +      G Q E     L +  +  +    + V  S   + TEL +A
Sbjct  236   HFLDLILRSLCQSEVELIPLGCQSEVELIPLGYVTTTTRVK--TSVTPSLTPSVTELYQA  293

Query  936   GVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYA  1115
             GV   KV    +LF I+F +   EIPK  + D TE   RN++A+EQ  C   + +  DY 
Sbjct  294   GVEF-KVGSMKNLFDIRFTNGICEIPKIRVDDDTEISLRNLLAFEQ--CHYMHNHICDYM  350

Query  1116  QLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKL  1295
              +MD  +N   DV+L    G++ N LGD KE++ LFN L  G+   S + F ++ +C  L
Sbjct  351   TIMDGFVNNAIDVDLLVERGIIENILGDRKELSALFNNLGLGIC--SDENFTFASLCEDL  408

Query  1296  NGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             N +Y+   + MMA LRH+YFNTPW  +S IAAV LL LT+ QTV +++ +
Sbjct  409   NRYYSSKRHKMMANLRHNYFNTPWRTLSVIAAVVLLILTLIQTVCSIISV  458



>ref|XP_006489552.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Citrus 
sinensis]
Length=440

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 162/436 (37%), Positives = 232/436 (53%), Gaps = 39/436 (9%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV + LR+ N  AY P +++IGPYHHG  +LS  E  K  YL   L R  +P +    
Sbjct  30    IFKVPDVLRKLNEKAYEPKMLAIGPYHHGKEELSTFEVHKTRYLRELLDRTSKP-LPDYV  88

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
               ++  +E+A + YG        L    DKFV M+LLDGCFI E + +      +     
Sbjct  89    IAMRAMEERAKNCYGGS------LSLETDKFVLMMLLDGCFIVEVIRKFALTRLR-----  137

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG---MVYDESKPKFLDIV  677
                    D++ +F  + M   + RD++LLENQLPFFVL +L     M  + +   FL ++
Sbjct  138   ------GDDDPIFKLSWMLPSIARDMILLENQLPFFVLWKLFTITKMPNNSNDDNFLLMI  191

Query  678   KITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFP  857
                F  +L         V    D    E+K HL+ ++H+   P + GI   R+       
Sbjct  192   LRFFNGILPGKGCRRDDVYRDKDYRINEVK-HLVHLIHDNWLPSSAGINAFRNN------  244

Query  858   CSLGKQSQDSKVGSSDIRTATELQEAGVNLK--KVVKSSSLFHIKFNHAELEIPKFHITD  1031
                GK + D +     I +A  +QEAGV  +  +V K  SLF IKF +  ++IP   ITD
Sbjct  245   ---GKNNSDWRF----ICSAIGIQEAGVQFEMFEVHKDDSLFDIKFENGVMKIPSLEITD  297

Query  1032  PTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
              TET F+N+I +EQ S D N  +  DY +L+  LIN+ KD  L R  G++ N+LGDD+ +
Sbjct  298   ATETIFQNLITFEQCSQDINPKHVIDYVELLGCLINSSKDAELLRHRGIIDNFLGDDEVI  357

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAA  1391
               L ++L  G V      FYY +V NK+N H ++  N  MA LRH+YF+TPWA IS +AA
Sbjct  358   VTLIHKLGDGAVLGK--QFYYWEVFNKVNFHRSRRRNKWMANLRHNYFSTPWAIISVLAA  415

Query  1392  VFLLSLTIAQTVIAVL  1439
               +L LT+ Q + AVL
Sbjct  416   FAILLLTMLQALFAVL  431



>ref|XP_007034457.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007034458.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05383.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05384.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=418

 Score =   236 bits (602),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 243/463 (52%), Gaps = 46/463 (10%)
 Frame = +3

Query  63    EGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             E ++ D P+   + + ++ +  +SS+ CIFKV   LR+ N  AY P +++IGP+H G   
Sbjct  2     EAERVD-PVAVRIGQKLQAISPISSDCCIFKVPNYLRKVNEKAYEPEVVAIGPFHRGKDH  60

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME  K+ +L L L+   +  + +    +++ +E+A   Y +     + LDS G  FV
Sbjct  61    LKPMEERKIRFLQLILQERGENDITKYVVVMRELEERARKCYAE----PVSLDSDG--FV  114

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +M+LLDGC I + + +     +              ++ +F  +G    + RD+LL+ENQ
Sbjct  115   EMMLLDGCLIIQLIRKSARTTSI-------------DDPIFKMSGFHGILCRDMLLIENQ  161

Query  603   LPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQ  782
             LP FVL EL  ++    + +F+D +   F  +L     I   + ++ +N       HLL 
Sbjct  162   LPLFVLWELFCVIAVPREDRFIDDIIKFFTVVLPGKGCIRKSLRSITENK------HLLG  215

Query  783   IVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVK  962
             ++++  +P                  +   + +   +  S +  ATEL+EAG+  KKV +
Sbjct  216   LIYDCWHPS-----------------AFEMEVKTKTIECSFMHCATELKEAGIRFKKV-E  257

Query  963   SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
               S+F IKF +  ++IP   I D TE F RN+IAYEQ     +  + TDY   MD LIN+
Sbjct  258   GRSIFDIKFENGTMKIPTLEIDDDTEWFLRNVIAYEQFFSGSSLNHVTDYMNFMDCLINS  317

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
              KDV + R  G++ NWLGDD+ +  +FNRL   V   +     YS+V N +N + +  WN
Sbjct  318   RKDVEILRQRGIVKNWLGDDEVIATMFNRLGDSVTIPAFS--LYSEVFNNVNMYCSGRWN  375

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
                A L+H+YFN+PWA +S +AAV  L LT+ Q V +VL   K
Sbjct  376   KRFANLKHNYFNSPWAFLSFLAAVLFLLLTMVQAVFSVLSYVK  418



>ref|XP_010696170.1| PREDICTED: UPF0481 protein At3g47200-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 153/467 (33%), Positives = 245/467 (52%), Gaps = 39/467 (8%)
 Frame = +3

Query  87    IYE---SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKME  257
             IYE   S++R IKNL  LS   CI+K+ + L+  N  AYTP LISIGP+H+G  KL  M+
Sbjct  7     IYELATSIRRRIKNLPPLSPNCCIYKIPQTLKEPNKLAYTPCLISIGPFHYGKKKLESMQ  66

Query  258   NLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLL  437
               KL YL  FL R  + ++    + +K  +E+   YY   E+I+L    +  +F +M+LL
Sbjct  67    KHKLRYLQNFLARNTKKTLLDYLKCIKQWEEELREYYV--ENIEL----SSKEFNEMVLL  120

Query  438   DGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFV  617
             DGCF+ EF      +++             + + +F    ++  + RD+LLLENQLP+FV
Sbjct  121   DGCFLIEFFLVWLFDKSD------------ETDGIFKKPSLEVAIMRDILLLENQLPYFV  168

Query  618   LQELHGMVYDESKPKFLDIVKITFASMLTKVR------LIPPIVPNLGDNNATEMKGHLL  779
             L  L+ +V+ +       +     A+            ++ PI P L D     + G   
Sbjct  169   LDGLYNIVFGDDNLVSSQVKNPVSATDDDIDDNEDKNDVVRPI-PTLIDLCCLVLVGRR-  226

Query  780   QIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIR---TATELQEAGVNLK  950
             ++   L + Q   + +       C+  SL +   D      ++        L +AG+  +
Sbjct  227   EVSEKLNDHQVLHLVD---LMRTCYLPSLLRHPSDDSDEQDNLEFPPGVERLHDAGIKFE  283

Query  951   KVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKN-NMYFTDYAQLMD  1127
                   +L +I+FN   L IP+  + D TE+   N+ A+EQ  C  + + Y  DY  LMD
Sbjct  284   VAKNEQTLLNIEFNKGVLSIPRLEMEDHTESLLLNLSAFEQ--CHYHFDSYIVDYVVLMD  341

Query  1128  NLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHY  1307
              LI++ KDV++    G++ N LG+ +E+ ++FN +C+G  Y + + F+YS +C +LN +Y
Sbjct  342   VLISSLKDVDILMSGGIIENSLGNKEELAEVFNTICRGTTYQA-NRFFYSHLCKELNAYY  400

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
             N PW+   A L+HDYF+ PW  IS IAAV LL LT+ QT   ++ ++
Sbjct  401   NTPWHRWRATLKHDYFSNPWTIISVIAAVMLLILTVIQTYCTIISMK  447



>ref|XP_006489551.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Citrus 
sinensis]
Length=514

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 162/436 (37%), Positives = 232/436 (53%), Gaps = 39/436 (9%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV + LR+ N  AY P +++IGPYHHG  +LS  E  K  YL   L R  +P +    
Sbjct  104   IFKVPDVLRKLNEKAYEPKMLAIGPYHHGKEELSTFEVHKTRYLRELLDRTSKP-LPDYV  162

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
               ++  +E+A + YG        L    DKFV M+LLDGCFI E + +      +     
Sbjct  163   IAMRAMEERAKNCYGGS------LSLETDKFVLMMLLDGCFIVEVIRKFALTRLR-----  211

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG---MVYDESKPKFLDIV  677
                    D++ +F  + M   + RD++LLENQLPFFVL +L     M  + +   FL ++
Sbjct  212   ------GDDDPIFKLSWMLPSIARDMILLENQLPFFVLWKLFTITKMPNNSNDDNFLLMI  265

Query  678   KITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFP  857
                F  +L         V    D    E+K HL+ ++H+   P + GI   R+       
Sbjct  266   LRFFNGILPGKGCRRDDVYRDKDYRINEVK-HLVHLIHDNWLPSSAGINAFRNN------  318

Query  858   CSLGKQSQDSKVGSSDIRTATELQEAGVNLK--KVVKSSSLFHIKFNHAELEIPKFHITD  1031
                GK + D +     I +A  +QEAGV  +  +V K  SLF IKF +  ++IP   ITD
Sbjct  319   ---GKNNSDWRF----ICSAIGIQEAGVQFEMFEVHKDDSLFDIKFENGVMKIPSLEITD  371

Query  1032  PTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
              TET F+N+I +EQ S D N  +  DY +L+  LIN+ KD  L R  G++ N+LGDD+ +
Sbjct  372   ATETIFQNLITFEQCSQDINPKHVIDYVELLGCLINSSKDAELLRHRGIIDNFLGDDEVI  431

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAA  1391
               L ++L  G V      FYY +V NK+N H ++  N  MA LRH+YF+TPWA IS +AA
Sbjct  432   VTLIHKLGDGAVLGK--QFYYWEVFNKVNFHRSRRRNKWMANLRHNYFSTPWAIISVLAA  489

Query  1392  VFLLSLTIAQTVIAVL  1439
               +L LT+ Q + AVL
Sbjct  490   FAILLLTMLQALFAVL  505



>ref|XP_006489608.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis]
Length=441

 Score =   235 bits (599),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 165/442 (37%), Positives = 231/442 (52%), Gaps = 62/442 (14%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IFKV + LR+ N  AY P +++IGPYHHG  +LS  E  K  YL   L R  +P +    
Sbjct  30    IFKVPDVLRKLNEKAYEPKMLAIGPYHHGKEELSTFEVHKTRYLRELLHRTSKP-LPDYV  88

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
               ++  +E+A + YG        L    DKFV M+LLDGCFI E + +      +     
Sbjct  89    TAMRAMEERAKNCYGGS------LSLETDKFVLMMLLDGCFIVEVIRKFALTRLR-----  137

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY---DESKPKFLDIV  677
                     N+ +F  + M   + RD++LLENQLPFFVL EL  M     D+   KFL   
Sbjct  138   -------GNDPIFELSWMLPSIARDMILLENQLPFFVLWELFTMTKIPNDQDSDKFL---  187

Query  678   KITFASMLTKVRLIPPIVPNLGDNNAT----------EMKGHLLQIVHNLCNPQNGGIQE  827
                    L  +R    I+P  G    T          E+K HL+ ++H+   P   GI+ 
Sbjct  188   -------LMILRFFNGILPGKGCRKDTVRRDNLYPINEIK-HLVHLIHDNWLP--SGIEA  237

Query  828   ERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLK--KVVKSSSLFHIKFNHAE  1001
              R+          GK++ D     S I +AT +QEAG+  +  +V K  SLF IKF +  
Sbjct  238   FRNN---------GKKNSDW----SFICSATGIQEAGIQFQMFEVHKDDSLFDIKFENGV  284

Query  1002  LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVL  1181
             + IP   ITD TET F+N+I +EQ S D N  +  DY +L+  LIN+ KD  L R  G++
Sbjct  285   MMIPSLEITDATETIFQNLITFEQCSQDINPKHVIDYVELLGCLINSSKDAELLRHRGII  344

Query  1182  VNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNT  1361
              N+LGDD+ +  L ++L  G V      FYY +V NK+N H ++  N  MA LRH+YF+T
Sbjct  345   DNFLGDDEVIVTLIHKLGDGAVLGK--QFYYWEVFNKVNFHRSRRRNKWMANLRHNYFST  402

Query  1362  PWAGISTIAAVFLLSLTIAQTV  1427
             PWA IS +AA  +L LT+ Q +
Sbjct  403   PWAIISVLAAFAILLLTMLQAL  424



>ref|XP_008337123.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
Length=417

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 225/446 (50%), Gaps = 47/446 (11%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             + R+++ L  LS+  CIF++ E LRR N  AYTP ++SIGP HHG   L  ME  K  YL
Sbjct  1     MSRELEGLPPLSNLGCIFRIPEELRRVNEKAYTPQVVSIGPLHHGKEGLKDMEEHKRRYL  60

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
               FL R K P +     K+K  + +  S Y   + I+L    + D+FV+++L+D  FI E
Sbjct  61    RYFLDRTKVP-LADYVTKIKGREAELRSCYA--QTIEL----SSDEFVRIILVDAAFIIE  113

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
             FL R  D   +             N+ +F    +   V  DLLLLENQLPFFVL++L   
Sbjct  114   FLLRFLDPIKRD-----------SNDRIFHKPWLVNSVLPDLLLLENQLPFFVLEDLFAA  162

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK-GHLLQIVHNLCNPQNG  815
                E KP   D+    F +  T        V      ++  +K  H + ++  L  P + 
Sbjct  163   ---EEKPSVFDL-SCQFCNESTS-----SYVQRDNSKSSXXLKVDHFVDLIRALNLPTD-  212

Query  816   GIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNH  995
               +EER                   V +  + + T+L +AG+  KK   + +LF + F  
Sbjct  213   --EEER--------------DNRGSVKTLAVPSMTKLHQAGIKFKKR-SNKNLFAMCFKD  255

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               LEIP   I D TE   RN+IA+EQ  C +   +  DY  LMD+ +NT  DV+L   NG
Sbjct  256   GILEIPNLMIXDNTELVLRNLIAFEQFRCTEXTRHXIDYIILMDSFVNTPNDVDLLVKNG  315

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++   LGD+ EV+ L N L KGVV+     FYY+ +   LN +Y KPWN     LR  YF
Sbjct  316   IVETMLGDNSEVSTLINSLGKGVVFER-KHFYYAKLTEGLNKYYKKPWNKWKGDLRQKYF  374

Query  1356  NTPWAGISTIAAVFLLSLTIAQTVIA  1433
             ++PW  +S IAA  ++ LT  QT+ +
Sbjct  375   HSPWTTVSVIAATLIIILTFIQTLCS  400



>ref|XP_010040032.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=438

 Score =   234 bits (598),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 165/473 (35%), Positives = 255/473 (54%), Gaps = 50/473 (11%)
 Frame = +3

Query  33    QRQ*GMIENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLIS  212
             +++ G    +E D     +  S+KR ++ L  LS + CIF V E LR+TN  AYTP +++
Sbjct  14    KKEDGRAGTSESDCHLDEVEFSIKRKLEGLSPLS-DCCIFTVPERLRQTNEKAYTPCIVA  72

Query  213   IGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQL  392
             IGPYHH N+ L  MEN KL+YL  FL   +   +++  +++K  +  A + Y    D ++
Sbjct  73    IGPYHHLNSSLMPMENHKLLYLQNFLLYNQNYRLKEYIQRVKSWENDARNSY----DKKI  128

Query  393   LLDSAGDKFVKMLLLDGCFIAE-FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQ  569
              LDS  +KF +M+LLDG F+ + FL ++ +                 N+ +F    M   
Sbjct  129   NLDS--NKFAEMILLDGIFVIQLFLMKQNNGFRL------------PNDQIFGKPWMLTD  174

Query  570   VFRDLLLLENQLPFFVLQELHGMVYD-ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGD  746
             +  D+ LLENQ+PFF++Q+L  M +     P  L +V  +F  + T++  +P  V     
Sbjct  175   IRSDMALLENQMPFFIVQKLFYMAFGPHHSPTLLQLV-WSFFELTTEMGHLPWWVVE---  230

Query  747   NNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATEL  926
                +E+K H L ++                   L F  S+     +S+V +   ++ATEL
Sbjct  231   ---SEVK-HFLDVIR------------------LSFLPSVRMTPNESQVKTEFTQSATEL  268

Query  927   QEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFT  1106
              +AGV L++  KS+ LF I+F +  L IP+  + D TE++FRN+IA+EQ     N+ Y  
Sbjct  269   VKAGVKLRR-GKSNCLFDIEFKNGVLNIPELKLFDITESYFRNIIAFEQ-CYHYNDRYLI  326

Query  1107  DYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVC  1286
             DY   MD+L++T+ D  L     ++ NWL + K V DL N LC+ V  S   G+Y++++ 
Sbjct  327   DYLAFMDSLVDTQYDAKLLIEERIINNWLSNKKAVADLINSLCEKVTLSK-PGYYFNNLS  385

Query  1287  NKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               LN H  K  N   A  +H+Y + PWA IS IAAV LL LT AQTV +V+ L
Sbjct  386   IDLNNHCKKSCNKWKATFKHEYCSNPWAVISVIAAVVLLLLTAAQTVCSVISL  438



>ref|XP_002515544.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46993.1| conserved hypothetical protein [Ricinus communis]
Length=439

 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 152/460 (33%), Positives = 236/460 (51%), Gaps = 62/460 (13%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+K  ++NL  +SSE CI++V + +R  N +AYTP L+SIGP+HHG   L  ME  K  +
Sbjct  26    SMKSRLENLSPVSSERCIYRVPKRIRDVNHNAYTPRLVSIGPFHHGKPGLKAMEEHKWRH  85

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL R+ +  ++   + +KD +E+A + Y   E I L      D+FV++L++D  F  
Sbjct  86    LQNFL-RQTRVKLDDLVKFIKDREERARNCYA--ETIAL----TSDEFVQILIVDATFTI  138

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             + L             + + +  C    V+  + + F ++RD+LL+ENQLP+F+L    G
Sbjct  139   DIL-----------LGKVIPQLTCAIECVYDRSSLMFDIYRDMLLIENQLPYFIL----G  183

Query  636   MVYDESK----------PKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQI  785
              + D +K          P  L++ ++ F S +   R   P+       +        L++
Sbjct  184   DILDFAKSIAASGSSQWPSILELTRVYFNSYMQLGRASHPM-----RRSEVNHFVDFLRL  238

Query  786   VHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
              H    P+    +  +   T                     R++TEL+EAGV  K V  +
Sbjct  239   CHQPIKPRQTPRENRKFEMT---------------------RSSTELREAGVKFK-VAST  276

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
             + L  I+FN   LEIP   +++ TE FFRN+IA+EQ  C  +  Y +DY  +MD+LINT 
Sbjct  277   THLLDIQFNDGVLEIPYIRVSEITEAFFRNLIAFEQ--CHCHTSYISDYIVIMDSLINTP  334

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
              DV +    G++   L ++ E + LFN L K ++Y S   FYYS +C  LN      W+ 
Sbjct  335   HDVEVLVKYGIMKVMLANNVEASTLFNNLAKEILYDS-HVFYYSLLCEDLNTFCKVRWHR  393

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               A L+H+YFNTPW  IS IA V LL LT  Q V +++ +
Sbjct  394   WKATLKHNYFNTPWTAISVIAGVILLVLTFIQAVCSIIQV  433



>gb|ACH87183.1| unknown protein [Camellia sinensis]
Length=417

 Score =   233 bits (595),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 156/434 (36%), Positives = 232/434 (53%), Gaps = 50/434 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             +E  IF++HE LR+ N  AY P +ISIGPYH G   L  ME  KL Y    L+ EK  S 
Sbjct  26    TEFFIFRLHEELRQLNDKAYDPEIISIGPYHRGKQNLQMMERHKLRYFHSLLQ-EKNLSP  84

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             E     +   +  A  +Y +     + LDS  D+ +KM++LDGCFI E L +   E  + 
Sbjct  85    EDFVYAIGSLELHACDFYAE----PISLDS--DEMIKMMVLDGCFIIELLRKFDMEFLRD  138

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                        +N+ +F    +  ++ RDL+L ENQ+PFFVL +L  M+      K L  
Sbjct  139   -----------ENDPIFKRDWIFNRLQRDLMLFENQIPFFVLCKLFDMIEAPGNHKRLIY  187

Query  675   VKITFASMLTKVRLIPPIVPNLGDN-NATEMKG---HLLQIVHNLCNPQNGGIQEERHYW  842
             + + F S L         +P  G   +  E +G   HLL ++H+  +P   G++      
Sbjct  188   LALRFFSDL---------LPGTGKREDGKESQGKISHLLGLIHSNWHPSFAGVE------  232

Query  843   TLCFPCSLGKQSQDSKVGSSDIR---TATELQEAGVNLKKV-VKSSSLFHIKFNHAELEI  1010
                 P     +   +K G  + R   +  ELQE+GV ++K  V   SLF I+F +  ++I
Sbjct  233   ----PV----EDASNKKGKGNWRFIPSTRELQESGVKIEKFEVTGGSLFDIEFKNGVMQI  284

Query  1011  PKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNW  1190
             P   I   TE+FFRN+IAYEQ+S D    Y  DY + +D LI++ KDV +    G++ NW
Sbjct  285   PPLTIEGRTESFFRNLIAYEQYSPDNQFSYVADYVKFLDFLIDSPKDVKILSRRGIIDNW  344

Query  1191  LGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
             LGDD+ V++LFN++   V  +S   F Y+D+ N++N H ++PWN+  A L  +YFN PWA
Sbjct  345   LGDDEAVSNLFNKISDTVSGTSMH-FRYADIFNRVNIHCSQPWNLYRATLNRNYFNNPWA  403

Query  1371  GISTIAAVFLLSLT  1412
              I+ +A + LL LT
Sbjct  404   MIAIMARLVLLLLT  417



>ref|XP_006360882.1| PREDICTED: UPF0481 protein At3g47200-like [Solanum tuberosum]
Length=684

 Score =   239 bits (610),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 239/456 (52%), Gaps = 72/456 (16%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             A IF+V+ GLR++N+DAYTP+ + +                                 E 
Sbjct  269   ATIFRVNMGLRKSNSDAYTPIGVDV---------------------------------ES  295

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
             C   L+  K++A   Y D+ D  ++     D F++MLLLDGCF+ EF+ REY    +KEE
Sbjct  296   CISALEKKKDEALKCYDDNLDNDIV-----DNFLEMLLLDGCFVVEFI-REYYATEEKEE  349

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
             E++  ++  DN  +     MK QV RD++LLENQLPFFVL  LH M     +  FL +V+
Sbjct  350   EDQEEEEDNDN--IINLEWMKKQVCRDMVLLENQLPFFVLTMLHDMTKHHKEVSFLYMVR  407

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNP------------QNGGIQ  824
              T      K + IPP   +   N  TE   HL+ ++H  C P            +N    
Sbjct  408   KTLLDTFPKAKFIPP---SEIHNFNTERFNHLVHVIHMFCRPSDHHDGMKDKQNKNASTP  464

Query  825   EERHYWTLCFPC-SLGKQSQDSKV-GSSD---IRTATELQEAGVNLKKV-------VKSS  968
             +E    T C     L K  +  KV G  D   I + TEL +AGV   +V          +
Sbjct  465   KECCKITFCDNVLQLTKSKETPKVLGLWDCYHIPSVTELYDAGVRFIRVGYVQEKKEDKT  524

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNM-YFTDYAQLMDNLINTE  1145
             +LF IKF    ++IP F I D  ETF RN+IAYEQHS   +   YF++YA +M  LI + 
Sbjct  525   TLFDIKFEKGLMKIPCFAIEDTMETFMRNLIAYEQHSSKVDVYPYFSNYAHIMTQLIGSH  584

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             +DV   R   +++  +GDDK+V  +F +L  GV  +S   FYY   C+KL  H +KPW+ 
Sbjct  585   RDVKFLRKEKIILKDIGDDKQVASIFKKLSDGVEITS---FYYIKECSKLIQHCDKPWSQ  641

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             M A LRH+YF++PW G ST+AA+ LL LT+ QTV+A
Sbjct  642   MKASLRHNYFSSPWVGASTVAAITLLVLTVIQTVLA  677


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 13/91 (14%)
 Frame = +3

Query  48   MIENTEGDQQDLPIYESLKRDIKNLKQ--------LSSEACIFKVHEGLRRTNTDAYTPL  203
            +IE  E + QD  + +++K   +   +            A IF+V+  LR++N DAYTP+
Sbjct  112  LIEIKETNGQDQLVLQTMKSANQTFDEKFKYLDNTCIKSATIFRVNMELRKSNPDAYTPI  171

Query  204  LISIGPYHHGNAKLSKMENLKLMYLDLFLKR  296
            LISIGPYH  N +LS ME  K     LFLKR
Sbjct  172  LISIGPYHKRNHELSSMEKYK-----LFLKR  197



>ref|XP_006360880.1| PREDICTED: UPF0481 protein At3g47200-like [Solanum tuberosum]
Length=430

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 160/404 (40%), Positives = 223/404 (55%), Gaps = 42/404 (10%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
             A IF+V+ GLR++N+DAYTP+LISIGPYH  N +LS ME  KL+YL  FL+R++   +E 
Sbjct  32    ATIFRVNMGLRKSNSDAYTPMLISIGPYHKRNHELSLMEKYKLLYLQRFLQRKEGLDVES  91

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
             C   LK  K++A   Y D+ D  ++     D F++MLLLDGCF+ EF+   Y  E K+EE
Sbjct  92    CISALKKKKDEALKCYDDNLDNDIV-----DNFLEMLLLDGCFVVEFIREYYATEEKEEE  146

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
             ++E +     N        MK QV RD++LLENQLPFFVL  LH M     +  FL +V+
Sbjct  147   DQEEDNDNIIN-----LEWMKKQVCRDMVLLENQLPFFVLTMLHDMTKHHKEVSFLYMVR  201

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNP------------QNGGIQ  824
              T      K + IPP+  +   N  TE   HL+ ++H  C P            +N    
Sbjct  202   KTLLDTFPKAKFIPPLEIH---NFNTERFNHLVHVIHMFCRPSDHHDGMKDKQNKNASTP  258

Query  825   EERHYWTLCFPC-SLGKQSQDSKV-GSSD---IRTATELQEAGVNL-------KKVVKSS  968
             +E    T C     L K  +  KV G  D   I + TEL +AGV         +K    +
Sbjct  259   KECCKITFCDNVLQLTKSKETPKVLGLWDCYHIPSVTELYDAGVRFIRIGYVQEKKEDKT  318

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNM--YFTDYAQLMDNLINT  1142
             +LF IKF    ++IP F I D  ETF RN+IAYEQHS +K ++  YF++YA +M  LI +
Sbjct  319   TLFDIKFEKGIMKIPCFAIEDTMETFMRNLIAYEQHSSNKVDVYPYFSNYAHIMTQLIGS  378

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYY  1274
              +DV   R   ++   +GDDK+V  +F +L  GV  ++   FYY
Sbjct  379   HRDVKFLRKKKIIFKDIGDDKQVASIFKKLSDGVEITN---FYY  419



>emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera]
Length=439

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 153/456 (34%), Positives = 238/456 (52%), Gaps = 51/456 (11%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+   + +L  L S+ CI++V + LRR N +A+ P ++SIGP HHG  +L  ME  K  Y
Sbjct  27    SINEKLSSLTSLPSQCCIYRVPDTLRRVNEEAFVPRILSIGPVHHGKKRLRDMEGHKWQY  86

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L   L+R+    +E+  + +++ + +    Y +      ++    D+FV M+LLDGCFI 
Sbjct  87    LKALLQRKPGTMVERYVKAMRELEARTRGCYAE------IIKFDSDEFVTMMLLDGCFII  140

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E   +  +++ +            +++ +F  T +   + RDL+LLENQLPFFVL+ L  
Sbjct  141   ELFLKNKNKQLRD-----------EDDPIFNRTMVLTDLHRDLILLENQLPFFVLETLFN  189

Query  636   MV--YDESKP--KFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN  803
             ++   D+  P    L++  + F  +  +  LI    P++          HLL ++     
Sbjct  190   LIENTDQEGPSTSVLELTYVFFKFLGLQEVLIRDSQPDV---------KHLLDLLRLWFV  240

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
             P +      +  + L                   IR+ TEL EAGV   ++   S L  I
Sbjct  241   PPSSTKSTSKSKFEL-------------------IRSVTELHEAGVKF-RMGTVSCLMEI  280

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
             KF +  LEIP   I D T++   N+IA+EQ        Y TDY  LM+ LIN+ KDV L 
Sbjct  281   KFINGVLEIPPLTIEDTTDSLLGNLIAFEQCCNRFTPHYITDYVILMEYLINSPKDVALL  340

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
                G++ N LGD++ V+ LF +L K VV++S D F +S++C  +N ++   W++  A LR
Sbjct  341   SRYGIINNLLGDNEGVSHLFKKLGKEVVFNS-DKFQFSNLCRDVNKYHKTRWHIWRATLR  399

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
              DYFN PWA IS I AV LL  T+ QTV ++L L+K
Sbjct  400   RDYFNNPWAIISFIGAVLLLFFTLIQTVCSLLSLKK  435



>ref|XP_010654754.1| PREDICTED: UPF0481 protein At3g47200-like [Vitis vinifera]
Length=439

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 153/456 (34%), Positives = 237/456 (52%), Gaps = 51/456 (11%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+   +  L  L S+ CI++V + LRR N +A+ P ++SIGP HHG  +L  ME  K  Y
Sbjct  27    SINEKLSTLTSLPSQCCIYRVPDTLRRVNEEAFVPRILSIGPVHHGKKRLRDMEGHKWQY  86

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L   L+R+    +E+  + +++ + +    Y +      ++    D+FV M+LLDGCFI 
Sbjct  87    LKALLQRKPGTMVERYVKAMRELEARTRGCYAE------IIKFDSDEFVTMMLLDGCFII  140

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E   +  +++ +            +++ +F  T +   + RDL+LLENQLPFFVL+ L  
Sbjct  141   ELFLKNKNKQLRD-----------EDDPIFNRTMVLTDLHRDLILLENQLPFFVLETLFN  189

Query  636   MV--YDESKPK--FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN  803
             ++   D+  P    L++  + F  +  +  LI    P++          HLL ++     
Sbjct  190   LIENTDQEGPSTSVLELTYVFFKFLGLQEVLIRDSQPDVK---------HLLDLLRLWFV  240

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
             P +      +  + L                   IR+ TEL EAGV  + +   S L  I
Sbjct  241   PPSSTKSTSKSKFEL-------------------IRSVTELHEAGVKFR-MGTVSCLMEI  280

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
             KF +  LEIP   I D T++   N+IA+EQ        Y TDY  LM+ LIN+ KDV L 
Sbjct  281   KFINGVLEIPPLTIEDTTDSLLGNLIAFEQCCNRFTPHYITDYVILMEYLINSPKDVALL  340

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
                G++ N LGD++ V+ LF +L K VV++S D F +S++C  +N ++   W++  A LR
Sbjct  341   SRYGIINNLLGDNEGVSHLFKKLGKEVVFNS-DKFQFSNLCRDVNKYHKTRWHIWRATLR  399

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
              DYFN PWA IS I AV LL  T+ QTV ++L L+K
Sbjct  400   RDYFNNPWAIISFIGAVLLLFFTLIQTVCSLLSLKK  435



>ref|XP_002303850.2| hypothetical protein POPTR_0003s18020g [Populus trichocarpa]
 gb|EEE78829.2| hypothetical protein POPTR_0003s18020g [Populus trichocarpa]
Length=420

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 166/459 (36%), Positives = 232/459 (51%), Gaps = 58/459 (13%)
 Frame = +3

Query  84    PIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENL  263
             P+   +   ++ L    S   IFKV   LR  N  A+ P ++SIGPYH G  KL  ME  
Sbjct  6     PLIVQIDEKLRGLPSNHSTCSIFKVPSRLRHVNERAFEPEILSIGPYHRGKDKLKMMEEH  65

Query  264   KLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDG  443
             K  YL   L+R  + S+ +    +   + +A  +Y  D+ + L      D+FV+MLLLDG
Sbjct  66    KKRYLQKLLQRRGESSVSEYVTAMIGVEAEARKFY--DQSVSL----GQDEFVEMLLLDG  119

Query  444   CFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQ  623
             CFI E + +  +    ++          DN+ VF  + +   +  D+ LLENQLPF VL 
Sbjct  120   CFIVELIRKYNNIPGVRD----------DNDPVFEVSWILSSIETDMFLLENQLPFSVLW  169

Query  624   ELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATE--MKGHLLQIVHNL  797
             EL  M  +     F  +  ++F            I P  G+++  E     HLL I++++
Sbjct  170   ELFTMTSEVQNEDFFGMA-LSFCQR---------IFPGSGNHSIPENYTCKHLLDILYHI  219

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD-----IRTATELQEAGVNLKKVVK  962
                                    G Q+ DS+    D     IR A ELQE+G+  KK   
Sbjct  220   -----------------------GYQTPDSREPPKDNDWYFIRNAKELQESGIKFKKREG  256

Query  963   SSSLFHIKF-NHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLIN  1139
             S  LF + F  +  +EIP   I D TE+ FRN++AYEQ S  K+ +Y TDY  LMD LIN
Sbjct  257   SRRLFDVVFLENGTIEIPCLKIYDTTESLFRNLVAYEQCSRCKH-LYVTDYITLMDCLIN  315

Query  1140  TEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPW  1319
              ++DV + R +G++ N LGDD  V  LFN L   V+ S    FYY  V N +  H N+  
Sbjct  316   NQEDVQILRHSGIIENGLGDDGMVCSLFNNLGINVILSHRRYFYYHKVFNSVKEHCNRKR  375

Query  1320  NVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             NV +AKLRH+YFN+PWA IS +AA  LL  T+ QTV  V
Sbjct  376   NVWLAKLRHNYFNSPWALISFLAAAALLLFTLVQTVYTV  414



>ref|XP_009355715.1| PREDICTED: putative UPF0481 protein At3g02645 [Pyrus x bretschneideri]
Length=443

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 156/464 (34%), Positives = 230/464 (50%), Gaps = 62/464 (13%)
 Frame = +3

Query  84    PIYESLKRDIKN-LKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             P+  S+ +  +N L  LS   CI++V E +R  N  AYTP ++SIGP HHG   L +ME 
Sbjct  17    PLLTSMGQSQENDLPPLSDPCCIYRVPEPVRCVNEKAYTPQIVSIGPLHHGKEGLEEMEG  76

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL+R    S +    K+K  + +  S Y         ++ + +KFV+++L+D
Sbjct  77    HKRRYLQYFLERTGV-SEKDYVTKIKGKEAELRSCYAH------TIEFSSEKFVEIILVD  129

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI E L R   E  K +           N+ +F   G    +  D+LLLENQLPFF+L
Sbjct  130   AAFIIELLLRRDGEHIKPD----------SNDRIFYKPGFINFIVPDMLLLENQLPFFIL  179

Query  621   QELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
             ++L  +   E                         + P      AT++   +L + +  C
Sbjct  180   EDLFSLTKKEED-----------------------LFPTADQVPATKLS--VLDLSYEFC  214

Query  801   NPQNGGIQEERHYW---------------TLCFPCSLGKQSQDSKVGSSDIRTATELQEA  935
               ++ G   E+  W               TL  P + G   +  ++G   I  +T+L  A
Sbjct  215   K-KSTGFYMEKDNWKCPTSVVHHFVDLVRTLHLPTAKGNSEKGEQLGFRGIPPSTKLHRA  273

Query  936   GVNLKKVVKSSSLFHIKFNHAE--LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTD  1109
             GV  + V  S +LF I+FN  +  L+IP   I D TE   RN+IA+EQ  C  N+ +F+D
Sbjct  274   GVKFRPVRSSENLFDIRFNDQDGILKIPHLIIDDDTELVLRNVIAFEQSHCTPNSYFFSD  333

Query  1110  YAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCN  1289
             Y  L+D+L+NT  DV L     ++ N LGD+ EV+ L NRLCKGVV+   D F Y+ +  
Sbjct  334   YIILIDHLVNTPIDVELLVKEEIVENLLGDNNEVSTLINRLCKGVVFDR-DEFSYAKLTK  392

Query  1290  KLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQ  1421
              L+ +   PWN+ MA L+  YF+TPW  IS I A  ++ LTI Q
Sbjct  393   DLDNYCKNPWNIWMADLKQTYFDTPWKIISFIVATCVILLTITQ  436



>ref|XP_004293001.1| PREDICTED: UPF0481 protein At3g47200-like [Fragaria vesca subsp. 
vesca]
Length=440

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 162/470 (34%), Positives = 239/470 (51%), Gaps = 59/470 (13%)
 Frame = +3

Query  51    IENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             IEN   +   +P+  S+++++K+L  LS   CI++V E LRR +  AYTP ++SIGP HH
Sbjct  11    IENQRAEH--IPLITSMEKELKDLPILSPSCCIYRVPERLRRVSEKAYTPQVVSIGPLHH  68

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G   L  ME  K  YL  F+ + K  S+E+   K+K  +EK  + Y +       ++   
Sbjct  69    GKDSLKAMEVHKKRYLQAFIVQTKA-SVEEYVVKMKSQEEKLRNCYAET------IEFTS  121

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             D+FVK++L+D  FI E L R      +            +N+ +F    M   V+ D+ L
Sbjct  122   DEFVKIILVDAAFIIEVLLRYCFHALQD-----------ENDRIFNKPWMLQDVWPDMRL  170

Query  591   LENQLPFFVLQELHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATE  761
             LENQLPFF+L+EL+  V   + E K   +D+    F S++                    
Sbjct  171   LENQLPFFILEELYAKVSSNFTEGK-SLIDLSHNFFTSLM--------------------  209

Query  762   MKGHLLQIVHNLCNPQNGGIQEERHYWTLC----FPCSLGKQSQDSKVGSSDIRTATELQ  929
                H+     NL N  +  +    H+   C     P  L + ++  K+ + +  + T+L 
Sbjct  210   ---HIEGTEDNLQNIDSSTVH---HFVAFCRDLYLPSPLERPAK-GKLETLNTPSMTDLH  262

Query  930   EAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTD  1109
              AGV   KV  S +LF I+F    LEIPK  I+D  E   RN++A+EQ  C +N     D
Sbjct  263   RAGVKF-KVRSSKNLFDIRFQGGMLEIPKLAISDEIELTIRNILAFEQCHCLEN--IIND  319

Query  1110  YAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCN  1289
             Y  +MD L+NT KDV L    G++ N LGD    + L N L  GV+  S D F Y+ +C 
Sbjct  320   YVVVMDRLVNTPKDVELLVKYGIVENRLGDSSGGSTLINSLADGVIVDSKD-FCYATLCK  378

Query  1290  KLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
              LN + +  W+   A LR +YFNTPWA IS  AAV LL LT+ Q V +++
Sbjct  379   DLNYYCSWTWHKWKANLRQNYFNTPWAVISFTAAVILLVLTLIQAVCSIV  428



>ref|XP_010670655.1| PREDICTED: UPF0481 protein At3g47200 [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 231/446 (52%), Gaps = 47/446 (11%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+++ + +L  +SS  CI++V E LR+ N DAY PLL+SIGP+++ + ++  M+  KL Y
Sbjct  11    SIQQKLASLPAVSSNCCIYRVPENLRKVNEDAYRPLLVSIGPFYYNDPRVVGMQQQKLRY  70

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL R    +++   + ++  +  A   Y   E I L      + F++M+LLD  FI 
Sbjct  71    LQSFLGRSTSYNLDYYTQAIRGWENLARHCYV--EAINL----PSEHFIEMVLLDATFII  124

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E   R    E               N+ VF    M  +V RD+ L ENQLP F+L+ L+ 
Sbjct  125   ELFLRGCFHEFIDA-----------NDRVFNKPRMILEVTRDIRLEENQLPIFILKGLYD  173

Query  636   MVYD-ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
             +V++  S+ K L  + IT+   + K   IP  +       A+    H++  +        
Sbjct  174   LVFEPSSQNKHLSFLDITYRFFMGKNEDIPSRI-------ASADVRHMVDFLR-------  219

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
                     Y        L   ++  +  SS     TEL EAGV      +S +L  ++F 
Sbjct  220   ------VRYLPSVLRAELPTTNKKFEFTSS----VTELSEAGVKFV-AGRSQNLLDVRFV  268

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKN-NMYFTDYAQLMDNLINTEKDVNLFRM  1169
                LEIP+F +TD TE+ FRN++ +EQ  C    + Y  DY   +D+LINT KDV++   
Sbjct  269   KGVLEIPRFVVTDDTESLFRNIMVFEQ--CHYYFDSYIIDYFAFLDSLINTPKDVSILVQ  326

Query  1170  NGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHD  1349
             +GV+ NWLG+++EV DLF++L K       + FYYS +C  LN +   PWN   A L+HD
Sbjct  327   SGVIENWLGNNEEVADLFSKLFKQTRLKGSN-FYYSTICKDLNAYAGTPWNRWKAILKHD  385

Query  1350  YFNTPWAGISTIAAVFLLSLTIAQTV  1427
             YFN PWA IS I A+ +L LT+ Q V
Sbjct  386   YFNHPWAAISVIYAIVMLILTVLQVV  411



>ref|XP_010696165.1| PREDICTED: UPF0481 protein At3g47200-like [Beta vulgaris subsp. 
vulgaris]
Length=412

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 155/456 (34%), Positives = 230/456 (50%), Gaps = 60/456 (13%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             ++KR  ++L  LSS+ CI+K+   LR+ N ++YTP LISIGP+HHGN K   ME  KL Y
Sbjct  11    TIKRKCESLTPLSSKCCIYKIPRNLRKINENSYTPSLISIGPFHHGNTKFQAMEEQKLRY  70

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  F++R  +  +E     L   +++A   Y         ++ +  +F +ML+LDGCFI 
Sbjct  71    LQKFIQRNSKKDLEDYLSALMKWEKEARDCY------LATINFSSIEFTEMLVLDGCFII  124

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             EF    +                  N+ +F    +   + RDL LLENQ+PFF+L+ L+ 
Sbjct  125   EFFLTWHGAVID------------PNDRIFHRPALSQAILRDLQLLENQVPFFILEILYN  172

Query  636   MVYD--ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL----  797
             + ++  E  P FL   K+T   M+            LG       K  +L +V  L    
Sbjct  173   IAFEDNEKAPSFL---KLTCECMI-----------GLGKVPKHFKKTKILHLVDFLRTYY  218

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF  977
               P N  I      W   FP  +                 +EL E+GV LK   K   L 
Sbjct  219   LPPDNKEICHVNQNWE--FPDGI-----------------SELYESGVILK-ADKDDKLL  258

Query  978   HIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
             +IKF +  L IP+  + + +E+  RN++A+EQ    + + +  DY   +D+LI   KDV+
Sbjct  259   NIKFENGVLYIPELMLENHSESQLRNLVAFEQCHYPRES-FVVDYVLFLDSLIYDRKDVD  317

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             +   NG+++N  G  ++V  LF+ + KG  YS    FYY+DVC +LN +   PWN   A 
Sbjct  318   VLVNNGIILNSPGSSEDVYRLFSNISKGTTYSR-GSFYYADVCRRLNHYCGTPWNRWRAI  376

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             LR DYFN PW+ ISTI AV L+ LT+ QT   ++ L
Sbjct  377   LRQDYFNNPWSMISTIVAVVLVILTVIQTYCDIIQL  412



>gb|KDO36306.1| hypothetical protein CISIN_1g014530mg [Citrus sinensis]
Length=423

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 160/420 (38%), Positives = 223/420 (53%), Gaps = 44/420 (10%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL-DLFLKREKQPS  311
             S+  IF+V   LR+ N  AY P +++IGPYHHG   L   E  K  YL +L  +R    S
Sbjct  14    SQFSIFRVPNQLRKINATAYEPEMLAIGPYHHGKDHLMAFEEHKTRYLQNLLHRRSLNRS  73

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +      L+  +EKA   YG      + LD   ++FV+M+LLDGCFI E + +   +E++
Sbjct  74    LSDYVTTLRALEEKARKCYGG----SISLDK--EEFVEMMLLDGCFIVEIIRKNLRQESR  127

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY----DESKP  659
             +           DN+ +F    M   + RD+ L+ENQLPFFVL EL  M      +++  
Sbjct  128   E-----------DNDPIFKLGWMLPFIARDMFLVENQLPFFVLWELFSMTEVTNNNQTNY  176

Query  660   KFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHY  839
              F  ++   F  +L   +  P +     D    E   HL+  +HN   P   GI      
Sbjct  177   SFFYMILYFFYGILPG-KGYPRV-----DVYPIEEIKHLVGFIHNNWLPSPTGID-----  225

Query  840   WTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKF  1019
                 F  +  K S+        I  ATE+QEAGV  +KV +   LF IKF++  ++IP  
Sbjct  226   ---AFKINASKNSE-----WKFICCATEIQEAGVKFQKV-EDGLLFDIKFDNGVMKIPTL  276

Query  1020  HITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGD  1199
              I D TE   RN+IAYEQ S D+N+ +  DY + +D LIN+ KD  L R  G++ NWLGD
Sbjct  277   AIGDTTEAVLRNLIAYEQFSHDQNSKHILDYVKFLDCLINSSKDAELLRRCGIIDNWLGD  336

Query  1200  DKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGIS  1379
             D+ +  L +RL   VV S  D FYYS+V NK+N H ++  N   AKLRH+YFNTPWA IS
Sbjct  337   DEVIAGLISRLGDAVVLS--DQFYYSEVFNKVNLHCSRRVNKWKAKLRHNYFNTPWAIIS  394



>ref|XP_009353518.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
 ref|XP_009334802.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=437

 Score =   231 bits (588),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 158/460 (34%), Positives = 232/460 (50%), Gaps = 54/460 (12%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             +P+  S+ R+++ L  LS+  CI++V E LR  NT AYTP ++SIGP HHG   L  ME 
Sbjct  16    IPLATSMSRELEGLPSLSNSFCIYRVPEQLRCANTKAYTPQVVSIGPLHHGKKGLKDMEE  75

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL+R  + S+    +K+K  +++  S Y         ++   DKFV+++L+D
Sbjct  76    QKKRYLRYFLRR-TEVSLADYVKKIKGKEKELRSCYAHT------IELCSDKFVRIILVD  128

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI E L R                    N+ +F    +   +  D+LLLENQLPFF+L
Sbjct  129   AAFIIELLLRNCRYIPPD-----------SNDRIFNKPWLINYIVPDMLLLENQLPFFIL  177

Query  621   QELHGMV-YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL  797
             ++L        + P   D+    F    T + +   +   LG ++  +++ H + ++  L
Sbjct  178   EDLFATPEVPATMPSVFDL-SYKFCEKRTNLYVGRDV---LGSSSRLKVE-HFVDLIRTL  232

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSK----VGSSDIRTATELQEAGVNLKKVVKS  965
                                  +L  + +DSK    V +  I + T+L +AGV  K    S
Sbjct  233   ---------------------NLPTEEEDSKNRGTVKTVSIPSMTKLHQAGVKFK-ARSS  270

Query  966   SSLFHIKFNH--AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLIN  1139
                F I F      LEIP   I D TE   RN+IA+EQ  C  N  YF DY  LMD L+N
Sbjct  271   KKPFDICFTDKGGILEIPNIMIEDNTELILRNLIAFEQCHCSPNT-YFIDYISLMDGLVN  329

Query  1140  TEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPW  1319
             T+ DV L   NG++ N LGD+K V+ L NRL KGVV +    FYY+ +   LN +Y K W
Sbjct  330   TQNDVELLVKNGIVENLLGDNKAVSALINRLGKGVVLNP-GRFYYATLAEGLNNYYKKSW  388

Query  1320  NVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             N   A L+  YF +PW  IS IAA  ++ LT+ QT++ ++
Sbjct  389   NEWKADLKQKYFKSPWTTISVIAAALIIILTLIQTLLQMV  428



>ref|XP_006420574.1| hypothetical protein CICLE_v10004982mg [Citrus clementina]
 gb|ESR33814.1| hypothetical protein CICLE_v10004982mg [Citrus clementina]
Length=440

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 155/422 (37%), Positives = 222/422 (53%), Gaps = 39/422 (9%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S +  IFKV + LR+ N  AY P +++IGPYHHG  +L   E  K  YL   L+R + P 
Sbjct  25    SDQFNIFKVPDVLRKLNEKAYEPEMLAIGPYHHGQEQLLAFEEHKTRYLKKLLERTRIP-  83

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +      ++  +E+A   YG    +        D+FV+M+LLDGCFI E + +   +  +
Sbjct  84    LSDYVMAMRALEERARKCYGGSTSLN------RDEFVQMMLLDGCFIVEVIRKFRLKHLR  137

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV---YDESKPK  662
                         D++  F    M   + RD++LLENQLPFFV+ +L  M     D     
Sbjct  138   G-----------DDDPNFKLGWMLPSIARDMILLENQLPFFVIWKLFIMTDMPSDSRNES  186

Query  663   FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYW  842
             FL ++   F  +L        IV  +      E+K HL+ ++H    P   G++  R+  
Sbjct  187   FLVMILRFFNGILPGKGCRRDIVYQVDVYPINEIK-HLVHLIHENWLPSPAGVEAYRNNA  245

Query  843   TLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV--VKSSSLFHIKFNHAELEIPK  1016
             T          S  S +GS     ATE+QEAG++ +KV  +K  SLF IKF +  +++P 
Sbjct  246   T--------NNSYWSFIGS-----ATEIQEAGIHFRKVGVLKDDSLFDIKFENGVMKMPS  292

Query  1017  FHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLG  1196
               I D TET  +N IAYEQ S D N  +  DY + ++ LIN+ KD  L R  G++ N LG
Sbjct  293   LEIGDATETILQNFIAYEQCSQDLNLKHVIDYVEFLNCLINSSKDAELLRRRGIIENLLG  352

Query  1197  DDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGI  1376
             DD+ +  L N+LC GVV    + FYY +V NK+  H ++  N  MAKLRH+YFNTPWA I
Sbjct  353   DDEVIATLLNKLCDGVVLG--EKFYYREVFNKVILHCSRRRNKWMAKLRHNYFNTPWAII  410

Query  1377  ST  1382
             S 
Sbjct  411   SV  412



>ref|XP_010447464.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Camelina 
sativa]
Length=414

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 147/456 (32%), Positives = 233/456 (51%), Gaps = 54/456 (12%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             + +S+K  + +L  LS+  CI+KV   LRR N DAYTP L+S GP H G  +L  ME  K
Sbjct  10    LVDSIKAKLDSLSSLSTHCCIYKVPNKLRRLNPDAYTPRLVSFGPLHRGKEELQAMEEHK  69

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
               Y   F+ R    ++E+     +  ++KA S Y   ED++L      D+FV+ML++DG 
Sbjct  70    YRYFQSFILRTDS-TLEELVRVARTWEQKARSCYA--EDVKL----NSDEFVEMLVVDGS  122

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             F+ E L R               + +C+ +++F  + M   V RDL+L+ENQLPFFV++E
Sbjct  123   FLVELLLR-----------SYYPQLRCEKDSIFGNSMMITDVCRDLILIENQLPFFVVKE  171

Query  627   LHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL  797
             L  ++   Y +  P  L + +  F+  L+          N+ D   T    H + ++ + 
Sbjct  172   LFLLLFVYYQQGTPSILKLAQRHFSCFLS----------NIDDEMLTLEPKHFVDLLRS-  220

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF  977
                              C+   +  + +++ +   +   ATEL  AGVN K   ++S L 
Sbjct  221   -----------------CYLPLVPTRLKETTLKVENAPEATELHSAGVNFKP-AETSCLL  262

Query  978   HIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              I F    L+IP   I D TE+ +RN+IA+EQ  C   N  F  Y +L+   I +  D N
Sbjct  263   DISFADGVLKIPTIFIDDLTESLYRNIIAFEQCHCSDKN--FLHYIRLLGCFIKSPTDAN  320

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L   +G++VN LG+ ++V+ LF+ + K V++     FY+  +   L  + N PWN   A 
Sbjct  321   LLIRSGIIVNNLGNAEDVSKLFHSIYKEVIFGR--RFYFQTISENLQAYCNTPWNRWKAI  378

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             LR DYF+ PW+ +S +AA+ L+ LT    V ++L L
Sbjct  379   LRRDYFHNPWSVVSVLAAILLIFLTFIPAVCSILAL  414



>ref|XP_008219470.1| PREDICTED: UPF0481 protein At3g47200-like [Prunus mume]
Length=451

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 163/465 (35%), Positives = 238/465 (51%), Gaps = 38/465 (8%)
 Frame = +3

Query  69    DQQDLPIYESLKRDIKNLK-QLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKL  245
             + Q +P+   ++ ++  L  Q     CI++V + LR  N   YTP ++SIGP HHG   L
Sbjct  11    ENQHIPLATCMRDELSKLSPQPPMVCCIYRVPDRLRHVNEKVYTPQVVSIGPLHHGKQSL  70

Query  246   SKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVK  425
               ME  K  YL  FL R +  S+E+  +K+K  + K  S Y  +E I+       D+FV+
Sbjct  71    KAMEEQKKRYLQGFLTRTRV-SLEEYVKKVKYHEAKLRSCY--EESIKF----NSDEFVR  123

Query  426   MLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQL  605
             ++L+D  FI E L R   E       E       +N+ +F    +   +  D+ LLENQL
Sbjct  124   IILVDAAFIIELLLRICRERFNIIGLENY-----ENDRIFNKPWLIHYIAPDMQLLENQL  178

Query  606   PFFVLQELHG--MVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLL  779
             PFF+L++L    ++   S  K L ++ +++  +   + L                +  L 
Sbjct  179   PFFILEDLFDPDIITVSSNGKKLSMINLSYEFLTMTLAL-------------EGAEDSLK  225

Query  780   QIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTA---TELQEAGVNLK  950
             +I  +  NP+     +     TL  P  L +  Q ++  S  I T    T+L  AGV  K
Sbjct  226   RISSSSSNPKVEHFLD--FIRTLHLPI-LEESDQSNEGPSKSIMTTPCITKLHLAGVKFK  282

Query  951   KVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDN  1130
              +  S +LF I+FN   LEIPK  I D TE   RN++A+EQ  C  N  Y +DY  LMD+
Sbjct  283   -LGSSRNLFDIRFNDGILEIPKLQIHDYTELTLRNLLAFEQSHCQNN--YISDYVSLMDD  339

Query  1131  LINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYN  1310
              +NTEKDV     +G++ N LGD  EV  L N L +GV     D FY++ +  +LN +  
Sbjct  340   FVNTEKDVEFLLQDGIVENMLGDYNEVCTLINNLGRGVSVDR-DSFYFATLSERLNSYCR  398

Query  1311  KPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             KPWN   A LR +YFNTPWA IS IAAV LL LT  Q V +++ +
Sbjct  399   KPWNRWKANLRQNYFNTPWATISVIAAVLLLILTCIQAVCSIISV  443



>ref|XP_010026745.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=371

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 150/439 (34%), Positives = 228/439 (52%), Gaps = 73/439 (17%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             SE  IF+V   LR+ N  AY P +++IGPYH  N K   ME  KL YL   L+R K+ S+
Sbjct  6     SERSIFRVRHQLRKVNEKAYDPEILAIGPYHCENGKFKFMEEQKLRYLQQLLERRKE-SV  64

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             +     L++ +E+A + Y   E I L    + +KF+ M+L+DGCFI EF  +  +     
Sbjct  65    DSYMPTLRELEERARNCYA--ETINL----SQEKFLAMMLIDGCFIIEFFRKYNNMIPTD  118

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         ++ V    G+   + RDL LLENQLP FVL +     YD ++ +  + 
Sbjct  119   R-----------DDPVMRGRGIINSIRRDLQLLENQLPLFVLSK----PYDLTEDEHHEF  163

Query  675   VKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCF  854
              K+  A M  ++  IP ++P+     A E++  +++ V                      
Sbjct  164   SKV--AIMYFQLNCIP-VMPS-----AIELRKSVVRSV----------------------  193

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
                              + +A EL+E+GV  +   +   L  IKF +  LE+   ++ D 
Sbjct  194   -----------------MPSAIELRESGVRFR-AAQGRELSDIKFKNGTLELLVLYVEDD  235

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             TE+ FRN+IAYEQH   ++  YFTDY   MD LI++ KDV + R  G++ N+LGDDK + 
Sbjct  236   TESNFRNLIAYEQHRQSRDINYFTDYVTFMDCLISSSKDVEVLRHAGIVKNYLGDDKVIA  295

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
              +FN++   V  S     YYS++   +N HY   WNV +AKL+ +YF++PWA +S  AA+
Sbjct  296   QMFNKIGDHVAVSDS---YYSEIFPNVNAHYKNKWNVWIAKLKREYFHSPWAFLSVPAAI  352

Query  1395  FLLSLTIAQTVIAVLDLRK  1451
              LL LT+AQTV ++L   K
Sbjct  353   VLLFLTVAQTVFSILPYTK  371



>ref|XP_006487607.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis]
Length=455

 Score =   229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 153/427 (36%), Positives = 221/427 (52%), Gaps = 51/427 (12%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S +  IFKV + LR+ N  AY P +++IGPYHHG  +L   E  K  YL   L+R + P 
Sbjct  40    SDQFNIFKVPDVLRKLNEKAYEPEMLAIGPYHHGKEQLLAFEEHKTRYLKKLLERTRIP-  98

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +      ++  +E+A   YG    +        D+FV+M+LLDGCFI E + +   +  +
Sbjct  99    LSDYVMAMRALEERARKCYGGSISLN------RDEFVQMMLLDGCFIVEVIRKFRLKHLR  152

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV---YDESKPK  662
                         D++  F    M   + RD++LLENQLPFFV+ +L  M     D     
Sbjct  153   G-----------DDDPNFKLGWMLPSIARDMILLENQLPFFVIWKLFIMTDMPSDSRNES  201

Query  663   FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERH--  836
             FL ++   F  +L        IV  +      E+K HL+ ++H    P   G++  R+  
Sbjct  202   FLLMILRFFNGILPGKGCRRDIVYQVDVYPINEIK-HLVHLIHANWLPSPAGVEAYRNNA  260

Query  837   ----YWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV--VKSSSLFHIKFNHA  998
                 YW+                    I +ATE+QEAG++ +KV  +K  SLF IKF + 
Sbjct  261   TDNSYWSF-------------------IGSATEIQEAGIHFRKVEVLKDDSLFDIKFENG  301

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
              +++P   I D TET  +N IAYEQ S D N  +  DY + ++ LIN+ KD  L R  G+
Sbjct  302   VMKMPSLEIGDATETILQNFIAYEQCSQDLNLKHVIDYVEFLNCLINSSKDAELLRRRGI  361

Query  1179  LVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFN  1358
             + N LGDD+ +  L N+LC GVV    + FYY +V NK+  H ++  N  MAKLRH+YFN
Sbjct  362   IENLLGDDEVIATLLNKLCDGVVLG--EEFYYREVFNKVIYHCSRRRNKWMAKLRHNYFN  419

Query  1359  TPWAGIS  1379
             TPWA IS
Sbjct  420   TPWAIIS  426



>emb|CDO99352.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   228 bits (582),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 150/454 (33%), Positives = 223/454 (49%), Gaps = 39/454 (9%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             I  SL   +    QLS+E CIF+VH+ LRR N  AY P +++IGPYHHG +KL  ME  K
Sbjct  9     ISASLNEKLSGRSQLSNEKCIFRVHDRLRRHNPQAYEPEIVAIGPYHHGKSKLQNMEEHK  68

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
             L YL   L R  + S+E+  E L   + +A   Y   E+I L    + D FV+M+ LDGC
Sbjct  69    LRYLQGLLHRRGETSVERYIEALLPLEGRARRCYA--EEISL----SKDDFVEMMCLDGC  122

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             F+ E L +      +            D + +F    +   V RDL L ENQLP FVL +
Sbjct  123   FLIETLRKSQQHNLRN-----------DEDPIFQMDWLGLSVGRDLFLFENQLPLFVLVQ  171

Query  627   LHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNP  806
             L  M          D+    F +     R          D  A     HLL ++H     
Sbjct  172   LFDMTKFAESENLSDLAIPYFTTGFFPCRDGYQFCTKNSDGEAI----HLLDLMHK----  223

Query  807   QNGGIQEERHYWTLCFPCSLGK-QSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
                        W   F   L + +     +    I+++TEL+  G+  +K  +S+S  HI
Sbjct  224   ----------SWCSSFAAKLPEIKDFCDDLPFEFIKSSTELELRGIKFEKAERSTSWLHI  273

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQH--SCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              F +  ++IP F + D TETFFRN++AYE++  +  ++    TDYA  MD LI++ +DV 
Sbjct  274   TFANGVIKIPPFPVGDVTETFFRNLVAYEEYILTGYEDRRCVTDYAIFMDCLIDSSRDVE  333

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
                  G++ N LGDD  V+ + N+L   V+    + F Y  +  ++N   ++  N+  A 
Sbjct  334   RLGQRGIITNCLGDDAAVSTIINKLFNDVILRR-EHFCYRRLFKEVNEQSSRQLNIWKAH  392

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             L  +YF TPW+ IS +AA FL+ L   Q + ++L
Sbjct  393   LMRNYFKTPWSIISFLAACFLILLATVQAIFSIL  426



>ref|XP_010432794.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Camelina 
sativa]
Length=414

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 148/468 (32%), Positives = 239/468 (51%), Gaps = 57/468 (12%)
 Frame = +3

Query  51    IENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             ++  EGD     + +S+K  + +L  L+   CI+KV   LRR N DAYTP L+S GP H 
Sbjct  1     MDQNEGDDA---LIDSIKAKLDSLSSLTIHCCIYKVPNKLRRLNPDAYTPRLVSFGPLHR  57

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G  +L  ME  K  YL  F+ R    ++E+    ++  ++KA S Y   ED++L      
Sbjct  58    GKEELQAMEEHKYRYLQSFILR-TDCTLEELVRVVRTWEQKARSCYA--EDVKL----NS  110

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             D+FV+ML++DG F+ E L R +  + +            + +++F  + M   V RDL+L
Sbjct  111   DEFVEMLVVDGSFLVELLLRSHYPQLRG-----------EKDSIFGNSMMITDVCRDLIL  159

Query  591   LENQLPFFVLQELHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATE  761
             +ENQLPFFV++E+  ++   Y +  P  L + +  F+  L+          N+ D   T 
Sbjct  160   IENQLPFFVVKEIFLLLFVYYQQGTPSILKLAQRHFSCFLS----------NIDDEMLTS  209

Query  762   MKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGV  941
                H + ++ +                  C+   +  + +++ +   +   ATEL  AGV
Sbjct  210   EPKHFVDLLRS------------------CYLPLVPARLKETTLKVENAPEATELHTAGV  251

Query  942   NLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQL  1121
             N K   ++S L  I F    L+IP   I D TE+ +RN+IA+EQ  C   N  F  Y +L
Sbjct  252   NFKP-AETSCLLDISFADGVLKIPTIFIDDLTESLYRNIIAFEQCHCSDKN--FLHYIRL  308

Query  1122  MDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNG  1301
             +   I +  D NL   +G++VN LG+ ++V+ LF+ + K V++     FY+  +   L  
Sbjct  309   LGCFIKSPTDANLLIRSGIIVNNLGNAEDVSKLFHSIYKEVIFGR--RFYFQTISENLQA  366

Query  1302  HYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             + N PWN   A LR DYF++PW+ +S  AA+ L+ LT  Q   ++L L
Sbjct  367   YCNTPWNRWKAILRRDYFHSPWSVVSVFAAILLIFLTFIQAACSILAL  414



>ref|XP_006432624.1| hypothetical protein CICLE_v10001225mg [Citrus clementina]
 gb|ESR45864.1| hypothetical protein CICLE_v10001225mg [Citrus clementina]
Length=430

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 159/460 (35%), Positives = 236/460 (51%), Gaps = 55/460 (12%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             E L+  +K L  L S  CI++V E LR+ N   YTP ++SIGP HHG A L  ME  K  
Sbjct  9     ECLQVKLKKLSPLPSNCCIYRVPERLRQINEKVYTPQVVSIGPLHHGKANLQFMEEHKQR  68

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL  FL+R    S ++  + +K  + +    Y +  ++      + DKFV+M+LLD  FI
Sbjct  69    YLHCFLQR-TNISFDEFVQIIKFREAELRGSYAEKVEL------SSDKFVEMILLDAAFI  121

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              E L R +  + +K            ++ +F    +   ++ D+ LLENQLPFF+L++L 
Sbjct  122   IELLLRYHFRQLQK-----------KDDHIFHKPYLIEDIWYDMWLLENQLPFFILEDLF  170

Query  633   GM----VYDESKPKFLDIVKITFASMLTKVR----LIPPIVPNLGDNNATEMK-GHLLQI  785
              +    + D+ +   +  V   F   L  V+      PP          TE++  H L  
Sbjct  171   ALAAIEIPDQHENPIIITVTYEFFKGLEAVQGNRQKFPPY---------TEVRVEHFLDF  221

Query  786   VHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
             +  +C+  +   QE++           G+Q    K   S     T+L +AGV+   + KS
Sbjct  222   L-RICHLPSSRNQEKQE----------GQQYHKGKTAPS----VTDLHQAGVHFS-LSKS  265

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
             + LF I+F +  L IPK  +   TE+ FRN+IA+EQ    +N  Y  DY  L+ +L+NT 
Sbjct  266   NDLFAIEFKNRTLHIPKLKLQLETESLFRNLIAFEQRHYSEN--YINDYVFLIHHLVNTA  323

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             KDV L   NG++ NWL D +  + L N L +G    S D FY+S +C  LN H  +    
Sbjct  324   KDVELLVQNGIIENWLPDKETASMLLNNLSRGTTLLS-DSFYFSGLCKGLNDHCKRTCYK  382

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               A L+ +YFNTPWAGIS   AVFLL LT+ Q+V +V+ L
Sbjct  383   WRANLKQNYFNTPWAGISVCGAVFLLILTVIQSVCSVIQL  422



>gb|EYU31471.1| hypothetical protein MIMGU_mgv1a022973mg [Erythranthe guttata]
Length=426

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 147/451 (33%), Positives = 240/451 (53%), Gaps = 37/451 (8%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
              +L + +  L    S+  I++VH+ LR  N  AY P ++SIGPYH     L+ ME+ KL 
Sbjct  12    RNLSQKLTQLTMSQSQCTIYRVHKHLRNVNMKAYEPEVVSIGPYHRDKDNLTMMEDKKLC  71

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL L L+R K  S+E     ++  + +A   Y   E I L       +F++ML+LDGCFI
Sbjct  72    YLHLLLQR-KNESIENYVAAIEPFEFEARKCYA--EPISL----NAVEFIEMLVLDGCFI  124

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              + + +      +++           N+++F+   +   + RDL+L ENQ+PFF+L +L 
Sbjct  125   IDLVRKCNMIYLREK-----------NDSIFLMDWIINSLQRDLMLFENQVPFFILCKLF  173

Query  633   GMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
              ++   ++   L  + + F + L   +    +  +  D ++ E+  HLL ++H+  +P  
Sbjct  174   DLIEVPNQHSRLIYLLLNFFNSLFPGK----VYRDSKDRSSAEVIKHLLDLIHSNWHPSF  229

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
               +  E             K  +  K     +  ATEL+E  V  K++ +  SLF I+F 
Sbjct  230   DWLDFE-------------KNKKSEKKRWRFVNNATELRETNVKFKRI-EGISLFDIRFQ  275

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
                + +    I D TE+ FRN++AYEQ+  D    Y TDY + +D LI++ +DV++   +
Sbjct  276   DGNMLLAPLTIEDRTESLFRNLMAYEQYFGDSQISYVTDYVKFLDCLIDSSRDVSILSWH  335

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ NWLGDD+ V ++FN+L   +       F Y+DV   +N H N+  N  MAKLR +Y
Sbjct  336   GIIDNWLGDDEVVANMFNKLTDSIAGPGI-RFVYADVFEDVNKHCNRRRNKWMAKLRRNY  394

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              N+PWA IS + AV LL LT+AQTV ++L +
Sbjct  395   MNSPWAVISILFAVVLLLLTVAQTVCSILQV  425



>ref|XP_007226756.1| hypothetical protein PRUPE_ppa018811mg [Prunus persica]
 gb|EMJ27955.1| hypothetical protein PRUPE_ppa018811mg [Prunus persica]
Length=417

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 159/451 (35%), Positives = 234/451 (52%), Gaps = 45/451 (10%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             +  ++  L  LSS  CI++V E LRR +  AYTP ++SIGP HHG   L  ME+ K  YL
Sbjct  1     MGEELDGLSPLSSLCCIYRVPERLRRVSEKAYTPQVVSIGPLHHGKEGLKAMEDHKKRYL  60

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
               +++R +  S+    +K+KD + K  S Y   E IQ+    + D+FV+++L+D  FI E
Sbjct  61    QDYIRRTRV-SLADYVQKVKDQEAKLRSCYA--ETIQV----SSDEFVRIILVDAAFIIE  113

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
              L R   +E +            +N+ +F    M   V+ D+ LLENQLPFF+L+EL   
Sbjct  114   VLLRYRFDELQD-----------ENDCIFNKPYMLQDVWPDMRLLENQLPFFILEEL---  159

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
                       D  KI  +S    +  +   + NL  N       +L+ I     N +   
Sbjct  160   ---------FDPDKIEVSSNNNNIERLS--ILNLCHN----FFKNLMHIEGTDGNMEKLC  204

Query  819   IQEERHYWTLC----FPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIK  986
               +  H+   C     P  L   ++  ++ + +  + TEL  AGV  + V    +LF+IK
Sbjct  205   ASKVEHFVDFCRNLHLPLPLKPHAK-GRLETLNTPSITELHRAGVKFR-VGSPKNLFNIK  262

Query  987   FNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFR  1166
             F +  L+IPK  I+D TE   RN++A+EQ  C +N  Y  DY  +MD  +NT KDV L  
Sbjct  263   FANGILKIPKLAISDETELTIRNLLAFEQCHCMEN--YINDYVVIMDRFVNTAKDVELLV  320

Query  1167  MNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRH  1346
              +G++ N LGD  E + L N L  GV+    D FY++ +C  LN +    W+   A LR 
Sbjct  321   KHGIVENSLGDSSEGSTLINNLADGVIVDPND-FYFAILCADLNKYCRTSWHKWQANLRQ  379

Query  1347  DYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             +Y NTPWA IS  AA+FLL LT  QTV +V+
Sbjct  380   NYCNTPWATISIAAAIFLLILTFIQTVCSVI  410



>ref|XP_010447461.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Camelina 
sativa]
Length=413

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/466 (32%), Positives = 230/466 (49%), Gaps = 54/466 (12%)
 Frame = +3

Query  51    IENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             ++  EGD     +  S+K  +++L  LS++  I+KV   LR+ N DAYTP L+S GP+H 
Sbjct  1     MDQNEGDDA---LVNSIKAKLESLSSLSAQCSIYKVPNKLRKLNPDAYTPRLVSFGPFHR  57

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G  +L  ME  K  YL  F+ R    S+E      +  ++ A + Y   ED++L      
Sbjct  58    GKEELQAMEEHKYRYLKSFIPRTNF-SLEDLVRIARTWEQHARNCYA--EDVRL----TT  110

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             D+FV ML++DG F+ E L R  +   +            +N+ +F    M   V RD+LL
Sbjct  111   DEFVVMLVVDGSFLVELLLRFRNPLLRD-----------ENDRIFGKPMMITDVCRDMLL  159

Query  591   LENQLPFFVLQELHGMV-YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK  767
             +ENQLPFFV++    ++ Y +  P  +++V+  F+  L+          N+ D       
Sbjct  160   IENQLPFFVVKGFFLLLYYQQGTPSIMEMVQCHFSCFLS----------NIDDKKFISEP  209

Query  768   GHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNL  947
              H + ++ +                  C+   +  + +++ +   +   ATEL  AGV  
Sbjct  210   EHFVDLLRS------------------CYLPLVPIRLEETTLNVDNAPEATELHTAGVRF  251

Query  948   KKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMD  1127
             K    SS L  I F    L+IP   I D TE+ +RN+I +EQ  C   N  F  Y  L+ 
Sbjct  252   KPAETSSCLLDITFVDGLLKIPTVFIDDLTESLYRNIIVFEQCHCSDKN--FLHYTTLLG  309

Query  1128  NLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHY  1307
               I +  D  L   +GVLVN LG+ ++V+ LFN +CK VV+     FY+S +   L  + 
Sbjct  310   CFIKSPTDAELLIRSGVLVNNLGNAEDVSKLFNSICKEVVFGR--RFYFSTLSENLQAYC  367

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             N PWN   A LR DYF  PW+ +S  AA+ L+ LT  Q V ++L L
Sbjct  368   NTPWNRWKAILRRDYFQNPWSVVSVFAAILLIILTFIQAVCSILAL  413



>ref|XP_002324850.2| hypothetical protein POPTR_0018s01500g [Populus trichocarpa]
 gb|EEF03415.2| hypothetical protein POPTR_0018s01500g [Populus trichocarpa]
Length=428

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/455 (35%), Positives = 238/455 (52%), Gaps = 49/455 (11%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S++ ++ +L  LSS+ CI+ V + L   N  AYTP L+SIGP HHG  +L  ME  K  Y
Sbjct  18    SMRGELDSLPVLSSKCCIYTVPKRLHHLNEKAYTPQLVSIGPLHHGKPELRPMEEHKKRY  77

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL+R K  S+    + ++ +++K    Y +       ++ + D+F+KM+L+D  FI 
Sbjct  78    LQDFLQRTKL-SLVDYLKVIEKNEKKLRDCYAET------IEFSSDEFIKMILVDAAFII  130

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L R + +  +KE+         +N+ V+        + +D+ LLENQLPFF+L++L  
Sbjct  131   EVLLRYHFKPMRKEK---------ENDRVYNKPWAIQDIRKDMWLLENQLPFFILEDL--  179

Query  636   MVYDESKPKFLDIVKITFAS----MLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN  803
                        D  +IT  S    ML+  +L      +L D    E K            
Sbjct  180   ----------FDPARITLPSGKNQMLSITKLAYEFSKDLWDLEEMEEKS-----------  218

Query  804   PQNGGIQEERHYWTLCFPCSLGKQ-SQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
              Q     + +H     + C    Q     K+ +  I +ATEL +AGV   K+  S +LF 
Sbjct  219   -QKNKSPKVQHLVDFLWICHQPPQSKSKKKLKTLGIPSATELHQAGVKF-KLGSSKNLFD  276

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNL  1160
             IKF +  LEIP+  I   TE  FRN++A+EQ  C KN  Y  DY  ++++L+NT KDV L
Sbjct  277   IKFKNGILEIPRLEIVGATELLFRNLLAFEQCHCSKN--YINDYVIIINHLVNTAKDVEL  334

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
                +G++ NWL DD+ ++ LF+ L K   +   D FY+S +  +LN +  KPW+   A L
Sbjct  335   LVKDGIVENWLWDDEGMSALFHGLVKE-TFVIVDHFYFSGLVEELNAYCRKPWHKWQATL  393

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             +  YFN PW+ IS IAAV LL LT  Q V ++L +
Sbjct  394   KQHYFNNPWSIISFIAAVILLVLTTIQAVCSILSV  428



>ref|XP_010023544.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
 gb|KCW59838.1| hypothetical protein EUGRSUZ_H02583 [Eucalyptus grandis]
Length=434

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 144/438 (33%), Positives = 218/438 (50%), Gaps = 49/438 (11%)
 Frame = +3

Query  138   EACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSME  317
             E  IF+V   LR  N  AY P +++IGPYH GN K   ME  KL Y+   L R ++ S++
Sbjct  39    EHSIFRVRRQLRGVNEKAYEPEILAIGPYHSGNDKFKFMEEQKLRYVKRLLWRRREGSVD  98

Query  318   QCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkke  497
             +    L+  ++ A   Y +  D+      + + F+ M+L+DG F+ E   +   +E +  
Sbjct  99    KYMPALRSMEQWARDCYAEAVDL------SQENFLAMMLIDGLFLVELFRKNSIKELRD-  151

Query  498   eeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYD-ESKPKFLDI  674
                       +++ V     ++F + RDL+LLENQ+PF +L+EL+G+    E   + +D+
Sbjct  152   ----------EDDPVMKEDWIRFCLPRDLVLLENQIPFLILEELYGLTKGPEEHSELIDV  201

Query  675   VKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCF  854
                               VP+  +        HLL ++H        G+   RH      
Sbjct  202   ATRYLN-----------FVPSDSNRGMLRESKHLLHLMHTCLT----GL-PRRH------  239

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
                  + +  +K  +    +  EL+E GV   +V KS  L  I F    LEIP   + D 
Sbjct  240   -----RLNPRTKPMTEKFMSPAELREFGVRF-RVKKSPDLLDITFKDGTLEIPVLTVQDH  293

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             TE+  RN+IAYEQH       Y TDY   MD LI++  DV L R  G++ N++GDD+ V 
Sbjct  294   TESQLRNLIAYEQHRPSGEVNYMTDYVTFMDCLIDSSTDVELLRAAGIIKNYMGDDEAVA  353

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
              +FN++     Y +   FYY D+  +LN H  K WN  MAKLR ++ ++PWA +S  AA 
Sbjct  354   QMFNKMGD---YVTLSNFYYDDIFRRLNAHCKKRWNRSMAKLRREHLHSPWALLSISAAT  410

Query  1395  FLLSLTIAQTVIAVLDLR  1448
              LL LT+AQTV+  L  R
Sbjct  411   MLLLLTVAQTVLTYLAYR  428



>ref|XP_006446057.1| hypothetical protein CICLE_v10015331mg [Citrus clementina]
 gb|ESR59297.1| hypothetical protein CICLE_v10015331mg [Citrus clementina]
Length=428

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 161/457 (35%), Positives = 229/457 (50%), Gaps = 46/457 (10%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             I  SLK +++ +  +S E CI++V    R  N   +TP +ISIGP HHG  +L +ME  K
Sbjct  14    IAASLKENLQTMHPVSEECCIYRVPRRTRCLNESDFTPQVISIGPLHHGKEELKEMEEHK  73

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
               YL  FL+R K  S+E+    +KD + K  SYY   E I+L      D FV M+L+D  
Sbjct  74    RRYLKHFLQRTK-VSIEELLTLIKDKEAKLRSYYS--ESIEL----TSDAFVTMILVDSI  126

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKF-QVFRDLLLLENQLPFFVLQ  623
             F+ E L R               K   +++ VF   G  +  +F DL LLENQLPFF+L 
Sbjct  127   FMIEHLLR-----------FSNRKLVTNDDRVF---GKPYIDIFEDLRLLENQLPFFILN  172

Query  624   ELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN  803
             +L  +    S  + LD         L+ + LI  ++ +L  ++        L I  N+  
Sbjct  173   DLFILAKTTSHGEVLD--------GLSLIELIISLISDLAADD--------LLIEKNILQ  216

Query  804   PQNGGIQEERHYWTLCFPCS--LGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF  977
                   +       LC   S  L    Q+  + + +I +ATEL +AGV   ++  +  L 
Sbjct  217   QHFSEAEHILDLLRLCLEPSVELNDDDQEDTIRTQNIPSATELHQAGVKF-QLGSTKHLL  275

Query  978   HIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              I FN   LEIP   I D TE  FRN+ A+E   CD  + Y  DY  +M NL+ T  D  
Sbjct  276   EITFNKGILEIPLLTIYDTTEGLFRNLHAFETVHCD--SCYINDYIIMMKNLVVTANDAE  333

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCK-GVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             L   NGV+ NW GD + V++    L +   +Y+  + F YSD+   L  +   P +   A
Sbjct  334   LLVQNGVIDNWTGDSQAVSNFLRNLDRQATLYA--NNFRYSDLVQDLKAYCRYPLHKWKA  391

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              L+ +YFNTPWA IS IAAV LL LTI QTV +++ L
Sbjct  392   NLKQNYFNTPWASISVIAAVVLLLLTIIQTVCSIIAL  428



>ref|XP_006487605.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis]
Length=455

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 151/428 (35%), Positives = 219/428 (51%), Gaps = 51/428 (12%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S +  IFKV + LR+ N  AY P +++IGPYHHG  +L   E  K  YL   L+R + P 
Sbjct  40    SDQFNIFKVPDVLRKLNEKAYEPEMLAIGPYHHGKEQLLAFEEHKTRYLKKLLERTRIP-  98

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +      ++  +E+A   YG    +        D+FV+M+LLDGCFI E + +   +  +
Sbjct  99    LSDYVMAMRALEERARKCYGGSISLN------RDEFVQMMLLDGCFIVEVIRKFRLKHLR  152

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV---YDESKPK  662
                         D++  F    M   + RD++LLENQLPFFV+ +L  M     D     
Sbjct  153   G-----------DDDPNFKLGWMLPSIARDMILLENQLPFFVIWKLFIMTDMPSDSRNES  201

Query  663   FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERH--  836
             FL ++   F  +L        IV  +      E+K HL+ ++H    P   G++  R+  
Sbjct  202   FLLMILRFFNGILPGKGCRRDIVYQVDVYPINEIK-HLVHLIHANWLPSPAGVEAYRNNA  260

Query  837   ----YWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV--VKSSSLFHIKFNHA  998
                 YW+                    I +A E++EAG+  +KV  +K  SLF IKF + 
Sbjct  261   TDNSYWSF-------------------IGSAIEIREAGIRFRKVEVLKDDSLFDIKFENG  301

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
              +++P   I D TET  +N IAYEQ S D N  +  DY + ++ LIN+ KD  L R  G+
Sbjct  302   VMKMPSLEIGDATETILQNFIAYEQCSQDLNLKHVIDYVEFLNCLINSSKDAELLRRRGI  361

Query  1179  LVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFN  1358
             + N LGDD+ +  L N+LC GVV    + FYY +V NK+  H ++  N  MAKLRH+YFN
Sbjct  362   IENLLGDDEVIATLLNKLCDGVVLG--EKFYYREVFNKVILHCSRRRNKWMAKLRHNYFN  419

Query  1359  TPWAGIST  1382
             TPWA IS 
Sbjct  420   TPWAIISV  427



>ref|XP_009355871.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=427

 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 220/448 (49%), Gaps = 45/448 (10%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+  ++ +L  LS+  CI+KV E LR  N  AYTP ++SIGP HHG   L  ME  K  Y
Sbjct  18    SMSEELGDLTPLSASCCIYKVPERLRCVNEKAYTPQVVSIGPIHHGKKGLEDMEEHKKRY  77

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL R K  S+E    K++  + +  S Y  +      +  + D+FV+++L+D  FI 
Sbjct  78    LQHFLNRTKV-SLEVYVTKIQVKEPELRSCYAHN------IGLSSDEFVRIILVDAAFII  130

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L R       +            N+ +     +K  +  D+LLLENQLPFF+L++L  
Sbjct  131   ELLLRYCSPIQLE-----------SNDGILNKPWLKKFIIPDMLLLENQLPFFILEDLFA  179

Query  636   MVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK-GHLLQIVHNLCNPQN  812
                  +    + ++   F    T +      V      + +  K  H + ++  L  P  
Sbjct  180   TAEVLAMMPSVFVLSYIFCMESTSLH-----VKRDDSGSFSSFKVEHFVDLIRTLHLPT-  233

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
                +EE   +   F              +S + + T L +AGV  K    S++LF I+F 
Sbjct  234   ---EEENSKYQRPF-------------EASPVPSMTTLHQAGVKFK-ARSSNNLFDIRFK  276

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
                LEIP   I   TE   RN+IA+EQ  CD N  YF+DY  LMDNL+NT  DV L   N
Sbjct  277   DGSLEIPNLMIAYSTELLLRNLIAFEQCHCDCN--YFSDYIFLMDNLVNTPNDVELLVKN  334

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ N LGD  +V+ L N L KGVV+     FYY+ +   +N +Y KPWN   A L+  Y
Sbjct  335   GIVENLLGDKNKVSTLINSLGKGVVFDKA-SFYYATLTADINKYYKKPWNEWKANLKQKY  393

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             FNT W  IS I A   + LT  QTV +V
Sbjct  394   FNTTWDTISVIGAPIAIILTFVQTVCSV  421



>ref|XP_009395234.1| PREDICTED: UPF0481 protein At3g47200-like [Musa acuminata subsp. 
malaccensis]
Length=483

 Score =   225 bits (574),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 155/456 (34%), Positives = 233/456 (51%), Gaps = 43/456 (9%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             I KV    +  N  AY P ++S+GPYHH N  L  ME+LK  YL  FL R    S+E   
Sbjct  39    ISKVPRIFQEVNPKAYEPKMVSLGPYHHRNIHLKAMEDLKWHYLQKFLGRNPGKSLEDYI  98

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLY---------Reyd  479
             E++K  +  A   Y +       +D + D+F +M+LLD CF+ E ++             
Sbjct  99    EQIKKRELLARMAYSEK------VDMSSDEFAQMMLLDCCFVIEIIHSWKPFVEIKETVP  152

Query  480   eetkkeeeeelnkkkCDNNAVFMP-TGMKF---QVFRDLLLLENQLPFFVLQELHGMVYD  647
                 +              AV  P T  ++    + RD+L+LENQLPFF+LQ L    +D
Sbjct  153   TFRTRLPMSMHQTVGKGTEAVQNPNTSTRYILPAIARDMLMLENQLPFFLLQTL----FD  208

Query  648   ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQE  827
              + P   D++K      L +  +   +   L  +N      HLL ++H   +P     ++
Sbjct  209   SAYPDKSDLLKKHAFEFLGETFMNRKM--KLASDNGDVY--HLLHMLHFSISPPEKN-RD  263

Query  828   ERHYWTLCFPCSLGKQSQ----DSKVGSSD-------IRTATELQEAGVNLKKVVKSSSL  974
             +   +  C+P    K+S+    D   G+         I +AT+L EAGV+ +K  K+++L
Sbjct  264   DGEPFAFCWPLQSMKKSRHQPKDDLEGTDHQTRQLKWIPSATQLMEAGVHFRKKEKATNL  323

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKN-NMYFTDYAQLMDNLINTEKD  1151
               I F++  +EI    I D TETF RN+IA+EQ  C KN +++ T YA  MD +INT  D
Sbjct  324   LDITFHNGVMEIALLQIDDSTETFLRNLIAFEQ--CSKNVSLHVTAYAAFMDCIINTAAD  381

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V L + +G++++ LGD K+V DLFN+LCK V     +  Y S +   +N H+   +N   
Sbjct  382   VALLQQHGIILSGLGDGKQVADLFNKLCKEVTL-DYEKSYVSGIYKDVNKHWTNKYNQWR  440

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             A+L HDYF+ PWA IS  AA+ L  L I QT+ + L
Sbjct  441   ARLNHDYFSNPWAIISVFAAILLFGLAITQTIYSAL  476



>ref|XP_010432792.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Camelina 
sativa]
Length=413

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 150/467 (32%), Positives = 236/467 (51%), Gaps = 56/467 (12%)
 Frame = +3

Query  51    IENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             ++  EGD     + +S+K  +++L  LS++  I+KV   LR+ N DAYTP ++S G +H 
Sbjct  1     MDQNEGDDA---LVKSIKAKLESLSSLSAQCSIYKVPNKLRKLNPDAYTPRIVSFGTFHR  57

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G  +L  ME  K  YL  F+ R    S+E      +  ++ A + Y   ED++L      
Sbjct  58    GKEELQAMEEHKYRYLKSFIPRTNF-SLEDLVRIARTWEQHARNCYA--EDVKL----TT  110

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             D+FV+ML++DG F+ E L R  +   +            + + +F    M   V RD+LL
Sbjct  111   DEFVEMLVVDGSFLVELLLRSRNPLLRD-----------EKDRIFGKPMMIADVCRDMLL  159

Query  591   LENQLPFFVLQELHGMVY-DESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK  767
             +ENQLPFFV++ L  ++Y  +  P  +++V+  F+  L+          N+ D       
Sbjct  160   IENQLPFFVVKGLFLLLYYQQGTPSIMEMVQCHFSCFLS----------NIDDKKFILEP  209

Query  768   GHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNL  947
              H + ++ +                  C+   +  + +++ +   +   ATEL  AGV  
Sbjct  210   EHFVDLLRS------------------CYLPLVPIRLEETTLNVDNAPEATELHTAGVRF  251

Query  948   KKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLM  1124
             K    SS L  I F    L+IP   I D TE+ +RN+I +EQ H  DKN   F  Y  L+
Sbjct  252   KPAETSSCLLDITFVDGLLKIPTVFIDDLTESLYRNIIVFEQCHFSDKN---FLHYTTLL  308

Query  1125  DNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGH  1304
                + + KD  L   +G+LVN LG+ ++V+ LFN +CK VV+     FY+S +  KL  +
Sbjct  309   GCFVKSPKDAELLIRSGILVNNLGNAEDVSKLFNSICKEVVFGR--RFYFSTLSEKLQAY  366

Query  1305  YNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              N PWN   A LR DYF+ PW+  S +AA+ L+ LT  Q V ++L L
Sbjct  367   CNTPWNRWKAILRRDYFHNPWSVASVLAAILLIILTFIQAVCSILAL  413



>ref|XP_004292997.1| PREDICTED: UPF0481 protein At3g47200-like [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   224 bits (570),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 159/475 (33%), Positives = 229/475 (48%), Gaps = 65/475 (14%)
 Frame = +3

Query  63    EGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             + ++   P+   +   ++ L  LS+   I++V E LR  N   YTP ++SIGP HHGN  
Sbjct  14    DTEKASTPLEILIGERLEQLAPLSASCSIYRVPERLRSLNPSVYTPKVVSIGPLHHGNET  73

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME  K  YL  FL R  + ++E    K++  +    SYY   E I+     + D  V
Sbjct  74    LQDMEEHKYRYLQQFLDRTNE-NLEYYLRKIRYQEATLRSYYA--ETIKF----SSDDLV  126

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
              ++L+D  FI E     Y                   + +     M   V  DL LLENQ
Sbjct  127   TIILVDSAFIIELFLNYYFNIAN------------STDRIMSAPFMIIDVRNDLFLLENQ  174

Query  603   LPFFVLQEL----------HGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNN  752
             LPFF+L++L          HG   +  K  F+ + +  F   L  V     +  NL   N
Sbjct  175   LPFFILEDLFDPDKVNASNHG---ESEKLSFIQLCRTFFELKLEAVG----VDCNLERVN  227

Query  753   ATEMKG-HLLQIVHNLC---NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTAT  920
             ++E+KG   L I+ NLC    PQ GGI+          P ++   S             T
Sbjct  228   SSEVKGERFLDIMRNLCLPPEPQVGGIRN---------PAAIAAPS------------IT  266

Query  921   ELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMY  1100
             EL  AGV LK V  + +LF I+F +  LEIP+  I+D +E   RN+ AYEQ  C  ++  
Sbjct  267   ELHRAGVKLK-VRSTRNLFSIRFENGILEIPRLTISDDSERILRNLAAYEQ--CHYSHCR  323

Query  1101  FTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSD  1280
              ++Y  L+D  +NT  DV L    G++ N  GD  E   + N L KGV Y   + F ++ 
Sbjct  324   ISEYLDLLDCFVNTPNDVELLVKYGIVTNIFGDSSEACSMINSLGKGV-YVDYNDFCFAT  382

Query  1281  VCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             +   L+ H  KPWN   A LR +Y NTPWA +S +AAVFL+ LT+ QTV +++ L
Sbjct  383   LYEDLHKHCKKPWNKWKANLRQNYLNTPWAIVSVVAAVFLIILTVIQTVCSLISL  437



>ref|XP_006368926.1| hypothetical protein POPTR_0001s14920g [Populus trichocarpa]
 gb|ERP65495.1| hypothetical protein POPTR_0001s14920g [Populus trichocarpa]
Length=434

 Score =   223 bits (569),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 161/450 (36%), Positives = 233/450 (52%), Gaps = 41/450 (9%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             ++  ++NL    S   IFKV  G R  N  AY P ++SIGPYH G   L  ME  K  YL
Sbjct  11    IQMSLQNLSTNQSTCSIFKVPRGQRFVNERAYEPEIVSIGPYHRGKDDLKMMEEYKKHYL  70

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
               FL+R  + S+      ++  + +A  YY  D+ + L      D FV+MLLLDGCFI E
Sbjct  71    QKFLQRRPENSLTSYVAAMRGLEAQARRYY--DQTVSL----GEDAFVEMLLLDGCFIVE  124

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
              + +      ++ +          N+ V     +  ++  D+LLLENQLPF VL +L  M
Sbjct  125   LICKLATSGLQQGD---------QNDPVIGNLLILSRISYDILLLENQLPFCVLLKLSSM  175

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
                  K  F+D     F  M    RL         +  ++    HLL +V+         
Sbjct  176   AMPNEKVPFIDKASGFFEWMYPGSRL------ERSNTISSHECKHLLDLVY---------  220

Query  819   IQEERHYWTLCFPCSL--GKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF-HIKF  989
                  H W L  P  L  G +++++K+    IR+A EL++AG+   K   S  LF  ++F
Sbjct  221   -----HKWLLPSPSELPSGIEAKNTKL--EFIRSAKELKDAGIKFGKQEGSFGLFLGVRF  273

Query  990   NHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRM  1169
                 ++IP   I D TE+ FRN+IAYEQ S  + ++Y TDY  LMD LINT +DV + R 
Sbjct  274   EKDMIKIPCLKIDDTTESLFRNLIAYEQCS-QRQHLYVTDYITLMDCLINTREDVRILRH  332

Query  1170  NGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHD  1349
              G++ N LGDD+ V  LFN+L   V+ S    FYY+ +   +  H  +  NV + KLR +
Sbjct  333   RGIIENGLGDDEMVCTLFNKLGINVMISDRGRFYYAQLFEGVEKHCAQRRNVWLVKLRRN  392

Query  1350  YFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             +FN+PW+ IS +AA+ LL LT+ QTV  V+
Sbjct  393   HFNSPWSLISFLAALTLLLLTLVQTVFTVM  422



>emb|CAB96664.1| putative protein [Arabidopsis thaliana]
Length=422

 Score =   223 bits (568),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 147/456 (32%), Positives = 228/456 (50%), Gaps = 51/456 (11%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             + +S+K ++++L  LS+  CI+K  E LRR N DAY+P ++SIGP H+G  +L  ME+ K
Sbjct  15    LVDSIKENLESLSSLSTNCCIYKAPERLRRLNPDAYSPRVVSIGPLHYGKEELQAMEDHK  74

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
             L YL  F+ R    S+E      +  +E+A   Y   ED++L    + D++VKML++D  
Sbjct  75    LRYLQSFIPRTAL-SLEDLVRVARTWEERARFCYT--EDVRL----SSDEYVKMLIVDAS  127

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             F+ E L R   +  +              + ++    M   V  D++LLENQLP+FV++ 
Sbjct  128   FLVELLLRSQFDVYRGML-----------DRIYGKQKMIVDVNHDVMLLENQLPYFVVEG  176

Query  627   LHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL  797
             + G++   Y    P    I+   F         IP    ++ D+       H + ++ ++
Sbjct  177   MFGLLHVDYHRELPPLTRIIHNHFKKFWMS---IPSFSRSISDSKIC----HFVDLLRSI  229

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF  977
               P             L FP     +  DS      + +A E+Q AGV L+    ++   
Sbjct  230   HLP-----------LVLSFPGG-SMRMMDS------VLSAKEIQNAGVKLQPADNNTCAL  271

Query  978   HIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              I F +  L IPK  I D TE+ +RN+I +EQ  C + + YF  Y + +   I +  D  
Sbjct  272   DISFANGVLTIPKIKINDITESLYRNIILFEQ--CHRLDAYFIHYMRFLSCFIRSPMDAE  329

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             LF  +G++VN  G+ ++V+ LFN + K   YS   GFYY  V   L  H N PWN   A 
Sbjct  330   LFIDHGIIVNRFGNAEDVSRLFNSILKETSYS---GFYYKTVYGNLQAHCNAPWNKWKAT  386

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             LR DYF+ PW+  S +AA  LL LT  Q + ++L L
Sbjct  387   LRRDYFHNPWSAASVVAACVLLLLTFVQAICSILAL  422



>ref|XP_011086479.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Sesamum 
indicum]
Length=423

 Score =   223 bits (567),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 151/449 (34%), Positives = 237/449 (53%), Gaps = 42/449 (9%)
 Frame = +3

Query  90    YESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKL  269
             Y  +  ++  L +  ++  I++VH+ LR  N  AY P +I+IGPYH     L  ME  KL
Sbjct  10    YTLISHELSQLSEARTQRSIYRVHKDLRDVNNKAYEPEIIAIGPYHRDKDHLKMMEEHKL  69

Query  270   MYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
              YL L LKR+K+ ++E     + + +++A + Y +     + L+SA  KF+KML+LD CF
Sbjct  70    WYLHLLLKRKKE-NVEAYISAMGELEQEARNCYAE----PVSLNSA--KFIKMLVLDSCF  122

Query  450   IAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL  629
             I E + ++++ +              +++ +F    +   +  D++L ENQ+PFF+L  L
Sbjct  123   IIELVRKDHEGDH-------------EDDPIFEMGWIMNSLQPDIILFENQIPFFILCRL  169

Query  630   HGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ  809
               M+   ++   L    + F       RL      N  + +  E+K HLL ++H+     
Sbjct  170   FDMIEGPNRHNMLIDRLLLFYQNNPGGRL-----KNKTERSLQEIK-HLLDLIHS-----  218

Query  810   NGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKF  989
                I      +         ++ Q        I  ATEL +A V  K V +S + F + F
Sbjct  219   -SLIDSVEELYVNVEEVPKTREWQF-------IPPATELTDANVAFKNV-ESDNFFKVDF  269

Query  990   NHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYF-TDYAQLMDNLINTEKDVNLFR  1166
                 + IP F I D  E  FRN+IA+EQ+S       F TDY + MD LIN+ KDV +  
Sbjct  270   RDGIMLIPHFIIDDSKECLFRNLIAHEQYSSTTTRPNFVTDYVRFMDCLINSSKDVEILS  329

Query  1167  MNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRH  1346
               G++ NWLGD++EV ++FN+L   V  +  D F+Y  +C+++N HY K WN  MA LR 
Sbjct  330   ECGIIENWLGDNEEVANIFNQLFTSVTLTR-DNFFYGTICDRVNTHYKKRWNRAMALLRR  388

Query  1347  DYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             DYFN+PW+  S  AA+ +L LT+AQTV++
Sbjct  389   DYFNSPWSYFSFSAALAILLLTVAQTVLS  417



>ref|XP_007022358.1| Uncharacterized protein TCM_032589 [Theobroma cacao]
 gb|EOY13883.1| Uncharacterized protein TCM_032589 [Theobroma cacao]
Length=632

 Score =   227 bits (579),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 166/508 (33%), Positives = 243/508 (48%), Gaps = 85/508 (17%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG-NAKLSKMENLKLMYLDLF  287
             ++   +L  +A + KV   +R+ N  AY P LISIGPY+HG    L +ME  K   L   
Sbjct  149   LRESPRLDEKAYLLKVPHQIRQVNESAYEPQLISIGPYYHGAKPHLIEMEVYKNQCLQRI  208

Query  288   LKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLY  467
             L+R+ +   E+C + +  + E+A  +Y       L   +   KF +M+L DGCFI E L 
Sbjct  209   LERKGEQIKERCVKAM--NLERARKWYSPSLSKLLEDPNVYKKFEEMMLHDGCFIVELL-  265

Query  468   ReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYD  647
                            N K   ++ +F    +   +F D LLLENQLPFFVL  L+ ++ D
Sbjct  266   ---------------NGKVPGDDPIFKLKWVLNALFHDFLLLENQLPFFVLVGLYHVIKD  310

Query  648   ESKPK-FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQ  824
              S  K F        +++L   +      PN+ D +  +   HLL ++H+  +P   GI+
Sbjct  311   PSDEKDFACQAFSVLSNLLPGPKRWNKNPPNIKDTDNIK---HLLSLIHDNWSPSPQGIR  367

Query  825   EERHYW------------------------TLC---------------------------  851
               + Y+                        TLC                           
Sbjct  368   RHQEYYRTKKDKAMAGEEEREESGLEKWKFTLCAIEKPKEKKCQGDEESGVTKGADHNSF  427

Query  852   ---FPCSLGKQSQDSK--VGSSDIRTATELQEAGVNLKKVVKSS---SLFHIKFNHAELE  1007
                F C   ++    K  V    +  ATEL+EAG+      + S   SLF + F  A ++
Sbjct  428   KWKFICCAREKKNVRKGLVEWQSLHCATELEEAGIQFMNSTEESDVKSLFDVSFTDATMK  487

Query  1008  IPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVN  1187
             IP F + D TE  FRN+IAYEQ+  ++ + Y  DY  LMDNLI++ KDV L R +G++ N
Sbjct  488   IPTFVVEDYTERLFRNLIAYEQY--EEGSTYVIDYVTLMDNLIDSAKDVQLLRFSGIIEN  545

Query  1188  WLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPW  1367
              LGDDK V  + N+L   V     D FYY ++   +  HY + WN   AKLRHDYFN+PW
Sbjct  546   MLGDDKAVAQMLNKLRDHVTLCG-DTFYYEEIFVDVKKHYGRRWNTWKAKLRHDYFNSPW  604

Query  1368  AGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             A +S IAA+ ++ LTI Q + A++ L K
Sbjct  605   ALVSFIAALLVILLTIGQFITAIIPLVK  632



>gb|KDO58836.1| hypothetical protein CISIN_1g014434mg [Citrus sinensis]
Length=424

 Score =   221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 159/460 (35%), Positives = 238/460 (52%), Gaps = 55/460 (12%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             E L+  ++ L  L S  CI++V E LR+ N  AYTP ++SIGP HHG A L  ME+ K  
Sbjct  3     ECLQVKLEKLSPLPSNCCIYRVPERLRQINEKAYTPQVVSIGPLHHGKANLQFMEDHKQR  62

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL  FL+R    S ++  + +K  + +    Y   E I+L    + DKFV+M+LLD  FI
Sbjct  63    YLRYFLQRAI-ISFDEFVQFIKLREAELRGSYA--EKIEL----SSDKFVEMILLDAGFI  115

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              E L R +  + +K            ++ +F    +   ++ D+ LLENQLPFF+L++L 
Sbjct  116   IELLLRYHFRQPQK-----------KDDHIFHKPYLIEDIWYDMWLLENQLPFFILEDLF  164

Query  633   GMVYDE-----SKPKFLDIVKITFASM--LTKVRL-IPPIVPNLGDNNATEMK-GHLLQI  785
              +   E       P  + +    F  +  +   RL  PP          TE +  H L  
Sbjct  165   ALAAIEIPEQHENPTIITVTYEYFKGLEAVQGNRLKFPPY---------TEARVEHFLDF  215

Query  786   VHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
             +  +C+  +   QE++           G+Q +  K     + + T+L +AGV    + KS
Sbjct  216   L-RICHLPSSRNQEKQE----------GQQYRKGKT----VPSVTDLHQAGVRFS-LSKS  259

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
             + LF I+F ++ L IPK  +   TE+ FRN+IA+EQ    +N  Y  DY  L+ +L+NT 
Sbjct  260   NDLFAIEFKNSTLHIPKLKLQLETESLFRNLIAFEQRHYSEN--YINDYVFLIHHLVNTA  317

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             KDV L   NG++ NWL D +  + L N L +G    + D FY+S +C  LN H  +    
Sbjct  318   KDVELLVQNGIIENWLPDKEAASTLINNLSRGTTLLA-DRFYFSGLCKGLNDHCKRTCYK  376

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               A L+ +YFNTPWAGIS   AVFLL LT+ Q V +V+ +
Sbjct  377   WRANLKQNYFNTPWAGISVCGAVFLLILTVIQAVCSVIQV  416



>ref|XP_008245592.1| PREDICTED: UPF0481 protein At3g47200-like [Prunus mume]
Length=441

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 154/455 (34%), Positives = 233/455 (51%), Gaps = 37/455 (8%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             +P+  S+++++  L  LSS  CI++V E LR  N +AYTP ++SIGP HHG   L  ME 
Sbjct  17    IPLETSMRQELGRLSPLSSSCCIYRVPERLRLVNENAYTPQVVSIGPLHHGKKGLEAMEE  76

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL R K  S+E C +K++D + +  + Y +       +  + D+FV+++L+D
Sbjct  77    HKKRYLQEFLCRTK-VSLEDCIKKIRDQETRLRNCYAET------IGFSSDEFVRIILVD  129

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI E L +      +K           +N+ +F    M   +  D+ LLENQLPFF+L
Sbjct  130   AAFIIELLLKSNFRTPRK-----------ENDRIFNKPVMFHDIMTDMQLLENQLPFFIL  178

Query  621   QELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
             ++L           +L    ++  S  +  RL    V +L     T     + Q      
Sbjct  179   EDLF----------YLQEGTLSSDSDTSDDRL-STFVTDLSLKFFTSTMILMYQADQEFI  227

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRT--ATELQEAGVNLKKVVKSSSL  974
               +    ++  H+  L    SL +      +   D+ T   TEL +AGV  K V    ++
Sbjct  228   LKRLSSTKKVEHFLDLILR-SLCQSEVVPSIPLEDLTTPSVTELYQAGVKFK-VGSRKNI  285

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             F I+F    LEIPK  + D TE   RN++A+EQ  C   + Y  DY  +MD  +N   DV
Sbjct  286   FDIRFTDGILEIPKIKVEDHTEISLRNLLAFEQ--CHYQHNYVCDYMIMMDRFVNNASDV  343

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             +L    G++ N LGD KEV  LFN L  G+ + S D F ++++C  LN + +   +  MA
Sbjct  344   DLLVDRGIIENVLGDRKEVAALFNNLGIGI-FGSHD-FTFANLCQDLNRYCSSTRHKRMA  401

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
              LR +YFNTPW  +S IAAV LL LT+ QTV +++
Sbjct  402   NLRQNYFNTPWRTLSVIAAVVLLILTLIQTVCSII  436



>ref|XP_009608055.1| PREDICTED: UPF0481 protein At3g47200-like [Nicotiana tomentosiformis]
Length=450

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 218/418 (52%), Gaps = 70/418 (17%)
 Frame = +3

Query  51    IENTEG-DQQDLPIYESLKRDI-KNLKQLSSEA----CIFKVHEGLRRTNTDAYTPLLIS  212
             IE T G DQ  L   +S K+   +N K  ++ +     IFKV  GL  +N ++Y P+LIS
Sbjct  60    IEETNGQDQSRLQTIKSAKQIYDENFKDFNNSSIKSTTIFKVSAGLSESNPNSYKPMLIS  119

Query  213   IGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQL  392
             IGPYH  N +L  +E  KLMYL  F +R++   +E C  K+++ K++A   Y D  D   
Sbjct  120   IGPYHKHNTELRSIEKYKLMYLQRFFRRKEGIDVESCIRKIEELKDEARKCYDDIHD--F  177

Query  393   LLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKF--  566
               D+ G+ F+ MLL+DGCF+ E++                           +PTG     
Sbjct  178   YSDNIGE-FLLMLLVDGCFVVEYIREC---------------------CGIIPTGEDIII  215

Query  567   -------QVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPP  725
                    QV RDLLLLENQLPFFVL +LH M  +  +  F+ +VK TF   L K   I P
Sbjct  216   RGGCIDNQVRRDLLLLENQLPFFVLAKLHDMTMEVDQTSFIIMVKCTFLPCLPK---ITP  272

Query  726   IVPNLGDNNATEMKGHLLQIVHNLCNPQ---------NGGIQEERHYWTLCFPCSLGKQS  878
                   + NA  +K HLLQ+VH  C+P          N  I+ ER   +LC       +S
Sbjct  273   ASFVETEGNAKNIK-HLLQLVHMSCHPSEMKTSLTRNNPSIEIERCGKSLCGNLLQIIKS  331

Query  879   QDSKVGSSDI------RTATELQEAGVNLKKV------------VKSSSLFHIKFNHAEL  1004
             ++  + S+ +        ATEL EAGVN  KV              S+SLF I F +  +
Sbjct  332   KEIAIDSNHLIWHDIMPNATELCEAGVNFAKVGTVYTCLEEDNLEDSTSLFDITFENGLM  391

Query  1005  EIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
             +IP FH+ D TET  RN+IAYEQ S + ++ YF+DYA  MD LI++EKDVNL R+ GV
Sbjct  392   KIPCFHVVDDTETILRNLIAYEQQSPNAHSRYFSDYAVFMDYLIDSEKDVNLLRLKGV  449



>ref|XP_006420579.1| hypothetical protein CICLE_v10005049mg [Citrus clementina]
 ref|XP_006420580.1| hypothetical protein CICLE_v10005049mg [Citrus clementina]
 gb|ESR33819.1| hypothetical protein CICLE_v10005049mg [Citrus clementina]
 gb|ESR33820.1| hypothetical protein CICLE_v10005049mg [Citrus clementina]
Length=419

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 218/418 (52%), Gaps = 54/418 (13%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S +  IFKV + LR+ N  AY P +++IG YHHG  +L   E  K  YL   L+R + P 
Sbjct  25    SDQFNIFKVPDVLRKLNEKAYEPEMLAIGSYHHGKEQLLAFEEHKTRYLKKLLERTRIPL  84

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
              +     ++  +E+A   YG    +        D+FV+M+LLDGCFI E + +   +  +
Sbjct  85    SDYVM-AMRALEERARKCYGGSTSLN------RDEFVQMMLLDGCFIVEVIRKFRLKHLR  137

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
                         D++  F    M   + RD++LLENQLPFFV+ +L  M     K    D
Sbjct  138   G-----------DDDPNFKLGWMLPSIARDMILLENQLPFFVIWKLFMMTDMPRKGCRRD  186

Query  672   IVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLC  851
             IV         +V + P            E+K H++ ++H    P   G++  R+  T  
Sbjct  187   IV--------YQVDVYP----------INEIK-HVVHLIHENWLPSPAGVEAYRNNAT--  225

Query  852   FPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV--VKSSSLFHIKFNHAELEIPKFHI  1025
                     S  S +GS     ATE+QEAG++ +KV  +K  SLF IKF +  +++P   I
Sbjct  226   ------NDSYWSFIGS-----ATEIQEAGIHFRKVEVLKDDSLFDIKFENGVMKMPSLEI  274

Query  1026  TDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDK  1205
              D TET  +N IAYEQ S D N  +  DY + ++ LIN+ KD  L R  G++ N LGDD+
Sbjct  275   GDATETILQNFIAYEQCSQDLNLKHVIDYVEFLNCLINSSKDAELLRRRGIIENLLGDDE  334

Query  1206  EVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGIS  1379
              +  L N+LC GVV    + FYY +V NK+  H ++  N  MAKLRH+YFNTPWA IS
Sbjct  335   VIATLLNKLCDGVVLG--EKFYYREVFNKVILHCSRRRNKWMAKLRHNYFNTPWAIIS  390



>ref|XP_006293111.1| hypothetical protein CARUB_v10019405mg [Capsella rubella]
 gb|EOA26009.1| hypothetical protein CARUB_v10019405mg [Capsella rubella]
Length=525

 Score =   223 bits (569),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 153/442 (35%), Positives = 236/442 (53%), Gaps = 44/442 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L++ +T++Y P  +S+GPYHHG+  L  M++ K   +++ LKR KQ  +E  
Sbjct  101   CIYRVPHSLQKNDTNSYFPQTVSLGPYHHGDEHLRPMDHHKWRAVNMVLKRTKQ-GIETY  159

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y         ++ + +KF +ML+LDGCF+ E L+R  DE   K   
Sbjct  160   IDAMKELEERARACYEGP------INLSSNKFTQMLVLDGCFVLE-LFRGADEGFSKLGY  212

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM-VYDESKPKFLDIVK  680
             +        N+ VF   G    V RD+L+LENQLP+FVL  L  + +  ++KP  + I+ 
Sbjct  213   DR-------NDPVFAMRGSMHSVRRDMLMLENQLPWFVLNRLFDLQLGTQNKPGLVAILA  265

Query  681   ITFASMLTKVRLIPPIVPN----------LGDNNATEMKGHLLQIVH-NLCNPQ---NGG  818
             + F + L    +    V N          + D +  E+  H L +   ++  P       
Sbjct  266   VGFFNPLMPTYMPSTKVGNSLVNNKFFNPIADKDKEEL--HCLDVFRRSVLQPSLKPEPR  323

Query  819   IQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHA  998
             +   R  W    P    K+ Q        +   TEL+EAG+  K   KS   + I+F + 
Sbjct  324   LSRSRWSWK---PLVADKRQQQL------LHCVTELREAGIKFKSR-KSDRFWDIQFKNG  373

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
              LEIPK  I D T++ F N+IAYEQ   D  N   T Y   MDNLI++ +DV       +
Sbjct  374   CLEIPKLLIHDGTKSLFSNLIAYEQCHIDSTND-ITSYIIFMDNLIDSAEDVRYLHYYDI  432

Query  1179  LVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFN  1358
             + +WLG+D EV D+FNRLC+ V +   +  Y S++ +K++ +YN+ WNV+ A L+H YFN
Sbjct  433   IEHWLGNDSEVADVFNRLCQEVAFD-LENTYLSELSHKVDSYYNRKWNVVKATLKHKYFN  491

Query  1359  TPWAGISTIAAVFLLSLTIAQT  1424
              PWA  S  AAV LL LT+ Q+
Sbjct  492   NPWAYFSFFAAVILLLLTLFQS  513



>ref|XP_010431199.1| PREDICTED: LOW QUALITY PROTEIN: UPF0481 protein At3g47200 [Camelina 
sativa]
Length=464

 Score =   221 bits (564),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 152/432 (35%), Positives = 231/432 (53%), Gaps = 38/432 (9%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V + L++ + ++Y P  +S+GPYHHG+  L  M+  K   +++ LKR KQ  +E  
Sbjct  53    CIYRVPQSLQKNDKNSYIPQTVSLGPYHHGDEHLQPMDYHKWRAVNMVLKRTKQ-GIETY  111

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +K+ +E+A A Y G        +D + +KF +ML LDGCF+ E L+R  DE   K E
Sbjct  112   IDAMKELEERARACYEGR-------IDMSSNKFTEMLXLDGCFVLE-LFRGADEGFSKLE  163

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM-VYDESKPKFLDIV  677
                       N+ VF   G    + RD+L+LENQLP FVL  L  + +  +S+   + I+
Sbjct  164   YNR-------NDPVFAMRGSMHSIRRDMLMLENQLPLFVLNRLLDLQLGTQSQTGLVAIL  216

Query  678   KITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ---NGGIQEERHYWTL  848
              + F +      L+P  +P+    ++ E    L     ++  P       +   R  W  
Sbjct  217   AVRFFN-----PLMPTYMPSTKIEDSQEELHCLDVFRRSVLQPSLKPEPRLSRSRWSWK-  270

Query  849   CFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHIT  1028
               P    K+ Q        +   TEL+EAG+  K+  KS   + I+F +  LEIPK  I 
Sbjct  271   --PLVADKRQQQL------LHCVTELREAGIKFKRR-KSDRFWDIQFKNGCLEIPKLLIH  321

Query  1029  DPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKE  1208
             D T++ F N+IAYEQ   D  N   T Y   MDNLI++ +DV       ++ +WLG+D E
Sbjct  322   DGTKSLFSNLIAYEQCHIDSTND-ITSYIIFMDNLIDSAEDVRHLHYYNIIEHWLGNDSE  380

Query  1209  VTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIA  1388
             V D+FNRLC+ V +   +  Y S + +K++ +YN+ WNV+ A L+H YFN PWA  S  A
Sbjct  381   VADVFNRLCQEVAFD-LENTYLSVLSHKVDSYYNRKWNVVKATLKHKYFNNPWAYFSFFA  439

Query  1389  AVFLLSLTIAQT  1424
             AV LL LT+ Q+
Sbjct  440   AVILLLLTLFQS  451



>ref|XP_010242713.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
Length=608

 Score =   225 bits (573),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 155/455 (34%), Positives = 236/455 (52%), Gaps = 46/455 (10%)
 Frame = +3

Query  111   IKNLKQLSS----EACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             IKN  +LSS    + CI+++   LR+TN  AY P +ISIGP+H     L  ME  K  YL
Sbjct  181   IKNKVELSSARSTDCCIYRIPNTLRKTNEKAYVPEIISIGPFHRCKENLGAMEEHKQWYL  240

Query  279   DLFLKREKQPS--MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
                L R   P   ++ C + ++  +  A   Y   E I  L   + D+FV+M+L+DGCF+
Sbjct  241   KALLSRTTDPDKILDDCIKAMRALEANARKCYS--EPIDYL---SSDEFVEMMLVDGCFM  295

Query  453   AEFLYReydeetkkee--eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
              E  +R  ++  +++E   ++   K    + +F    M   + RD+LLLENQLPFFVL+ 
Sbjct  296   IELFFRYSEQHLEEQECLMKKNEVKLDQKDPIFSSERMLPTILRDMLLLENQLPFFVLEW  355

Query  627   LHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG-HLLQIVHNLCN  803
             L  ++    K K +  +     +    V  +P  +  +   + T +KG HLL ++     
Sbjct  356   LFDIIIAPVKQKSVSSLNQLVFNFFANV--LP--MGGMKSKDRTHLKGEHLLHLLRR---  408

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDI-RTATELQEAGVNLKKVVKSSSLFH  980
                 GI           P S  ++ +D  +   +I    TEL+EAGV  KK  K+ S   
Sbjct  409   ----GI----------LPSSAMRKPRD--IQEPEITHCVTELREAGVKFKKKDKADSFMD  452

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQ--HSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             I F++  +EIP  ++ D T   FRN+IA+EQ  HSC       T YA LMD+LI+T +DV
Sbjct  453   ITFSNGVVEIPNLNVQDYTNCLFRNLIAFEQCYHSCTSR---ITSYAYLMDSLIDTPEDV  509

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
                +   ++ + +G+ +EV+ LFN LC GV     + FYY D+C ++N H+   W+   A
Sbjct  510   QYLKRRRIITHLMGNHEEVSFLFNNLCNGVYL---NHFYYVDLCEQVNAHFRSRWHTWRA  566

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
              L  DYF  PWA +S  AA+ LL+LT    + + L
Sbjct  567   SLMRDYFKNPWAVLSFTAAILLLALTFIGALFSTL  601



>ref|XP_002515541.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46990.1| conserved hypothetical protein [Ricinus communis]
Length=433

 Score =   220 bits (561),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 160/474 (34%), Positives = 235/474 (50%), Gaps = 67/474 (14%)
 Frame = +3

Query  60    TEGDQQDLPIYESLKRDIKNLKQ-----LSSEACIFKVHEGLRRTNTDAYTPLLISIGPY  224
             TE ++     ++   ++I  + +     LSS  CI++V   LR+ N +AYTP +ISIGP+
Sbjct  13    TEAEESSSTEFDEFVKNISKMLEHLEPPLSSNCCIYRVPPRLRKVNEEAYTPQVISIGPF  72

Query  225   HHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDS  404
             HHG+ +L  ME  KL YL  FL+R K  S+    + +K  ++   S Y   E I+L    
Sbjct  73    HHGDPRLQTMEKHKLRYLRKFLERTKT-SLRSFVQDIKQKEDSIRSCYA--ETIEL----  125

Query  405   AGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDL  584
               ++FVKM+L D  FI E   R+Y  + +            +++        +  +  DL
Sbjct  126   GSNEFVKMILTDSTFIIEHFLRKYFPDLQD-----------EHDRTVCKPWRQGDIKNDL  174

Query  585   LLLENQLPFFVLQELHGMVYDESK---PKFLDIVKITFASMLTKVRLIPPIVPNLGDNNA  755
             +LLENQLP FV+++L+ + +   +   P FL++    F S                 NN 
Sbjct  175   ILLENQLPLFVIKDLYELAFSSFQNKCPSFLELAFHFFKSF----------------NNQ  218

Query  756   TEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFP-CSLGKQSQDSKVGSSDIRTATELQE  932
              +             +PQ G         +   P C   + + D K+    I +ATELQ 
Sbjct  219   GK-------------SPQEGAKHFTDMLRSFLLPWCKSSEPTDDDKMLY--IHSATELQG  263

Query  933   AGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQ--HSCDKNNMYFT  1106
             AGV  K V  +  L  ++F    LEIP+F I   TE+  RN++A EQ  + C   N Y  
Sbjct  264   AGVKFK-VSSTKCLLRLQFTDQVLEIPRFRIHSRTESILRNLMALEQCLYPC---NTYIC  319

Query  1107  DYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDG-FYYSDV  1283
             DY  LMD LINTE DV+L     ++VN LG+  EV  L N LCK +    C+G F+YS +
Sbjct  320   DYIFLMDCLINTENDVDLLIDKKIIVNGLGNSSEVATLLNNLCKHITL--CEGCFFYSKI  377

Query  1284  CNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               +LN +Y   W+   A    DYF  PW   STIAAV LL LT+ QT+ +++ L
Sbjct  378   SEELNNYYEVLWHSWNATFIRDYFGNPWLTASTIAAVVLLILTLVQTIFSIISL  431



>ref|XP_002282564.2| PREDICTED: UPF0481 protein At3g47200 [Vitis vinifera]
Length=442

 Score =   220 bits (561),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 151/438 (34%), Positives = 228/438 (52%), Gaps = 43/438 (10%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             ++R +++L  LS+E CI++V + LR+   +AY P L+SIGP H+G   L  ME LKL YL
Sbjct  24    VERMLESLTPLSNECCIYRVPQKLRKAKNEAYEPRLLSIGPLHYGKKHLVAMEELKLRYL  83

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
               F  R  Q S+++  E +   +      Y   E ++L    + + F+ M+L+DGCFI E
Sbjct  84    QNFRSRFNQKSLKEYVEIISKMERNIRDSYS--ESVEL----SSEDFLTMILVDGCFIIE  137

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
              +   Y  + ++            N+ ++    +   V RD+ LLENQLPF +LQ L+ +
Sbjct  138   VILCSYYPDLRE-----------SNDRIYNKPWLITDVRRDMTLLENQLPFSLLQILYNL  186

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
                E +    D   +T +    K  L  P + +  + N    K      + + C  +   
Sbjct  187   ALPEHEN---DCSFLTLSIEFFKDCLQMPEIKSPREMNEFARK------ISSSCKVE---  234

Query  819   IQEERHYWTLCFPCSL-----GKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
                  H+  L   C L       + Q +K  ++ I TAT+L+EAGV+ +   K   L  I
Sbjct  235   -----HFVDLLRVCQLPSSLRSSRDQSNKRINTMILTATQLREAGVSFELGSKEKPLLDI  289

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCD-KNNMYFTDYAQLMDNLINTEKDVNL  1160
             ++    LEIPK  + D  E+ FRN+IA+EQ  C  + + Y TDY  LMD+LINT KDV++
Sbjct  290   EYRDGVLEIPKLILADACESLFRNIIAFEQ--CHYREDTYITDYIYLMDHLINTTKDVDI  347

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
                 G++ NWLGD+  VTDLFN L           FY++ +   LN + + PW+   A L
Sbjct  348   LVNKGIIDNWLGDNVAVTDLFNNLLINATLWG-RNFYFAGIFEGLNAYCDVPWHSWKATL  406

Query  1341  RHDYFNTPWAGISTIAAV  1394
             RHDYF++PW G ST AAV
Sbjct  407   RHDYFSSPWRGASTSAAV  424



>ref|XP_007206473.1| hypothetical protein PRUPE_ppa1027120mg [Prunus persica]
 gb|EMJ07672.1| hypothetical protein PRUPE_ppa1027120mg [Prunus persica]
Length=534

 Score =   223 bits (567),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 154/458 (34%), Positives = 238/458 (52%), Gaps = 57/458 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI++V   LR  +  A  P ++S+GPYHHG  +L +M+  K   L   LKR  Q ++
Sbjct  102   AKLCIYRVPHYLREGDDKAIVPQIVSLGPYHHGRRRLRQMDRHKWRSLHHMLKRNNQ-NI  160

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             +   + +K+ +EKA + Y    +  + +  + ++FV+M++LDGCF+ E L+R   E  K+
Sbjct  161   QLYLDSIKEVEEKARACY----EGPVAMGISSNEFVEMMVLDGCFVLE-LFRGAAEGFKQ  215

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ +F   G    + RD+++LENQLP F+L  L G+ + + + K L +
Sbjct  216   LGYPR-------NDPIFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQFGDPEQKGL-V  267

Query  675   VKITFASMLTKVRLIPPIVPN---LGDNNATEMKGHLLQIVHNLCNP---QNG-------  815
              K+        +R   P++P    L  ++ ++++  L     N  +P   Q G       
Sbjct  268   AKLA-------LRFFDPLMPTDEPLTKSDRSKLESSLGYA--NTFDPLSDQGGLHCLDVF  318

Query  816   -------GIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVK  962
                    G+Q     W       + K S  ++V        I   TEL+EAG+  KK  K
Sbjct  319   RRSLLRRGLQPTPRVW-------IKKWSHANRVADKRRQQLIHCVTELREAGIKFKKR-K  370

Query  963   SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
             +   + +KF +  L IP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLIN+
Sbjct  371   TDRFWDVKFENGILRIPRLLIHDGTKSLFLNLIAFEQCHLDCSND-ITSYVIFMDNLINS  429

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
              +DV      G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +YN  WN
Sbjct  430   PQDVGYLHYCGIIEHWLGSDAEVADLFNRLCQEVVFDINDS-YLSRLSEDVNRYYNHRWN  488

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
                A L+H+YFN PWA +S +AAV LL LT AQT   V
Sbjct  489   AWRASLKHNYFNNPWATLSFVAAVVLLFLTFAQTFYGV  526



>ref|XP_010100242.1| hypothetical protein L484_000653 [Morus notabilis]
 gb|EXC44966.1| hypothetical protein L484_000653 [Morus notabilis]
Length=438

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 156/469 (33%), Positives = 231/469 (49%), Gaps = 65/469 (14%)
 Frame = +3

Query  69    DQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLS  248
             + Q  P+  S++ +++NL  LSS  CIF+V   LR     AYTP ++SIGP HHG A L 
Sbjct  13    ENQLTPLVNSMRLELENLSPLSSNCCIFRVPVRLRLVKEKAYTPQVVSIGPLHHGKANLK  72

Query  249   KMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKM  428
              ME  K  YL  +L R    S+E   + +K  +    S Y +       +    D+FVK+
Sbjct  73    PMEEHKKRYLKHYLTRTST-SLEHFVKIIKQKEAGLRSSYAEP------IAFTSDEFVKI  125

Query  429   LLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLP  608
             +L+D  FI E L R +++               D++ +F    M   ++ DL LLENQLP
Sbjct  126   ILVDAAFIIEVLLRYFEDYQD------------DHDRIFNKPWMLQDIWPDLTLLENQLP  173

Query  609   FFVLQELH-----GMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGH  773
             FF+L +L       +  DE +   + +VK++ A     +    P      DN+       
Sbjct  174   FFILVDLFDPKRISVRSDEGEE--ISMVKLSLAFFKGLMHFETP-----KDNSERISSSE  226

Query  774   LLQIVHNLCN-------PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQE  932
             ++  V  L +       P+ GG                       ++ +  I + TEL  
Sbjct  227   VVHFVDFLRDLYKPPPRPRTGG-----------------------ELKTLRIPSMTELHR  263

Query  933   AGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDY  1112
             AGV  K V  S +LF I+F+   LEIPK  I+D T+   RN++A+EQ  C +N  Y  DY
Sbjct  264   AGVKFK-VGSSKNLFDIRFSKGILEIPKLTISDETDLTIRNLLAFEQCHCKQN--YLNDY  320

Query  1113  AQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNK  1292
               +MD L+NT KDV+L     ++ N LGD  E  D+ N+L  GV   S D FY++ +   
Sbjct  321   VVIMDRLVNTSKDVDLLVKYEIVENMLGDSSEGADMINKLADGVFMDSND-FYFATISEG  379

Query  1293  LNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             LN +    W+   A LR +YF+TPWA +S +AAV LL LT  Q + +V+
Sbjct  380   LNKYCRTSWHKWKANLRQNYFHTPWAIVSVVAAVLLLILTFIQAICSVI  428



>ref|XP_010696168.1| PREDICTED: UPF0481 protein At3g47200-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010696169.1| PREDICTED: UPF0481 protein At3g47200-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 224/458 (49%), Gaps = 62/458 (14%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             ++KR   +L  LSS+ CI+++   LR+ N +++TP LISIGP+H GN K   ME  KL Y
Sbjct  11    TIKRKCDSLTPLSSKCCIYRIPRNLRKINENSFTPSLISIGPFHRGNPKFQAMEEQKLRY  70

Query  276   LDLFLKREKQPSMEQCWEK-LKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             L  F++R     +E      +K  KE    Y          +  +  +F +ML+LDGCFI
Sbjct  71    LQKFIQRNSNRDLEDYLSSSMKWEKEARDCYLAT-------IHLSSIEFTEMLVLDGCFI  123

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EF                       N+ +F    +   + RDL LLENQ+PFF+L+ L+
Sbjct  124   IEFFLTWVGTAVD------------PNDRIFHRPALSQAILRDLKLLENQVPFFILEILY  171

Query  633   GMVYD--ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL---  797
              + ++  E  P FL   K+T   M+            LG       K  +L +V  L   
Sbjct  172   NIAFEDNEKAPSFL---KLTCECMI-----------GLGKVPQHFKKTKILHLVDFLRTY  217

Query  798   -CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                P    I  E   W   FP  +                 +EL E+GV LK V K    
Sbjct  218   YLPPDKKEICYEDQDWE--FPDGI-----------------SELYESGVTLK-VDKDDKF  257

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
              +I+F +  L IP+  + + TE+  RN++A+EQ    + + +  DY   +D+LI   KDV
Sbjct  258   LNIEFINGVLYIPELMLENHTESQLRNLVAFEQCHYPRES-FVVDYVLFLDSLIYDRKDV  316

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             ++   +G+++N  G  ++V  LF+ + KG  YS    FYY+DVC +LN     PWN   A
Sbjct  317   DVLVNHGIILNSPGSSEDVYRLFSNISKGTTYSR-GSFYYADVCRRLNQFCGTPWNRWKA  375

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
              LR DYF+ PW+ ISTI AV LL LTI QT   ++ L+
Sbjct  376   ILRQDYFSNPWSMISTIVAVVLLVLTIIQTYCDIVQLQ  413



>ref|XP_010696167.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 224/458 (49%), Gaps = 62/458 (14%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             ++KR   +L  LSS+ CI+++   LR+ N +++TP LISIGP+H GN K   ME  KL Y
Sbjct  17    TIKRKCDSLTPLSSKCCIYRIPRNLRKINENSFTPSLISIGPFHRGNPKFQAMEEQKLRY  76

Query  276   LDLFLKREKQPSMEQ-CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             L  F++R     +E      +K  KE    Y          +  +  +F +ML+LDGCFI
Sbjct  77    LQKFIQRNSNRDLEDYLSSSMKWEKEARDCYLAT-------IHLSSIEFTEMLVLDGCFI  129

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EF                       N+ +F    +   + RDL LLENQ+PFF+L+ L+
Sbjct  130   IEFFLTWVGTAVD------------PNDRIFHRPALSQAILRDLKLLENQVPFFILEILY  177

Query  633   GMVYD--ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL---  797
              + ++  E  P FL   K+T   M+            LG       K  +L +V  L   
Sbjct  178   NIAFEDNEKAPSFL---KLTCECMI-----------GLGKVPQHFKKTKILHLVDFLRTY  223

Query  798   -CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                P    I  E   W   FP  +                 +EL E+GV LK V K    
Sbjct  224   YLPPDKKEICYEDQDWE--FPDGI-----------------SELYESGVTLK-VDKDDKF  263

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
              +I+F +  L IP+  + + TE+  RN++A+EQ    + + +  DY   +D+LI   KDV
Sbjct  264   LNIEFINGVLYIPELMLENHTESQLRNLVAFEQCHYPRES-FVVDYVLFLDSLIYDRKDV  322

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             ++   +G+++N  G  ++V  LF+ + KG  YS    FYY+DVC +LN     PWN   A
Sbjct  323   DVLVNHGIILNSPGSSEDVYRLFSNISKGTTYSR-GSFYYADVCRRLNQFCGTPWNRWKA  381

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
              LR DYF+ PW+ ISTI AV LL LTI QT   ++ L+
Sbjct  382   ILRQDYFSNPWSMISTIVAVVLLVLTIIQTYCDIVQLQ  419



>ref|XP_010696166.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 224/458 (49%), Gaps = 62/458 (14%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             ++KR   +L  LSS+ CI+++   LR+ N +++TP LISIGP+H GN K   ME  KL Y
Sbjct  22    TIKRKCDSLTPLSSKCCIYRIPRNLRKINENSFTPSLISIGPFHRGNPKFQAMEEQKLRY  81

Query  276   LDLFLKREKQPSMEQ-CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             L  F++R     +E      +K  KE    Y          +  +  +F +ML+LDGCFI
Sbjct  82    LQKFIQRNSNRDLEDYLSSSMKWEKEARDCYLAT-------IHLSSIEFTEMLVLDGCFI  134

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EF                       N+ +F    +   + RDL LLENQ+PFF+L+ L+
Sbjct  135   IEFFLTWVGTAVD------------PNDRIFHRPALSQAILRDLKLLENQVPFFILEILY  182

Query  633   GMVYD--ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL---  797
              + ++  E  P FL   K+T   M+            LG       K  +L +V  L   
Sbjct  183   NIAFEDNEKAPSFL---KLTCECMI-----------GLGKVPQHFKKTKILHLVDFLRTY  228

Query  798   -CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                P    I  E   W   FP  +                 +EL E+GV LK V K    
Sbjct  229   YLPPDKKEICYEDQDWE--FPDGI-----------------SELYESGVTLK-VDKDDKF  268

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
              +I+F +  L IP+  + + TE+  RN++A+EQ    + + +  DY   +D+LI   KDV
Sbjct  269   LNIEFINGVLYIPELMLENHTESQLRNLVAFEQCHYPRES-FVVDYVLFLDSLIYDRKDV  327

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             ++   +G+++N  G  ++V  LF+ + KG  YS    FYY+DVC +LN     PWN   A
Sbjct  328   DVLVNHGIILNSPGSSEDVYRLFSNISKGTTYSR-GSFYYADVCRRLNQFCGTPWNRWKA  386

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
              LR DYF+ PW+ ISTI AV LL LTI QT   ++ L+
Sbjct  387   ILRQDYFSNPWSMISTIVAVVLLVLTIIQTYCDIVQLQ  424



>ref|XP_008238889.1| PREDICTED: UPF0481 protein At3g47200 [Prunus mume]
Length=534

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/457 (34%), Positives = 231/457 (51%), Gaps = 55/457 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI++V   LR  +  A  P ++S+GPYHHG  +L +M+  K   L   LKR  Q ++
Sbjct  102   AKLCIYRVPHYLREGDDKAIVPQIVSLGPYHHGRRRLRQMDRHKWRSLHHMLKRTNQ-NI  160

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             +   + +K+ +EKA + Y    +  + +  + ++FV+M++LDGCF+ E L+R   E  K+
Sbjct  161   QLYLDSIKEVEEKARACY----EGPVAMGISSNEFVEMMVLDGCFVLE-LFRGAAEGFKQ  215

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ +F   G    + RD+++LENQLP F+L  L G+ + + + K L +
Sbjct  216   LGYPR-------NDPIFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQFGDPEQKGL-V  267

Query  675   VKITFASMLTKVRLIPPIVPN-----LGDNNATEMKGHLLQIVHNLCNPQNG--------  815
              K+        +R   P++P        D N  E           L + Q G        
Sbjct  268   AKLA-------LRFFDPLMPTDEPLTKSDRNKLESSLGYANTFDPLSD-QGGLHCLDVFR  319

Query  816   ------GIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKS  965
                   G+Q     W       + K S  ++V        I   TEL+EAG+  KK  K+
Sbjct  320   RSLLLRGLQPTPRVW-------IKKWSHANRVADKRRQQLIHCVTELREAGIKFKKR-KT  371

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
                + +KF +  L IP+  I D T++ F N+IA+EQ   D  N   T Y   MDNLIN+ 
Sbjct  372   DRFWDVKFKNGILRIPRLLIHDGTKSLFLNLIAFEQCHLDCGND-ITSYVIFMDNLINSP  430

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             +DV      G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +YN  WN 
Sbjct  431   QDVGYLHYCGIIEHWLGSDAEVADLFNRLCQEVVFDINDS-YLSRLSEDVNRYYNHRWNA  489

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               A L+H+YFN PWA +S +AAV LL LT AQT   V
Sbjct  490   WRASLKHNYFNNPWATLSFVAAVVLLFLTFAQTFYGV  526



>ref|NP_194926.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA16591.1| putative protein [Arabidopsis thaliana]
 emb|CAB79916.1| putative protein [Arabidopsis thaliana]
 gb|AEE85985.1| uncharacterized protein AT4G31980 [Arabidopsis thaliana]
Length=680

 Score =   224 bits (572),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 152/464 (33%), Positives = 231/464 (50%), Gaps = 57/464 (12%)
 Frame = +3

Query  63    EGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             EGD     + +S+K  +  L  LS++ CI+KV   LRR N DAYTP L+S GP H G  +
Sbjct  271   EGDA----LVDSIKAKLAFLSSLSTKCCIYKVPNKLRRLNPDAYTPRLVSFGPLHRGKEE  326

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME+ K  YL  F+ R    S+E      +  ++ A S Y +D  +        D+FV
Sbjct  327   LQAMEDQKYRYLLSFIPRTNS-SLEDLVRLARTWEQNARSCYAEDVKLH------SDEFV  379

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +ML++DG F+ E L R +    +            +N+ +F  + M   V RD++L+ENQ
Sbjct  380   EMLVVDGSFLVELLLRSHYPRLRG-----------ENDRIFGNSMMITDVCRDMILIENQ  428

Query  603   LPFFVLQELHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGH  773
             LPFFV++E+  ++   Y +  P  + + +  F+  L+++           D        H
Sbjct  429   LPFFVVKEIFLLLLNYYQQGTPSIIQLAQRHFSYFLSRI----------DDEKFITEPEH  478

Query  774   LLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKK  953
              + ++ +   PQ              FP  L    + + V   +   ATEL  AGV  K 
Sbjct  479   FVDLLRSCYLPQ--------------FPIKL----EYTTVKVDNAPEATELHTAGVRFKP  520

Query  954   VVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                SS L  I F    L+IP   + D TE+ ++N+I +EQ  C   N  F DY  L+   
Sbjct  521   AETSSCLLDISFADGVLKIPTIVVDDLTESLYKNIIGFEQCRCSNKN--FLDYIMLLGCF  578

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             I +  D +L   +G++VN+LG+  +V++LFN + K V+Y     FY+S +   L  + N 
Sbjct  579   IKSPTDADLLIHSGIIVNYLGNSVDVSNLFNSISKEVIYDR--RFYFSMLSENLQAYCNT  636

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             PWN   A LR DYF+ PWA  S  AA+ LL LT  Q+V ++L L
Sbjct  637   PWNRWKAILRRDYFHNPWAVASVFAALLLLLLTFIQSVCSILAL  680



>ref|XP_010270826.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
Length=542

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 155/454 (34%), Positives = 229/454 (50%), Gaps = 48/454 (11%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI++V + LR  +  AY P ++S+GPYHHG  +  +ME  K   L   LKR  Q  +
Sbjct  110   AKLCIYRVPKSLREGDDKAYFPQIVSLGPYHHGRRRFREMEPHKWRSLHHILKRTNQ-DV  168

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             +   E +++ +EKA + Y  D  I L    + ++FV+M++LDGCF+ E          + 
Sbjct  169   KLYLESIEELEEKARTCY--DGVIPL----SSNEFVEMMVLDGCFMLEIF--------RG  214

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
               E         N+ VF   G+   + RD+++LENQ+P F+L  L G+       K L +
Sbjct  215   AAEGFKELGYSRNDPVFAMRGIMHSIQRDMIMLENQIPLFILDRLLGLQIGVPDQKGL-V  273

Query  675   VKITFASMLTKVRLIPPIVPN---LGDNNATEMKGHLLQIVHNLCNP---QNG-------  815
              K+        +R   P+ P    L  ++ T+++  L        +P   Q G       
Sbjct  274   AKLA-------LRFFDPLTPTDEPLQKSDRTKLESSLELGHATTFDPLTDQGGLHCLDIF  326

Query  816   -------GIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                    G Q     W   +     + +   +     I   TEL+EAGV  KK  K+   
Sbjct  327   RRSLLRTGPQPSPRMWIRRWSSHAVRVADKRR--QQLIHCVTELKEAGVKFKKR-KTDRF  383

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             + IKF +  L IP+  I D T++ F N+IA+EQ   D +N Y T Y   MDNLIN+ +DV
Sbjct  384   WDIKFKNGVLSIPRLLIHDGTKSLFLNLIAFEQCHLDCSN-YITSYVIFMDNLINSPQDV  442

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
                   G++ +WLG D EV DLFNRLC+ VV+   D  Y S +  ++N +Y+  WN   A
Sbjct  443   GYLHYYGIIEHWLGSDAEVADLFNRLCQEVVFDINDS-YLSRLSEQVNRYYDHRWNAWRA  501

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              L+H+YFN PWA IS IAAV LL LT AQT   +
Sbjct  502   SLKHNYFNNPWAIISFIAAVVLLFLTGAQTFYGI  535



>ref|XP_010042668.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Eucalyptus 
grandis]
Length=412

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 245/452 (54%), Gaps = 46/452 (10%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             ++++   S E  IF+V   LR+ N  AY P++++IGPYHHGN K   ME  KL YL   L
Sbjct  2     LRSVPATSPEHSIFRVLHQLRQVNEKAYEPVILAIGPYHHGNDKFKFMEEQKLRYLQQLL  61

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             KR K+ S+++    L++ +++A + Y +       +D + +KF+ M+L+DGCFI E L R
Sbjct  62    KRRKEESVDRYMPTLRELEQQARNCYEE------TIDLSQEKFLAMMLIDGCFIIELL-R  114

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTG----MKFQVFRDLLLLENQLPFFVLQELHGM  638
             +Y      +E++    + C +  +  P G    +++ + RDLLLLENQLP FVL +L+ +
Sbjct  115   KYILNKSIDEDDSDRLRHCRSCYLDDPLGESDWLQYHLRRDLLLLENQLPLFVLSKLYDL  174

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
                  +    ++V I +     +             N A     H+L + H  C   NG 
Sbjct  175   TRGPDEHHEFNVVAIEYFEFEGE---------GPDRNWARGNWEHILHLYHAWCT--NGL  223

Query  819   IQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHA  998
              +E         PC            +  + +A EL E+GV   +  +   L  IKF + 
Sbjct  224   PREP------SLPC------------TPVMPSAIELGESGVRF-RAAEGCHLGDIKFENG  264

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
              LEIP   + D TE+ +RN+IAYEQH   +   YFTDY   +D LIN+ KDV + R  G+
Sbjct  265   TLEIPVLMVQDNTESKYRNLIAYEQHPQSRVINYFTDYVIFIDCLINSSKDVKVLRSAGI  324

Query  1179  LVNWLGDDKEVTDLFNRLCKGVV-YSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             + NWLGDD+ +  +FN++C  +V Y SC    YS++   LN H  K  NV MA LR +YF
Sbjct  325   IENWLGDDEVLAQMFNKMCDNIVSYGSC----YSEIFENLNAHCKKRRNVWMATLRREYF  380

Query  1356  NTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             ++PWA +S +AA+ LL LT AQT+ +VL  +K
Sbjct  381   HSPWAFLSVVAAIMLLLLTAAQTLYSVLSYQK  412



>ref|XP_009334804.1| PREDICTED: putative UPF0481 protein At3g02645 [Pyrus x bretschneideri]
Length=444

 Score =   219 bits (557),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 151/444 (34%), Positives = 217/444 (49%), Gaps = 60/444 (14%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
              CI+++ E LR  N  AYTP L+SIGP HHG   L +ME  K  YL  FL+R    S + 
Sbjct  37    CCIYRIPEPLRCVNEKAYTPQLVSIGPLHHGKEGLEEMEGHKRRYLQYFLERTGV-SEKD  95

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
                K+K  + +  S Y         ++ + +KFV+++L+D  FI E L R   E  K + 
Sbjct  96    YVTKIKGKEAELRSCYAH------TIEFSSEKFVEIILVDAAFIIELLLRGDGEHIKPD-  148

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ +F   G    +  D+LLLENQLPFF+L++L      +S+   L I  
Sbjct  149   ---------SNDRIFYKPGFINFMVPDMLLLENQLPFFILEDLFSWT-PKSEEDLLPIAD  198

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYW------  842
                A+ L+                       +L + +  C  ++ G   E+  W      
Sbjct  199   QVPATQLS-----------------------VLGLSYEFCK-KSTGFYMEKDNWECPSSK  234

Query  843   ---------TLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNH  995
                      TL  P + G      ++    I T T+L  AGV  + V  S +LF I+F  
Sbjct  235   VHHFVDLVRTLHLPTAKGNSKNGEQLELLGIPTLTKLHRAGVKFRPVRPSENLFDIRFTD  294

Query  996   AE--LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRM  1169
              +  L+IP   I D TE   RN+IA+EQ  C  N+ +F+DY  L+D+L+NT  DV L   
Sbjct  295   QDRILKIPNLIIDDDTELVLRNLIAFEQCHCTPNSYFFSDYIILIDHLVNTPNDVELLVK  354

Query  1170  NGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHD  1349
               ++ N LGD+ EV+ L NRLCKGVV+   D F Y+ +   L+ +   PWN  MA L+  
Sbjct  355   EEIVENLLGDNNEVSTLINRLCKGVVFDR-DEFSYAKLTKDLDNYCKNPWNKWMADLKQT  413

Query  1350  YFNTPWAGISTIAAVFLLSLTIAQ  1421
             YF+TPW  IS I A  ++ LTI Q
Sbjct  414   YFDTPWKIISFIVATCVIVLTITQ  437



>ref|XP_010042667.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Eucalyptus 
grandis]
Length=443

 Score =   218 bits (555),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 245/452 (54%), Gaps = 46/452 (10%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             ++++   S E  IF+V   LR+ N  AY P++++IGPYHHGN K   ME  KL YL   L
Sbjct  33    LRSVPATSPEHSIFRVLHQLRQVNEKAYEPVILAIGPYHHGNDKFKFMEEQKLRYLQQLL  92

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             KR K+ S+++    L++ +++A + Y +       +D + +KF+ M+L+DGCFI E L R
Sbjct  93    KRRKEESVDRYMPTLRELEQQARNCYEE------TIDLSQEKFLAMMLIDGCFIIELL-R  145

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTG----MKFQVFRDLLLLENQLPFFVLQELHGM  638
             +Y      +E++    + C +  +  P G    +++ + RDLLLLENQLP FVL +L+ +
Sbjct  146   KYILNKSIDEDDSDRLRHCRSCYLDDPLGESDWLQYHLRRDLLLLENQLPLFVLSKLYDL  205

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
                  +    ++V I +     +             N A     H+L + H  C   NG 
Sbjct  206   TRGPDEHHEFNVVAIEYFEFEGE---------GPDRNWARGNWEHILHLYHAWCT--NGL  254

Query  819   IQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHA  998
              +E         PC            +  + +A EL E+GV   +  +   L  IKF + 
Sbjct  255   PREP------SLPC------------TPVMPSAIELGESGVRF-RAAEGCHLGDIKFENG  295

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
              LEIP   + D TE+ +RN+IAYEQH   +   YFTDY   +D LIN+ KDV + R  G+
Sbjct  296   TLEIPVLMVQDNTESKYRNLIAYEQHPQSRVINYFTDYVIFIDCLINSSKDVKVLRSAGI  355

Query  1179  LVNWLGDDKEVTDLFNRLCKGVV-YSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             + NWLGDD+ +  +FN++C  +V Y SC    YS++   LN H  K  NV MA LR +YF
Sbjct  356   IENWLGDDEVLAQMFNKMCDNIVSYGSC----YSEIFENLNAHCKKRRNVWMATLRREYF  411

Query  1356  NTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             ++PWA +S +AA+ LL LT AQT+ +VL  +K
Sbjct  412   HSPWAFLSVVAAIMLLLLTAAQTLYSVLSYQK  443



>ref|XP_009128936.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Brassica 
rapa]
Length=512

 Score =   220 bits (560),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 156/455 (34%), Positives = 224/455 (49%), Gaps = 61/455 (13%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG   L  ME+ K   ++  +KR KQ  +E  
Sbjct  85    CIYRVPHYLQENDKKSYFPQTVSLGPYHHGKIHLMPMEHHKWRAVNKVMKRNKQ-QIEMY  143

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K  +EK+ + Y      Q  +  + +KF +ML+LDGCF+ E L+R   +   +   
Sbjct  144   IDAMKQLEEKSRACY------QGAIYMSSNKFTQMLVLDGCFVLE-LFRGTVDGFPEIGY  196

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
             E        N+ VF   G+   + RD+++LENQLP FVL  L G+  D            
Sbjct  197   EL-------NDPVFAMRGLMHSIQRDMIMLENQLPLFVLNRLLGLQSDTQNQ--------  241

Query  684   TFASMLTKVRLIPPIVPN------------------LGDNNATEMKGHLLQIVH-----N  794
             T       VR   P++P                   L DN       H L + H      
Sbjct  242   TGIVAEVAVRFFKPLMPTSKAVTERDQLKLMNWRRKLVDNGEL----HCLDVFHGSIFRT  297

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
               +      Q  R Y       S    S   K     I   TEL+EAGV  ++  K++ L
Sbjct  298   FQSSTRTPYQTTRRY------MSFRNMSMVDKRQQQLIHCVTELREAGVKFRRK-KTNEL  350

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKD  1151
             + I F +  LEIPK  I D T++ F N+IA+EQ H    +N+  T Y   MDNLIN+ +D
Sbjct  351   WDIGFKNGYLEIPKLLIHDGTKSLFSNLIAFEQCHIQSSHNI--TSYIIFMDNLINSSED  408

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V+     G++ +WLG D EV DLFNRLCK VV+   D  Y S + +++N +Y++ WN + 
Sbjct  409   VSYLHHCGIIEHWLGSDSEVADLFNRLCKEVVFDPQDS-YLSQLSSEVNRYYSRKWNSLK  467

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             A LRH YFN PWA  S  AAV LL  T +Q+  A+
Sbjct  468   ATLRHKYFNNPWAYFSFFAAVTLLVFTFSQSFYAI  502



>ref|XP_008378370.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
Length=438

 Score =   218 bits (554),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 159/455 (35%), Positives = 239/455 (53%), Gaps = 46/455 (10%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             +P+ +S+  ++  L  LSS  CI++V E LRR +  AYTP ++SIGP HHG   L  ME 
Sbjct  16    IPLAKSMNXELDVLAPLSSSCCIYRVPERLRRVSEKAYTPQVVSIGPLHHGKEGLQAMEE  75

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  F++R +  S+E   +K+KD + K  S Y +       ++ + D FV+++L+D
Sbjct  76    HKKRYLRDFIRRTRV-SLEHYIKKIKDQEGKIRSCYAE------TIEFSSDDFVRIVLVD  128

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               FI E L R    E +            +N+ +F    M   V+ D+ LLENQLPFFVL
Sbjct  129   AAFIIEVLLRHRFHELQD-----------ENDRIFNKPWMLQDVWPDIRLLENQLPFFVL  177

Query  621   QELHGMVYDESKPKFLDIVKITFAS-MLTKVRLIPPIVPNL--GDNNATEMKGHLLQIVH  791
             ++L    +D   P  +D+   +  +  L+ ++L      +L   D N  +M  +  +   
Sbjct  178   EDL----FD---PDKIDVPSDSNCTERLSIIKLSHVFFKDLEGADGNLDKMCAYKAEHFV  230

Query  792   NLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSS  971
             + C               L  P  L +Q++  K+ + +  + TEL  AGV   +V  + +
Sbjct  231   DFCR-------------KLYLPLPLERQAK-GKLKTLNTPSITELHRAGVKF-RVGSAKN  275

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
             L  I+FN   LEIPK  I+D TE   RN++A+EQ  C +N  Y  DY  +MD  +NT KD
Sbjct  276   LLDIQFNDGILEIPKLTISDETELTVRNLLAFEQCHCXEN--YMNDYVVIMDRFVNTAKD  333

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V L   +G++ N LGD    + L N L  GV+  S D FY++ +C  LN +    W+   
Sbjct  334   VELLVKHGIVENRLGDSSGGSTLINNLADGVIVDSND-FYFATLCEDLNKYCKTSWHKWK  392

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             A LR +Y NTPWA +S  AAV LL LT+ QT+ +V
Sbjct  393   ANLRQNYCNTPWATLSIAAAVLLLVLTLIQTMCSV  427



>ref|XP_009368238.1| PREDICTED: UPF0481 protein At3g47200 [Pyrus x bretschneideri]
Length=532

 Score =   220 bits (560),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 154/456 (34%), Positives = 233/456 (51%), Gaps = 53/456 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI+KV   LR  +  A  P ++S+GPYHHG  +L +M+  K   L   LKR  Q  +
Sbjct  100   AKHCIYKVPHYLREGDDKAIVPQIVSLGPYHHGKRRLRQMDRHKWRSLHRMLKRTNQ-CI  158

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             EQ    +K+ +EKA + Y     + L    + ++FV+M++LDGCF+ E L+R   E  K+
Sbjct  159   EQYLNSIKEVEEKARACYEGPAAMGL----SSNEFVEMMVLDGCFVLE-LFRGVGEGFKQ  213

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ +F   G    + RD+++LENQLP F+L  L G+   + + K L +
Sbjct  214   LGYPR-------NDPIFAMRGTMHSIQRDMIMLENQLPLFILDRLLGLQLGDPEQKGL-V  265

Query  675   VKITFASMLTKVRLIPPIVPN---LGDNNATEMKGHL-LQIVHNLCNPQNG---------  815
              K+        +R   P++P    L  ++  +++  L      +  + Q G         
Sbjct  266   AKLA-------LRFFDPLMPTDEPLTKSDRNKLESSLAYATTFDPLSEQGGLHCLDVFRR  318

Query  816   -----GIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSS  968
                  G+Q     W       + + S  ++V        I   TEL+EAG+  KK  K+ 
Sbjct  319   SLLRTGLQAVPRVW-------IKRWSHSNRVADKRRQQLIHCVTELREAGIKFKKR-KTD  370

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
               + +KF +  L+IP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLIN+  
Sbjct  371   RFWDVKFENGILKIPRLLIHDGTKSLFLNLIAFEQCHLDCSND-ITSYVIFMDNLINSPH  429

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVM  1328
             DV      G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +Y+  WN  
Sbjct  430   DVGYLHYCGIIEHWLGSDDEVADLFNRLCQEVVFDINDS-YLSRLSADVNRYYDHRWNAW  488

Query  1329  MAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              A L+H+YF+ PWA +S IAAV LL LT AQT   V
Sbjct  489   RASLKHNYFSNPWAILSFIAAVVLLFLTFAQTFYGV  524



>ref|XP_010093525.1| hypothetical protein L484_007240 [Morus notabilis]
 gb|EXB54191.1| hypothetical protein L484_007240 [Morus notabilis]
Length=530

 Score =   219 bits (559),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 159/444 (36%), Positives = 226/444 (51%), Gaps = 37/444 (8%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI+++   LR  +  AY P ++S+GPYHHG  +L +M+  K   L   LKR  Q  ++  
Sbjct  103   CIYRIPHYLREGDDKAYCPQIVSLGPYHHGKRRLRQMDRHKWRSLQHILKRNNQ-DIKLY  161

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A   Y  +  I L    + ++FV+M++LDGCFI E          +    
Sbjct  162   LDAIKELEERARGCY--EGSITL----SSNEFVEMMVLDGCFILELF--------QGAAG  207

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKP--------  659
                +     N+ +F   G    + RD+++LENQLP F+L  L G+   E           
Sbjct  208   GFKHLGYSRNDPIFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQLGEPNQTGLVAKLA  267

Query  660   -KFLDIVKITFASMLTKV---RLIPPIVPNLGDNNATEMKG-HLLQIVHNLCNPQNGGIQ  824
              +F D +  T    LTK    RL   I      +  +E  G H L++     +    G Q
Sbjct  268   LQFFDPLMPT-DEPLTKSGRNRLESSIGYRKTFDPLSEQDGLHCLEVFRR--SLLRRGPQ  324

Query  825   EERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAEL  1004
              E   W   +  S G +  D K     I   TEL+EAGV  KK  K+   + IKF++  L
Sbjct  325   PEPRVWIKRW--SHGNRVVD-KRRQQLIHCVTELREAGVKFKKR-KTDRFWDIKFSNGIL  380

Query  1005  EIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
             EIP+  I D T++ F N+IA EQ   D +N   T Y   MDNLIN+ +DV      G++ 
Sbjct  381   EIPRLLIHDGTKSLFLNLIALEQCHLDCSND-ITSYVVFMDNLINSSEDVGYLHYCGIIE  439

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
             +WLG D EV DLFNRLC+ VVY   D  Y S +  ++N +YN  WN   A LRH+YF+ P
Sbjct  440   HWLGSDAEVADLFNRLCQEVVYDINDS-YLSRLSAEVNRYYNHKWNAWRASLRHNYFSNP  498

Query  1365  WAGISTIAAVFLLSLTIAQTVIAV  1436
             WA IS  AAV LL LT AQ+   +
Sbjct  499   WAIISFFAAVILLLLTFAQSFYGI  522



>gb|KCW60069.1| hypothetical protein EUGRSUZ_H02798, partial [Eucalyptus grandis]
Length=352

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 143/436 (33%), Positives = 215/436 (49%), Gaps = 85/436 (19%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
              IF+V   LR+ N  AY P +++IGPYH  N K   ME  KL YL   L+R K+ S++  
Sbjct  2     SIFRVRHQLRKVNEKAYDPEILAIGPYHCENGKFKFMEEQKLRYLQQLLERRKE-SVDSY  60

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
                L++ +E+A + Y   E I L    + +KF+ M+L+DGCFI EF  +  +        
Sbjct  61    MPTLRELEERARNCYA--ETINL----SQEKFLAMMLIDGCFIIEFFRKYNNMIPTDR--  112

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      ++ V    G+   + RDL LLENQLP FVL + + +  DE   +F  +  +
Sbjct  113   ---------DDPVMRGRGIINSIRRDLQLLENQLPLFVLSKPYDLTEDEHH-EFSKVAIM  162

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCS  863
              F    + VR + P        +A E++                G++         F  +
Sbjct  163   YFQLRKSVVRSVMP--------SAIELR--------------ESGVR---------FRAA  191

Query  864   LGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTET  1043
              G++  D                                IKF +  LE+   ++ D TE+
Sbjct  192   QGRELSD--------------------------------IKFKNGTLELLVLYVEDDTES  219

Query  1044  FFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLF  1223
              FRN+IAYEQH   ++  YFTDY   MD LI++ KDV + R  G++ N+LGDDK +  +F
Sbjct  220   NFRNLIAYEQHRQSRDINYFTDYVTFMDCLISSSKDVEVLRHAGIVKNYLGDDKVIAQMF  279

Query  1224  NRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLL  1403
             N++   V  S     YYS++   +N HY   WNV +AKL+ +YF++PWA +S  AA+ LL
Sbjct  280   NKIGDHVAVSDS---YYSEIFPNVNAHYKNKWNVWIAKLKREYFHSPWAFLSVPAAIVLL  336

Query  1404  SLTIAQTVIAVLDLRK  1451
              LT+AQTV ++L   K
Sbjct  337   FLTVAQTVFSILPYTK  352



>ref|XP_011100122.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
Length=429

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 157/464 (34%), Positives = 234/464 (50%), Gaps = 47/464 (10%)
 Frame = +3

Query  60    TEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRR-TNTDAYTPLLISIGPYHHGN  236
             +EG    + I+   + D   L    ++  I +V   LR     + Y P +++IGPYHHG 
Sbjct  2     SEGSADSVIIHIHCQLD--GLPSTPAKPTILRVDSHLRNDKRNNVYDPEILAIGPYHHGI  59

Query  237   AKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDK  416
             ++L  ME LK  YL  FLKR+ + S+E+    +   +++A   Y D       LD   + 
Sbjct  60    SRLQNMEQLKYNYLKRFLKRKNEQSVERYVTAVAAMEKRARKCYADP------LDLDENA  113

Query  417   FVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLE  596
             FV M++LDG F+ E L+R    +  ++            + +F    +  Q+  D+LLLE
Sbjct  114   FVTMMVLDGVFLIE-LFRYSGFKHLRDTV----------DPIFRHERILSQLRHDVLLLE  162

Query  597   NQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHL  776
             NQLPFFVL +L  M   +  P  L  + + F + +        ++  L   N      HL
Sbjct  163   NQLPFFVLNQLFNMTKTDEDPDDLIALALRFFNGMFLNLSASRVLARLPVKNI----DHL  218

Query  777   LQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV  956
               ++H++              W L F  ++  +S + +    +I + + L+EAG+  +K 
Sbjct  219   CGLIHDV--------------WCLPFVETISHKSNE-RDEWDNINSISGLREAGIKFRKA  263

Query  957   VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLI  1136
               + +L  IKF +  L IP+  I D TE+ F N+IAYEQ   D    Y +DY   M  LI
Sbjct  264   KGNENLMDIKFVNGVLRIPELIIYDETESQFMNLIAYEQLLPDGEQRYVSDYTFFMHCLI  323

Query  1137  NTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGH---Y  1307
             NT KDV L R  G++ N LGDD+EV  +FNRL + ++ SS  GF YS V   +N H    
Sbjct  324   NTSKDVELLRTRGIIENCLGDDEEVCQMFNRLGRNILTSS--GFCYSQVFCSVNRHCQRR  381

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             +K WN   A LR +YFN+PW+ IS +AA  LL LT  QT   VL
Sbjct  382   SKKWN---ANLRRNYFNSPWSIISFLAAFALLVLTFTQTTYTVL  422



>ref|XP_009345288.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=434

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 155/454 (34%), Positives = 233/454 (51%), Gaps = 54/454 (12%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             + L+ ++ NL  LS   CI++V + LR  N +AYTP ++SIGP HHG   L  ME  K  
Sbjct  25    DPLQEELDNLSPLSPLRCIYRVPKRLRWVNEEAYTPQVVSIGPLHHGKEHLKAMEEHKKR  84

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL +FL+R    S     + +K+ + +    Y +       ++   D+FV+ +L+D  F+
Sbjct  85    YLRVFLRRTGV-SFSDYIQMIKEKEGRLRGCYAEP------IEFGSDEFVRTVLVDVAFV  137

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EFL R Y  + +++          +++ +F    M   V  DL LLENQLPFF+LQ+L 
Sbjct  138   IEFLLRNYSSDYRQD----------EDDYIFNKPQMLCDVRPDLRLLENQLPFFILQDLF  187

Query  633   GMVYDESK--PKFLDIVKITFASMLT---KVRLIPPIVPNLGDNNATEMKGHLLQIVHNL  797
               ++  S   P FL+I    F S +    K ++   I       ++ E   H + ++  L
Sbjct  188   KKLFPSSHQLPSFLEISYYFFGSEINSKGKEKIFKQIC------SSGEEVQHFVDLIRIL  241

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLF  977
               P     +E                     + S  +   TEL +AGV  +    SS LF
Sbjct  242   YRPVESNPEE--------------------GLNSIAVPNVTELVQAGVQFRVRTDSSDLF  281

Query  978   HIKFNHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDV  1154
              IKF+   LEIPK  I D TE  +RN++A+EQ H+  K+  Y T+Y  LM  L+ T KDV
Sbjct  282   DIKFSDGILEIPKLTIADSTEARYRNLVAFEQCHAIKKD--YVTNYNLLMKRLMKTPKDV  339

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
              L   N ++ NWLGD K+++ LF+ L  GVV +   G YY+ +   LN +     +  MA
Sbjct  340   ELLVENEIIENWLGDTKKISTLFDNLGNGVVVT---GLYYATLREGLNNYCRTRRHKWMA  396

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              L+ DYFNTPW+ IS +AA+ LL LT+ QT  ++
Sbjct  397   NLKQDYFNTPWSIISVVAAIILLILTLIQTACSI  430



>ref|XP_010050240.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=409

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 163/437 (37%), Positives = 233/437 (53%), Gaps = 53/437 (12%)
 Frame = +3

Query  138   EACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSME  317
             E  IFKV   LR  N  AY P ++SIGPY++G  K   ME  K+ Y+   L R  + S++
Sbjct  11    EHSIFKVRHQLREVNEKAYEPEILSIGPYNYGKEKFKSMEEQKMRYVRQMLLRRNEESVD  70

Query  318   QCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkke  497
             +    L++ ++ A + Y ++ D         ++F+ M+ +DGCFI E L+R Y+    ++
Sbjct  71    RYMLTLRELEKPARNCYAENID-----HLTPEEFLGMMFIDGCFIIE-LFRNYNMRQWRD  124

Query  498   eeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIV  677
                        ++ +     +KF + RDLLLLENQLP FVL +L    YD++K     + 
Sbjct  125   R----------DDQLMEADWIKFSLRRDLLLLENQLPLFVLNKL----YDQTKGLNEHLG  170

Query  678   KITFASMLTKVRLIPPIVPNLGDNNATEMKG---HLLQIVHNLCNPQNGGIQEERHYWTL  848
              I  A+             +LGD+   +  G   HLL ++H  C             WT 
Sbjct  171   LIDIATGYFNF--------DLGDSGRNQTLGESKHLLHLMHT-C-------------WTS  208

Query  849   CFPCSLGKQSQDSKVGSSD-IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHI  1025
               P +   + Q+SK      + TATEL+E GV LK   +      IKF +  LEIP   +
Sbjct  209   GLPNA---RLQNSKTELDIFVSTATELKEHGVQLK-AARGRHQMDIKFKNGILEIPVLIV  264

Query  1026  TDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDK  1205
              D TE+ FRN+IAYEQH   ++  Y T+Y   MD LIN+ KDV L R  G++ N LGDD+
Sbjct  265   EDDTESRFRNLIAYEQHRQCRDINYVTEYMSFMDFLINSSKDVKLLRHKGIIKNNLGDDE  324

Query  1206  EVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTI  1385
              V  +FN++   V  S    FYY D+  ++N + NK WNV MAKLR DYF++PWA  S +
Sbjct  325   VVAQMFNKMGDWVALSD---FYYDDISYRVNKYCNKKWNVRMAKLRRDYFHSPWAFFSVL  381

Query  1386  AAVFLLSLTIAQTVIAV  1436
             AA+ LL LT AQTVI +
Sbjct  382   AAISLLLLTTAQTVIVL  398



>ref|NP_190584.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB62123.1| putative protein [Arabidopsis thaliana]
 gb|ABE66003.1| unknown [Arabidopsis thaliana]
 gb|AEE78632.1| uncharacterized protein AT3G50150 [Arabidopsis thaliana]
Length=509

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/443 (34%), Positives = 224/443 (51%), Gaps = 44/443 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +SIGPYHHG   L  ME  K   +++ + R K  ++E  
Sbjct  91    CIYRVPFYLQENDKKSYLPQTVSIGPYHHGKVHLRPMERHKWRAVNMIMARTKH-NIEMY  149

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y    D++       ++F +ML+LDGCF+ E          K   +
Sbjct  150   IDAMKELEEEARACYQGPIDMK-----NSNEFTEMLVLDGCFVLELF--------KGTIQ  196

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM---------VYDESK  656
                      N+ VF   G+   + RD+++LENQLP FVL  L G+         +  E  
Sbjct  197   GFQKIGYARNDPVFAKRGLMHSIQRDMIMLENQLPLFVLDRLLGLQTGTPNQTGIVAEVA  256

Query  657   PKFLDIVKITFASMLTKVRLIPPIVPN--LGDNNATEMKGHLLQIVHNLCNPQNGGIQEE  830
              +F   +  T   +    R +     +  LGDN       H L + H      +    + 
Sbjct  257   VRFFKTLMPTSEVLTKSERSLDSQEKSDELGDNGGL----HCLDVFHRSLIQSSETTNQG  312

Query  831   RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEI  1010
               Y  +     + KQ Q        I   TEL+ AGVN  +  ++  L+ I+F +  L+I
Sbjct  313   TPYEDMSM---VEKQQQL-------IHCVTELRGAGVNFMRK-ETGQLWDIEFKNGYLKI  361

Query  1011  PKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVN  1187
             PK  I D T++ F N+IA+EQ H+   NN+  T Y   MDNLIN+ +DV+    +G++ +
Sbjct  362   PKLLIHDGTKSLFSNLIAFEQCHTQSSNNI--TSYIIFMDNLINSSQDVSYLHHDGIIEH  419

Query  1188  WLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPW  1367
             WLG D EV DLFNRLCK V++   DG Y S +  ++N +Y++ WN + A LR  YFN PW
Sbjct  420   WLGSDSEVADLFNRLCKEVIFDPKDG-YLSQLSREVNRYYSRKWNSLKATLRQKYFNNPW  478

Query  1368  AGISTIAAVFLLSLTIAQTVIAV  1436
             A  S  AAV LL LT  Q+  AV
Sbjct  479   AYFSFSAAVILLFLTFFQSFFAV  501



>ref|XP_007030490.1| Uncharacterized protein TCM_026256 [Theobroma cacao]
 gb|EOY10992.1| Uncharacterized protein TCM_026256 [Theobroma cacao]
Length=451

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 157/448 (35%), Positives = 225/448 (50%), Gaps = 56/448 (13%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S +A IF+V   LR+ N  AY P +ISIGPYH G A L  ME  K  YL + L+R K+ S
Sbjct  41    SPDAFIFRVPYQLRQVNERAYEPRVISIGPYHRGKAHLRAMEIHKWSYLKMLLQRRKEDS  100

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
               +  E +++ ++ A S Y +       +  +  +FV+ML+LDGCFI E + +       
Sbjct  101   PVRYVEAMRNEEKAARSCYAET------VYMSAQEFVEMLVLDGCFIIELIRK-------  147

Query  492   keeeeelnkkkCD-----NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESK  656
                        CD     ++ +F        V ++LLL+ENQLPFFVL +L  M   E++
Sbjct  148   ---------FACDELKDEHDDLFKRNFNLSIVGQELLLVENQLPFFVLDQLFKMTKTENE  198

Query  657   PKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG-----HLLQIVHNLCNPQNGGI  821
              +  + + + F S      ++P     +G+   +  K      HLL +V     P   GI
Sbjct  199   EEAFNHMALRFFSG-----IVPGPGIRVGNYRRSVRKKRKCILHLLGLVQANWLPSPEGI  253

Query  822   QEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAE  1001
             +          P +  K +         IR+A EL + G+  KK    +SLF IKF    
Sbjct  254   KRSEQ------PVTDRKWNF--------IRSAKELLDVGIKFKKASGENSLFDIKFEKGR  299

Query  1002  LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVL  1181
              +IP   I   +E  FRN IAYEQ   ++   Y  DY + MD LIN   DV L   +G++
Sbjct  300   FQIPTLTIYHDSERIFRNFIAYEQF--NEGPTYVMDYTRFMDCLINYGDDVALLSHSGII  357

Query  1182  VNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNT  1361
             VNWLG ++EV  +FN+L    VY S   FYYS++ N +N +    W +   KLR+ YF+T
Sbjct  358   VNWLGSNEEVAHMFNKL-NDFVYLSTSNFYYSELFNDVNKYCRGRWTLWKIKLRNKYFDT  416

Query  1362  PWAGI--STIAAVFLLSLTIAQTVIAVL  1439
             PW  +  S IA   LL LT+ QTV AVL
Sbjct  417   PWDWVLTSIIAGAILLLLTLVQTVFAVL  444



>ref|XP_010088614.1| hypothetical protein L484_004014 [Morus notabilis]
 gb|EXB36768.1| hypothetical protein L484_004014 [Morus notabilis]
Length=441

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 145/457 (32%), Positives = 240/457 (53%), Gaps = 41/457 (9%)
 Frame = +3

Query  75    QDLPI---YESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKL  245
             QD P+     SL+R ++NL    SE CI++V E LR  N +AY P ++SIGP HHG  + 
Sbjct  11    QDQPLENLVNSLRRKLQNLSPPPSECCIYRVPERLRLENANAYIPRVLSIGPLHHGEQRF  70

Query  246   SKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDD-EDIQLLLDSAGDKFV  422
               ME  K++YL+ FL+R K  S+E   + +K+ ++K   +Y +  E ++       ++FV
Sbjct  71    QAMEEHKMLYLNSFLERTKV-SLEDYTKFIKEREQKVRKHYAETFETVE------SNRFV  123

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +M+L+D  F+ E L+R + ++  +           +N+ +F        +  D++LLENQ
Sbjct  124   EMILVDAAFVIELLWRNHSKDEVQ-----------ENDRIFNRPWKVGDIRYDMMLLENQ  172

Query  603   LPFFVLQELHGMVYDESKPKF-LDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLL  779
             LPFF+ +++  +    +K +  LD +    +    K+ LI      +        K +L 
Sbjct  173   LPFFIFEDIFTL----AKLRISLDNIGDRLSMSSEKISLI------ILTYKFFRFKAYLG  222

Query  780   QIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQ-SQDSKVGSSDIRTATELQEAGVNLKKV  956
              I   L   Q+  I   +H+      C + ++     ++ +  + + TEL EAGVN  +V
Sbjct  223   GIKEILKRVQSSEI---KHFVDFFRQCHVPRELPPRGEIQTLTVPSVTELYEAGVNF-EV  278

Query  957   VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLI  1136
               + SLF I+F    L IP+  I   TE+FF N++A+EQ  C   + Y  DY  ++D LI
Sbjct  279   GSTKSLFDIQFRKGTLVIPRLRIRKSTESFFLNLLAFEQ--CHLLDCYINDYVFIIDRLI  336

Query  1137  NTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKP  1316
             +T   V L   +GV+ + L D+KEV    N L +G +   C  FY++D+C  LN +Y+ P
Sbjct  337   DTTSAVQLLVQSGVIESKLPDNKEVVTSINNLVRGSIL-RCKHFYFNDLCVSLNAYYSDP  395

Query  1317  WNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTV  1427
             WN   A L+H +F++P    + + A  +  LT+ QTV
Sbjct  396   WNKWTAALKHKHFSSPLTIFAVVLAAAVFILTLIQTV  432



>ref|XP_010503687.1| PREDICTED: UPF0481 protein At3g47200-like [Camelina sativa]
Length=512

 Score =   218 bits (554),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 150/443 (34%), Positives = 226/443 (51%), Gaps = 41/443 (9%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +SIGPYHHG   L  ME  K   +++ + R K  ++E  
Sbjct  91    CIYRVPFYLQENDKKSYLPQTVSIGPYHHGKEHLMPMERHKWRAVNMIMARTKH-NIEMY  149

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y    D++       ++F +ML+LDGCF+ E          K   +
Sbjct  150   IDAMKELEEEARACYQGPIDMK-----NSNEFTEMLVLDGCFVLELF--------KGTVQ  196

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFL--DIV  677
                      N+ VF   G+   + RD+++LENQLP FVL  L G+         +  D+ 
Sbjct  197   GFKEIGYASNDPVFAKRGLMHSIQRDMVMLENQLPLFVLNRLLGLQPGTPNQTGIVADVA  256

Query  678   KITFASMLTKVRLIPPIVPNLGDNNA----TEMKG-HLLQIVH----NLCNPQNGGIQEE  830
                F ++L   + +     +LG        T+  G H L + H          N GI  E
Sbjct  257   VRFFKTLLPTSKALTKSESSLGSQGKSDELTDNGGLHCLDVFHRSLIQSSETTNRGIPYE  316

Query  831   RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEI  1010
                  +     + KQ Q        I   TEL++AGV   +  ++  L+ I+F +  L+I
Sbjct  317   DMRMVV-----VDKQQQQL------IHCVTELRDAGVKFMRK-ETGQLWDIEFKNGYLKI  364

Query  1011  PKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVN  1187
             PK  I D T++ F N+IA+EQ H+   NN+  T Y   MDNLIN+ +DV+     G++ +
Sbjct  365   PKLLIHDGTKSLFSNLIAFEQCHTQSSNNI--TSYIIFMDNLINSSEDVSYLHHAGIIEH  422

Query  1188  WLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPW  1367
             WLG D EV DLFNRLCK V++   DG Y S +  ++N +Y++ WN + A LR  YFN PW
Sbjct  423   WLGSDAEVADLFNRLCKEVIFDPKDG-YLSQLSGEVNRYYSRKWNSLKATLRQKYFNNPW  481

Query  1368  AGISTIAAVFLLSLTIAQTVIAV  1436
             A  S  AAV LL LT  Q++ AV
Sbjct  482   AYFSFSAAVILLVLTFFQSLFAV  504



>ref|XP_006420573.1| hypothetical protein CICLE_v10007039mg [Citrus clementina]
 gb|ESR33813.1| hypothetical protein CICLE_v10007039mg [Citrus clementina]
Length=418

 Score =   214 bits (546),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 151/435 (35%), Positives = 220/435 (51%), Gaps = 43/435 (10%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             + E L R      Q S    IF+V + LR+ N  AY P L++IGPYHHG   LS  E  K
Sbjct  13    VGEKLHRPTPTPSQFS----IFRVPDVLRKLNEKAYEPELLAIGPYHHGKDNLSAFEGHK  68

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
             + YL   L+R   P  +     +   +E+A + YG        + S  ++FV+M+L DGC
Sbjct  69    ISYLQTLLERTGIPYPDYV-RAMWALEERARNCYGGS------ISSGKNEFVQMMLFDGC  121

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             FI E + +      +            D++ +F    M   + RD++LLENQLPFFV+ +
Sbjct  122   FIVEVIRKFGLPHLRG-----------DDDPIFKQGWMLPHIARDMILLENQLPFFVVWK  170

Query  627   LHGMVYDESKPK---FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL  797
             L  M    S P+   FL  +   F  +L         V  + D    E+K HL+ ++H+ 
Sbjct  171   LFIMSEMPSIPRNESFLVTILRFFYGILPGKGFRRDGVDRVNDYPINEIK-HLVNLIHDN  229

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV--VKSSS  971
              +P   GI+            + GK + D     S I +A+E+Q+AG+  +KV   +  S
Sbjct  230   WHPSPSGIEAY---------ANNGKNNSDW----SFICSASEIQKAGIKFQKVDAHRDGS  276

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
             LF IKF +  ++IP   I D TET F+N+I YEQ S   N  +  DY + +  LIN+ KD
Sbjct  277   LFDIKFKNGVMKIPTLEIGDATETIFQNLIVYEQCSHGINPKHILDYCKFLHCLINSSKD  336

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
               L R  G++ N LGDD+ +  L N+L  G V    + FYY +V NK+N H ++  N   
Sbjct  337   AELLRRRGIIDNRLGDDEVIATLLNKLGDGGVLG--EQFYYCEVLNKVNFHCSRRRNKWK  394

Query  1332  AKLRHDYFNTPWAGI  1376
             AKL+H YF  PWA I
Sbjct  395   AKLKHHYFKDPWAVI  409



>ref|XP_010088613.1| hypothetical protein L484_004013 [Morus notabilis]
 gb|EXB36767.1| hypothetical protein L484_004013 [Morus notabilis]
Length=441

 Score =   215 bits (548),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 144/457 (32%), Positives = 238/457 (52%), Gaps = 41/457 (9%)
 Frame = +3

Query  75    QDLPI---YESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKL  245
             QD P+     SL+R ++NL    SE CI++V E LR  N +AY P ++SIGP HHG  + 
Sbjct  11    QDQPLENLVNSLRRKLQNLSPPPSECCIYRVPERLRLENANAYIPRVLSIGPLHHGEQRF  70

Query  246   SKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDD-EDIQLLLDSAGDKFV  422
               ME  K++YL+ FL R K  S+E   + +K+ ++K    Y +  E ++       ++FV
Sbjct  71    QAMEAHKMLYLNSFLDRTKV-SLEDYAKFIKEREQKVRQNYAETFESVE------SNQFV  123

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +M+L+D  F+ E L+R + ++  +           +N+ +F        +  D++LLENQ
Sbjct  124   EMILVDAAFVIELLWRNHSKDEVQ-----------ENDRIFNRPWKVVDIRYDMMLLENQ  172

Query  603   LPFFVLQELHGMVYDESKPKF-LDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLL  779
             LPFF+ +++  +    +K +  LD +    +    K+ LI      +      + K +L 
Sbjct  173   LPFFIFEDIFTL----AKLRISLDNISDRLSMSSEKISLI------ILTYKFYQFKAYLG  222

Query  780   QIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQ-SQDSKVGSSDIRTATELQEAGVNLKKV  956
              I   L   Q+  I   +H+      C + ++     ++ +  I + TEL EAGVN  +V
Sbjct  223   GIKEILKRVQSSKI---KHFIDFFRKCHVPRELPPRGEIQTLTIPSVTELYEAGVNF-EV  278

Query  957   VKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLI  1136
               + SLF I+F    L IP+  I   TE+FF N++A+EQ  C   + Y  DY  ++D L+
Sbjct  279   GSTKSLFDIQFRKGTLVIPRLRIRKSTESFFLNLLAFEQ--CHLLDCYINDYVFIIDRLV  336

Query  1137  NTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKP  1316
             +T   V L   +GV+ + L D+KEV    N L +G +      FY++D+C+ LN +Y  P
Sbjct  337   DTTSAVQLLVQSGVIESKLPDNKEVVTSINNLVRGSILRR-KHFYFNDLCDSLNAYYGNP  395

Query  1317  WNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTV  1427
             WN   A L+H +F++P    + + A  +  LT+ QTV
Sbjct  396   WNTWTATLKHKHFSSPLTIFAVVVAAAIFILTLIQTV  432



>ref|XP_010503686.1| PREDICTED: UPF0481 protein At3g47200-like [Camelina sativa]
Length=538

 Score =   218 bits (554),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 156/443 (35%), Positives = 230/443 (52%), Gaps = 46/443 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L++ +  +Y P  +S+GPYHHG+  L  M+  K   +++ LKR KQ  +E  
Sbjct  113   CIYRVPHSLQKNDKTSYFPQTVSLGPYHHGDEHLQPMDYHKWRAVNMVLKRTKQ-GIETY  171

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y      +  +D + +KF +ML+LDGCF+ E L+R  DE   K E 
Sbjct  172   IDAMKELEERARACY------EGRIDMSSNKFTEMLVLDGCFVLE-LFRGADEGFSKLEY  224

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+L+LENQLP FVL  L  +      P    +V I
Sbjct  225   NR-------NDPVFAMRGSMHSIRRDMLMLENQLPLFVLNRLLDLQL--GTPSQTGLVAI  275

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERH----YWTLC  851
                     VR   P++P    +   E      Q+ +   NP     +EE H    +    
Sbjct  276   L------AVRFFNPLMPTYMPSTKIEDS----QVNNKFFNPIADKDKEELHCLDVFRRSV  325

Query  852   FPCSLGKQSQDSKVGSS------DIRT------ATELQEAGVNLKKVVKSSSLFHIKFNH  995
                SL  + + S+   S      D R        TEL+EAG+  K+  KS   + I+F +
Sbjct  326   LQPSLKPEPRLSRSRWSWKPLVADKRQQQLLHCVTELREAGIKFKRR-KSDRFWDIQFKN  384

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               LEIPK  I D T++ F N+IAYEQ   D  N   T Y   MDNLI++ +DV       
Sbjct  385   GCLEIPKLLIHDGTKSLFSNLIAYEQCHIDSTND-ITSYIIFMDNLIDSAEDVRHLHYYD  443

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ +WLG+D EV D+FNRLC+ V +   +  Y S + +K++ +YN+ WNV+ A L+H YF
Sbjct  444   IIEHWLGNDSEVADVFNRLCQEVAFD-LENTYLSVLSHKVDSYYNRKWNVVKATLKHKYF  502

Query  1356  NTPWAGISTIAAVFLLSLTIAQT  1424
             N PWA  S  AAV LL LT+ Q+
Sbjct  503   NNPWAYFSFFAAVILLLLTLFQS  525



>ref|XP_006478631.1| PREDICTED: putative UPF0481 protein At3g02645-like [Citrus sinensis]
Length=437

 Score =   215 bits (547),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 237/477 (50%), Gaps = 60/477 (13%)
 Frame = +3

Query  66    GDQQDLPIYE---SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGN  236
             G+Q+ + I     SL++  K L  L  + CI++V E +R  N  A+ P L+SIGP HHGN
Sbjct  4     GEQEPIDIESLANSLRKKFKTLHHLPEKCCIYRVPEQVRCLNPKAHAPQLVSIGPLHHGN  63

Query  237   AK-LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGD  413
              + L  ME  KL YL+ FL+R  + S+E     +K+ + K    Y   E I+L       
Sbjct  64    KEELKAMEEQKLRYLEYFLQR-TEVSIETFLTSIKNKEAKLRDCYA--ETIRL----ESK  116

Query  414   KFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLL  593
              FV M+L+D  F+ EFL R     +               + +F  + M   ++ D  LL
Sbjct  117   DFVTMVLVDAVFLIEFLLRYSCPRSITI-----------GDPIFTKSKMISDMWLDFWLL  165

Query  594   ENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTK----VRLIPPIVPNLGDNNATE  761
             ENQLP F+L +L  +   E      D   ++  S+  +    +   P I  NL + + +E
Sbjct  166   ENQLPLFILDDLFNLAKTEMYHD--DYYGVSLLSLTRRFYKDIHEFPSIEENLFEIHFSE  223

Query  762   MKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGK-------QSQDSKVGSSDIRTAT  920
              + H L ++                   LCF     +       ++Q +K+ + +I + T
Sbjct  224   SE-HFLDLLR------------------LCFQPPPTQSQPQSQSRAQPNKLKTQNIPSVT  264

Query  921   ELQEAGVNLKKVVKSSSLFHI--KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNN  1094
             EL +AGV  + +  S +LF I  +FN   LEIP F I++ TE  FRN+ A+E+  CD   
Sbjct  265   ELYQAGVKFQ-LGSSKNLFAITFRFNKGILEIPLFRISESTEVLFRNLQAFERLRCDTR-  322

Query  1095  MYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYY  1274
              Y  DY  +M+ L+NT +DV L   + V+ NWL D++ V+ LF+ L +    S+ D F Y
Sbjct  323   -YINDYVIIMNYLVNTPQDVELLVQSRVIENWLWDNEAVSTLFHNLVQETSLSAID-FQY  380

Query  1275  SDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             SD+   L  +    W+   A L+ DYFN PWA IS IAAV LL LT  Q   ++L L
Sbjct  381   SDLIENLKAYCGHRWHRWKAILKQDYFNNPWASISVIAAVILLVLTAIQATCSILQL  437



>ref|XP_007203945.1| hypothetical protein PRUPE_ppa017935mg [Prunus persica]
 gb|EMJ05144.1| hypothetical protein PRUPE_ppa017935mg [Prunus persica]
Length=451

 Score =   215 bits (548),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 146/476 (31%), Positives = 234/476 (49%), Gaps = 50/476 (11%)
 Frame = +3

Query  27    ELQRQ*GMIENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLL  206
             ++Q+Q  ++E    +   L     ++  +++      + CI+KV +  RR N + Y P +
Sbjct  23    QIQKQRVIVEKPRDEVAIL-----IEGKVRDTPSFWPDCCIYKVPQRFRRGNEEFYEPRV  77

Query  207   ISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDI  386
             +SIGPYH       +M+  KL YL+ FL R  + S++QC  +++  + KA  +Y D    
Sbjct  78    VSIGPYHFHQGSFPQMQIFKLKYLEAFLSR-NELSLDQCLGRVRTWEAKARRFYVD----  132

Query  387   QLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKF  566
               L+D + D+F +++L+D  F+ E + R          +       CD   ++    M  
Sbjct  133   --LIDLSSDEFAELMLVDAIFVLELMIR---------HQFFEYVDNCDR--IYRKPRMIE  179

Query  567   QVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRL---IPPIVPN  737
              VF D+LL+ENQ+PFFVL+ L+ +V + SK      V++T       V++        P 
Sbjct  180   DVFHDVLLIENQIPFFVLEGLYDLVDNSSKGTLKFFVELTHEFFKASVKINEFGADRAPV  239

Query  738   LGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTA  917
              G N+  +   H +  +     P      E  H +    P                  + 
Sbjct  240   PGVNHGVK---HFVDFIRCYYLPTEDEKHEYGHRFYEIPP------------------SV  278

Query  918   TELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNM  1097
             T L++AGV       + SL  I+FN   L+IP F + D TET FRN+IA EQ   D    
Sbjct  279   TALEDAGVKF-ATTSTRSLLDIQFNRGCLKIPNFRVDDWTETVFRNLIALEQCHDDHQVK  337

Query  1098  YFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYS  1277
             Y ++   LM  +I T KDV+L   + ++ + LG + +V+ LFN + +GV       +YY 
Sbjct  338   YISELMFLMGCMIKTSKDVDLLIEHEIISSMLGSNVDVSTLFNHIGQGVGLGQ--PYYYF  395

Query  1278  DVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              +C KLN +   PW+     L+ DYFNTPW  +STIAA+ LL LT+ QT+ ++L L
Sbjct  396   SLCKKLNAYCKTPWHRWKPILQCDYFNTPWKVVSTIAAIVLLVLTLVQTICSILSL  451



>ref|XP_010045492.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=427

 Score =   214 bits (546),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 155/451 (34%), Positives = 236/451 (52%), Gaps = 56/451 (12%)
 Frame = +3

Query  120   LKQLS--SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLK  293
              KQLS  S+ CIF V + LR+TN  AYTPL++SIGPYH  N  L  ME+ KL+YL  FL+
Sbjct  25    FKQLSLPSDCCIFTVPKRLRQTNKKAYTPLVVSIGPYHRRNPSLKLMEDHKLLYLQNFLE  84

Query  294   REKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYRe  473
              +K+  +E   +++K  +++A + Y    D Q+ L+S  DKF +M+LLDG F+ + L   
Sbjct  85    HDKKNRLEVYIDRVKSWEDEARNCY----DRQINLNS--DKFAEMILLDGIFVIQLL---  135

Query  474   ydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE-  650
                           +K   N+ +F    +   V RD+ LLENQ+PFFV+Q L  M +++ 
Sbjct  136   --------LIYGKQRKTLPNDQIFGKPLIVDDVRRDMTLLENQIPFFVVQRLFKMAFEKH  187

Query  651   --SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQ  824
                 PK L++V   F +++         +  L ++  +E+K  +  I  +       G  
Sbjct  188   WRGMPKLLELVCQFFKTVMR--------MEKLPESKESEVKHFVHAISLSFLRSVRKG--  237

Query  825   EERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS---SSLFHIKFNH  995
             ++R Y  + F  S                 ATEL  AGV L++ + S   + LF I+F +
Sbjct  238   QDRCYRKIKFTPS-----------------ATELVAAGVELRRPMLSGENNRLFDIQFEN  280

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               LEIP   + D TE +FRN++A+EQ  C+  N Y TDY   M +L++T  D  L     
Sbjct  281   GVLEIPYLVLEDSTEFYFRNIMAFEQCYCE--NTYLTDYMVFMHHLVDTPGDAELLIDKE  338

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ N L + +    + N    G        FY++ + ++L  H  +P N   A  + DY 
Sbjct  339   IIENCLSNKEAAARVINNF--GKENPVTPKFYFNSLSHELTKHCQRPCNKWKATFKRDYC  396

Query  1356  NTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
             ++PWA IS IAAV LL LT+AQTV +VL L+
Sbjct  397   SSPWAIISVIAAVVLLLLTVAQTVCSVLSLK  427



>ref|XP_010048250.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=442

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 142/460 (31%), Positives = 239/460 (52%), Gaps = 47/460 (10%)
 Frame = +3

Query  75    QDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKM  254
             ++L +  S++  + +L  LSSE CIF+V E LR ++ +AY P +++IGPYH  +  + +M
Sbjct  28    ENLNLAFSIQEKLMSLPTLSSECCIFRVPEKLRHSHEEAYMPRVVAIGPYHRHSQSVMQM  87

Query  255   ENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLL  434
             E+ KL YL  FL   +   +E   ++++  +++A SYY  D+ I    D + D+F +M+L
Sbjct  88    EDHKLRYLQSFLGHNQNCRLEDYIKRIRSWEDRARSYY--DKQI----DLSSDEFTEMML  141

Query  435   LDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFF  614
             LDG F  +                   +   +++ +F    M   V RD++LLENQ+PFF
Sbjct  142   LDGIFAIQLF-----------LMYWNLEGMPNSDRIFGKPWMLNDVRRDMMLLENQMPFF  190

Query  615   VLQELHGMVYDESKPKFLDIVKITFASMLTKVRL--IPPIVPNLGDNNATEMKGHLLQIV  788
              ++ L  M     +     ++++T+   +  V++  +P  V        +E+K H L  +
Sbjct  191   AIEGLFEMALGSHQRHTPVLLELTYGFFMPGVKMEEVPEAV------MESEVK-HFLDAI  243

Query  789   HNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSS  968
                                L +  S  K   D       I + TEL  AGV LK+  KS+
Sbjct  244   R------------------LSYLPSAKKAPYDINEEVKLIPSVTELVAAGVKLKR-GKSN  284

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
              LF I +N+  LEIP+  +   TE++FRN+IA+EQ    + N Y  DY   MD+L+NT  
Sbjct  285   RLFDIGYNNGVLEIPRLSLYHTTESYFRNLIAFEQIYY-QGNSYLIDYIVFMDHLVNTPA  343

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVM  1328
             D  +    G++ NWLG++    DL N  CK  +  + + ++YS + ++L  +  +P+N  
Sbjct  344   DSKMLIDLGIIENWLGNEDAAADLINSFCKDTLLWTRNAYFYS-LRHELVAYCQRPYNKW  402

Query  1329  MAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
                L+ DY ++PW  +S + AV LL+LT+ QT  ++L L+
Sbjct  403   KTSLKRDYCSSPWVVLSIMTAVVLLTLTVVQTACSLLSLK  442



>gb|KCW78764.1| hypothetical protein EUGRSUZ_C00198 [Eucalyptus grandis]
Length=405

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 162/438 (37%), Positives = 231/438 (53%), Gaps = 53/438 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
              E  IFKV   LR  N  AY P ++SIGPY++G  K   ME  K+ Y+   L R  + S+
Sbjct  10    QEHSIFKVRHQLREVNEKAYEPEILSIGPYNYGKEKFKSMEEQKMRYVRQMLLRRNEESV  69

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             ++    L++ ++ A + Y ++ D         ++F+ M+ +DGCFI E L+R Y+    +
Sbjct  70    DRYMLTLRELEKPARNCYAENID-----HLTPEEFLGMMFIDGCFIIE-LFRNYNMRQWR  123

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
             +           ++ +     +KF + RDLLLLENQLP FVL +L    YD++K     +
Sbjct  124   DR----------DDQLMEADWIKFSLRRDLLLLENQLPLFVLNKL----YDQTKGLNEHL  169

Query  675   VKITFASMLTKVRLIPPIVPNLGDNNATEMKG---HLLQIVHNLCNPQNGGIQEERHYWT  845
               I  A+             +LGD+   +  G   HLL ++H  C             WT
Sbjct  170   GLIDIATGYFNF--------DLGDSGRNQTLGESKHLLHLMHT-C-------------WT  207

Query  846   LCFPCSLGKQSQDSKVGSSD-IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFH  1022
                P +   + Q+SK      + TATEL+E GV LK   +      IKF +  LEIP   
Sbjct  208   SGLPNA---RLQNSKTELDIFVSTATELKEHGVQLK-AARGRHQMDIKFKNGILEIPVLI  263

Query  1023  ITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDD  1202
             + D TE+ FRN+IAYEQH   ++  Y T+Y   MD LIN+ KDV L R  G++ N LGDD
Sbjct  264   VEDDTESRFRNLIAYEQHRQCRDINYVTEYMSFMDFLINSSKDVKLLRHKGIIKNNLGDD  323

Query  1203  KEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGIST  1382
             + V  +FN++   V  S    FYY D+  ++N + NK WNV MAKLR DYF++PWA  S 
Sbjct  324   EVVAQMFNKMGDWVALSD---FYYDDISYRVNKYCNKKWNVRMAKLRRDYFHSPWAFFSV  380

Query  1383  IAAVFLLSLTIAQTVIAV  1436
             +AA+ LL LT AQTV   
Sbjct  381   LAAISLLLLTTAQTVFTT  398



>ref|XP_010426559.1| PREDICTED: UPF0481 protein At3g47200-like [Camelina sativa]
Length=514

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 151/445 (34%), Positives = 227/445 (51%), Gaps = 43/445 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +SIGPYHHG   L  ME  K   +++ + R K  ++E  
Sbjct  91    CIYRVPFYLQENDKKSYLPQTVSIGPYHHGKEHLMPMERHKWRAVNMIMARTKH-NIEMY  149

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y    D++       ++F +ML+LDGCFI E          K   +
Sbjct  150   IDAMKELEEEARACYQGPIDMK-----NSNEFTEMLVLDGCFILELF--------KGTVQ  196

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFL--DIV  677
                      N+ VF   G+   + RD+++LENQLP FVL  L G+         +  D+ 
Sbjct  197   GFKEIGYAYNDPVFAKRGLMHSIQRDMVMLENQLPLFVLNRLLGLQPGTPNQTGIVADVA  256

Query  678   KITFASMLTKVRLIPPIVPNLGD------NNATEMKG-HLLQIVH----NLCNPQNGGIQ  824
                F ++L   + +     +LG       +  T+  G H L + H          N GI 
Sbjct  257   VRFFKTLLPTSKALTKSESSLGSQSNGKSDELTDNGGLHCLDVFHRSLIQSSETTNRGIP  316

Query  825   EERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAEL  1004
              E     +     + KQ Q        I   TEL++AGV   +  ++  L+ I+F +  L
Sbjct  317   YEDMRMVV-----VDKQQQQL------IHCVTELRDAGVKFMRK-ETGQLWDIEFKNGYL  364

Query  1005  EIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVL  1181
             +IPK  I D T++ F N+IA+EQ H+   NN+  T Y   MDNLIN+ +DV+     G++
Sbjct  365   KIPKLLIHDGTKSLFSNLIAFEQCHTQSSNNI--TSYIIFMDNLINSSEDVSYLHHAGII  422

Query  1182  VNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNT  1361
              +WLG D EV DLFNRLCK V++   DG Y S +  ++N +Y++ WN + A LR  YFN 
Sbjct  423   EHWLGSDAEVADLFNRLCKEVIFDPKDG-YLSQLSGEVNRYYSRKWNSLKATLRQKYFNN  481

Query  1362  PWAGISTIAAVFLLSLTIAQTVIAV  1436
             PWA  S  AAV LL LT  Q++ AV
Sbjct  482   PWAYFSFSAAVILLVLTFFQSLFAV  506



>emb|CAN69719.1| hypothetical protein VITISV_026312 [Vitis vinifera]
Length=467

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 151/460 (33%), Positives = 225/460 (49%), Gaps = 43/460 (9%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             +  SL+  +  L  LS+  CI++V + LR+ N +AYTP ++SIGP HHG   L  ME  K
Sbjct  9     VATSLQGRLDRLTPLSATCCIYRVPQKLRKVNMEAYTPRVVSIGPLHHGEEHLIAMEEHK  68

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
             L YL  FL R ++ ++E+C E +   ++ A   Y         ++ +  +FV+M+LLDGC
Sbjct  69    LRYLQNFLHRTRK-TLEECVEIISRKEKTARDCYMKR------INMSSKEFVEMILLDGC  121

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             FI E +    +      +          ++ +F    + F V RD+ LLENQLPF +L  
Sbjct  122   FIIEVILGFQNCNRHTMK---------PDDRIFNKPWLIFDVSRDMTLLENQLPFSLLLS  172

Query  627   LHGMVYDESK-----------PKFLDIVKI-TFASMLTKVRLIPPIVPNLGDNNAT--EM  764
             L+ +V                P  L  VK   + S +        I+  +    ++  E 
Sbjct  173   LYSLVAPPGPLPENQNDYAYYPFLLSSVKFFKYYSHMPVAESCEEIIETIAKKASSTDEE  232

Query  765   KGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSS----------DIRT  914
               H + ++     P +     +   + +  P +  +  Q S               ++ T
Sbjct  233   IKHFVDLLIVCQQPSSPTRLRKPSDFKIMIPTATLEAQQPSSPRQPTPSNVSDWKLNLPT  292

Query  915   ATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNN  1094
             AT+L E GV+ K   ++  L  I +    L+IPK  + D  E+ FRN+IA+EQ    K  
Sbjct  293   ATQLHEGGVSFKLGSENKRLLDITYGSGVLKIPKLSLEDVCESLFRNLIAFEQCHYRKRR  352

Query  1095  MYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYY  1274
              Y TDY  LMD LINT KDV++    G++ NWLGD+  VT+LFN L    V  S   FY 
Sbjct  353   -YITDYISLMDQLINTTKDVDVLVNGGIIDNWLGDNVAVTNLFNNLLINTV--SASDFYL  409

Query  1275  SDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
             + + N LN +Y+  WN   A LR DYF +PW G STIAAV
Sbjct  410   AGITNGLNKYYDIRWNRWKAALRRDYFCSPWRGASTIAAV  449



>ref|XP_008340394.1| PREDICTED: UPF0481 protein At3g47200 [Malus domestica]
Length=532

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 153/456 (34%), Positives = 233/456 (51%), Gaps = 53/456 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI+KV   LR  +  A  P ++S+GPYHHG  +L +M+  K   L   LKR  Q  +
Sbjct  100   AKHCIYKVPHYLREGDDKAIVPQIVSLGPYHHGKRRLRQMDRHKWRSLLRMLKRTNQ-CI  158

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             E     +K+ +EKA + Y     + L    + ++FV+M++LDGCF+ E L+R   E  K+
Sbjct  159   ELYLNSIKEVEEKARACYEGPAAMGL----SSNEFVEMMVLDGCFVLE-LFRGVGEGFKQ  213

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ +F   G    + RD+++LENQLP F+L  L G+   + + K L +
Sbjct  214   LGYPR-------NDPIFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQLGDPEQKGL-V  265

Query  675   VKITFASMLTKVRLIPPIVPN---LGDNNATEMKGHL-LQIVHNLCNPQNG---------  815
              K+        +R   P++P    L  ++  +++  L      +  + Q G         
Sbjct  266   AKLA-------LRFFDPLMPTDEPLTKSDRNKLESSLAYATTFDPLSEQGGLHCLDVFRR  318

Query  816   -----GIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSS  968
                  G+Q     W       + + S  ++V        I   TEL+EAG+  KK  K+ 
Sbjct  319   SLLRTGLQAVPRVW-------IKRWSHSNRVADKRRQQLIHCVTELKEAGIKFKKR-KTD  370

Query  969   SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEK  1148
               + +KF +  L+IP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLIN+ +
Sbjct  371   RFWDVKFENGILKIPRLLIHDGTKSLFLNLIAFEQCHLDCSND-ITSYVIFMDNLINSPQ  429

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVM  1328
             DV      G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +Y+  WN  
Sbjct  430   DVGYLHYCGIIEHWLGSDDEVADLFNRLCQEVVFDINDS-YLSPLSADVNRYYDHRWNAW  488

Query  1329  MAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              A L+H+YF+ PWA +S IAAV LL LT AQT   V
Sbjct  489   RASLKHNYFSNPWAILSFIAAVVLLFLTFAQTFYGV  524



>ref|XP_002513460.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48863.1| conserved hypothetical protein [Ricinus communis]
Length=410

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/457 (33%), Positives = 232/457 (51%), Gaps = 57/457 (12%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S++ +++ L  LS + CI +V + LR+ N  AYTP  +SIG  HHG  +L  ME  K  Y
Sbjct  2     SVRNELEVLHSLSDDCCIHRVPKRLRQLNEKAYTPRAVSIGALHHGKQELKAMEEHKRRY  61

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL+  K  S+E C + +KD++ +  + Y   E I L      + FVKM+LLD  FI 
Sbjct  62    LRDFLEWSK-ASVEDCIKLIKDNEIRLRNCYS--ETIGL----NSENFVKMILLDAAFII  114

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
               L ++  +E + +            + +F   GM   V  D+LLLENQ+PFF+L +L  
Sbjct  115   MVLLKQCLKEFRSK-----------KDRIFSKPGMIGDVRFDILLLENQIPFFILDDLFK  163

Query  636   MVYDESKPKFLDIVKIT-------FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHN  794
             +  +    + L ++ +T       F S + K         ++ D +      H++  +  
Sbjct  164   LSTNSEGHEELSMIVLTHKFFTDTFDSWVAK---------HILDEHDFSKIEHMVDFLR-  213

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
             +C  Q   +Q  +    L  P                  + TEL +AGV  + +  S  L
Sbjct  214   VCQ-QPPKLQNRKKLKKLIIP------------------SVTELHQAGVKFE-LGSSRKL  253

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
              +IKFN   L++P   I D TE   RN+ A+EQ  CD+ N Y +DY  L+  L+   KDV
Sbjct  254   LNIKFNRGILKVPSLQIDDNTEILLRNLQAFEQCLCDRGN-YVSDYISLVSLLVKAPKDV  312

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
             +L   NG++ NWL + + V+ LF +L +  +    D FY+S +  +LN +   PWN   A
Sbjct  313   DLLAQNGIIENWLVNSEGVSTLFQKLEQENLLIP-DDFYFSSLVEELNSYCKNPWNKWKA  371

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              L+ DYFNTPWA IS IAA  LL LT+ Q+V ++L +
Sbjct  372   TLKQDYFNTPWAVISVIAAAILLILTVIQSVCSILQV  408



>ref|XP_002513461.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48864.1| conserved hypothetical protein [Ricinus communis]
Length=437

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 153/462 (33%), Positives = 229/462 (50%), Gaps = 61/462 (13%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             + ES+KR+I+ L  LS E CI++V + LR  N  AYTP ++SIGPYHHG  +L  ME  K
Sbjct  26    LVESIKREIEILDPLSDECCIYRVPQQLREINEKAYTPRVVSIGPYHHGKNELKAMEEYK  85

Query  267   LMYLDLFLKREK------QPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKM  428
               YL  FL+R +         +++  ++L++S  +   +   D             FVKM
Sbjct  86    RRYLVDFLERSEIMFDIFITGIQEMEKRLRNSYAETIRHSRKD-------------FVKM  132

Query  429   LLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLP  608
             + +DG F+ E+L +               +    ++ +F    +   +  DL++LENQLP
Sbjct  133   MAVDGAFLIEYLLK------------WYLRDWSSSDRIFNKQQLGHMLCFDLIMLENQLP  180

Query  609   FFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIV  788
             FF L+ L  +  + SK          F   L+ V+L+   + N+ + N   +  H L  V
Sbjct  181   FFFLEHLFKLT-NASK----------FVEGLSIVKLVNIFLINMTEQNW--LSSHYL--V  225

Query  789   HNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSS  968
             H      N  +Q    +  +CF     K +   K  S    T ++L  AG   K    S 
Sbjct  226   HG-----NIAVQHLVDFVAICF-LQPSKPNAKRKCRSLTTPTISKLHRAGAKFKSST-SR  278

Query  969   SLFHIKFNHAE--LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
              L  IKF+     LEIP+F +TD TE F RN+ A+EQ  C     Y  DY  +MD L++ 
Sbjct  279   CLLDIKFDKKRGVLEIPQFKVTDYTEIFSRNIQAFEQ--CHNRVNYANDYFSIMDLLVDV  336

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCK-GVVYSSCDGFYYSDVCNKLNGHYNKPW  1319
              +DV+L   +G++ NWL D++     FN + K  ++Y   D FY+S +   LN +   PW
Sbjct  337   PEDVDLLVQSGIIENWLEDNQAAATFFNNMGKHNLIY---DDFYFSGLVGDLNAYCRTPW  393

Query  1320  NVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             +   A L+  YFN PW  IS  AA FLL LTI QTV ++L +
Sbjct  394   HNWKASLKQKYFNNPWTMISVAAAGFLLLLTIIQTVCSILQV  435



>gb|AAU44488.1| hypothetical protein AT3G50170 [Arabidopsis thaliana]
Length=541

 Score =   216 bits (549),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 164/478 (34%), Positives = 242/478 (51%), Gaps = 46/478 (10%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKR-DIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             E T GD   + I + L++ D  +   +  + CI++V   L+  +  +Y P  +S+GPYHH
Sbjct  83    EETTGDSWVISIRDKLEQADRDDDTTIWGKLCIYRVPHYLQENDKKSYFPQTVSLGPYHH  142

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G  +L  ME  K   L+  LKR KQ  +E     +++ +EKA + Y  +  I L    + 
Sbjct  143   GKKRLRPMERHKWRALNKVLKRLKQ-RIEMYTNAMRELEEKARACY--EGPISL----SR  195

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             ++F +ML+LDGCF+ E L+R   E   +            N+ VF   G+   + RD+++
Sbjct  196   NEFTEMLVLDGCFVLE-LFRGTVEGFTEIGY-------ARNDPVFAMRGLMHSIQRDMIM  247

Query  591   LENQLPFFVLQELHGM---------VYDESKPKFLDIVKITFASMLTK------VRLIPP  725
             LENQLP FVL  L  +         +      KF D +  T    LTK      +  +  
Sbjct  248   LENQLPLFVLDRLLELQLGTQNQTGIVAHVAVKFFDPLMPT-GEALTKPDQSKLMNWLEK  306

Query  726   IVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQD-SKVGSS  902
              +  LGD      KG L    H L   +   +Q      T      L + ++   K    
Sbjct  307   SLDTLGD------KGEL----HCLDVFRRSLLQSSPTPNTRSLLKRLTRNTRVVDKRQQQ  356

Query  903   DIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSC  1082
              +   TEL+EAGV  +K  K+   + I+F +  LEIPK  I D T++ F N+IA+EQ   
Sbjct  357   LVHCVTELREAGVKFRKR-KTDRFWDIEFKNGYLEIPKLLIHDGTKSLFSNLIAFEQCHI  415

Query  1083  DKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCD  1262
             + +N + T Y   MDNLIN+ +DV+     G++ +WLG D EV DLFNRLC+ VV+   D
Sbjct  416   ESSN-HITSYIIFMDNLINSSEDVSYLHYCGIIEHWLGSDSEVADLFNRLCQEVVFDPKD  474

Query  1263  GFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               + S +   +N +YN+ WNV+ A L H YFN PWA  S  AAV LL LT+ Q+  AV
Sbjct  475   S-HLSRLSGDVNRYYNRKWNVLKATLTHKYFNNPWAYFSFFAAVILLLLTLCQSFYAV  531



>ref|XP_010244239.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
Length=539

 Score =   215 bits (548),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 162/484 (33%), Positives = 245/484 (51%), Gaps = 60/484 (12%)
 Frame = +3

Query  60    TEGDQQDLPIYESLKRDIKNLKQLS-SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGN  236
             +E  Q  + I E L++  ++    S ++ CI++V + LR  +  AY P ++S+GPYHHG 
Sbjct  80    SESTQWVISITEKLEQARQDENAGSWAKLCIYRVPKCLREGDDKAYVPQIVSLGPYHHGR  139

Query  237   AKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDK  416
              +L +M+  K   L   LKR     ++   E +K+ +EKA + Y  + +I L    +  +
Sbjct  140   KRLREMDRHKWRALHHTLKRTNH-DVKHYLEPIKELEEKARACY--EGEITL----SSKE  192

Query  417   FVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLE  596
             FV+M++LDGCF+ E L+R      K             N+ VF   G+   + RD+++LE
Sbjct  193   FVEMMVLDGCFMLE-LFRGAAGGFKHLGYSR-------NDPVFAMRGIMHSIQRDMIMLE  244

Query  597   NQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPN---LGDNNATEMK  767
             NQ+P FVL  L G+       +  D+ +  F + L  +R   P++P+   L     T M+
Sbjct  245   NQIPLFVLDRLLGL-------QMGDLDQKGFVAKLA-LRFFDPLMPSDEPLQQKYLTRME  296

Query  768   ---GHLLQIVHNLCNPQNG--------------GIQEERHYWTLCFPCSLGKQSQDSKVG  896
                GH    V +    Q+G              G Q     W       + + SQ  +V 
Sbjct  297   SSMGH--STVFDPLTEQDGLHCLDIFRRSLLRRGPQPSARMW-------IRRWSQADRVA  347

Query  897   SSD----IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIA  1064
                    I   TEL++AG+  KK  K+   + IKF +  L IP+  I D T++ F N+IA
Sbjct  348   DKRRQQLIHCVTELKDAGIKFKKR-KTDRFWDIKFKNGVLRIPRLLIHDGTKSLFLNLIA  406

Query  1065  YEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV  1244
             +EQ   D +N   T Y   MDNLIN+ +DV      G++ +WLG D EV DLFNRLC+ V
Sbjct  407   FEQCHLDCSNN-ITTYVIFMDNLINSPQDVGYLHYYGIIEHWLGSDAEVADLFNRLCQEV  465

Query  1245  VYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQT  1424
             V+   +  Y S +  ++N +  + WN   A L+H+YF+ PWA IS  AAV LL LT AQT
Sbjct  466   VFDIKES-YLSLLSEQVNRYSEQKWNAWRASLKHNYFSNPWAIISFSAAVVLLLLTTAQT  524

Query  1425  VIAV  1436
                V
Sbjct  525   FYGV  528



>ref|XP_009136540.1| PREDICTED: UPF0481 protein At3g47200-like [Brassica rapa]
Length=582

 Score =   216 bits (550),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 158/448 (35%), Positives = 230/448 (51%), Gaps = 49/448 (11%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHH    L  ME+ K   +++ +KR K   +E  
Sbjct  151   CIYRVPRYLQENDKKSYFPQTVSLGPYHHSKEHLVPMEHHKWRAVNMVMKRTKH-RIEMY  209

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +K+ +EKA A Y G        +  + +KF +M+ LDG FI E L+R  D +     
Sbjct  210   IDAMKELEEKARACYEGP-------IVWSSNKFAEMMFLDGLFILE-LFRGADNDKGFLV  261

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ VF   G    + RD+++LENQLP FVL  L  +         L +V+
Sbjct  262   LGYGR-----NDPVFAMRGSMHSIQRDMVMLENQLPLFVLNRLLELQLGSEYQTGL-VVQ  315

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIV---HNLCNPQNGGIQEERHYWTLC  851
             +        +R   P++P   D  AT+     ++I     N  NP     +EE H   + 
Sbjct  316   LA-------IRFFNPLMPT--DKLATKTDQVEIKISLENDNFFNPIADKDKEELHCLDV-  365

Query  852   FPCSLGKQSQDSKVGSSDIRTA-----------------TELQEAGVNLKKVVKSSSLFH  980
             F  SL + SQ  +   S  R +                 TEL+EAG+  K+  K+   + 
Sbjct  366   FRRSLLRPSQKPEPRLSRTRWSWKRRAADKRQQQLIHCVTELREAGIKFKRR-KTDRFWD  424

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNL  1160
             I+F +  LEIPK  I D T++ F N+IA+EQ   D NN   T Y   MDNLI++ +DV  
Sbjct  425   IRFKNGYLEIPKLLIHDGTKSLFSNLIAFEQCHIDSNND-ITSYIIFMDNLIDSAEDVRY  483

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
                 G++ +WLG D EV DLFNRLC+ V +   D  Y S++ NK++ +YN+ WNVM A L
Sbjct  484   LHYCGIIEHWLGTDSEVADLFNRLCQEVAFDLQDS-YLSELSNKVDHNYNRKWNVMKATL  542

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQT  1424
             +H YFN PWA  S IAAV LL LT+ Q+
Sbjct  543   KHKYFNNPWAYFSFIAAVILLLLTLFQS  570



>ref|XP_008241187.1| PREDICTED: UPF0481 protein At3g47200-like [Prunus mume]
Length=457

 Score =   213 bits (542),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 143/445 (32%), Positives = 226/445 (51%), Gaps = 40/445 (9%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             +++      + CI+KV + LRR N + Y P ++SIGPYH       +M+  KL YL+ FL
Sbjct  53    LRDTPSFWPDCCIYKVPQRLRRGNEEFYEPRVVSIGPYHFHQGSFPEMQIFKLKYLEAFL  112

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
              R  + S++QC   ++  + KA  +Y D       +D + D+F +++L+D  F+ E + R
Sbjct  113   SR-NELSLDQCLGLVRTWEAKARRFYVDR------IDLSSDEFAELMLVDAIFVLELMIR  165

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE  650
                 E              D + ++    M   VF D+LL+ENQ+PFFVL+ L+ +V + 
Sbjct  166   HQFFEYVD-----------DCDRIYRKPRMIEDVFHDVLLIENQIPFFVLEGLYNLVDNG  214

Query  651   SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE  830
             SK      V++T       V+     +   G + A          VH + +     +   
Sbjct  215   SKRTLKFFVELTHEFFKASVK-----IDKFGADRAP---------VHGVNHGVKHFVDFI  260

Query  831   RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEI  1010
             R Y+    P    K     +V      + T L++AGV       + SL  I+FN   L+I
Sbjct  261   RCYY---LPTEDEKHEYGHRVYEIP-PSVTALEDAGVKFA-TTSTRSLLDIQFNRGCLKI  315

Query  1011  PKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNW  1190
             P F + D TET F+N+IA+EQ   D    Y ++   LM  +I T KDV+L   + ++ + 
Sbjct  316   PNFRVDDWTETVFKNLIAFEQ-CHDHQVKYISELMFLMGCMIKTSKDVDLLIEHEIISSM  374

Query  1191  LGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
             LG + +V+ LFN + +GV +S     YY  +C +LN +   PW+   A L+ DYFNTPW 
Sbjct  375   LGSNVDVSTLFNHIGQGVGFSQPK--YYLSLCKELNAYCKAPWHRWKAILKRDYFNTPWK  432

Query  1371  GISTIAAVFLLSLTIAQTVIAVLDL  1445
              +STIAA+ LL LT+ QT+ ++L L
Sbjct  433   VVSTIAAIVLLVLTLVQTICSILSL  457



>ref|NP_190586.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB62125.1| putative protein [Arabidopsis thaliana]
 emb|CAB62296.1| putative protein [Arabidopsis thaliana]
 gb|AEE78634.1| uncharacterized protein AT3G50170 [Arabidopsis thaliana]
Length=541

 Score =   215 bits (547),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 164/478 (34%), Positives = 242/478 (51%), Gaps = 46/478 (10%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKR-DIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             E T GD   + I + L++ D  +   +  + CI++V   L+  +  +Y P  +S+GPYHH
Sbjct  83    EETTGDSWVISIRDKLEQADRDDDTTIWGKLCIYRVPHYLQENDKKSYFPQTVSLGPYHH  142

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G  +L  ME  K   L+  LKR KQ  +E     +++ +EKA + Y  +  I L    + 
Sbjct  143   GKKRLRPMERHKWRALNKVLKRLKQ-RIEMYTNAMRELEEKARACY--EGPISL----SR  195

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             ++F +ML+LDGCF+ E L+R   E   +            N+ VF   G+   + RD+++
Sbjct  196   NEFTEMLVLDGCFVLE-LFRGTVEGFTEIGY-------ARNDPVFAMRGLMHSIQRDMIM  247

Query  591   LENQLPFFVLQELHGM---------VYDESKPKFLDIVKITFASMLTK------VRLIPP  725
             LENQLP FVL  L  +         +      KF D +  T    LTK      +  +  
Sbjct  248   LENQLPLFVLDRLLELQLGTQNQTGIVAHVAVKFFDPLMPT-GEALTKPDQSKLMNWLEK  306

Query  726   IVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQD-SKVGSS  902
              +  LGD      KG L    H L   +   +Q      T      L + ++   K    
Sbjct  307   SLDTLGD------KGEL----HCLDVFRRSLLQSSPTPNTRSLLKRLTRNTRVVDKRQQQ  356

Query  903   DIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSC  1082
              +   TEL+EAGV  +K  K+   + I+F +  LEIPK  I D T++ F N+IA+EQ   
Sbjct  357   LVHCVTELREAGVKFRKR-KTDRFWDIEFKNGYLEIPKLLIHDGTKSLFSNLIAFEQCHI  415

Query  1083  DKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCD  1262
             + +N + T Y   MDNLIN+ +DV+     G++ +WLG D EV DLFNRLC+ VV+   D
Sbjct  416   ESSN-HITSYIIFMDNLINSSEDVSYLHYCGIIEHWLGSDSEVADLFNRLCQEVVFDPKD  474

Query  1263  GFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               + S +   +N +YN+ WNV+ A L H YFN PWA  S  AAV LL LT+ Q+  AV
Sbjct  475   S-HLSRLSGDVNRYYNRKWNVLKATLTHKYFNNPWAYFSFSAAVILLLLTLCQSFYAV  531



>ref|XP_010244181.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010244182.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010244183.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010244184.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010244185.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010244186.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010244187.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
Length=522

 Score =   214 bits (546),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 155/476 (33%), Positives = 234/476 (49%), Gaps = 58/476 (12%)
 Frame = +3

Query  78    DLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKME  257
             D  + +S+   +K     SSE CI++V + LR T   AY P ++SIGP+H GN  L  M+
Sbjct  76    DKALSDSIGGKVKLTPPRSSECCIYRVPKALRETKERAYVPEIVSIGPFHRGNRNLQAMD  135

Query  258   NLKLMYL-DLFLKREKQPSMEQCWEK-LKDSKEKAASYYGDDEDIQLLLDSAGDKFVKML  431
               K +YL DL      Q  M + W K L+  + KA   Y +  D     + + D+FV+M+
Sbjct  136   EYKRLYLHDLLSHLPTQAKMLESWIKTLRGLEVKARKCYSEPVD-----NLSSDEFVEMM  190

Query  432   LLDGCFIAEFLYReydeetk--------keeeeelnkkkCDNNA-----VFMPTGMKFQV  572
             L+DGCF+ E L +  + + K                 +  D+ A     +F    M  ++
Sbjct  191   LVDGCFVLELLRKYSEIQLKGGPPEPVHSGVLGAAQDQAADDKAQPQDPIFKSAWMLPRI  250

Query  573   FRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNN  752
               D+LLLENQLP FVL+ L  +       + L + ++ F            I+P  G++ 
Sbjct  251   LCDMLLLENQLPLFVLECLFKLTIAPQLQQALSLNELVF-------NFFANIMPTGGESP  303

Query  753   ATE---MKG-HLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTAT  920
             A     +KG H+L ++     P +           L FP  +        V        T
Sbjct  304   ADRPRLIKGQHILSLLRKAILPSS----------KLKFPGDIKAPELTHCV--------T  345

Query  921   ELQEAGVNLKKVVKSSSLFHIKFN-HAELEIPKFHITDPTETFFRNMIAYEQ--HSCDKN  1091
             EL EAG+  KK  K  S   I F+    LEIP  ++ + T+  FRN+IA+EQ   SC   
Sbjct  346   ELIEAGIKFKKKEKPDSFLDISFSTDGVLEIPSINVQEYTDCLFRNLIAFEQCHPSCTSR  405

Query  1092  NMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFY  1271
                 T YA LMD+L++T +DV       ++ + +G  KEV+ LFN+LC GV     + FY
Sbjct  406   ---ITSYAFLMDSLVDTPEDVQYLNRRSIITHVMGTHKEVSLLFNKLCDGVYL---NHFY  459

Query  1272  YSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             Y D+C+++N H+   W+V  A L  DYF  PWA +S +AA+FLL LT   ++ ++L
Sbjct  460   YVDLCDQVNAHFRSRWHVWRATLMRDYFKNPWAVLSFVAAIFLLILTFTGSLFSIL  515



>emb|CDO99351.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 149/458 (33%), Positives = 235/458 (51%), Gaps = 47/458 (10%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             + +++ ++   S +  IFKVH  LR  N +AY P ++SIGPYHHG  KL +ME  KL Y 
Sbjct  4     IDQNLSDVLDTSEKPSIFKVHGPLRSENEEAYEPQVVSIGPYHHGKPKLKEMEKHKLRYF  63

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
                L+R  + S E+    L + +++A   Y   E+I L    + D FV ML LDGCF+ E
Sbjct  64    KEILRRRGESSAEKYIIALANLQDQARRCYA--EEINL----SEDDFVDMLCLDGCFVIE  117

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
             FL +            +  +   +N+ +F    +   +  DL+L ENQLPFFVLQ+L  M
Sbjct  118   FLRK-----------NQQPESCLENDHIFEMLWLPSTIAHDLVLFENQLPFFVLQKLFDM  166

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEM-----KGHLLQIVHNLCN  803
                 S  + L         +   +RL+    P+ G N+ + +     + HLL ++H + +
Sbjct  167   TKSPSGEENL-------IDLAIDLRLL-WYFPDPGLNSHSTILEQYEEVHLLGLMHKILS  218

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
                 G              ++     DS +    I++A EL ++G+  KK   S SLFHI
Sbjct  219   ASFSG----------TLSSTMNSNRGDSTLY---IKSAGELGQSGIKFKKAEDSKSLFHI  265

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMY--FTDYAQLMDNLINTEKDVN  1157
              F +  L+IP   + D TE+FFRN+IAYEQ+  +    +   T Y   +D LI++  DV 
Sbjct  266   TFENGVLKIPPLVVHDNTESFFRNLIAYEQYMSNPAEAWKCITGYMIFLDCLIDSPSDVE  325

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
               R + ++ N LG D+ ++ +FN+L K V  +S   F Y+ + + ++ +  K W++  A 
Sbjct  326   RLRRHDIIENGLGSDEALSTMFNKLSKQV--NSGGRFCYAKIFDDVDKYSRKRWHIWRAH  383

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             L   YFNTPW+ I+ +AA  LL L   Q + ++L   K
Sbjct  384   LVRKYFNTPWSFIAFLAACALLLLATVQAIFSILQYTK  421



>ref|XP_008352183.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
Length=423

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 152/453 (34%), Positives = 226/453 (50%), Gaps = 52/453 (11%)
 Frame = +3

Query  90    YESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKL  269
             Y+ L  +++NL  LS   CI++V E LR+ N  AYTP ++SIGP HHG   L  ME  K 
Sbjct  15    YDPLLEELRNLLPLSPLRCIYRVPERLRQGNEKAYTPQVVSIGPLHHGKEHLKAMEEHKK  74

Query  270   MYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
              YL  FL R    S     + +K+ + +   +Y +       ++ + D+FV+++L+D  F
Sbjct  75    RYLRHFLSRTGV-SFFDYIQMIKEQEGRLRGFYAES------IEFSSDQFVRIVLVDAAF  127

Query  450   IAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL  629
             + EFL R Y    +            +++ +F    MK  V  DL LLENQLPFF+LQ L
Sbjct  128   VIEFLLRNYSVNFR-----------GEDDYIFNKPMMKRDVRPDLRLLENQLPFFILQVL  176

Query  630   HGMVYDES--KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN  803
                 +  +  +P  L+I      S +              D+   E          +   
Sbjct  177   FNTTFSSANQRPSLLEISYFFIKSAI--------------DSKGKE---------DSFDK  213

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQD-SKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
              ++ G++ + H+  L     L  +S+   K  ++     TEL +AGV         SLF 
Sbjct  214   IRSSGVKVQ-HFVDLIRTLYLPMKSKAIKKFKTTAAPNITELLQAGVKFAAGT-GHSLFD  271

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
             IKF+   LEIPK  I D T    RN++A+EQ H+ + N  Y T+Y  LM  L  T KDV 
Sbjct  272   IKFSGGILEIPKITINDTTNMTLRNLLAFEQCHTKEAN--YLTNYVFLMKRLAKTPKDVX  329

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L    G++ NWLGD K+++ L + L   V+ S+    YY+ +C  LN +   P +  MA 
Sbjct  330   LLVEYGIIENWLGDTKKISTLLHDLGTRVIVSN---HYYAILCEDLNNYCRTPRHKWMAN  386

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             LR +YFN+PW  IS +AA+ LL LT  QTV ++
Sbjct  387   LRQNYFNSPWTIISVVAALILLILTFIQTVCSI  419



>ref|XP_009334781.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=457

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 222/454 (49%), Gaps = 54/454 (12%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             + L+ ++ NL  LS   CI++V + LR  +  AYTP ++SIGP HHG   L  ME  K  
Sbjct  50    DPLQEELDNLSTLSPLRCIYRVPKRLRWVHEKAYTPQVVSIGPLHHGKEHLKAMEEHKKW  109

Query  273   YLDLFLKREKQP-SMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
             YL  FL R ++  S     + +KD + +    Y +       ++   D+FV+++L+D  F
Sbjct  110   YLRHFLSRTRERVSFSDYIQMIKDQEGRLRGSYAEP------IEFGSDQFVRIVLVDAAF  163

Query  450   IAEFLYReydeetkkeeeeelnkkkCD-NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             + EFL R                  C+ ++ +F    M++ V  DL LLENQLPFF+LQ 
Sbjct  164   VIEFLLR-------------CRDSNCEGDDYIFNNPMMRWDVLPDLRLLENQLPFFILQV  210

Query  627   LHGMVYDES--KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
             L   +   +  +P  L+I    F S + +            +   TE   H + ++  L 
Sbjct  211   LFNTLSSSAHPRPSLLEISYSFFESQIVR----KGKEKGFNEICYTEEVQHFVDLIRILY  266

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
              P     + E                    + ++ +  A EL +AGV    V K S+LFH
Sbjct  267   RPFKSQTRRE--------------------LKTTAVPNAAELLQAGVKF-TVGKGSNLFH  305

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNM-YFTDYAQLMDNLINTEKDVN  1157
             IKF+   L+IP   + D T+   RN++A+EQ  C K      T Y  LM  L  T KDV 
Sbjct  306   IKFSDGILKIPTLIVADTTDLTLRNLLAFEQ--CHKREEDCLTSYVFLMKRLAKTPKDVE  363

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L   +G++ NWLG  K+++ L + L  G++    D + Y+ +C  LN +  K  +  MA 
Sbjct  364   LLVEHGIIENWLGSTKKISTLLHDLGTGMI---LDYYCYAPLCEDLNSYCGKRRHKWMAN  420

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             LR +YFNTPW+ IS +AAV LL LT  QTV  V+
Sbjct  421   LRQNYFNTPWSIISVVAAVILLILTFIQTVCTVI  454



>emb|CDY23018.1| BnaC07g31690D [Brassica napus]
Length=413

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 154/430 (36%), Positives = 223/430 (52%), Gaps = 48/430 (11%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG   L  ME+ K   +++ +KR K  S+E  
Sbjct  17    CIYRVPRYLQENDKKSYFPQTVSLGPYHHGKEHLLPMEHHKWRAVNMVMKRTKH-SIEMY  75

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +K+ +EKA A Y G        +  + +KF +M+ LDG FI E L+R  D +     
Sbjct  76    IDAMKELEEKARACYEGP-------IGWSSNKFAEMMFLDGLFILE-LFRGADNDKGFLV  127

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ VF   G    + RD+++LENQ+P F+           +K   L+I K
Sbjct  128   LGYGR-----NDPVFAMRGSMHSIQRDMVMLENQIPLFL----------ATKTDQLEI-K  171

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVH-NLCNP-QNGGIQEERHYWTLCF  854
             I+    L       PI     D +  E+  H L +   +L  P Q    +  R  W+   
Sbjct  172   IS----LENDNFFNPI----ADKDKEEL--HCLDVFRRSLLRPSQKPEPRLSRTRWSW--  219

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
                  K+    K     I   TEL+EAG+  K+  K+   + I+F +  LEIPK  I D 
Sbjct  220   -----KRRAADKRQQQLIHCVTELREAGIKFKRR-KTDRFWDIRFKNGYLEIPKLLIHDG  273

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             T++ F N+IA+EQ   D NN   T Y   MDNLI++ +DV      G++ +WLG D EV 
Sbjct  274   TKSLFSNLIAFEQCHIDSNND-ITSYIIFMDNLIDSAEDVRYLHYCGIIEHWLGTDSEVA  332

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
             DLFNRLC+ V +   D  Y S++ NK++ +YN+ WNVM A L+H YFN PWA  S IAAV
Sbjct  333   DLFNRLCQEVAFDLQDS-YLSELSNKVDHNYNRKWNVMKATLKHKYFNNPWAYFSFIAAV  391

Query  1395  FLLSLTIAQT  1424
              LL LT+ Q+
Sbjct  392   ILLLLTLFQS  401



>ref|XP_002278393.1| PREDICTED: UPF0481 protein At3g47200 [Vitis vinifera]
Length=527

 Score =   213 bits (543),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 152/458 (33%), Positives = 233/458 (51%), Gaps = 59/458 (13%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI+++   LR  +  AY P ++S+GPYHHG  +L  M+  K   L   LKR     +
Sbjct  98    AKLCIYRLPHYLREGDDKAYIPQIVSLGPYHHGRRRLRNMDRHKWRSLHHILKRTNH-DI  156

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             E   + +K+ +EKA + Y    +  + L S  ++FV+M++LDGCFI E L+R      K 
Sbjct  157   EIYLDAMKELEEKARACY----EGTICLSS--NEFVEMMVLDGCFILE-LFRGVAGGFKH  209

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ VF   G    + RD+++LENQ+P FVL+ L G+   + + K L +
Sbjct  210   LGY-------ARNDPVFAIRGSMHSIQRDMIMLENQIPLFVLERLLGIQLGQPEQKGL-V  261

Query  675   VKITFASMLTKVRLIPPIVP---------------NLGDNNATEMKG-----HLLQIVHN  794
              K+        +R   P++P               +LG     +  G     H L++   
Sbjct  262   AKLA-------LRFFDPLMPTDEPLTKSDRNRLESSLGYTTTFDPLGDQGGLHCLEVFRR  314

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVK  962
               +    G +     W       + + S  ++V        I   T+L+EAG+  KK  K
Sbjct  315   --SLLRTGPRPVPRIW-------MKRWSHSNRVADKRRQQLIHCVTQLREAGIKFKKR-K  364

Query  963   SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
             +   + IKF +  L IP+  I D T++ F N+IA+EQ   D +N   T Y   MD+LIN+
Sbjct  365   TDRFWDIKFKNGILRIPRLLIHDGTKSLFLNLIAFEQCHLDCSND-ITSYVIFMDSLINS  423

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
              +DV      G++ +WLG + EV DLFNRLC+ VV+   D  Y S +  ++N +YN  WN
Sbjct  424   PEDVGYLHYCGIMEHWLGSESEVADLFNRLCQEVVFDINDS-YLSSLSEQVNKYYNHRWN  482

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
                A L+H+YF++PW  IS +AAV LL+LT AQT  AV
Sbjct  483   AWRASLKHNYFSSPWTIISFVAAVVLLALTFAQTFYAV  520



>gb|KDP22062.1| hypothetical protein JCGZ_25893 [Jatropha curcas]
Length=434

 Score =   211 bits (537),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 149/460 (32%), Positives = 231/460 (50%), Gaps = 57/460 (12%)
 Frame = +3

Query  87    IYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLK  266
             + +S++ D+KNL  LS + CI +V + LR+ N  AYTP  +SIGP HHG  +L  ME  K
Sbjct  24    LAKSVRSDLKNLHSLSDDCCISRVPKRLRQLNEKAYTPRAVSIGPLHHGKEELKAMEEHK  83

Query  267   LMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGC  446
               YL+ FL+   + S+E   +++K+ + +  + Y +   ++       + FVK++L+D  
Sbjct  84    RRYLNEFLEWS-EVSIEDYIKQIKEHETRLRNCYSETVGLK------SEDFVKIILIDAA  136

Query  447   FIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             FI   L ++  +E +              + VF    M  +V  D+LLLENQLPFF+L +
Sbjct  137   FIIMVLLKQSLKEFR-----------SKKDRVFSKPWMIGEVRFDILLLENQLPFFILDD  185

Query  627   LHGMVYDESKPKFLDIVKIT-------FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQI  785
             L  +     +   L I+ +T       F S + K          + D +      H++  
Sbjct  186   LFKLSNKPPEGHELSIIMLTHNFFIDTFGSWVAK---------RILDKHDFSKIEHMVDF  236

Query  786   VHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
             +  +C  Q   +Q  +    L  P                  + TEL +AGV  + +  S
Sbjct  237   LR-ICQ-QPPKLQNRKKLKKLTVP------------------SVTELLQAGVKFE-LGSS  275

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
               L +IKF +  LEIP   I D +E   RN+ A+EQ  C+++N Y +DY  L+  L    
Sbjct  276   KKLLNIKFQNGVLEIPPLQIDDNSEILLRNLQAFEQCLCNRDN-YVSDYITLVSMLAKGP  334

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             KDV +   NG++ NWL + + V+ LF +L +  +    D FY+S +   LN +   PWN 
Sbjct  335   KDVEILARNGIMENWLVNSEGVSTLFQKLVQENLLFP-DDFYFSSLVEDLNSYCKNPWNK  393

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               A L+ DYFNTPWA IS IAA FLL  T+ Q+V ++L L
Sbjct  394   WKATLKQDYFNTPWAVISVIAAGFLLIFTVIQSVCSILQL  433



>ref|XP_007022372.1| Uncharacterized protein TCM_032631 [Theobroma cacao]
 gb|EOY13897.1| Uncharacterized protein TCM_032631 [Theobroma cacao]
Length=514

 Score =   213 bits (542),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 156/481 (32%), Positives = 232/481 (48%), Gaps = 83/481 (17%)
 Frame = +3

Query  168   LRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSK  347
             LR+ N  AY P LISIGPYHHG   L +ME  K   L   L+R    + +Q   + +D+ 
Sbjct  64    LRQLNESAYEPQLISIGPYHHGKQHLIEMEVYKKRCLQRILER----NGDQNHHRYRDAI  119

Query  348   E--KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkk  521
             +  +A  +Y        L +    KF  ++L+DGCFI E L +   +E            
Sbjct  120   DFVRARKWYSPS-----LPNDIEAKFKAIMLVDGCFIVELLRQMETDEY-----------  163

Query  522   kCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPK-FLDIVKITFASM  698
                ++ +F    ++  +  DL+L ENQLPFFVL  L+ ++ D +  K F        ++ 
Sbjct  164   ---DDPIFQKKWVQNSLLGDLVLFENQLPFFVLVGLYHVIEDPTDGKDFACRAFSVLSNF  220

Query  699   LTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHY-------------  839
             L   +     +P + D   T+    LL ++H+  +P   GI+  + Y             
Sbjct  221   LPGPQTWKENLPTIKD---TDNIKDLLSLLHDNWSPSPQGIRHHQDYYRTKDEKARAGQE  277

Query  840   ----------WTLCFPCSLGKQSQDSKVGSSD------------------------IRTA  917
                       W     C++ K  +    G ++                        +R A
Sbjct  278   AREKGGLENKWKFTL-CAVEKPKEKKFQGDAESGVTITCCAREKENLRKGLLEWQSLRCA  336

Query  918   TELQEAGVNLKKVVKSS---SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDK  1088
             TEL+EAG+      + S   SLF I F +A ++IP F + D TE  FRN+IAYE +  ++
Sbjct  337   TELKEAGIQFMNSTEESGVNSLFDISFTNATMKIPTFVVEDDTERLFRNLIAYELY--EE  394

Query  1089  NNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGF  1268
              + Y  DY  LMDNLIN+ KDV L R + ++ N LGDD+ V  +FN+L   V+    D F
Sbjct  395   GSTYVIDYVTLMDNLINSSKDVQLLRFSEIIENMLGDDEAVAIMFNKLRDHVILCG-DTF  453

Query  1269  YYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
             YY ++   +  H  + WN   AKLRHDYFN+PWA IS IAA+ ++ LTI Q V A++ L 
Sbjct  454   YYEEIFVDVKRHCARRWNTWKAKLRHDYFNSPWALISFIAALLVILLTIGQFVTALIPLV  513

Query  1449  K  1451
             K
Sbjct  514   K  514



>ref|XP_010558850.1| PREDICTED: UPF0481 protein At3g47200 [Tarenaya hassleriana]
Length=525

 Score =   213 bits (542),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 150/459 (33%), Positives = 230/459 (50%), Gaps = 61/459 (13%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI++V   L+  +  +Y P ++S+GPYHHG  +L  M+  K   +   LKR  Q  +
Sbjct  95    AKLCIYRVPYYLQENDNKSYFPQIVSLGPYHHGKKRLRSMDRHKWRAVQRILKRTNQ-DI  153

Query  315   EQCWEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +   + +K+ +E+A A Y G        +  + ++FV+MLLLDGCF+ E L+R   E  K
Sbjct  154   KMYIDAMKELEERARACYEGS-------IGMSSNEFVEMLLLDGCFVLE-LFRGAVEGFK  205

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
             +            N+ +F   G    + RD+++LENQLP FVL +L  +         L 
Sbjct  206   ELGY-------ARNDPIFAMRGSMHSIQRDMIMLENQLPLFVLDKLLELQ--------LG  250

Query  672   IVKITFASMLTKVRLIPPIVPN---LGDNNATEMKG-----------------HLLQIVH  791
             I   T       +R   P++P    L   + ++++                  H L +  
Sbjct  251   IPNQTGLVAQLAIRFFDPLMPTDEPLTKTDRSKLESSLKTDKTFDPFSDMGGLHCLDVFR  310

Query  792   NLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVV  959
                  ++G   E R         S  + S + +V        +   TEL+E+G+  +K  
Sbjct  311   RSL-LRSGPKPEPR--------LSRRRWSHNRRVADKRRQQLVHCVTELKESGIRFRKR-  360

Query  960   KSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLIN  1139
             K+   + I+F +  LEIP+  I D T++ F N+IA EQ   D +N   T Y   MDNLIN
Sbjct  361   KTDRFWDIRFKNGYLEIPRLLIHDGTKSLFLNLIALEQCHIDSSND-ITSYIIFMDNLIN  419

Query  1140  TEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPW  1319
             + +DV L    G++ +WLG D EV DLFNRLC+ VV+   D  Y S +  ++N +YNK W
Sbjct  420   SPQDVGLLHYYGIIEHWLGSDSEVADLFNRLCQEVVF-DIDDSYLSRLSEEVNRYYNKKW  478

Query  1320  NVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             N   A L+H YFN PWA +S  AA  LL+LT +Q+  AV
Sbjct  479   NAWRATLKHKYFNNPWAIVSLFAATILLTLTFSQSFYAV  517



>ref|XP_002869301.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45560.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=677

 Score =   216 bits (550),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 154/464 (33%), Positives = 228/464 (49%), Gaps = 57/464 (12%)
 Frame = +3

Query  63    EGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             EGD     + +S+K  +  L  LS++ CI+KV   LRR N DAYTP L+S GP H G  +
Sbjct  268   EGDA----LVDSIKAKLDFLSSLSTKCCIYKVPNKLRRLNPDAYTPRLVSFGPLHRGKEE  323

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME+ K  YL  F+ R    S+E      +  ++ A S Y   ED++L      D+FV
Sbjct  324   LQAMEDHKYRYLQSFIPRTNS-SLEDLVRVARTWEQNARSCYA--EDVKL----NSDEFV  376

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
              ML++DG F+ E L R +    +            +N+ +F  + +   V RD++L+ENQ
Sbjct  377   MMLVVDGSFLVELLLRSHYPRLRG-----------ENDRIFGNSMIITDVCRDMILIENQ  425

Query  603   LPFFVLQELHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGH  773
             LPFFVL+E+  ++   Y +  P    + +  F+  L+++           D        H
Sbjct  426   LPFFVLKEIFLLLFIYYQQGTPSITQLAQRHFSYFLSRI----------DDEKFISEPEH  475

Query  774   LLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKK  953
              + ++ +   PQ   +     Y TL             KV ++    ATEL  AGV  K 
Sbjct  476   FVDLLRSCYLPQ---LPIRLEYTTL-------------KVDNAP--EATELHTAGVRFKP  517

Query  954   VVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                +S L  I F    L+IP   + D TE+ +RN+I YEQ  C   N  F  Y  L+   
Sbjct  518   AESTSCLLDISFADGVLKIPTIVVDDLTESLYRNIIVYEQCHCSNKN--FLHYTTLLGCF  575

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             I +  D +L   +G++VN LG+  +V+ LFN + K V+Y     FY+S +   L  + N 
Sbjct  576   IKSPTDADLLIRSGIIVNHLGNSVDVSKLFNSISKEVIYDR--RFYFSTLSENLQAYCNT  633

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             PWN   A LR DYF+ PW+  S  AA+ LL LT  Q V ++L L
Sbjct  634   PWNRWKAILRRDYFHNPWSVASVFAALLLLLLTFIQAVCSILAL  677



>emb|CDP21269.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 147/458 (32%), Positives = 222/458 (48%), Gaps = 49/458 (11%)
 Frame = +3

Query  75    QDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKM  254
             +D  +   + R +  L    S+  IF+V   LR  N  AY P + SIGPYHHG   L K 
Sbjct  3     EDKGLTTRIDRKLSGLSNSFSKQRIFRVDHNLRSQNEVAYEPQMFSIGPYHHGKENLVKA  62

Query  255   ENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLL  434
             +  KL YL   L R  + S E+    LKD +++A S+Y +++ I L      ++FV+M+L
Sbjct  63    QTYKLWYLKELLLRRGESSTERYINALKDIEDEARSWYAEEDMIGL----GSEEFVEMML  118

Query  435   LDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFF  614
             LDG FI EFL +       K+       K+ D   +F+       +FRD+LL ENQLPFF
Sbjct  119   LDGFFIIEFLRKYAGWCLYKDYPLNYGPKQGD--PIFLNRRTMGSLFRDILLFENQLPFF  176

Query  615   VLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHN  794
             +L  L  M       +  ++V +           I P  P              L +   
Sbjct  177   ILVRLFEMTKSPGGDEEENLVDLA----------IFPDSP--------------LHLFFP  212

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                P NG +Q+          CS   +  +       I+ A+EL++AG+  +   KS S 
Sbjct  213   GEKP-NGDLQDN---------CSTSGEVNEH------IKCASELRQAGIKFETANKSVSW  256

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDK--NNMYFTDYAQLMDNLINTEK  1148
               I F    ++IP   + D TE  FRN+I +E +  +   +  Y  DY   MD+LI + +
Sbjct  257   LDIAFEKGVMKIPTLDVQDVTECVFRNLIGFELYMINGLYDRRYIIDYVTFMDSLIASSR  316

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             DV   R   ++  WLGDD+ ++ +FN L K V  Y+  + F Y  V  ++N + ++  N+
Sbjct  317   DVEKLRRQKIITKWLGDDEAISSVFNGLVKEVETYTGDNVFCYWRVFKQVNEYSSRRRNI  376

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
               A L  +YFN PW+ IS  AA+ LLSLT  QT+ ++L
Sbjct  377   WRAHLMRNYFNNPWSIISFAAALVLLSLTFVQTIFSIL  414



>gb|KHG28877.1| hypothetical protein F383_02198 [Gossypium arboreum]
Length=427

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 149/444 (34%), Positives = 228/444 (51%), Gaps = 56/444 (13%)
 Frame = +3

Query  84    PIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENL  263
             P+  S+   +K+    S + CI KV   LR+ N  AY P LISIGPYH G   L  ME  
Sbjct  14    PVAISVNEMLKSSSLASPKPCISKVPNYLRQVNEKAYEPQLISIGPYHRGKLHLKAMEER  73

Query  264   KLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDG  443
             K+ +L   ++     +  +   K+++ + +A   Y    +  L LDS  D+FVKMLLLDG
Sbjct  74    KIGFLQQVVEETMVMNASKYVMKMRELETQARKCY----EQPLCLDS--DEFVKMLLLDG  127

Query  444   CFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQ  623
             CFI + +     ++                   +   G    + +D+LL+ENQLPFFV+ 
Sbjct  128   CFIVQLIRLCLKKDLVN----------------YYTNGYFLALIQDILLVENQLPFFVIW  171

Query  624   ELHGMV-YDESKPKFLDIV-KITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIV-HN  794
             EL  ++     +  F++ V  + F  +  K R      P     + T    HLL    H+
Sbjct  172   ELFSVIETGVDQGMFIEAVFDMFFHRVPGKGR------PKHDLISITSEIKHLLDFTYHH  225

Query  795   LCNPQNG---GIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
              C+P +     + E R++                    + IR A ELQE+G+  +  ++ 
Sbjct  226   CCHPSSSEMEALNETRNF------------------DMNFIRCALELQESGIKFE-TIEG  266

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINT  1142
             +S+F I+F +  L IPK +I D TE+F RN+IA+EQ    D++  + +DY  LMD+LI++
Sbjct  267   NSMFDIRFENKTLLIPKLNIDDYTESFLRNLIAFEQLFVADRDVKHASDYMVLMDSLIDS  326

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
              KDV +   +G++ N LGDDK V  + N L  G+       FYYS V   +N H +K WN
Sbjct  327   PKDVEILCQHGIINNMLGDDKAVAAMINSL--GIYVCHSHNFYYSGVFEDVNKHCSKRWN  384

Query  1323  VMMAKLRHDYFNTPWAGISTIAAV  1394
             + MA L+H+YFN+PW+ IS +AA+
Sbjct  385   IWMANLKHNYFNSPWSLISLMAAI  408



>ref|XP_011099100.1| PREDICTED: UPF0481 protein At3g47200 [Sesamum indicum]
Length=537

 Score =   213 bits (542),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 150/458 (33%), Positives = 229/458 (50%), Gaps = 57/458 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++ CI+++   LR  +  AY P ++S+GPYHHG  +L  M+  K   L   LKR  Q  +
Sbjct  105   AKLCIYRIPHCLRDCDDKAYIPQVVSLGPYHHGKKRLRNMDRQKWRALHHILKRTNQ-DI  163

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             E   + +++ +EKA + Y    +  + L S  ++FV+M++LD CFI E L+R       +
Sbjct  164   ELYLDAVRELEEKARACY----EGPICLSS--NEFVEMMVLDACFILE-LFRGAAGGFTQ  216

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ +F   G    + RD+++LENQ+P FVL  L G+       K + +
Sbjct  217   LGYSR-------NDPIFAMRGTMHSIQRDMIMLENQIPLFVLDRLFGIQSGNPDQKGM-V  268

Query  675   VKITFASMLTKVRLIPPIVP---------------NLGDNNA----TEMKG-HLLQIVHN  794
              ++        +R   P++P               +LG+ +     TE  G H L++   
Sbjct  269   ARLA-------LRFFDPLMPTDEPLTKSDRSKLESSLGNASTFDPLTEQGGLHCLEVFRR  321

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVK  962
                    G +     W       + + S  ++V        I   TEL++AG+  K+  K
Sbjct  322   SLLAIRTGPKPTPRIW-------IKRWSHTNRVADKRRQQLIHCVTELKDAGLKFKRR-K  373

Query  963   SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINT  1142
             +   + IKF +  L+IP+  I D T++ F N+IAYEQ   D  N   T Y   MDNLIN+
Sbjct  374   TDRFWDIKFKNGILKIPRLLIHDGTKSLFLNLIAYEQCHLDCTND-ITSYVIFMDNLINS  432

Query  1143  EKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWN  1322
               DV+     G++ NWLG D EV DLFNRLC+ VV+   D    S +  ++N +Y+  WN
Sbjct  433   PGDVSYLHYCGIIENWLGSDAEVADLFNRLCQEVVFDINDS-SLSRLSEQVNRYYDHRWN  491

Query  1323  VMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
                A LRH YFN PW+ +S  AAV LL+LT AQT  +V
Sbjct  492   AWRATLRHKYFNNPWSIVSFFAAVVLLALTFAQTFYSV  529



>ref|XP_009345303.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=457

 Score =   211 bits (537),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 222/454 (49%), Gaps = 54/454 (12%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             + L+ ++ NL  LS   CI++V + LRR +  AYTP ++SIGP HHG   L  ME  K  
Sbjct  50    DPLQEELDNLSTLSPLRCIYRVPKRLRRVHEKAYTPQVVSIGPLHHGKEHLKAMEEHKKW  109

Query  273   YLDLFLKREKQP-SMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
             YL  FL R ++  S     + +KD + +    Y +       ++   D+FV+++L+D  F
Sbjct  110   YLRHFLSRTRERVSFSDYIQMIKDQEGRLRGSYAEP------IEFGSDQFVRVVLVDAAF  163

Query  450   IAEFLYReydeetkkeeeeelnkkkCD-NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQE  626
             + EFL R                  C+ ++ +F    M++ V  DL LLENQLPFF+LQ 
Sbjct  164   VIEFLLR-------------CRDSNCEGDDYIFNNPMMRWDVLPDLRLLENQLPFFILQV  210

Query  627   LHGMVYDES--KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
             L   +   +  +P  L+I    F S + +            +   TE   H + ++  L 
Sbjct  211   LFNTLSSSAHPRPSLLEISYSFFESQIVR----KGKEEGFNEICYTEEVQHFVDLIRILY  266

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
              P     + E                    + ++ +  A EL +AGV    V + S+LF 
Sbjct  267   RPFKSQTRRE--------------------LKTTAVPNAAELLQAGVKF-TVGRGSNLFD  305

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNM-YFTDYAQLMDNLINTEKDVN  1157
             IKF+   L+IP   + D T+   RN++A+EQ  C K      T Y  LM  L  T KDV 
Sbjct  306   IKFSDGILKIPTLIVADTTDLTLRNLLAFEQ--CHKREEDCLTSYVFLMKRLAKTPKDVE  363

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L   +G++ NWLG  K+++ L + L  G++    D + Y+ +C  LN +  K  +  MA 
Sbjct  364   LLVEHGIIENWLGSTKKISTLLHDLGTGMI---LDYYCYAPLCEDLNSYCGKRRHKWMAN  420

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             LR +YFNTPW+ IS +AAV LL LT  QTV  V+
Sbjct  421   LRQNYFNTPWSIISVVAAVILLILTFIQTVCTVI  454



>emb|CDO99349.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   210 bits (534),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 147/453 (32%), Positives = 230/453 (51%), Gaps = 37/453 (8%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             + + +  L   S +  IFK+H  LR  N  AY P ++SIGPYHHG  KL +ME  KL+Y 
Sbjct  4     IDQKLSELLDTSEKPSIFKIHGQLRSENEGAYEPQVVSIGPYHHGKPKLKEMEKHKLIYF  63

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
                L+R  + S E+    L + +++A   Y ++      ++ + D FV ML LDGCF+ E
Sbjct  64    KELLRRRGE-SAEKYIIALANLQDQARRCYAEE------INLSNDDFVDMLCLDGCFVIE  116

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
             FL +           +        N+ +F    ++     DL+L ENQLPFFVL +L  M
Sbjct  117   FLRK-----------KRHPGSHLHNDPIFQMFWLRTATENDLILFENQLPFFVLLQLFDM  165

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
                  + + L  + I    +          +PN G N+ + +  H  + VH L      G
Sbjct  166   TKSPGEEENLTGLAIHLCLIGN--------LPNPGLNSHSPIFEH-YKPVHLL------G  210

Query  819   IQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHA  998
             +  +  + +L     L     + +  S  I++A EL ++G+  KK   S SLFHI F   
Sbjct  211   LMHKILFASLS-EAFLSTAHFNRRPSSLFIKSAGELGQSGIKFKKAEDSKSLFHITFEKG  269

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMY--FTDYAQLMDNLINTEKDVNLFRMN  1172
              L+IP   + D TE+ FRN+IAYE++  + +  +   TDY   MD LI++  DV   R +
Sbjct  270   VLKIPPLVVGDRTESVFRNLIAYEEYMSNPSETWKCITDYILFMDFLIDSPSDVEKLRRH  329

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
              ++VNWLG D+ ++ +FN+L K V +S    F Y+ + + ++ +  + W++  A L   Y
Sbjct  330   HIIVNWLGSDEALSTMFNKLSKHVQFSE-RFFCYTQIFDDVDKYTRRRWHIWRAHLLRKY  388

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             FN PWA IS +AA  LL L   Q + ++L   K
Sbjct  389   FNNPWAFISFLAACALLLLATVQAIFSILQYTK  421



>ref|XP_008367714.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
 ref|XP_008367715.1| PREDICTED: UPF0481 protein At3g47200-like [Malus domestica]
Length=441

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 152/460 (33%), Positives = 237/460 (52%), Gaps = 40/460 (9%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             + +L  LS   CI KV   LR     AYTP ++SIGP HH N  L  ME  K  YL  FL
Sbjct  5     LNSLSPLSRHCCINKVPARLRCVMKKAYTPQVVSIGPLHHENKDLLYMEEHKQRYLQHFL  64

Query  291   KREKQPSMEQCWEKLKDSKEK-AASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLY  467
               + +  +E   +K+   +E+    Y G+  + +       D FV ++L+D  FI E L 
Sbjct  65    -YQTRVDLEVYVKKIMAQEERLRGCYEGEASEFK------SDVFVSIILVDAAFIIELLL  117

Query  468   ReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV--  641
             R   ++ +            DN+ +F    M   +  D++LLENQ PFF+L++L   V  
Sbjct  118   RYSFKDLRD-----------DNDWIFKKPWMLQNIAPDMILLENQXPFFILEDLFAHVKS  166

Query  642   -YDESKPKFLDIVKITFASMLTKVRL------IPPIVPNLGDNNATEMKGHLLQIVHNLC  800
              +++ +P    I+K++F      VRL      +  I+ +     + E+K H + ++  L 
Sbjct  167   KWEKDEP-LPSIIKLSFDFFHETVRLQGNEGRLEDIISSSLMKGSLEVK-HFVDLIRTLH  224

Query  801   NPQNGGIQEE----RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSS  968
              P    ++      +H+          K+ Q  +  ++    A +L +AGV  +    S 
Sbjct  225   LPTQQPLKSSQTKVKHFCDRIRGFLSTKKPQTERPLNTP--CAKKLHQAGVKFQVRRSSK  282

Query  969   SLFHIKFN-HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
             +LF I+FN    LEIP+  I D TE   RN++A+EQ  C  N++  +DY  +MD  +NT 
Sbjct  283   NLFDIQFNNQGILEIPQVEINDYTELTLRNLLAFEQCHCMXNHI--SDYLCIMDGFVNTP  340

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
              DV+L   +G++VN LGD+ +V+ L N+LC GV ++  D +Y++ +   LN +  KPWN 
Sbjct  341   TDVDLLVEDGIVVNTLGDNNKVSCLINKLCTGVSWNHKD-YYFAALSKDLNDYCRKPWNK  399

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
               A L+  YFNTPWA IS  AA FL+ LTI QTV  ++ +
Sbjct  400   SKASLKQKYFNTPWAMISVFAAGFLIVLTIIQTVCTIISV  439



>ref|XP_010026753.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=434

 Score =   209 bits (533),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 152/441 (34%), Positives = 230/441 (52%), Gaps = 48/441 (11%)
 Frame = +3

Query  138   EACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSME  317
             E  IF+V   LRR N  AY P ++ IGPYH+GN K   ME  K+ Y+   L+R K+ S++
Sbjct  39    EHSIFRVRPQLRRVNNKAYEPEILVIGPYHYGNDKFKSMEEQKMRYVQQLLQRRKEESVD  98

Query  318   QCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkke  497
             +    L++ ++   + Y +       ++ + +KF+ M+ +DGCFI E   +   E+ +  
Sbjct  99    RYMPTLRELEQLVRNCYAET------INLSQEKFLAMMFIDGCFIVELFRKYNMEKLRN-  151

Query  498   eeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKP-KFLDI  674
                        +  +     +++ + RDLLLLENQLP F L +L+ +     +P K +DI
Sbjct  152   ----------KDGPLMEADWIRYCLQRDLLLLENQLPLFFLNKLYDLTKGPDEPRKLIDI  201

Query  675   VKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCF  854
                 F   L      P +              HLL ++H                WT   
Sbjct  202   ATTYFDFKLGDSDQCPTL----------RKSKHLLHLMHTC--------------WTSGL  237

Query  855   P--CSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHIT  1028
             P    L  ++  +K     + +ATEL+E+GV L+  V+   +  I+F + +LEIP   + 
Sbjct  238   PNVPRLYGRAPPTKEKLMFMSSATELRESGVKLR-AVRGRRMKDIRFENGKLEIPVLIVQ  296

Query  1029  DPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKE  1208
             D TE+ FRN+IAYEQH       YFTDY  LMD LIN+ KDV + R  G++ N+LGDD+ 
Sbjct  297   DHTESQFRNLIAYEQHRQGGGISYFTDYVTLMDCLINSSKDVEVLRRAGIIKNYLGDDEV  356

Query  1209  VTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIA  1388
             +  +FNR+     Y +   FYYS++   +N + NK  NV MAKLR +YF++PWA +S +A
Sbjct  357   IAQMFNRMGD---YVTLSNFYYSEIFKTVNAYCNKRRNVWMAKLRREYFHSPWAFLSVLA  413

Query  1389  AVFLLSLTIAQTVIAVLDLRK  1451
             A+ LL L  AQTV  +L   K
Sbjct  414   AIVLLLLAAAQTVFTILSYTK  434



>ref|XP_007047372.1| Uncharacterized protein TCM_000684 [Theobroma cacao]
 gb|EOX91529.1| Uncharacterized protein TCM_000684 [Theobroma cacao]
Length=532

 Score =   212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 154/467 (33%), Positives = 228/467 (49%), Gaps = 46/467 (10%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEAC-----IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             S+K  ++  +Q  S        I++V   LR  +  AY P ++S+GPYHHG  +L +M+ 
Sbjct  84    SIKEKLEQARQDDSAGSWEKLSIYRVPHYLREGDIKAYVPQIVSVGPYHHGKRRLRQMDQ  143

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K   L   LKR  Q  ++   + +K+ +E+A + Y      +  +  + ++FV+ML+LD
Sbjct  144   HKWRSLHRVLKRTNQ-ELQLYLDSMKELEERARACY------EGTITLSSNEFVEMLVLD  196

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
             GCF+ E          +             N+ VF   G    + RD+++LENQL  FVL
Sbjct  197   GCFVLELF--------QGAAVGFQRLGYARNDPVFAMRGSMHAIHRDMIMLENQLSLFVL  248

Query  621   QELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVH-NL  797
               L G+   E   K   + K+        +R   P++P       ++M      + H N+
Sbjct  249   DMLLGIQLGEPDQKG-KVAKLA-------IRFFDPLMPTDEPLTKSDMNRFGSSLGHTNI  300

Query  798   CNPQN--GGIQ---EERHYWTLCFP-----CSLGKQSQDSKVGSSD----IRTATELQEA  935
              +P +  GG+      R       P       L K+  D +V        I   +EL+EA
Sbjct  301   FDPFSDLGGLHCLDVFRRSLLSSGPKPVPRIWLKKRPNDIRVADKRRQQLIHCVSELREA  360

Query  936   GVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYA  1115
             G+  KK  K+   + IKF +  L IP+  I D T++ F N+IA+EQ   D +N   T Y 
Sbjct  361   GIKFKKR-KTDRFWDIKFKNGILRIPRLLIHDGTKSLFLNLIAFEQCHLDCSND-ITSYV  418

Query  1116  QLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKL  1295
               MDNLIN+ +DV      G++ +WLG D EV DLFNRLC+ VV+   +  Y S +   +
Sbjct  419   IFMDNLINSHEDVGYLHYFGIIEHWLGSDAEVADLFNRLCQEVVF-DINNSYLSQLSEDV  477

Query  1296  NGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             N +YN  WN   A L+H YFN PWA IS  AA  LL LT AQT   V
Sbjct  478   NRYYNHRWNAWRATLKHRYFNNPWAIISFFAACILLVLTFAQTFYGV  524



>ref|XP_006404051.1| hypothetical protein EUTSA_v10011143mg [Eutrema salsugineum]
 gb|ESQ45504.1| hypothetical protein EUTSA_v10011143mg [Eutrema salsugineum]
Length=545

 Score =   212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 149/449 (33%), Positives = 231/449 (51%), Gaps = 43/449 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG+ +L  M+  K   +++ + R K  ++E  
Sbjct  116   CIYRVPHYLQENDNKSYFPQTVSLGPYHHGHERLLPMDRHKWRAVNMVMARTKH-NIEIY  174

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +EKA + Y      + ++D   +KF +ML+LDGCF+ E L+R  +E   K   
Sbjct  175   IDAMKELEEKARACY------EGIIDLNSNKFTQMLVLDGCFVLE-LFRGANEGFLKLGY  227

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD++++ENQLP FVL  L  +             + 
Sbjct  228   GR-------NDPVFAMRGSMHSIQRDMIMMENQLPLFVLNRLLELQLGPHN-------QT  273

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHN-LCNPQNGGIQEERH-----YWT  845
                + L  +R   P++P     N T+       + ++   NP +    EE H       +
Sbjct  274   GLVAQLA-IRFFNPLMPTDKPLNKTDQVQPENSLENDKFFNPISDKDTEELHCLDVFRRS  332

Query  846   LCFPC-------SLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHIKFN  992
             L  P        S  + S  ++V        I   TEL+EAG+  K+  K+   + I+F 
Sbjct  333   LLRPSMKPEPRISRNRWSWKTRVADKRQQQLIHCVTELREAGIRFKRR-KTDRFWDIRFK  391

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
             +  LEIPK  I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +DV+     
Sbjct  392   NGYLEIPKLLIHDGTKSLFSNLIAFEQCHIDSSND-ITSYIIFMDNLIDSAEDVSYLHYC  450

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ +WLG+D EV DLFNRLC+ V +   D  Y S++ NK++ +YN+ WN M A L+H Y
Sbjct  451   GIIEHWLGNDSEVADLFNRLCQEVAFDLQDS-YLSELSNKVDRNYNRKWNSMKAILKHKY  509

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             FN PWA  S  AAV LL LT+ Q+     
Sbjct  510   FNNPWAYFSFFAAVLLLILTVFQSFFTAF  538



>ref|XP_003601320.1| hypothetical protein MTR_3g079390 [Medicago truncatula]
 gb|AES71571.1| DUF247 domain protein [Medicago truncatula]
Length=453

 Score =   210 bits (534),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 155/484 (32%), Positives = 236/484 (49%), Gaps = 47/484 (10%)
 Frame = +3

Query  27    ELQRQ*GMIENTEGDQQDLPIY-ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPL  203
             ELQ Q G I+ +E + ++L I+ E++ + ++    L S  CI+KV + +R+ N +AYTP 
Sbjct  5     ELQ-QNGFIQ-SENENRELIIHMENMLQSVE--LPLVSRCCIYKVPQKIRKLNQEAYTPT  60

Query  204   LISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDED  383
             ++SIGP+H+G+ +L  ME+LKL YL  F        +  C   +K S+E   S Y +   
Sbjct  61    IVSIGPFHNGDKRLESMEDLKLRYLKSFFLERTHKGLGDCIGYIKKSEEIIRSCYSEA--  118

Query  384   IQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMK  563
                 ++   D FVK++L D CFI E+  R  +                  + +     ++
Sbjct  119   ----IEQTSDDFVKIILTDACFIIEYFLRSLEWP--------------QEDPLLSKPWLR  160

Query  564   FQVFRDLLLLENQLPFFVLQELHGMV----YDESKPKFLDIVKITFASMLTKVRLIPPIV  731
               V  DL+LLENQLP+FVL++L  +      D     F D+    F     KV  +  I+
Sbjct  161   CDVKLDLILLENQLPWFVLEDLFNLTEPSCIDGEVSSFFDVAFHYF-----KVHFLQSIL  215

Query  732   PNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWT-----LCFPCSLGKQSQDSKVG  896
             PN  +N    +          +  P    +Q   H  T        P  +  + +   V 
Sbjct  216   PNETNNKNFTINYFHEHYQQYIMKPDQVSMQ--LHNLTDLLRVFYLPPDMLPKREKQIV-  272

Query  897   SSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQH  1076
                + +A++L EAGV L       S+  +KF    L IP+F +   TET  RN++A+EQ 
Sbjct  273   -KHLFSASQLVEAGVKLHVGQDYQSVLELKFAKGALTIPRFEVCHWTETLLRNVVAFEQ-  330

Query  1077  SCDKN-NMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYS  1253
              C      Y TDY  L+D LI+T +DV+     G+++N LGD   V  + N LC  VV  
Sbjct  331   -CHYPFQTYITDYTILLDFLIDTSQDVDKLVEKGIMINTLGDSNAVAKMINNLCLNVVQE  389

Query  1254  SCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
             + +G Y S +C KLN  Y  P +   A   HDYF+TPW   S  AA+ LL LT+ Q   +
Sbjct  390   NINGGYIS-LCRKLNCFYEDPSHKYKAIFIHDYFSTPWKITSFAAAIVLLLLTLIQATCS  448

Query  1434  VLDL  1445
             ++ L
Sbjct  449   IISL  452



>ref|XP_006404054.1| hypothetical protein EUTSA_v10011061mg [Eutrema salsugineum]
 gb|ESQ45507.1| hypothetical protein EUTSA_v10011061mg [Eutrema salsugineum]
Length=556

 Score =   212 bits (540),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 157/499 (31%), Positives = 246/499 (49%), Gaps = 55/499 (11%)
 Frame = +3

Query  12    YIYISELQRQ*GMIENTEGDQQD----LPIYESLKRDIKNLKQLSSEA-CIFKVHEGLRR  176
             + +++ L RQ     N E ++      + I E +++ ++     S E  CI++V   L+ 
Sbjct  81    WYFLTLLMRQKIHTRNREPEETREEWVISIKEKMEQALREDATTSWERLCIYRVPHYLQE  140

Query  177   TNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKA  356
              +  +Y P  +S+GPYHHG   L  M+  K   +++ + R KQ  +E   + +K+ +E+A
Sbjct  141   NDNKSYFPQTVSLGPYHHGKEHLLPMDRHKWRAVNMVMARTKQ-GIEMYIDAMKELEERA  199

Query  357   ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNN  536
              + Y         +  + +KF +ML+LDGCF+ E L+R   E   +   +        N+
Sbjct  200   RACYEGP------IGLSSNKFTEMLVLDGCFVLE-LFRGAAEGFSELGYDR-------ND  245

Query  537   AVFMPTGMKFQVFRDLLLLENQLPFFVLQEL----------HGMV-------YDESKPKF  665
              VF   G    + RD+++LENQLP FVL  L           G+V       +D   P  
Sbjct  246   PVFAMRGSMHSIQRDMVMLENQLPLFVLNRLLEIQLGPRNQTGLVAQLAVRFFDPLMPTD  305

Query  666   LDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVH-NLCNPQNGGIQE-ERHY  839
               + K      + K +   PI     D +  E+  H L +   NL  P         R  
Sbjct  306   EPLTKTDLEKPMGKDKFFNPI----SDKDTEEL--HCLDVFRRNLLRPSTKPEPRLSRRR  359

Query  840   WTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKF  1019
             W+     +  +Q Q        I   TEL+EAG+  K   K+   + I+F +  LEIPK 
Sbjct  360   WSWKTRVADKRQQQL-------IHCVTELREAGIKFK-ARKTDRFWDIRFKNGYLEIPKL  411

Query  1020  HITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGD  1199
              I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +DV+     G++ +WLG 
Sbjct  412   LIHDGTKSLFSNLIAFEQCHIDSSND-ITSYIIFMDNLIDSPQDVSYLHYCGIIEHWLGS  470

Query  1200  DKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGIS  1379
             D EV DLFNRLC+ V +   +  Y S + NK++ +Y++ WNV+ A L+H YFN PWA  S
Sbjct  471   DSEVADLFNRLCQEVAFDPQNS-YLSQLSNKVDRNYSRKWNVLKAILKHKYFNNPWAYFS  529

Query  1380  TIAAVFLLSLTIAQTVIAV  1436
               AA+ LL LT+ Q+  + 
Sbjct  530   FFAALVLLFLTLFQSFFSA  548



>ref|XP_002877733.1| hypothetical protein ARALYDRAFT_485374 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53992.1| hypothetical protein ARALYDRAFT_485374 [Arabidopsis lyrata subsp. 
lyrata]
Length=540

 Score =   212 bits (539),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 154/457 (34%), Positives = 230/457 (50%), Gaps = 65/457 (14%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  ME  K   ++  LKR KQ  +E  
Sbjct  113   CIYRVPHYLKENDKKSYFPQTVSLGPYHHGKKRLRPMERHKWRAVNKVLKRLKQ-RIEMY  171

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
                +++ +EKA + Y  +  I L    + ++F +ML+LDGCF+ E L+R   E   +   
Sbjct  172   TNAMRELEEKARACY--EGPISL----SSNEFTEMLVLDGCFVLE-LFRGTVEGFTEIGY  224

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM---------VYDESK  656
                      N+ VF   G+   + RD+++LENQLP FVL  L  +         +     
Sbjct  225   -------ARNDPVFAMRGLMHSIQRDMIMLENQLPLFVLDRLLELQLGTQNQTGIVAHVA  277

Query  657   PKFLDIVKITFASMLTK------VRLIPPIVPNLGDNNATEMKGHL-------LQIVHNL  797
              KF D +  T    LTK      +  +   +  LGD      KG L         ++H+ 
Sbjct  278   VKFFDPLMPT-GEALTKPDQSKLMNWLEKSLDTLGD------KGELHCLDVFRRSLLHSS  330

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKS  965
               P    +              L + +++++V        +   TEL+EAGV  +K  K+
Sbjct  331   PTPNTRSL--------------LKRLTRNTRVVDKRQQQMVHCVTELREAGVKFRKR-KT  375

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
                + I+F +  LEIPK  I D T++ F N+IA+EQ   + +N + T Y   MDNLIN  
Sbjct  376   DRFWDIEFKNGYLEIPKLLIHDGTKSLFSNLIAFEQCHIESSN-HITSYIIFMDNLINAS  434

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             +DV+     G++ +WLG D EV DLFNRLC+ VV+   D  + S +   +N +YN+ WNV
Sbjct  435   EDVSYLHYCGIIEHWLGSDSEVADLFNRLCQEVVFDPKDS-HLSRLSGDVNRYYNRKWNV  493

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             + A L H YFN PWA  S  AAV LL LT+ Q+  AV
Sbjct  494   LKATLTHKYFNNPWAYFSFSAAVILLLLTLCQSFYAV  530



>emb|CDY02089.1| BnaA03g40780D [Brassica napus]
Length=495

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/434 (34%), Positives = 221/434 (51%), Gaps = 44/434 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHGN  L  ME  K   +++ + R  Q  +E  
Sbjct  95    CIYRVPLHLQENDKKSYFPQTVSLGPYHHGNKHLLPMEFHKWRAVNMIMSRTGQ-GIEIY  153

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y      Q  +  + ++F +ML+LDGCF+ E L+R   E  +    
Sbjct  154   IDAMKELEERARACY------QGPIALSVNEFTEMLVLDGCFVLE-LFRGTVEGFQPIGY  206

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G+   + RD+++LENQLP FVL  L  +   E+          
Sbjct  207   -------ARNDPVFAMRGLMHSIQRDMVMLENQLPLFVLDRLLELQLGEA----------  249

Query  684   TFASMLTKVRLIPPI---VPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCF  854
               ++ L   +L P +   + +LGDN          + +       N   +E+        
Sbjct  250   --STRLNPSKLKPWLERSLNSLGDNGDLHCLDVFRRSLLKFSYTPNPRSEED------PL  301

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
             P +L  + Q   V        TEL+EAGV  K   K+   + I+F H  LEIPK  I D 
Sbjct  302   PLNLVDKRQQQLV-----HCVTELREAGVKFK-TRKTDRFWDIRFEHGCLEIPKLLIHDG  355

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             T++ F N+IA+EQ   D      T Y   MDNLIN+ +DV+     G++ +WLG D EV 
Sbjct  356   TKSLFSNLIAFEQCHIDSTKD-ITSYIIFMDNLINSSEDVSYLHYCGIIEHWLGSDAEVA  414

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
             DLFNRLC+ V +   D  Y S + +++N +Y++ WN + A L+H YFN PWA  S  AAV
Sbjct  415   DLFNRLCQEVFFDPKDS-YLSKLSDEVNYYYSRRWNALKATLKHRYFNNPWAYFSFFAAV  473

Query  1395  FLLSLTIAQTVIAV  1436
              LL LT+ Q+  AV
Sbjct  474   ILLVLTLVQSFYAV  487



>gb|EYU32623.1| hypothetical protein MIMGU_mgv11b017063mg, partial [Erythranthe 
guttata]
Length=409

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 150/443 (34%), Positives = 216/443 (49%), Gaps = 64/443 (14%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             SS + + +V E +R TN  +Y P +I+IGP+H G A L  M++ K  YL L L+   + S
Sbjct  22    SSNSSLCRVGEQIRTTNESSYDPTVIAIGPFHRGKAHLKAMDHHKKRYLKLILQSRGESS  81

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
              ++    + +S+E+A  +Y ++  +          F  MLLLDG FI EFL         
Sbjct  82    ADRYVNSMLESEEEARKFYAEETAVL-----GKYAFALMLLLDGIFILEFL---------  127

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
                     +    +N VF    MK  + RDL+L ENQ+P F+L++L  M  D        
Sbjct  128   -------RECTFGSNLVFQLGQMKSHILRDLMLFENQIPLFILEKLLSMTDDA-----FQ  175

Query  672   IVKITFASMLTKVRLIPPIVP-----NLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERH  836
             I  + +        LI PI+      +L D++      HLL +VH            ER 
Sbjct  176   ITHLIYP-------LISPIIVHQEAISLQDDHTK--PHHLLGLVH----------YAERL  216

Query  837   YWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPK  1016
              ++   P        D      +I +ATEL EAG++ KK   S +L  I F + ++ +P 
Sbjct  217   GFSPTVP--------DEHYVMENINSATELSEAGISFKK-SDSKNLLDIIFKNKKIRMPT  267

Query  1017  FHITDPTETFFRNMIAYEQH--SCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNW  1190
               ITD TE+  RNMIAYE +  +CD+   Y TDY   +  LI+  KD  L R  GV+ NW
Sbjct  268   LEITDLTESRIRNMIAYEYYNLACDERK-YVTDYTFFLHCLIHAPKDAELLRRYGVVSNW  326

Query  1191  LGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
             LG D+ V  L N++   V   + + F Y DV   +N H     N  +A LR DYFNTPW 
Sbjct  327   LGGDEMVYRLINQIGSHV--QTSEKFSYHDVFRDVNVHCRNRKNRWIAVLRRDYFNTPWK  384

Query  1371  GISTIAAVFLLSLTIAQTVIAVL  1439
              IS +A   LL + + Q V A+L
Sbjct  385   LISLVAGFVLLGVGVVQMVFAIL  407



>ref|XP_008352050.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Malus domestica]
 ref|XP_008352051.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Malus domestica]
Length=425

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 226/451 (50%), Gaps = 50/451 (11%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             + L+ ++ NL  LSS  CI++V + LRR N DAYTP ++SIGP HHG   L  ME  K  
Sbjct  22    DPLQEELDNLSPLSSLRCIYRVPKRLRRLNEDAYTPQVVSIGPLHHGKEHLKAMEEHKKR  81

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL +FL R    S     + ++D + +    Y +       ++   D+FV+++L+D  F+
Sbjct  82    YLRVFLSR-TGVSFSDYIQMIRDREGRLRGCYAEP------IEFGSDEFVRIVLVDAAFV  134

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EFL R      ++           +++ +F    +   V  DL LLENQLPFF+LQ L 
Sbjct  135   IEFLLRWRFSHYQQG----------EDDYIFERPVVCCDVHPDLQLLENQLPFFILQVLF  184

Query  633   GMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
               V   S  + L I    F   +              D+   E          N     +
Sbjct  185   NTV--NSSEQLLQISYDLFEGQI--------------DSKGKE---------ENFKKICS  219

Query  813   GGIQEERHYWTLCFPCSLGKQSQD-SKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKF  989
              G++ E H+  L     L  +SQ    + S  +   TEL  AGV  +    SSSLF IKF
Sbjct  220   SGVEVE-HFVDLIRILYLPLESQSPGGLNSIAVPNVTELVLAGVKFRVRTDSSSLFDIKF  278

Query  990   NHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFR  1166
             +   LEIPK  I D TE   RN++A+EQ H+  ++  Y ++Y  LM +L+ T +DV L  
Sbjct  279   SDGILEIPKLRIDDSTEARQRNLVAFEQCHAIWED--YVSNYDFLMKHLVKTPRDVELLV  336

Query  1167  MNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRH  1346
                ++ NWL D K+V+ L + L +GVV+   +  YY+ +   LN +     +  MA L+ 
Sbjct  337   ECEIIENWLADTKKVSTLLDDLGRGVVH---NALYYATLREDLNNYCRTRRHKWMANLKQ  393

Query  1347  DYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             +YF+TPW+ IS +AAV LL LT  QTV ++ 
Sbjct  394   NYFHTPWSIISVVAAVILLILTFIQTVCSIF  424



>ref|XP_009346196.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=474

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 154/470 (33%), Positives = 232/470 (49%), Gaps = 41/470 (9%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             +S+ +D+ +L  LS    I KV E LR     AYTP  +SIGP HH N  L  ME  KL 
Sbjct  25    KSITKDLNDLSPLSRHCWISKVPERLRCVRKKAYTPQAVSIGPLHHENEDLLYMEEHKLR  84

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL  FL R    S     + +         Y G+  D +       D FV+++ +D  FI
Sbjct  85    YLQHFLHRTGVDSEVYVKKIMAQEARLRGCYDGEASDFK------SDVFVRIIFVDAAFI  138

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              E L R + +  +            DN+ +F    M   +  D++LLENQLPFF+L++L 
Sbjct  139   IELLLRNFSQRLED-----------DNDWIFTKPWMLQNIAPDMILLENQLPFFILEDLF  187

Query  633   GMVYD--ESKPKFLDIVKITFASMLTKVRL------IPPIVPNLGDNNATEMKGHLLQIV  788
               V    ++      +V++++      V L      +  I+ +  + N  +    L++ +
Sbjct  188   ADVTSNLDNAEDLPSLVELSYKFFQKTVHLQGNEDNLKNIISSRLEVNPVKHFVDLIRTL  247

Query  789   HNLCNP-----QNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGV  941
             H    P     Q GG           F C   ++   +K   ++       A +L +AGV
Sbjct  248   HLPVQPPLKSSQTGGPTSCSSPQVKDF-CDRIRRFLPTKKSRTERPLNTPCAKKLHQAGV  306

Query  942   NLKKVVKSSSLFHIKFN--HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYA  1115
               + V  S +LF I FN     LEIP+  I D TE   RN++ +EQ  C +N  + +DY 
Sbjct  307   KFQ-VSPSKNLFDISFNIDKGILEIPQVEIHDYTELTLRNLLVFEQCHCMEN--HISDYL  363

Query  1116  QLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKL  1295
             ++MD  +NT  DV+L    G+ VN LGD+ +V+ L N+LC GV  S+ + +Y++D+  +L
Sbjct  364   RIMDGFVNTPMDVDLLVEYGIFVNTLGDNNKVSILINKLCVGV-SSNNENYYFADLSKEL  422

Query  1296  NGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             N +  KPWN   A L+  YFNTPWA IS  AA FL+ LTI QTV  ++ +
Sbjct  423   NNYCGKPWNKSKASLKQKYFNTPWAMISVFAAGFLIVLTIIQTVCTIISV  472



>ref|XP_006285485.1| hypothetical protein CARUB_v10006919mg [Capsella rubella]
 gb|EOA18383.1| hypothetical protein CARUB_v10006919mg [Capsella rubella]
Length=660

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/464 (32%), Positives = 224/464 (48%), Gaps = 57/464 (12%)
 Frame = +3

Query  63    EGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             EGD     + +S+K  + +L  L    CI+KV   LRR N DAYTP L+S GP+H G  +
Sbjct  251   EGDA----LVDSIKEKLDSLSSLLRPCCIYKVPNKLRRLNPDAYTPRLVSFGPFHRGKEE  306

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME  K  YL  F+ R    S+E      +  ++ A S Y   ED++L      D+FV
Sbjct  307   LQAMEEHKHRYLRSFISRTNS-SLEDIVRVGRSWEQNARSCYA--EDVKL----NSDEFV  359

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             +ML++DG F+ E L R +    +            + + +F    M   V RD++L+ENQ
Sbjct  360   EMLVVDGSFLVELLLRSHYPRLRG-----------EKDRIFGNLMMITDVCRDMILIENQ  408

Query  603   LPFFVLQELHGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGH  773
             LPFFV++E+  ++   Y +  P  + + +  F   L+++           DN       H
Sbjct  409   LPFFVVKEIFLLLFIYYQQGTPSIIQLAQRHFRCSLSRI----------DDNKIISEPEH  458

Query  774   LLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKK  953
              + ++ +                  CF   +  + ++  +   +    TEL  AGV+ K 
Sbjct  459   FVDLLRS------------------CFVPLVPIRLEECTLKVHNAPETTELHTAGVSFKP  500

Query  954   VVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
                SS L  I F    L+IP   I D TE+ +RN+I +EQ  C   +  F  Y  L+   
Sbjct  501   AETSSCLLDISFADGVLKIPTIVIDDLTESLYRNIIVFEQCHCSDKS--FIHYTTLLGCF  558

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             I +  D +L   +G++VN LG+ ++V+ LFN + K V Y     FY+S +   L  + N 
Sbjct  559   IKSPTDADLLIRSGIIVNDLGNSEDVSKLFNSISKEVTYDR--RFYFSTLSENLQAYCNT  616

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             P N   A LR DYF+ PW+  S +AA  LL LT  QTV ++L L
Sbjct  617   PLNRWKAILRRDYFHNPWSVASVLAASILLLLTFIQTVCSILAL  660



>ref|XP_009355878.1| PREDICTED: UPF0481 protein At3g47200-like [Pyrus x bretschneideri]
Length=449

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 156/456 (34%), Positives = 230/456 (50%), Gaps = 43/456 (9%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S+ +D+ +L  LS   CI KV E LR     AYTP  +SIGP HH N  L  ME  K  Y
Sbjct  29    SITKDLNDLSPLSPHCCISKVPERLRCVRKKAYTPQAVSIGPLHHNNKDLLYMEEHKQRY  88

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL R    S     + +         Y G+  + +       D FV+++ +D  FI 
Sbjct  89    LQHFLHRTGVGSGVYVKKIMAQEARLRDCYDGEASEFK------SDVFVRIIFVDAAFII  142

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L R + +  +            DN+ +F    M   +  D++LLENQLPFF+L++L  
Sbjct  143   ELLLRNFSQRLED-----------DNDWIFTKPWMLQNIAPDMILLENQLPFFILEDLFA  191

Query  636   MVYD--ESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQ  809
              V    ++      +V++++      V L         ++N   +    L++     NP 
Sbjct  192   DVTSNPDNAEDLPSLVELSYKFFQKTVHL------QGNEDNLKNIISSRLEV-----NPV  240

Query  810   NGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRT--ATELQEAGVNLKKVVKSSSLFHI  983
                +   R   TL  P SL K+SQ  K   S + T  A +L +AGV   +V  S +LF I
Sbjct  241   KHFVDLIR---TLHLP-SL-KRSQTEKPLESTLNTPCAKKLHQAGVKF-QVSSSKNLFDI  294

Query  984   KFN--HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              FN     LEIP+  I D TE   RN++ +EQ  C +N  + +DY ++MD  +NT  DV+
Sbjct  295   SFNIDKGILEIPQVEIHDYTELTLRNLLVFEQCHCMEN--HISDYLRIMDGFVNTPMDVD  352

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L    G+ VN LGD+ +V+ L N+LC G V S+ + +Y++D+  +L+ +  KPWN   A 
Sbjct  353   LLVEYGIFVNTLGDNNKVSILINKLCVG-VSSNNENYYFADLSKELSNYCGKPWNKSKAS  411

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             L+  YFNTP A IS  AA FL+ LTI QTV  ++ +
Sbjct  412   LKQKYFNTPLAMISVFAAGFLIVLTIIQTVCTIISV  447



>ref|XP_009136541.1| PREDICTED: UPF0481 protein At3g47200-like [Brassica rapa]
Length=518

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 227/446 (51%), Gaps = 45/446 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHGN  L  ME  K   +++ + R  Q  +E  
Sbjct  95    CIYRVPLHLQENDKKSYFPQTVSLGPYHHGNKHLLPMEFHKWRAVNMIMSRTGQ-GIEIY  153

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y      Q  +  + ++F +ML+LDGCF+ E L+R   E  +    
Sbjct  154   IDAMKELEERARACY------QGPIALSVNEFTEMLVLDGCFVLE-LFRGTVEGFQPIGY  206

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL----------HGMVYDES  653
                      N+ VF   G+   + RD+++LENQLP FVL  L           G+V  + 
Sbjct  207   -------ARNDPVFAMRGLMHSIQRDMVMLENQLPLFVLDRLLELQLGTLNQTGLV-AQV  258

Query  654   KPKFLDIVKIT--FASMLTKVRLIPPI---VPNLGDNNATEMKGHLLQIVHNLCNPQNGG  818
               KF D +  T   ++ L   +L P +   + +LGDN          + +       N  
Sbjct  259   AVKFFDPLMPTGEASTRLNPSKLKPWLERSLNSLGDNGDLHCLDVFRRSLLKFSYTPNPR  318

Query  819   IQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHA  998
              +E+        P +L  + Q   V        TEL+EAGV  K   K+   + I+F H 
Sbjct  319   SEED------PLPLNLVDKRQQQLV-----HCVTELREAGVKFK-TRKTDRFWDIRFEHG  366

Query  999   ELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGV  1178
              LEIPK  I D T++ F N+IA+EQ   D      T Y   MDNLIN+ +DV+     G+
Sbjct  367   CLEIPKLLIHDGTKSLFSNLIAFEQCHIDSTKD-ITSYIIFMDNLINSSEDVSYLHYCGI  425

Query  1179  LVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFN  1358
             + +WLG D EV DLFNRLC+ V +   D  Y S + +++N +Y++ WN + A L+H YFN
Sbjct  426   IEHWLGSDAEVADLFNRLCQEVFFDPKDS-YLSKLSDEVNYYYSRRWNALKATLKHRYFN  484

Query  1359  TPWAGISTIAAVFLLSLTIAQTVIAV  1436
              PWA  S  AAV LL LT+ Q+  AV
Sbjct  485   NPWAYFSFFAAVILLVLTLVQSFYAV  510



>ref|XP_008352049.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Malus domestica]
Length=452

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 152/451 (34%), Positives = 226/451 (50%), Gaps = 50/451 (11%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             + L+ ++ NL  LSS  CI++V + LRR N DAYTP ++SIGP HHG   L  ME  K  
Sbjct  49    DPLQEELDNLSPLSSLRCIYRVPKRLRRLNEDAYTPQVVSIGPLHHGKEHLKAMEEHKKR  108

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL +FL R    S     + ++D + +    Y +       ++   D+FV+++L+D  F+
Sbjct  109   YLRVFLSR-TGVSFSDYIQMIRDREGRLRGCYAEP------IEFGSDEFVRIVLVDAAFV  161

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              EFL R      ++           +++ +F    +   V  DL LLENQLPFF+LQ L 
Sbjct  162   IEFLLRWRFSHYQQG----------EDDYIFERPVVCCDVHPDLQLLENQLPFFILQVLF  211

Query  633   GMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQN  812
               V   S  + L I    F   +              D+   E          N     +
Sbjct  212   NTV--NSSEQLLQISYDLFEGQI--------------DSKGKE---------ENFKKICS  246

Query  813   GGIQEERHYWTLCFPCSLGKQSQD-SKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKF  989
              G++ E H+  L     L  +SQ    + S  +   TEL  AGV  +    SSSLF IKF
Sbjct  247   SGVEVE-HFVDLIRILYLPLESQSPGGLNSIAVPNVTELVLAGVKFRVRTDSSSLFDIKF  305

Query  990   NHAELEIPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFR  1166
             +   LEIPK  I D TE   RN++A+EQ H+  ++  Y ++Y  LM +L+ T +DV L  
Sbjct  306   SDGILEIPKLRIDDSTEARQRNLVAFEQCHAIWED--YVSNYDFLMKHLVKTPRDVELLV  363

Query  1167  MNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRH  1346
                ++ NWL D K+V+ L + L +GVV+   +  YY+ +   LN +     +  MA L+ 
Sbjct  364   ECEIIENWLADTKKVSTLLDDLGRGVVH---NALYYATLREDLNNYCRTRRHKWMANLKQ  420

Query  1347  DYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             +YF+TPW+ IS +AAV LL LT  QTV ++ 
Sbjct  421   NYFHTPWSIISVVAAVILLILTFIQTVCSIF  451



>ref|XP_006420575.1| hypothetical protein CICLE_v10006659mg [Citrus clementina]
 gb|ESR33815.1| hypothetical protein CICLE_v10006659mg [Citrus clementina]
Length=453

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 161/462 (35%), Positives = 236/462 (51%), Gaps = 63/462 (14%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEG--LRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLM  272
             L+ +++ L    S+  IF+V +   LR  N  AY P L+SIG YHHG  +L   EN +L 
Sbjct  15    LEEELRCLTSTPSQFSIFRVPQPQVLRNVNEKAYAPRLLSIGRYHHGKDQLWDFENERL-  73

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
               D+ L R         +  +++ ++ A + YG    +        D+FVKM++LDGCFI
Sbjct  74    --DIPLSRY--------FAVMRELEKTARNCYGGSISLN------QDEFVKMMILDGCFI  117

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              E   +   +       +        N+ +F  + M   + +D++LLENQL FFV+  L 
Sbjct  118   IEVFRKFRLDMDAPALGQ-------GNDPIFELSWMLPSIAQDMILLENQLAFFVIWRLF  170

Query  633   GMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLG---DN-------NATEMKGHLLQ  782
              M    + P +          ++T +R    I+P  G   DN          E+K HL+ 
Sbjct  171   SMTELPNSPSYESF-------LVTILRFFNGILPGKGCRRDNVYRVENYRINEIK-HLVH  222

Query  783   IVHNLCNPQNGGIQE-ERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVV  959
             ++H    P   G+   E H  T    C+              I +ATE+QEAG+  +KV 
Sbjct  223   LIHGNWLPSPTGLAAYELHNGTDNSHCNF-------------ICSATEIQEAGIEFRKVE  269

Query  960   ---KSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDN  1130
                   SLF IKF +  +++P   I+D TET F+N+IAYEQ S   N  +  DY + ++ 
Sbjct  270   VDKDDDSLFDIKFENGVMKMPSLEISDDTETIFQNLIAYEQCSQGINLKHVIDYVKFLNC  329

Query  1131  LINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYN  1310
             LIN+ KD  L    G++ N LGDD+ +  L N+LC+GVV    + FYYS+V NK+  H  
Sbjct  330   LINSSKDAELLCRRGIIDNLLGDDEVIATLLNKLCEGVVLG--ERFYYSEVSNKVIFHCR  387

Query  1311  KPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             +  N  MAKLRH+YFN PWA IS +AAVFLL LT  Q + +V
Sbjct  388   RRCNKWMAKLRHNYFNNPWAIISFLAAVFLLLLTFVQALFSV  429



>emb|CDY02090.1| BnaA03g40770D [Brassica napus]
Length=547

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 152/430 (35%), Positives = 221/430 (51%), Gaps = 48/430 (11%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG   L  ME+ K   +++ +KR K   +E  
Sbjct  151   CIYRVPRYLQENDKKSYFPQTVSLGPYHHGKEHLVPMEHHKWRAVNMVMKRTKH-RIEMY  209

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +K+ +EKA A Y G        +  + +KF +M+ LDG FI E L+R  D +     
Sbjct  210   IDAMKELEEKARACYEGP-------IVWSSNKFAEMMFLDGLFILE-LFRGADNDKGFLV  261

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ VF   G    + RD+++LENQLP F+  +              D V+
Sbjct  262   LGYGR-----NDPVFAMRGSMHSIQRDMVMLENQLPLFLATKT-------------DQVE  303

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVH-NLCNP-QNGGIQEERHYWTLCF  854
             I  +  L       PI     D +  E+  H L +   +L  P Q    +  R  W+   
Sbjct  304   IKIS--LENDNFFNPI----ADKDKEEL--HCLDVFRRSLLRPSQKPEPRLSRTRWSWKR  355

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
               +  +Q Q        I   TEL+EAG+  K+  K+   + I+F +  LEIPK  I D 
Sbjct  356   RAADKRQQQL-------IHCVTELREAGIKFKRR-KTDRFWDIRFKNGYLEIPKLLIHDG  407

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             T++ F N+IA+EQ   D NN   T Y   MDNLI++ +DV      G++ +WLG D EV 
Sbjct  408   TKSLFSNLIAFEQCHIDSNND-ITSYIIFMDNLIDSAEDVRYLHYCGIIEHWLGTDSEVA  466

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
             DLFNRLC+ V +   D  Y S++ NK++ +YN+ WNVM A L+H YFN PWA  S IAAV
Sbjct  467   DLFNRLCQEVAFDLQDS-YLSELSNKVDHNYNRKWNVMKATLKHKYFNNPWAYFSFIAAV  525

Query  1395  FLLSLTIAQT  1424
              LL LT+ Q+
Sbjct  526   ILLLLTLFQS  535



>ref|XP_010259276.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
 ref|XP_010259277.1| PREDICTED: UPF0481 protein At3g47200-like [Nelumbo nucifera]
Length=507

 Score =   210 bits (534),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 219/449 (49%), Gaps = 50/449 (11%)
 Frame = +3

Query  126   QLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQ  305
             Q S    IF+V   LR  +  AY P ++SIGPYHHG A+L +ME  K   L   L+R   
Sbjct  91    QSSLHRSIFRVPRNLREMDQKAYVPQIVSIGPYHHGKARLQEMEKQKWRLLRHVLERTSH  150

Query  306   PSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydee  485
             P +E   E +   +EKA   Y    D    +DS   +FV+M+LLD CFI E L       
Sbjct  151   P-VELYLEAMVGLEEKARQCYSKPIDN---MDSR--EFVEMMLLDACFILELL-------  197

Query  486   tkkeeeeelnkkkCD---NNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYD--E  650
                          C     + VF   G+   + RDLL+LENQLP FVL  L  +  D  E
Sbjct  198   ----NASVKGIIHCGYSWGDPVFTSRGVVPCIQRDLLMLENQLPLFVLDRLFALTCDPNE  253

Query  651   SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG------HLLQIVHNLCNPQN  812
             +      +    F S++   R           N   E+K       HLL +V     P +
Sbjct  254   TTESVSQLALEFFDSVIPGCR-----------NQQHELKNGNDPGLHLLHVVRQCLLPSS  302

Query  813   GGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFN  992
                  +R       P S+ ++++      +     T L++AGV  +K  +S+    IKF 
Sbjct  303   SKHSFQR------IPSSIRQRNKHKPQLMT--HCVTMLRDAGVKFRKN-ESTKFMDIKFK  353

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
                L IP   I D T++ F N++A+EQ     +N + T Y   MD L+N+ +DV   R  
Sbjct  354   KGILYIPPLVIHDSTKSIFLNLMAFEQCYPHCSN-HVTSYVNFMDGLVNSPQDVGYLRYR  412

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ + LG+++EV DL NRLC+ V +   D  Y S V   LN ++   W+   A L+HDY
Sbjct  413   GIIDHGLGNEEEVADLLNRLCREVAFDIND-CYLSGVSFDLNRYFEHKWHAWRASLKHDY  471

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             FN+PWA IS +AA+FL+ LT+ QTV  +L
Sbjct  472   FNSPWAIISLLAAIFLIGLTLTQTVYGIL  500



>emb|CDP16142.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 145/458 (32%), Positives = 220/458 (48%), Gaps = 37/458 (8%)
 Frame = +3

Query  75    QDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKM  254
             +D  +   + R +  L    S+  IF+V   LR  N  AY P + SIGPYHHG   L K 
Sbjct  3     EDKGLTTRIDRKLSGLSNSFSKQRIFRVDHKLRSQNEVAYEPQMFSIGPYHHGKENLVKA  62

Query  255   ENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLL  434
             +  KL YL   L R  + S E+    LKD +++A S+Y +++ I L      D+FV+M+L
Sbjct  63    QTYKLWYLKELLLRRGESSTERYINALKDIEDEARSWYAEEDMIGL----GSDEFVEMML  118

Query  435   LDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFF  614
             LDG FI EFL +       KE       K+ D   +F+       +FRD+LL ENQLPFF
Sbjct  119   LDGFFIIEFLRKYAGWCLYKEYPLNYGPKQSD--PIFLNRRKMGCLFRDILLFENQLPFF  176

Query  615   VLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHN  794
             +L  L  M       +  ++V +            P   P    N  T + G++      
Sbjct  177   ILVRLFEMTKSPGGDEEENLVDLAIFPDSPLHLFFPGEKPVSLPNPTTNIAGNV------  230

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                  NG  Q+          CS   +  +       I+ A+EL++AG+  +   KS S 
Sbjct  231   ---GDNGDSQDN---------CSTSGEVNEH------IKCASELRQAGIKFETANKSVSW  272

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDK--NNMYFTDYAQLMDNLINTEK  1148
               I F    ++IP   + D TE  FRN+I +E +  +   +  Y  DY   MD+LI + +
Sbjct  273   LDIAFEKGVMKIPTLDVHDVTECVFRNLIGFELYMINGLYDRRYIIDYVTFMDSLIASSR  332

Query  1149  DVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGV-VYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             DV   R   ++  WLGDD+ ++ +FN L K V  Y+  D F YS V  ++N + ++ WN+
Sbjct  333   DVEKLRRQKIITKWLGDDEAISSVFNGLVKEVETYTGNDVFCYSRVFKQVNEYSSRRWNI  392

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
               A +  +Y    W    +I ++ LLSLT  QT+ ++L
Sbjct  393   WRAHVMRNYIENHW----SIMSIVLLSLTFVQTIFSIL  426



>emb|CDY23015.1| BnaC07g31720D [Brassica napus]
Length=495

 Score =   209 bits (532),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 146/434 (34%), Positives = 219/434 (50%), Gaps = 44/434 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHGN  L  ME  K   +++ + R  Q  +E  
Sbjct  95    CIYRVPLHLQENDKKSYFPQTVSLGPYHHGNKHLLPMEFHKWRAVNMIMSRTGQ-GIEIY  153

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y      Q  +  + ++F +ML+LDGCF+ E L+R          E
Sbjct  154   IDAMKELEERARACY------QGPIALSVNEFTEMLVLDGCFVLE-LFR-------GTVE  199

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G+   + RD+++LENQLP FVL  L  +   E+          
Sbjct  200   GFQPIGYARNDPVFAMRGLMHSIQRDMVMLENQLPLFVLDRLLELQLGEA----------  249

Query  684   TFASMLTKVRLIPPIVPN---LGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCF  854
               ++ L    + P +  +   LGDN          + +       N   +E+   W L  
Sbjct  250   --STRLNPSNVKPWLERSLDLLGDNGELHCLDVFRRSLLKFSYTPNPRSEEDPLPWNL--  305

Query  855   PCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDP  1034
                + K+ Q        +   TEL+EAGV   K  K+   + I+F H  LEIPK  I D 
Sbjct  306   ---VDKRQQQL------VHCVTELREAGVKF-KTRKTDRFWDIRFEHGCLEIPKLLIHDG  355

Query  1035  TETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             T++ F N+IA+EQ   D      T Y   MDNLIN+ +DV+     G++ +WLG D EV 
Sbjct  356   TKSLFSNLIAFEQCHIDSTKD-ITSYIIFMDNLINSSEDVSYLHYCGIIEHWLGSDAEVA  414

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
             DLFNRLC+ V +   D  Y S + +++N +Y++ WN + A L+H YFN PWA  S  AAV
Sbjct  415   DLFNRLCQEVFFDPKDS-YLSKLSDEVNYYYSRRWNALKATLKHRYFNNPWAYFSFFAAV  473

Query  1395  FLLSLTIAQTVIAV  1436
              LL LT+ Q+  AV
Sbjct  474   ILLVLTLVQSFYAV  487



>ref|XP_010503688.1| PREDICTED: UPF0481 protein At3g47200-like [Camelina sativa]
Length=543

 Score =   210 bits (535),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 160/478 (33%), Positives = 242/478 (51%), Gaps = 46/478 (10%)
 Frame = +3

Query  54    ENTEGDQQDLPIYESLKR-DIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             +NT GD   + I + L++ +  +   +  + CI+++   L+  +  +Y P  +S+GPYHH
Sbjct  85    DNTGGDSWVISIRDKLEQANRDDDTTIWGKLCIYRIPHYLQENDKKSYFPQTVSLGPYHH  144

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G  +L  ME  K   ++  LKR KQ  +E     +++ +EKA + Y  +  I L    + 
Sbjct  145   GKKRLRPMERHKWRAVNKVLKRLKQ-RIEMYTNAMRELEEKARACY--EGPISL----SS  197

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             ++F +ML+LDGCF+ E L+R   E   +            N+ VF   G+   + RD+++
Sbjct  198   NEFTEMLVLDGCFVLE-LFRGTVEGFPEIGY-------ARNDPVFAMRGLMHSIQRDMIM  249

Query  591   LENQLPFFVLQELHGM---------VYDESKPKFLDIVKITFASMLTK------VRLIPP  725
             LENQLP FVL  L  +         +      KF D +  T     TK      +  +  
Sbjct  250   LENQLPLFVLDRLLELQLGTQNQTGIVAHVAVKFFDPLMPT-GEAFTKPDQAKLMNWLEK  308

Query  726   IVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQD-SKVGSS  902
              +  LGD      KG L    H L   +   +Q      T      L + ++   K    
Sbjct  309   SLDTLGD------KGEL----HCLDVFRRSLLQSSPTPNTRSLLKRLTRNTRVVDKRQQQ  358

Query  903   DIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSC  1082
              +   TEL+EAGV  +K  K+   + I+F    LEIPK  I D T++ F N+IA+EQ   
Sbjct  359   LVHCVTELREAGVKFRKR-KTDRFWDIEFKSGYLEIPKLLIHDGTKSLFSNLIAFEQCHM  417

Query  1083  DKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCD  1262
             + +N + T Y   MDNLIN+++DV+     G++ +WLG D EV DLFNRLC+ VV+   D
Sbjct  418   ESSN-HITSYIIFMDNLINSDEDVSYLHYCGIIEHWLGSDSEVADLFNRLCQEVVFDPKD  476

Query  1263  GFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               + S +   +N +YN+ WNV+ A L H YFN PWA  S  AAV LL LT+ Q+  AV
Sbjct  477   S-HLSRLSGDVNRYYNRKWNVLKATLTHKYFNNPWAYFSFSAAVILLLLTLCQSFYAV  533



>ref|XP_002877732.1| hypothetical protein ARALYDRAFT_485373 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53991.1| hypothetical protein ARALYDRAFT_485373 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   209 bits (533),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 147/444 (33%), Positives = 227/444 (51%), Gaps = 46/444 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +SIGPYHHG   L  ME  K   +++ + R K  ++E  
Sbjct  91    CIYRVPFYLQENDKKSYLPQTVSIGPYHHGKEHLLPMERHKWRAVNMVMARTKH-NIEMY  149

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y    D++       ++F +ML+LDGCF+ E          K   +
Sbjct  150   IDAMKELEEEARACYQGPIDMK-----NSNEFTEMLVLDGCFVLELF--------KGIAQ  196

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G+   + RD+++LENQLP F+L  L G+      P    IV  
Sbjct  197   GFQKIGYAQNDPVFAKRGLMHSIQRDMIMLENQLPLFILDRLLGL--QPGTPNQTGIVAD  254

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCS  863
                     V+    ++P       T+ K  L     +     NGG+     +    F  S
Sbjct  255   V------AVQFFKTLMPT--SEALTKSKSPLDSQEKSDELADNGGL-----HCLDVFHRS  301

Query  864   LGKQSQDSKVGS--SDIRTA----------TELQEAGVNLKKVVKSSSLFHIKFNHAELE  1007
             L + S+ +  G+   D+R            TEL++AGV   +  ++  L+ I+F +  L+
Sbjct  302   LIQSSETTNRGTPYEDMRMVDKQQQLIHCVTELRDAGVKFMRK-QTGQLWDIEFKNGYLK  360

Query  1008  IPKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
             IPK  I D T++ F N+IA+EQ H+   NN+  T Y   MDNLIN+ +DV+    +G++ 
Sbjct  361   IPKLLIHDGTKSLFSNLIAFEQCHTQSSNNI--TSYIIFMDNLINSSQDVSYLHHDGIIE  418

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
             +WLG D EV DLFNRLCK  ++   DG Y S +  ++N +Y++ WN + A LR  YFN P
Sbjct  419   HWLGSDSEVADLFNRLCKEGIFDPKDG-YLSQLSGEVNRYYSRKWNSLKATLRQKYFNNP  477

Query  1365  WAGISTIAAVFLLSLTIAQTVIAV  1436
             WA  S  AA+ LL LT  Q++ AV
Sbjct  478   WAYFSFSAALVLLILTFFQSLFAV  501



>ref|NP_190583.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE78631.1| uncharacterized protein AT3G50140 [Arabidopsis thaliana]
Length=539

 Score =   210 bits (534),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 148/443 (33%), Positives = 226/443 (51%), Gaps = 45/443 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L++++ ++Y P  +S+GPYHHG+  L  M+  K   +++ +KR KQ  +E  
Sbjct  114   CIYRVPLSLKKSDKNSYFPQAVSLGPYHHGDEHLRPMDYHKWRAVNMVMKRTKQ-GIEMY  172

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +E+A + Y         +  + +KF +ML+LDGCF+ + L+R   E   K   
Sbjct  173   IDAMKELEERARACYEGP------IGLSSNKFTQMLVLDGCFVLD-LFRGAYEGFSKLGY  225

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
             +        N+ VF   G    + RD+L+LENQLP FVL  L  +         L     
Sbjct  226   DR-------NDPVFAMRGSMHSIRRDMLMLENQLPLFVLNRLLELQ--------LGTQYQ  270

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERH-----YWTL  848
             T       VR   P++P    +   E      +  +   NP     +EE H       +L
Sbjct  271   TGLVAQLAVRFFNPLMPTYMSSTKIENSQ---ENNNKFFNPIADKEKEELHCLDVFRRSL  327

Query  849   CFPC-----SLGKQSQDSKVGSSDIRT------ATELQEAGVNLKKVVKSSSLFHIKFNH  995
               P       L +     K   +D R        TEL+EAG+  K+  KS   + I+F +
Sbjct  328   LQPSLKPDPRLSRSRWSRKPLVADKRQQQLLHCVTELREAGIKFKRR-KSDRFWDIQFKN  386

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               LEIPK  I D T++ F N+IAYEQ   D  N   T Y   MDNLI++ +D+       
Sbjct  387   GCLEIPKLLIHDGTKSLFSNLIAYEQCHIDSTND-ITSYIIFMDNLIDSAEDIRYLHYYD  445

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ +WLG+D EV D+FNRLC+ V +   +  Y S++ NK++ +YN+ WNV+ A L+H YF
Sbjct  446   IIEHWLGNDSEVADVFNRLCQEVAFD-LENTYLSELSNKVDRYYNRKWNVLKATLKHKYF  504

Query  1356  NTPWAGISTIAAVFLLSLTIAQT  1424
             + PWA  S  AAV LL LT+ Q+
Sbjct  505   SNPWAYFSFFAAVILLLLTLFQS  527



>ref|XP_010023720.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=434

 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 149/443 (34%), Positives = 231/443 (52%), Gaps = 52/443 (12%)
 Frame = +3

Query  138   EACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSME  317
             E  IF+V   LRR N  AY P ++ +GP+H+GN K   ME  K+ Y+   L+R K+ S++
Sbjct  39    EHSIFRVRPQLRRVNNKAYEPEILVVGPHHYGNDKFKSMEEQKMRYVQQLLQRRKEESID  98

Query  318   QCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkke  497
             +    L++ ++   + Y +       ++ + +KF+ M+ +DGCFI E   +   E+ +  
Sbjct  99    RYMPTLRELEQLVRNCYAET------INLSQEKFLAMMFIDGCFIVELFRKYNMEKLRN-  151

Query  498   eeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIV  677
                        +  +     +++ + RDLLLLENQLP F L +L+ +     +P+ L  +
Sbjct  152   ----------KDGPLMEADWIRYCLQRDLLLLENQLPLFFLNKLYDLTKRPDEPRELIDI  201

Query  678   KITFASMLTKVRLIPPIVPNLGDNN---ATEMKGHLLQIVHNLCNPQNGGIQEERHYWTL  848
               T+                LGD+          HLL ++H                WT 
Sbjct  202   ATTYFDF------------KLGDSGQCPTLRESKHLLHLMHTC--------------WTS  235

Query  849   CFP--CSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFH  1022
               P    L  ++  +K     + +ATEL+E+GV L+  V+   +  I+F + +LEIP   
Sbjct  236   GLPNVPRLSGRAPPTKEKLMFMSSATELRESGVKLR-AVRGRHMKDIRFENGKLEIPVLI  294

Query  1023  ITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDD  1202
             + D TE+ FRN+IAYEQH       YFTDY  LMD LIN+ KDV + R  G++ N+LGDD
Sbjct  295   VQDHTESQFRNLIAYEQHRQGGGISYFTDYVTLMDCLINSSKDVEVLRRAGIIKNYLGDD  354

Query  1203  KEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGIST  1382
             + +  +FNR+     Y +   FYYS++   +N + NK  NV MAKLR +YF++PWA +S 
Sbjct  355   EVIAQMFNRMGD---YVTLPNFYYSEIFKTVNAYCNKRRNVWMAKLRREYFHSPWAFLSV  411

Query  1383  IAAVFLLSLTIAQTVIAVLDLRK  1451
             +AA+ LL L  AQTV  +L   K
Sbjct  412   LAAIVLLLLAAAQTVFTILSYTK  434



>ref|XP_010030535.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
 gb|KCW54864.1| hypothetical protein EUGRSUZ_I00809 [Eucalyptus grandis]
Length=512

 Score =   209 bits (532),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 142/444 (32%), Positives = 221/444 (50%), Gaps = 48/444 (11%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++  I+++   L+    DAY P ++S+GPYHHG+ +LS+ME  K   L   L+R     M
Sbjct  99    AKPSIYQIPSYLKDAEKDAYVPQIVSLGPYHHGDKRLSQMEQHKWRCLRHILERTNH-RM  157

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             +     +K  +E+A + Y  DE    +   + ++FVKM++LDGCF+ E          + 
Sbjct  158   DYYLGSVKAVEERARTCY--DEKFPSM---SSEEFVKMMVLDGCFVIELF--------QG  204

Query  495   eeeeelnkkkCDNNAVFMPTG-MKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
              +          ++ VF   G +  ++ +D+++LENQ+P F+L  L G+ +     K L 
Sbjct  205   VKGGFKALGYPRDDPVFSSMGGLMHRIQQDMIMLENQIPLFILDRLLGLQHGNPNQKGLV  264

Query  672   IVKITFASMLTKVRLIPPIVPNLGDNNATEMKG---------HLLQIVHNLCNPQNGGIQ  824
               +         VR   P++    +++ T +K          H L++     +    G  
Sbjct  265   AKR--------AVRFFEPLM-QTDEHSRTRLKYDPLFYEGGLHCLEVYRR--SLLRLGTM  313

Query  825   EERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAEL  1004
              E   WT           + S+     IR+  EL+EAG+N K+  K+   + IKF    L
Sbjct  314   PEARTWT----------KRGSRRRQQHIRSVVELREAGINFKQR-KTDRFWDIKFKCGTL  362

Query  1005  EIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLV  1184
              IP+  I   T + F N+IA+EQ   D +N   + Y   MDNLIN+ +DV      G++ 
Sbjct  363   RIPRLRIHSGTRSLFLNLIAFEQSHFDCSNA-ISSYVTFMDNLINSPEDVGYLHYCGIIE  421

Query  1185  NWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTP  1364
             +WLG D EV DLFNRLC+ V ++  D  Y S++   LN +Y+  WN   A L+H+YFN P
Sbjct  422   HWLGSDAEVADLFNRLCQEVAFNINDS-YLSELSADLNKYYSLKWNNWRASLKHNYFNNP  480

Query  1365  WAGISTIAAVFLLSLTIAQTVIAV  1436
             W  IS +AA  LL LT  QT   V
Sbjct  481   WTIISVMAAFVLLVLTFTQTFYGV  504



>gb|KCW60073.1| hypothetical protein EUGRSUZ_H02803, partial [Eucalyptus grandis]
Length=395

 Score =   206 bits (523),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 151/440 (34%), Positives = 234/440 (53%), Gaps = 52/440 (12%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCW  326
             IF+V   LRR N  AY P ++ +GP+H+GN K   ME  K+ Y+   L+R K+ S+++  
Sbjct  3     IFRVRPQLRRVNNKAYEPEILVVGPHHYGNDKFKSMEEQKMRYVQQLLQRRKEESIDRYM  62

Query  327   EKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeee  506
               L++ ++   + Y +       ++ + +KF+ M+ +DGCFI E L+R+Y+ E  +    
Sbjct  63    PTLRELEQLVRNCYAET------INLSQEKFLAMMFIDGCFIVE-LFRKYNMEKLRN---  112

Query  507   elnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKIT  686
                     +  +     +++ + RDLLLLENQLP F L +L+ +     +P+ L  +  T
Sbjct  113   -------KDGPLMEADWIRYCLQRDLLLLENQLPLFFLNKLYDLTKRPDEPRELIDIATT  165

Query  687   FASMLTKVRLIPPIVPNLGDNN---ATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFP  857
             +                LGD+          HLL ++H                WT   P
Sbjct  166   YFDF------------KLGDSGQCPTLRESKHLLHLMHTC--------------WTSGLP  199

Query  858   --CSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITD  1031
                 L  ++  +K     + +ATEL+E+GV L+  V+   +  I+F + +LEIP   + D
Sbjct  200   NVPRLSGRAPPTKEKLMFMSSATELRESGVKLR-AVRGRHMKDIRFENGKLEIPVLIVQD  258

Query  1032  PTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
              TE+ FRN+IAYEQH       YFTDY  LMD LIN+ KDV + R  G++ N+LGDD+ +
Sbjct  259   HTESQFRNLIAYEQHRQGGGISYFTDYVTLMDCLINSSKDVEVLRRAGIIKNYLGDDEVI  318

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAA  1391
               +FNR+     Y +   FYYS++   +N + NK  NV MAKLR +YF++PWA +S +AA
Sbjct  319   AQMFNRMGD---YVTLPNFYYSEIFKTVNAYCNKRRNVWMAKLRREYFHSPWAFLSVLAA  375

Query  1392  VFLLSLTIAQTVIAVLDLRK  1451
             + LL L  AQTV  +L   K
Sbjct  376   IVLLLLAAAQTVFTILSYTK  395



>ref|XP_010426560.1| PREDICTED: UPF0481 protein At3g47200-like [Camelina sativa]
Length=541

 Score =   209 bits (532),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 154/481 (32%), Positives = 241/481 (50%), Gaps = 54/481 (11%)
 Frame = +3

Query  57    NTEGDQQDLPIYESLKR-DIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG  233
             +T GD   + I + L++ +  +   +  + CI++V   L+  +  +Y P  +S+GPYHHG
Sbjct  84    DTTGDSWVISIRDKLEQANRDDDTSIWGKLCIYRVPHYLQENDKKSYFPQTVSLGPYHHG  143

Query  234   NAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGD  413
               +L  ME  K   ++  LKR K   +E     +++ +EKA + Y  +  I L    + +
Sbjct  144   KKRLRPMERHKWRAVNKVLKRLKH-RIEMYTNAMRELEEKARACY--EGPISL----SSN  196

Query  414   KFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLL  593
             +F +ML+LDGCF+ E L+R   E   +            N+ VF   G+   + RD+++L
Sbjct  197   EFTEMLVLDGCFVLE-LFRGTVEGFPEIGY-------ARNDPVFAMRGLMHSIQRDMIML  248

Query  594   ENQLPFFVLQELHGM---------VYDESKPKFLDIVKITFASMLTK------VRLIPPI  728
             ENQLP FVL  L  +         +      KF D +  T     TK      +  +   
Sbjct  249   ENQLPLFVLDRLLELQLGTQNQTGIVAHVAVKFFDPLMPT-GEAFTKPDQAKLMNWLEKT  307

Query  729   VPNLGDNNATE-MKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD  905
             +  LGD      +      ++H+   P    +              L + +++++V    
Sbjct  308   LDTLGDKGELHCLDVFRRSLLHSSPTPNTRSL--------------LKRLTRNTRVVDKR  353

Query  906   ----IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQ  1073
                 +   TEL+EAGV  +K  K+   + I+F    LEIPK  I D T++ F N+IA+EQ
Sbjct  354   QQQLVHCVTELREAGVKFRKR-KTDRFWDIEFKSGYLEIPKLLIHDGTKSLFSNLIAFEQ  412

Query  1074  HSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYS  1253
                + +N + T Y   MDNLIN+++DV+     G++ +WLG D EV DLFNRLC+ VV+ 
Sbjct  413   CHMESSN-HITSYIIFMDNLINSDEDVSYLHYCGIIEHWLGSDSEVADLFNRLCQEVVFD  471

Query  1254  SCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIA  1433
               D  + S +   +N +YN+ WNV+ A L H YFN PWA  S  AAV LL LT+ Q+  A
Sbjct  472   PKDS-HLSRLSGDVNRYYNRKWNVLKATLTHKYFNNPWAYFSFSAAVILLLLTLCQSFYA  530

Query  1434  V  1436
             V
Sbjct  531   V  531



>ref|XP_006293039.1| hypothetical protein CARUB_v10019318mg [Capsella rubella]
 gb|EOA25937.1| hypothetical protein CARUB_v10019318mg [Capsella rubella]
Length=510

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 148/443 (33%), Positives = 225/443 (51%), Gaps = 43/443 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +SIGP+HHG   L  ME  K   +++ + R K  ++E  
Sbjct  91    CIYRVPFYLQENDKKSYLPQTVSIGPFHHGKEHLMPMERHKWRAVNMIMARTKH-NIEMY  149

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +++A + Y    D++       ++F +ML+LDGCF+ E          K   +
Sbjct  150   IDAMKELEDEARACYQGPIDMK-----NSNEFTEMLVLDGCFVLELF--------KGTVQ  196

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL----------HGMVYDES  653
                      N+ VF   G+   + RD+++LENQLP FVL  L           G+V D +
Sbjct  197   GFKEIGYASNDPVFAKGGLMHSIQRDMVMLENQLPLFVLDRLLALKPGTPNQTGIVADVA  256

Query  654   KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG-HLLQIVHNLCNPQNGGIQEE  830
                F  ++  + A  LTK       V        T+  G H L + H      +  +   
Sbjct  257   VRFFKTLMPTSKA--LTKSE--SSSVSQGKSEELTDHNGLHCLDVFHRSLIQSSETLNRG  312

Query  831   RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEI  1010
               Y  +     + KQ Q        I   TEL++AGV   +  ++  L+ I+F +  L+I
Sbjct  313   TPYEDVRM---VDKQQQQL------IHCVTELRDAGVKFVRK-ETGQLWDIEFKNGYLKI  362

Query  1011  PKFHITDPTETFFRNMIAYEQ-HSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVN  1187
             PK  I D T++ F N+IA+EQ H+   NN+  T Y   MDNLIN+ +DV+     G++ +
Sbjct  363   PKLVIHDGTKSLFSNLIAFEQCHTQSSNNI--TSYIIFMDNLINSSEDVSYLHHYGIIEH  420

Query  1188  WLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPW  1367
             WLG D EV DLFNRLCK V++   DG Y S +  ++N +Y++ WN + A LR  YFN PW
Sbjct  421   WLGSDSEVADLFNRLCKEVIFDPKDG-YLSQLSGEVNRYYSRKWNSLKATLRQKYFNNPW  479

Query  1368  AGISTIAAVFLLSLTIAQTVIAV  1436
             A  S  AAV LL LT  Q++ AV
Sbjct  480   AYFSFSAAVILLILTFFQSLFAV  502



>gb|KDP31987.1| hypothetical protein JCGZ_12448 [Jatropha curcas]
Length=524

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 165/497 (33%), Positives = 247/497 (50%), Gaps = 54/497 (11%)
 Frame = +3

Query  24    SELQRQ*GMIENTEGDQQDLPIYESLKRDIKNLKQLS--------SEACIFKVHEGLRRT  179
             SELQ+Q     +T  D+   P  E +    + L++ S        ++ CI++V   LR  
Sbjct  48    SELQKQTPSEPDTIKDETASPDSEWVISIKEKLEEASHDEEANSWAKLCIYRVPHYLREG  107

Query  180   NTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAA  359
             +  AY P ++S+GPYHHG  +L +++  K   L   LKR  +  +E   + +++ +EKA 
Sbjct  108   DDKAYVPQVVSLGPYHHGKRRLRQLDCHKWRSLHHMLKRTNK-DIELFLDSMRELEEKAR  166

Query  360   SYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNA  539
             S Y  +  I L    + ++FV+M++LDGCF+ E L+R          E         N+ 
Sbjct  167   SCY--ESKISL----SSNEFVEMMVLDGCFVLE-LFR-------GAAEGFKQLGYARNDP  212

Query  540   VFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLI  719
             +F   G    + RD+++LENQLP FVL  L G+ +D  +P    IV          +R  
Sbjct  213   IFAMRGSMHSIQRDMIMLENQLPLFVLDRLLGLQFD--RPDMKGIV------AKLALRFF  264

Query  720   PPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTL-CFPCSLGKQ-------  875
              P++P   D   T+ +   L+      N     + ++     L  F  SL ++       
Sbjct  265   DPLMPT--DEPLTKSEKSKLESSRGYSNATFDPLADQEGLHCLDVFRTSLLRRGPTPVPR  322

Query  876   ------SQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHI  1025
                   S  ++V        I   TEL+EAG+  KK  K+   + IKF +  L +P+  I
Sbjct  323   IWIKRWSNSNRVADKRRTQLIHCVTELKEAGIKFKK-RKTDRFWDIKFKNGVLRMPRLLI  381

Query  1026  TDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDK  1205
              D T + F N+IA+EQ   D +N   T Y   MDNLIN+ +DV      G++ +WLG D 
Sbjct  382   HDGTRSLFLNLIAFEQCHLDCSND-ITSYIVFMDNLINSPQDVAYLHYCGIIEHWLGSDA  440

Query  1206  EVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTI  1385
             EV DLFNRLC+ VV+   +  Y S +   +N +YN  WN   A L+H+YF  PWA IS +
Sbjct  441   EVADLFNRLCQEVVF-DINNSYLSRLSQDVNQYYNHRWNTWRASLKHNYFGNPWAIISLV  499

Query  1386  AAVFLLSLTIAQTVIAV  1436
             AAV LL LT AQT   V
Sbjct  500   AAVVLLLLTFAQTFYGV  516



>ref|XP_006404053.1| hypothetical protein EUTSA_v10010906mg [Eutrema salsugineum]
 gb|ESQ45506.1| hypothetical protein EUTSA_v10010906mg [Eutrema salsugineum]
Length=577

 Score =   209 bits (532),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 230/451 (51%), Gaps = 42/451 (9%)
 Frame = +3

Query  138   EACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSME  317
             + CI++V   L+  +  +Y P  +S+GPYHHG   L  ME+ K   +++ +KR K   +E
Sbjct  143   KVCIYRVPHYLQENDKKSYFPQTVSLGPYHHGKEHLLPMEHHKWRGVNMVMKRTKH-HIE  201

Query  318   QCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkke  497
                + +K  +EKA + Y      + LL  + +KF +M++LDGCF+ E ++R  + +    
Sbjct  202   MYIDAMKVLEEKARACY------EGLLCLSSNKFTEMMVLDGCFVLE-IFRGANNDKGFL  254

Query  498   eeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIV  677
             E          N+ VF   G    + RD+++LENQLP FVL  L  +         L   
Sbjct  255   ELGYGR-----NDPVFAMRGSMHSIQRDMVMLENQLPLFVLNRLLELQ--------LGAQ  301

Query  678   KITFASMLTKVRLIPPIVPNLGDNNATEMK--GHLLQIVHNLCNPQNGGIQEERH-----  836
               T       +R   P++P+   +  T+     + L   +N  NP     +EE H     
Sbjct  302   NQTGLVAQLAIRFFNPLMPSDKTSTRTDQAEIENSLDKDNNFFNPIADKDKEELHCLDVF  361

Query  837   YWTLCFPC-------SLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHI  983
               +L  P        S  + S   +V        I   T+L+EAG+  K+  ++   + +
Sbjct  362   RRSLLRPSLKPEPRLSRTRWSWKKRVADKRQQQLIHCVTDLREAGIKFKR-RETDRFWDV  420

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
             KF +  LEIPK  I D T++ F N+IA+EQ   D NN   T Y   MDNLI++ +DV+  
Sbjct  421   KFKNGYLEIPKLLIHDGTKSLFSNLIAFEQCHIDSNND-ITSYIIFMDNLIDSAEDVSYL  479

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
                G++ +WLG+D EV DLFNRLC+ V +   +  Y S++ NK+N +Y++ WN + A L+
Sbjct  480   HYCGIIEHWLGNDSEVADLFNRLCQEVAFDLQNS-YLSELSNKVNRNYSRKWNAVKATLK  538

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             H YFN PWA  S  AAV LL LT+ Q+    
Sbjct  539   HKYFNNPWAYFSFFAAVILLILTLFQSFFTA  569



>ref|XP_002877730.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53989.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=564

 Score =   209 bits (531),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 229/447 (51%), Gaps = 46/447 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V + L+  N  +Y P  +S+GP+HHGN  L  M+  K   +++ + R K   +E  
Sbjct  140   CIYRVPQYLQENNKKSYFPQTVSLGPFHHGNKHLLPMDRHKWRAVNMVMARTKH-DIEMY  198

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +++A + Y         +D + +KF +ML+LDGCF+ E L+R  DE   +   
Sbjct  199   IDAMKELEDRARACYEGP------IDLSSNKFCEMLVLDGCFVLE-LFRGADEGFSELGY  251

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
             +        N+ VF   G    + RD+++LENQLP FVL  L  +   +         + 
Sbjct  252   DR-------NDPVFAMRGSMHSIQRDMVMLENQLPLFVLNRLLEIQLGQRH-------QT  297

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERH-----YWTL  848
                + L  VR   P++P   D   T+    L        NP     + E H        L
Sbjct  298   GLVAQLA-VRFFDPLMPT--DELLTKTDNSLEN--DKFFNPIADKDKGELHCLDVFRRNL  352

Query  849   CFPCS-----LGKQSQDSKVGSSD------IRTATELQEAGVNLKKVVKSSSLFHIKFNH  995
               PCS     L ++    K   +D      I   TEL+EAG+  ++  K+   + I+F +
Sbjct  353   LRPCSKPEPRLSRRRWSWKTRVADKRQQQLIHCVTELREAGIKFRRR-KTDRFWDIRFEN  411

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               LEIPK  I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +DV+     G
Sbjct  412   GYLEIPKLLIHDGTKSLFSNLIAFEQCHIDSSND-ITSYIIFMDNLIDSPEDVSYLHYCG  470

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ +WLG+D EV DLFNRLC+ V +   +  Y S + NK++ +Y++ WNV+ A L+H YF
Sbjct  471   IIEHWLGNDYEVADLFNRLCQEVAFDPQNS-YLSQLSNKVDRNYSRKWNVLKAILKHKYF  529

Query  1356  NTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             N PWA  S  AA+ LL LT+ Q+    
Sbjct  530   NNPWAYFSFFAALVLLFLTLFQSFFTA  556



>ref|XP_010046511.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=390

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 155/440 (35%), Positives = 228/440 (52%), Gaps = 54/440 (12%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S E  IF+V   LR+ N  AY P +++IGPYH+GN K   ME  KL YL   L+R K+  
Sbjct  5     SPEHSIFRVRHQLRKVNEKAYDPEILAIGPYHYGNDKFKFMEEQKLRYLQQLLERRKE-R  63

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +++    L++ +++A + Y +       +D + +KF+ M+L+DGCFI E   +   +   
Sbjct  64    VDRYMPTLREMEQRARNCYAE------TIDLSQEKFLAMMLVDGCFIVELFRKYNMKIPT  117

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
                         +++ +    G++  + RDLLLLENQLP FVL  L+ +  D      + 
Sbjct  118   D-----------EDDPLMHELGIQNSIMRDLLLLENQLPLFVLSNLYDLTKDPGDQSEVG  166

Query  672   IVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLC  851
             +    +             VP        EMK HLL + H  C              T  
Sbjct  167   LHASEYFQ-----------VPMQNWTIGEEMK-HLLHLYHTWC--------------TSG  200

Query  852   FPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITD  1031
              P +L    +  K       +ATEL+E+GV  +   +   L  IKF +  LEIP   + D
Sbjct  201   LPKTLQPDCKPVKF------SATELRESGVRFR-AAEGGELSDIKFENGTLEIPVLEVED  253

Query  1032  PTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
              TE+ FRN++AYEQH   ++  +FTDY   MD+LIN+  DV + R  G++ N+LGDDK V
Sbjct  254   HTESKFRNLVAYEQHRRRRDINHFTDYVHFMDSLINSSMDVEVLRHKGIIKNYLGDDKVV  313

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAA  1391
               +FN +   V+     G YYS++   +N H +K  NV MAKL+ +YF++PWA +S +AA
Sbjct  314   AQIFNNMGDYVI---VYGSYYSEIFKNVNAHCDKRRNVWMAKLKREYFHSPWAFLSVLAA  370

Query  1392  VFLLSLTIAQTVIAVLDLRK  1451
             V LL LT AQTV  VL   K
Sbjct  371   VVLLLLTAAQTVFTVLSYTK  390



>gb|KCW80455.1| hypothetical protein EUGRSUZ_C01795, partial [Eucalyptus grandis]
Length=391

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/435 (31%), Positives = 224/435 (51%), Gaps = 47/435 (11%)
 Frame = +3

Query  117   NLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKR  296
             +L  LSSE CIF+V E LR ++ +AY P +++IGPYH  +  + +ME+ KL YL  FL  
Sbjct  2     SLPTLSSECCIFRVPEKLRHSHEEAYMPRVVAIGPYHRHSQSVMQMEDHKLRYLQSFLGH  61

Query  297   EKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYRey  476
              +   +E   ++++  +++A SYY  D+ I    D + D+F +M+LLDG F  +      
Sbjct  62    NQNCRLEDYIKRIRSWEDRARSYY--DKQI----DLSSDEFTEMMLLDGIFAIQLF----  111

Query  477   deetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESK  656
                          +   +++ +F    M   V RD++LLENQ+PFF ++ L  M     +
Sbjct  112   -------LMYWNLEGMPNSDRIFGKPWMLNDVRRDMMLLENQMPFFAIEGLFEMALGSHQ  164

Query  657   PKFLDIVKITFASMLTKVRL--IPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE  830
                  ++++T+   +  V++  +P  V        +E+K H L  +              
Sbjct  165   RHTPVLLELTYGFFMPGVKMEEVPEAV------MESEVK-HFLDAIR-------------  204

Query  831   RHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEI  1010
                  L +  S  K   D       I + TEL  AGV LK+  KS+ LF I +N+  LEI
Sbjct  205   -----LSYLPSAKKAPYDINEEVKLIPSVTELVAAGVKLKR-GKSNRLFDIGYNNGVLEI  258

Query  1011  PKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNW  1190
             P+  +   TE++FRN+IA+EQ    + N Y  DY   MD+L+NT  D  +    G++ NW
Sbjct  259   PRLSLYHTTESYFRNLIAFEQIYY-QGNSYLIDYIVFMDHLVNTPADSKMLIDLGIIENW  317

Query  1191  LGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
             LG++    DL N  CK  +  + + ++YS + ++L  +  +P+N     L+ DY ++PW 
Sbjct  318   LGNEDAAADLINSFCKDTLLWTRNAYFYS-LRHELVAYCQRPYNKWKTSLKRDYCSSPWV  376

Query  1371  GISTIAAVFLLSLTI  1415
              +S + AV LL+LT+
Sbjct  377   VLSIMTAVVLLTLTV  391



>ref|XP_006292637.1| hypothetical protein CARUB_v10018880mg [Capsella rubella]
 gb|EOA25535.1| hypothetical protein CARUB_v10018880mg [Capsella rubella]
Length=521

 Score =   207 bits (527),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 222/435 (51%), Gaps = 42/435 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +SIGPYHHG  +L  ME  K   ++  LKR K       
Sbjct  115   CIYRVPHYLQENDKKSYFPQTVSIGPYHHGKKRLRPMERHKWRAVNKVLKRLKH------  168

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
               +++   +  A Y G        +  + ++F +ML+LDGCF+ E L+R   E   +   
Sbjct  169   --RIEIEAKARACYEGP-------ISLSSNEFTEMLVLDGCFVLE-LFRGTVEGFHEIGY  218

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G+   + RD+++LENQLP FVL  L  +         L     
Sbjct  219   -------ARNDPVFAMRGLMHSIQRDMIMLENQLPLFVLDRLLELQ--------LGTQNQ  263

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCS  863
             T       V+   P++P  G+      +  L+  +    +    G + E H   + F  S
Sbjct  264   TGIVAHVAVKFFDPLMPT-GEAFTKPDQAKLMNWLEKHLD--TLGDKGELHCLDV-FRRS  319

Query  864   LGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITD  1031
             L + + +++V        +   TEL+EAGV  +K  K+   + I+F    LEIPK  I D
Sbjct  320   LLQLTGNTRVVDKRQQQLVHCVTELREAGVKFRKR-KTDRFWDIEFKSGYLEIPKLLIHD  378

Query  1032  PTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
              T++ F N+IA+EQ   + +N + T Y   MDNLIN+++DV+     G++ +WLG D EV
Sbjct  379   GTKSLFSNLIAFEQCHIESSN-HITSYIIFMDNLINSDEDVSYLHYCGIIEHWLGSDSEV  437

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAA  1391
              DLFNRLC+ VV++  D  + S +   +N +Y++ WNV+ A L H YFN PWA  S  AA
Sbjct  438   ADLFNRLCQEVVFNPKDS-HLSRLSGDVNRYYHRKWNVLKATLTHKYFNNPWAYFSFSAA  496

Query  1392  VFLLSLTIAQTVIAV  1436
             V LL LT+ Q+  AV
Sbjct  497   VILLLLTLCQSFYAV  511



>gb|ABK28593.1| unknown [Arabidopsis thaliana]
Length=504

 Score =   207 bits (526),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 149/435 (34%), Positives = 225/435 (52%), Gaps = 48/435 (11%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +T +Y P ++SIGPYHHG+  L  ME  K   +++ + R K   +E  
Sbjct  105   CIYRVPPYLQENDTKSYMPQIVSIGPYHHGHKHLMPMERHKWRAVNMVMARAKH-DIEMY  163

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +EKA + Y      Q  ++   ++F++ML+LDG FI E          K   E
Sbjct  164   IDAMKELEEKARACY------QGPINMNRNEFIEMLVLDGVFIIEIF--------KGTSE  209

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G+   + RD+++LENQLP+ VL+ L  +     +P  LD V +
Sbjct  210   GFQEIGYAPNDPVFGMRGLMQSIRRDMVMLENQLPWSVLKGLLQL----QRPDVLDKVNV  265

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKG-HLLQIVHNLCNPQNGGIQEERHYWTLCFPC  860
               +    +     P++P       TE  G H L ++       +G   E+          
Sbjct  266   QLSQPFFQ-----PLLPT--REVLTEEGGLHCLDVLRRGLLQSSGTSDEDM--------S  310

Query  861   SLGKQSQDSKVGSSDIRTATELQEAGV-NLKKVVKSSSLFHIKFNHAELEIPKFHITDPT  1037
              + KQ Q        I   TEL+ AGV +++K  ++   + I+F +  L+IPK  I D T
Sbjct  311   MVNKQPQQL------IHCVTELRNAGVESMRK--ETGHFWDIEFKNGYLKIPKLLIHDGT  362

Query  1038  ETFFRNMIAYEQHSCD-KNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVT  1214
             ++ F N+IA+EQ  C  K++   T Y   MDNLIN+ +DV+     G++ NWLG D EV+
Sbjct  363   KSLFLNLIAFEQ--CHIKSSKKITSYIIFMDNLINSSEDVSYLHHYGIIENWLGSDSEVS  420

Query  1215  DLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAV  1394
             DLFN L K V++   DG Y S +  ++N +Y + WN + A LRH YFN PWA  S IAAV
Sbjct  421   DLFNGLGKEVIFDPNDG-YLSALTGEVNIYYRRKWNYLKATLRHKYFNNPWAYFSFIAAV  479

Query  1395  FLLSLTIAQTVIAVL  1439
              LL  T  Q+  AV 
Sbjct  480   TLLIFTFCQSFFAVF  494



>ref|XP_009136538.1| PREDICTED: UPF0481 protein At3g47200 [Brassica rapa]
Length=531

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 148/455 (33%), Positives = 234/455 (51%), Gaps = 59/455 (13%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M+  K   ++  LKR  Q S++  
Sbjct  104   CIYRVPYYLQENDNQSYFPQTVSLGPYHHGKKRLRSMDRHKWRAVNRILKRTNQ-SIKIY  162

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +++ +EKA A Y G        L  + ++FV+ML+LDGCF+ E L+R   E   +  
Sbjct  163   IDAMRELEEKARACYEGP-------LGLSSNEFVEMLVLDGCFVLE-LFRGAVEGFTELG  214

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ VF   G    + RD+++LENQLP F+L  L  +         L    
Sbjct  215   Y-------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFILNRLLELQ--------LGTKN  259

Query  681   ITFASMLTKVRLIPPIVPN---LGDNNATEMKGHL-----------LQIVHNLCNPQNGG  818
              T       VR   P++P    +   + ++++ +L           +  +H L   +   
Sbjct  260   QTGLVAQLAVRFFDPLMPTDEPMTKTDQSKLENYLAGDKAFDPFADMGELHCLDVFRRSL  319

Query  819   IQ-----EERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSS  971
             ++     E R         S  + S++++V        I   TEL+EAG+  ++  K+  
Sbjct  320   LRSSPKPEPR--------LSRRRWSRNTRVADKRRQQLIHCVTELKEAGIKFRRR-KTDR  370

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
              + I+FN+  LEIP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +D
Sbjct  371   FWDIQFNNGYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSSND-ITSYIIFMDNLIDSHED  429

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V+     G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   
Sbjct  430   VSYLHYCGIIEHWLGSDAEVANLFNRLCEEVVFDTEDS-YLSRLSAEINRYYNQKWNAWR  488

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             A L+H YFN PWA +S  AAV LL LT+ Q+  AV
Sbjct  489   AALKHKYFNNPWAVVSFCAAVILLVLTLCQSFYAV  523



>emb|CDY17749.1| BnaC08g21570D [Brassica napus]
Length=528

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 224/448 (50%), Gaps = 53/448 (12%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M+  K   ++  LKR  Q +++  
Sbjct  109   CIYRVPYYLQENDNKSYFPQTVSLGPYHHGKKRLRPMDRHKWRAVNKILKRTNQ-NIKMY  167

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +++ +EKA + Y     +      + ++F++ML+LDGCF+ E L+R   E   +   
Sbjct  168   IDAMRELEEKARACYEGPFGL------SSNEFIEMLVLDGCFVLE-LFRGAVEGFTELGY  220

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+++LENQLP FVL  L  +         L     
Sbjct  221   -------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFVLNRLLELQ--------LGTRNQ  265

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKG-----------HLLQIVHN--LCNPQNGGIQ  824
             T       VR   P++P       T+              H L +     L +      +
Sbjct  266   TGLVAQLAVRFFDPLMPTDEPMTKTDQDKAFDPFADMGELHCLDVFRRSLLRSSPKPEPR  325

Query  825   EERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHIKFN  992
               R  W+          S++++V        I   TEL+EAG+  ++  K+   + I+FN
Sbjct  326   LSRKRWS----------SRNTRVADKRRQQLIHCVTELREAGIKFRRR-KTDRFWDIQFN  374

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
             +  LEIP+  I D T++ F N+IA+EQ   D  N   T Y   MDNLI++ +DV+     
Sbjct  375   NGYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSRND-ITSYIIFMDNLIDSHEDVSYLHYC  433

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   A LRH Y
Sbjct  434   GIIEHWLGSDSEVANLFNRLCEEVVFDTEDS-YLSRLSVEVNRYYNQKWNAWRATLRHKY  492

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             FN PWA +S  AAV LL LT++Q+  A 
Sbjct  493   FNNPWAIVSFCAAVILLVLTLSQSFYAA  520



>emb|CDY30604.1| BnaAnng03790D [Brassica napus]
Length=528

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 224/448 (50%), Gaps = 53/448 (12%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M+  K   ++  LKR  Q +++  
Sbjct  109   CIYRVPYYLQENDNKSYFPQTVSLGPYHHGKKRLRPMDRHKWRAVNKILKRTNQ-NIKMY  167

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +++ +EKA + Y     +      + ++F++ML+LDGCF+ E L+R   E   +   
Sbjct  168   IDAMRELEEKARACYEGPFGL------SSNEFIEMLVLDGCFVLE-LFRGAVEGFTELGY  220

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+++LENQLP FVL  L  +         L     
Sbjct  221   -------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFVLNRLLELQ--------LGTRNQ  265

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKG-----------HLLQIVHN--LCNPQNGGIQ  824
             T       VR   P++P       T+              H L +     L +      +
Sbjct  266   TGLVAQLAVRFFDPLMPTDEPMTKTDQDKAFDPFADMGELHCLDVFRRSLLRSSPKPEPR  325

Query  825   EERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHIKFN  992
               R  W+          S++++V        I   TEL+EAG+  ++  K+   + I+FN
Sbjct  326   LSRKRWS----------SRNTRVADKRRQQLIHCVTELREAGIKFRRR-KTDRFWDIQFN  374

Query  993   HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMN  1172
             +  LEIP+  I D T++ F N+IA+EQ   D  N   T Y   MDNLI++ +DV+     
Sbjct  375   NGYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSRND-ITSYIIFMDNLIDSHEDVSYLHYC  433

Query  1173  GVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDY  1352
             G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   A LRH Y
Sbjct  434   GIIEHWLGSDSEVANLFNRLCEEVVFDTEDS-YLSRLSVEVNRYYNQKWNAWRATLRHKY  492

Query  1353  FNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             FN PWA +S  AAV LL LT++Q+  A 
Sbjct  493   FNNPWAIVSFCAAVILLVLTLSQSFYAA  520



>ref|XP_011101987.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
Length=447

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 149/460 (32%), Positives = 238/460 (52%), Gaps = 36/460 (8%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYL  278
             +++ + +L    SE  I++VH+ LR  N  AY P +I+IGPYH     L  ME+ KL  L
Sbjct  12    IRQKLSHLSVAQSECTIYRVHKHLRSVNDKAYEPEVIAIGPYHRDKGNLKMMEDHKLRNL  71

Query  279   DLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAE  458
              L L+R K   +E+    +   +  A   Y   E I L   SA D F++ML+LDGCFI +
Sbjct  72    HLLLQR-KNDDVEKYVSAIGPLEPLARKCYA--ETISL---SAAD-FIEMLVLDGCFIID  124

Query  459   FLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGM  638
                +      +++           N+ +F    +   + RDL+L ENQ+PFFVL +L  +
Sbjct  125   LARKSNMPHLREK-----------NDPIFHMEWIMNSLQRDLMLFENQIPFFVLCKLFDL  173

Query  639   VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNP----  806
             +   ++   L  + ++F        L P  V     + ++    HLL ++H    P    
Sbjct  174   IEVPNQHSRLIYLLLSFFD-----NLYPGKVYVESRSWSSHEIKHLLDLIHRNWLPSFDW  228

Query  807   ----QNGGIQEERHYWTLCFPCSLG---KQSQDSKVGSSDIRTATELQEAGVNLKKVVKS  965
                 +NG  +++R  +  C  C  G    + ++SK     I  AT L+EA V   +    
Sbjct  229   LDVSKNGENRKKRWRFVNCGTCLGGANVSKGENSKTRWRFINCATWLREANVKFARR-DD  287

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
              +LF+I+F +  + +    + D T++FFRN+IAYEQ+  D    + TDY + +D LI++ 
Sbjct  288   VTLFNIRFKNGTMFLAPLTVEDRTDSFFRNVIAYEQYFQDTEFSFVTDYVKFLDCLIDSS  347

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             +DV +    G++ NWLGDD+ V ++ N+L   V       F Y+ + + +N H NK  N 
Sbjct  348   RDVQILGRAGIIDNWLGDDEVVANMINKLSDSVT-GPGSSFVYAKIFDSVNKHCNKRRNR  406

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              MAKLR +Y N+PWA +S + AV L+ LTI QTV ++L +
Sbjct  407   WMAKLRRNYLNSPWAIMSIVVAVVLVLLTITQTVFSILQV  446



>ref|XP_006487629.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis]
Length=417

 Score =   204 bits (519),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 142/420 (34%), Positives = 213/420 (51%), Gaps = 39/420 (9%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             + +  IF+V + LR+ N  AY P L++IGPYHHG   LS  E  K+ YL   ++R   P 
Sbjct  23    TPQFSIFRVPDLLRKLNEKAYEPELLAIGPYHHGKDNLSAFEEHKISYLQTLIERTGIPY  82

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
              +     +   +E+A + YG        +    ++FV+M+L DGCFI E + +      +
Sbjct  83    PDYV-RAMWALEERARNCYGGS------ISLGKNEFVQMMLFDGCFIVEVIRKFGLPHLR  135

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPK---  662
                         D++ +F    M   + RD++L+ENQLPFFV+ +L  M    + P+   
Sbjct  136   G-----------DDDPIFKQGWMLPHIARDMILVENQLPFFVIWKLFIMSEMPNIPRNEN  184

Query  663   FLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYW  842
             FL  +   F  +L         V  + D    E+K HL+ ++H+   P   GI+      
Sbjct  185   FLFTILRFFYGILPGKGFRRDGVDRVNDYPINEIK-HLVNLIHDNWLPSPSGIEAY----  239

Query  843   TLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKV--VKSSSLFHIKFNHAELEIPK  1016
                   + GK + D     S I +A+E+Q+AG+  +KV   +  SLF IKF +  ++IP 
Sbjct  240   -----ANNGKNNSDW----SFICSASEIQKAGIKFQKVDDHRDGSLFDIKFKNGVMKIPT  290

Query  1017  FHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLG  1196
               I D TET F+N+I YEQ S   N  +  DY + +  LIN+ KD  L R  G++ N LG
Sbjct  291   LEIGDATETIFQNLIVYEQCSHGINPKHILDYCKFLHCLINSSKDAELLRRRGIIDNRLG  350

Query  1197  DDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGI  1376
             DD+ +  L N+L  G V    + FYY  V NK+N H ++  N   AKL+H YF  PWA I
Sbjct  351   DDEVIATLLNKLGDGGVLG--EQFYYCGVLNKVNFHCSRRRNKWKAKLKHHYFKDPWAVI  408



>ref|XP_008231146.1| PREDICTED: UPF0481 protein At3g47200-like [Prunus mume]
Length=451

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 229/463 (49%), Gaps = 59/463 (13%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG-NAKLSKMENLKLM  272
             ++ +++     L ++ CIF+V E +RR  T AY P ++SIGP+H G   K   MEN+K  
Sbjct  27    TITKNLLGYSPLPAQCCIFRVPELIRRQKTAAYEPDIVSIGPFHRGCGEKFQLMENVKRW  86

Query  273   YLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFI  452
             YL   L      S++   + + +   +A   Y D      L   +   FV+M++LDGCF+
Sbjct  87    YLQCLLSSRADISLDSLIKGIMELGRRARDCYADP-----LEHLSQKDFVQMMILDGCFL  141

Query  453   AEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELH  632
              E   +E  ++ +            +N+ VF  + M   ++ DLLLLENQLP+FVL+ L+
Sbjct  142   LELFRKELWDDLQD-----------ENDPVFNLSCMLEYLYHDLLLLENQLPWFVLEGLY  190

Query  633   GMVYDESKPKFLDIVKIT--FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC--  800
              +  + +  +   ++K+   F       R++ P  P        E+  H+L ++  +   
Sbjct  191   NLTANNTNQRNASLIKLVLNFFRQAVDERILDPNFP-------FEIL-HILDLIRTVTVV  242

Query  801   -------NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVV  959
                      + G ++E+             ++ ++       I  AT L EAGV  ++  
Sbjct  243   PFKDLESQKKEGHVEEQ-------------EEQKNEPELPQRIPNATTLSEAGVQFRRSK  289

Query  960   KSSS-LFHIKFN--HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMY-FTDYAQLMD  1127
              +   + +I+FN  +    IP   I + T   FRN+IA+EQ  C  + ++  T YA LMD
Sbjct  290   NTPECIMNIEFNFKNGVFTIPPLGIDEKTGPLFRNLIAFEQ--CHHSRLHKITSYAVLMD  347

Query  1128  NLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHY  1307
             NLI+T  DV+L R   +L NWL  + +    FN L      ++  GFYY  +CN +N +Y
Sbjct  348   NLIDTSNDVDLLREKKILANWLSPE-DAAQFFNELYND---TTVIGFYYGSLCNDVNKYY  403

Query  1308  NKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             N  WN    KL+ DYF+TPWA IS IAA  LL LT+ QT   +
Sbjct  404   NTDWNRWREKLKRDYFSTPWAVISFIAAFILLVLTLVQTAYTI  446



>emb|CDY02093.1| BnaA03g40740D [Brassica napus]
Length=531

 Score =   207 bits (526),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 148/455 (33%), Positives = 234/455 (51%), Gaps = 59/455 (13%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M+  K   ++  LKR  Q S++  
Sbjct  104   CIYRVPYYLQENDNQSYFPQTVSLGPYHHGKKRLRSMDRHKWRAVNRILKRTNQ-SIKIY  162

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +++ +EKA A Y G        L  + ++FV+ML+LDGCF+ E L+R   E   +  
Sbjct  163   IDAMRELEEKARACYEGP-------LGLSSNEFVEMLVLDGCFVLE-LFRGAVEGFTELG  214

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ VF   G    + RD+++LENQLP F+L  L  +         L    
Sbjct  215   Y-------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFILNRLLELQ--------LGTKN  259

Query  681   ITFASMLTKVRLIPPIVPN---LGDNNATEMKGHL-----------LQIVHNLCNPQNGG  818
              T       VR   P++P    +   + ++++ +L           +  +H L   +   
Sbjct  260   QTGLVAQLAVRFFDPLMPTDEPMTKTDQSKLENYLAGDKAFDPFADMGELHCLDVFRRSL  319

Query  819   IQ-----EERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSS  971
             ++     E R         S  + S++++V        I   TEL+EAG+  ++  K+  
Sbjct  320   LRSSPKPEPR--------LSRRRWSRNTRVADKRRQQLIHCVTELKEAGIKFRRR-KTDR  370

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
              + I+FN+  LEIP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +D
Sbjct  371   FWDIQFNNGYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSSND-ITSYIIFMDNLIDSHED  429

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V+     G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   
Sbjct  430   VSYLHYCGIIEHWLGSDAEVANLFNRLCEEVVFDTEDS-YLSRLSAEVNRYYNQKWNAWR  488

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             A L+H YFN PWA +S  AAV LL LT+ Q+  AV
Sbjct  489   AALKHKYFNNPWAVVSFCAAVILLVLTLCQSFYAV  523



>ref|NP_190585.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ52728.1| hypothetical protein At3g50160 [Arabidopsis thaliana]
 gb|ABE97188.1| hypothetical protein At3g50160 [Arabidopsis thaliana]
 gb|AEE78633.1| uncharacterized protein AT3G50160 [Arabidopsis thaliana]
Length=503

 Score =   206 bits (524),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 221/434 (51%), Gaps = 46/434 (11%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +T +Y P ++SIGPYHHG+  L  ME  K   +++ + R K   +E  
Sbjct  105   CIYRVPPYLQENDTKSYMPQIVSIGPYHHGHKHLMPMERHKWRAVNMVMARAKH-DIEMY  163

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +EKA + Y      Q  ++   ++F++ML+LDG FI E          K   E
Sbjct  164   IDAMKELEEKARACY------QGPINMNRNEFIEMLVLDGVFIIEIF--------KGTSE  209

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G+   + RD+++LENQLP+ VL+ L  +     +P  LD V +
Sbjct  210   GFQEIGYAPNDPVFGMRGLMQSIRRDMVMLENQLPWSVLKGLLQL----QRPDVLDKVNV  265

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKG-HLLQIVHNLCNPQNGGIQEERHYWTLCFPC  860
                    +     P++P       TE  G H L ++       +G   E+          
Sbjct  266   QLFQPFFQ-----PLLPT--REVLTEEGGLHCLDVLRRGLLQSSGTSDEDM--------S  310

Query  861   SLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTE  1040
              + KQ Q        I   TEL+ AGV   +  ++   + I+F +  L+IPK  I D T+
Sbjct  311   MVNKQPQQL------IHCVTELRNAGVEFMRK-ETGHFWDIEFKNGYLKIPKLLIHDGTK  363

Query  1041  TFFRNMIAYEQHSCD-KNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTD  1217
             + F N+IA+EQ  C  K++   T Y   MDNLIN+ +DV+     G++ NWLG D EV+D
Sbjct  364   SLFLNLIAFEQ--CHIKSSKKITSYIIFMDNLINSSEDVSYLHHYGIIENWLGSDSEVSD  421

Query  1218  LFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVF  1397
             LFN L K V++   DG Y S +  ++N +Y + WN + A LRH YFN PWA  S IAAV 
Sbjct  422   LFNGLGKEVIFDPNDG-YLSALTGEVNIYYRRKWNYLKATLRHKYFNNPWAYFSFIAAVT  480

Query  1398  LLSLTIAQTVIAVL  1439
             LL  T  Q+  AV 
Sbjct  481   LLIFTFCQSFFAVF  494



>ref|XP_004293002.1| PREDICTED: UPF0481 protein At3g47200-like [Fragaria vesca subsp. 
vesca]
Length=463

 Score =   205 bits (521),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 147/468 (31%), Positives = 231/468 (49%), Gaps = 40/468 (9%)
 Frame = +3

Query  84    PIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENL  263
             P+  S++  + NL  LSS  CI +V   LRR +  AYTP ++SIGP HHG   L  ME  
Sbjct  19    PLLTSMRSMLYNLSPLSSSCCICRVPRRLRRVSEKAYTPQVVSIGPLHHGKEALKPMEEH  78

Query  264   KLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDG  443
             K  YL  +L R    S+E    K++  + +    Y +     +  DS  D+FVK++L+D 
Sbjct  79    KNRYLQDYLIRTNL-SLEHYINKIRRREAELRDCYAE----TIPFDS--DEFVKIVLVDA  131

Query  444   CFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQ  623
              FI E L R +  E +            +N+ +F    M   V+ D+ +LENQLPFF+LQ
Sbjct  132   AFIIEVLLRYHFHELQD-----------ENDRIFKKPRMFEDVWPDMRMLENQLPFFILQ  180

Query  624   ELHG-----MVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNAT---EMKGHLL  779
             +L       + ++E     +++    F +++         + +L D  AT       H +
Sbjct  181   DLFDPKRIQVPFEEENFSIVNLSYTFFRALMN--------IEDLEDTLATISSSTVDHFV  232

Query  780   QIVHNL--CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTA---TELQEAGVN  944
               V  L    P+    + ++ Y T      L         G ++I T    TEL  AGV 
Sbjct  233   DFVRKLYPPPPKIAQARAQQKYPTGASMRQLSISEVPQARGQTEIPTPPSMTELYRAGVK  292

Query  945   LKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLM  1124
              K V    ++F I+FN   L+IPK   +D +E    N++ +EQ  C +   Y  DY  ++
Sbjct  293   FK-VGSGKNMFDIQFNKGTLQIPKITFSDQSEVNLINLLVFEQSQCKETENYINDYIGIL  351

Query  1125  DNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGH  1304
             + L+N+ +DV+L   N +LVN LGD K+   +   +  GV     + F+++ +C KLN H
Sbjct  352   NILVNSPEDVSLLVKNAILVNKLGDSKKGCTMIKNMGDGVNIVDYNKFHFAPLCEKLNEH  411

Query  1305  YNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLR  1448
               K  +  +A L+ +YFNTP   IS IAA  ++  T+ QTV +V+ +R
Sbjct  412   CAKSRHKWLALLKQNYFNTPCKTISVIAAACIILFTLIQTVCSVISVR  459



>ref|XP_011091074.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
Length=432

 Score =   204 bits (519),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 143/433 (33%), Positives = 216/433 (50%), Gaps = 38/433 (9%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTN-TDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             + R +  L    S+  I++V   LR     D Y P ++SIGPYH+G  +L  M+ LK  Y
Sbjct  15    IHRHLDGLPSTPSKPSIYRVDSHLRNDKWNDVYDPEILSIGPYHYGILRLQNMQQLKFRY  74

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  +LKR  + S+E+    +   +++A   Y D  D+        + FV M+LLDG F+ 
Sbjct  75    LKRYLKRRNEQSVERYAIAVAAMEKRARKCYADSFDLD------ENAFVTMMLLDGFFLI  128

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L+R    +  ++           ++ +F    +  Q+  D+LLLENQLPFFVL +L  
Sbjct  129   E-LFRYSSFKHLRDA----------DDPIFRHERILSQLRHDILLLENQLPFFVLNQLFN  177

Query  636   MVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNG  815
             M   +  P   D   I  A       L+   V  +      ++  HL  +VH++      
Sbjct  178   MTKTDENP---DDDLIALALRFFDGMLLNLSVSRVLRRLPVKIIDHLCGLVHDV------  228

Query  816   GIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNH  995
                     W L F  ++ ++S + +    +I + + L+EAG+  K+     +L  IKF +
Sbjct  229   --------WCLSFAEAISQKSNE-RDKWENINSISGLREAGIKFKRAKIDDNLMDIKFVN  279

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               L IP+  I D TE+   N+IAYEQ+  D    Y +DY   M  LINT  DV L R  G
Sbjct  280   GVLRIPQLIIYDETESQLMNLIAYEQYLSDGERRYISDYIFFMHCLINTSNDVELLRSRG  339

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ N LGDD+EV  +FNRL + ++ SS   F YS V   +N H  +      A LR +YF
Sbjct  340   IIENCLGDDEEVCLMFNRLGRNILTSS--DFCYSQVFCSVNRHCRRRGKRWKANLRRNYF  397

Query  1356  NTPWAGISTIAAV  1394
             N+PW+ IS +AAV
Sbjct  398   NSPWSIISFLAAV  410



>ref|XP_010050754.1| PREDICTED: UPF0481 protein At3g47200-like [Eucalyptus grandis]
Length=429

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 151/450 (34%), Positives = 229/450 (51%), Gaps = 60/450 (13%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             S++R  + L  L S+ CIF V + LR+TN +AYTP +++IGPYH  N  L  ME+ KL+Y
Sbjct  19    SIRRRFEGL-SLPSDCCIFTVPKRLRQTNEEAYTPRVVAIGPYHRHNPSLMLMEDHKLLY  77

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  FL+ +    +E   +++K  +  A + +    D  + LDS  + F +M+LLDG F+ 
Sbjct  78    LRNFLRHDHNYRLEDYIQRVKSWEYDARNCF----DKPINLDS--NHFTEMILLDGIFVI  131

Query  456   EFL--YReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL  629
             + L  YR   +                 + +F    M   V RD+ LLENQ+PFF++Q L
Sbjct  132   QLLLMYRHPQKMLY--------------DQIFGNPWMLTDVRRDMTLLENQIPFFIIQRL  177

Query  630   HGMV---YDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
               M    + +  P+ L++V   F ++    RL+   +       A+E+K  +        
Sbjct  178   FEMALGTHQQDMPELLELVCQFFKTVTMVERLLDLAM-------ASEVKHFV--------  222

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
                        H  +L F  S+ K    S   +    +ATEL  AGV L++   S SLF 
Sbjct  223   -----------HAISLSFLTSVSKYLDKSNRETKFPPSATELVAAGVKLRR-SDSKSLFD  270

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQ--HSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             IKF + EL+IP   + D TE  FRNMIA+EQ  H  DK   Y  DY   M++L++T  D 
Sbjct  271   IKFQNGELKIPVLALNDRTEPLFRNMIAFEQCYHQKDK---YLIDYMTFMESLVDTPGDA  327

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
              L    G++ NWL + +    + N    G   S    FY++++ ++L  H ++P+N   A
Sbjct  328   KLLIDEGIIDNWLSNKESAVQIINSFGVGAKVSV--DFYFNNLSHELINHCHRPYNKWKA  385

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQT  1424
               + DY ++PW  IS IAAV LL LT+ QT
Sbjct  386   TFKRDYCSSPWVVISVIAAVLLLLLTVVQT  415



>ref|XP_008445188.1| PREDICTED: UPF0481 protein At3g47200-like [Cucumis melo]
Length=488

 Score =   205 bits (522),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 162/487 (33%), Positives = 238/487 (49%), Gaps = 47/487 (10%)
 Frame = +3

Query  33    QRQ*GMIENTEGDQQDLP---IYESLKRDIKNLKQLSSEAC-IFKVHEGLRRTNTDAYTP  200
             Q+   M+E +  DQQ L    +  S+++ +  +       C I++V + LR  N  AY P
Sbjct  20    QKSNNMVEISVVDQQQLVCDNVVISIEKMLDQVPPTHENQCSIYRVPKQLREMNPKAYAP  79

Query  201   LLISIGPYH-HGNAKLSKMENLKLMYLDLFLKR-EKQPSMEQC--WEKLKDSKEKAASYY  368
              LISIGP+H H +  L   E  KL     +L+R  K  S+EQ    + ++D  ++A S+ 
Sbjct  80    QLISIGPFHYHTHKNLIANEQYKLQGFINYLRRVYKMESLEQLVRTKSVEDLVKRAQSWV  139

Query  369   GDDEDIQLLLDSAGDK-FVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVF  545
              +  +      +  D+ F+KM+L+DGCFI EF      +  +  E  E    + +NN   
Sbjct  140   EEARNCYAETINMNDEDFIKMMLVDGCFIVEFF---ILDFEEYNESHESLFPQIENNV--  194

Query  546   MPTGMKFQVFR------DLLLLENQLPFFVLQELHGMV-YDESKPKFLDIVKITFASMLT  704
                 M F   R      DL+ LENQLPFFVLQ L  ++   +  P     +   + +M  
Sbjct  195   ---SMSFYKERIPDIDEDLIKLENQLPFFVLQHLFDLIPKHKDAPNCFKQLTYEYLTMGW  251

Query  705   KVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQD  884
                  P  + ++   +  +     L   H   + Q    +EE   W +  P S+      
Sbjct  252   LENYEPSDILSIKPKHFIDFLSFYLVPEHQYEHDQKSNDEEE---WNIIIPPSI------  302

Query  885   SKVGSSDIRTATELQEAGVNLKKVVKSSS-LFHIKFNHAELEIPKFHITDPTETFFRNMI  1061
                        TE+ EAGV +KK  K++  L +I+F +  LEIP  HI D  E   RN++
Sbjct  303   -----------TEICEAGVTIKKADKNTKCLLNIRFENGILEIPPLHIDDYFEPMMRNLL  351

Query  1062  AYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLG-DDKEVTDLFNRLCK  1238
             A+E    +  N Y   Y   MD LI TEKDVNL     +++N +G  D+EV+ LFN LCK
Sbjct  352   AFEHFPVEVKNTYVIPYLTFMDYLIITEKDVNLLVKEKIIINDIGGSDREVSQLFNNLCK  411

Query  1239  GVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIA  1418
              V  S  D  Y++D    L  H ++ WN   A L+H+YFNTPWA IS  AA FLL LTI 
Sbjct  412   FVSSSPNDN-YFNDTSKALRDHCDRRWNKAKASLKHNYFNTPWAAISVSAATFLLVLTIL  470

Query  1419  QTVIAVL  1439
             QT+ + +
Sbjct  471   QTIFSAI  477



>gb|KFK34276.1| hypothetical protein AALP_AA5G123900 [Arabis alpina]
Length=527

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 145/447 (32%), Positives = 229/447 (51%), Gaps = 44/447 (10%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M++ K   ++  LKR  Q +++  
Sbjct  101   CIYRVPYYLQENDNKSYFPQTVSLGPYHHGKKRLRSMDHHKWRAVNRVLKRTNQ-NIKMY  159

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +++ +EKA + Y     +        ++F++ML+LDGCF+ E L+R   E   +   
Sbjct  160   IDAMRELEEKARACYEGPFGLN------SNEFIEMLVLDGCFVLE-LFRGAVEGFTELGY  212

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL----------HGMVYDES  653
                      N+ VF   G    + RD+++LENQLP FVL  L           G+V  + 
Sbjct  213   -------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFVLHRLLELQLGTRNQTGLVA-QL  264

Query  654   KPKFLDIVKITFASMLT--KVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQE  827
               +F D +  T   M    + +L   +     D  A   + H L +       ++    E
Sbjct  265   AIRFFDPLMPTDEPMTKTDQSKLENSLAREAFDPFADMGELHCLDVFRRSL-LRSSPTPE  323

Query  828   ERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSLFHIKFNH  995
              R         S  K S++++V        I   TEL+EAG+  ++  ++   + I+F +
Sbjct  324   SR--------ISRKKWSRNTRVADKRRQQLIHCVTELREAGIKFRRR-RTDRFWDIQFKN  374

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               LEIP+  I D T++ F N+IA+EQ   D  N   T Y   MDNLI++ +DV+     G
Sbjct  375   GYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSRND-ITSYIIFMDNLIDSHEDVSYLHYCG  433

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ +WLG D EV DLFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   A L+H YF
Sbjct  434   IIEHWLGSDSEVADLFNRLCQEVVFDTEDS-YLSRLSMEVNRYYNQKWNAWRATLKHKYF  492

Query  1356  NTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             N PWA +S  AAV LL LT++Q+  A 
Sbjct  493   NNPWAIVSFFAAVILLVLTLSQSFFAA  519



>gb|KEH17301.1| DUF247 domain protein [Medicago truncatula]
Length=412

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 144/445 (32%), Positives = 222/445 (50%), Gaps = 73/445 (16%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQP---SM  314
             CI+KV   +R+ N DAYTP  +SIGP+HHG+ +L  ME  KL+Y   FL+R        +
Sbjct  26    CIYKVPSVIRKHNEDAYTPNFVSIGPFHHGHPQLKNMERHKLIYFKDFLQRTNASLSILI  85

Query  315   EQCWEKLKDSK---EKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydee  485
                +  L D K    +  S+  D+E             VK++L+D  FI +  ++ + ++
Sbjct  86    SDIYSILSDFKCCYSETLSFPQDEE------------LVKLILIDSGFIIQLFWKYFKKD  133

Query  486   tkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKF  665
                                F+   +   +  DLLLLENQLPFFV+++++G+ +  +   F
Sbjct  134   -------------------FLEPWLDAGIRSDLLLLENQLPFFVIEKIYGLSWSSTNGSF  174

Query  666   LDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK--GHLLQIVHNLCNPQNGGIQEERHY  839
             L++  I +     + +L+        DNN+  ++    L++I H L +P           
Sbjct  175   LELT-INYFQYFNQSKLV-------FDNNSQCIRHFTDLIRIFH-LQHP-----------  214

Query  840   WTLCFPCSLGKQSQDSKVGSSDIR--TATELQEAGVNLKKVVKSSSLFHIKFNHAELEIP  1013
                     +  Q    K+    I   +AT+L EAGV  +   KS  L  + F+   LEIP
Sbjct  215   --------IESQPSRDKIDEQIIHLPSATQLLEAGVRFQVKPKSECLLDLGFSEGVLEIP  266

Query  1014  KFHITDPTETFFRNMIAYEQHSCD-KNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNW  1190
             +  + D TE  FRNM+A EQ  C      Y TDY  ++D LINT KD ++     +L N 
Sbjct  267   RLEVEDGTEILFRNMVALEQ--CHYPYESYITDYVVVLDFLINTGKDADILVRKEILTNL  324

Query  1191  LGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
             LGD   V +LFNRLCK V++ +    ++S +C  LN   + PWN + A LR DY  TPW 
Sbjct  325   LGDSDSVANLFNRLCKNVIHHNISS-HFSILCKNLNAFCSNPWNRLKASLRRDYGKTPWQ  383

Query  1371  GISTIAAVFLLSLTIAQTVIAVLDL  1445
               +++A + LL LT+ Q+V +VL +
Sbjct  384   TAASVAGILLLVLTLLQSVCSVLQV  408



>ref|XP_006420587.1| hypothetical protein CICLE_v10005017mg [Citrus clementina]
 gb|ESR33827.1| hypothetical protein CICLE_v10005017mg [Citrus clementina]
Length=428

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 157/470 (33%), Positives = 239/470 (51%), Gaps = 54/470 (11%)
 Frame = +3

Query  51    IENTEGDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH  230
             + N   DQ  + I E L+        + S+  IF+V   LR    DAY P +++IGPYH 
Sbjct  1     MANEIADQLSIQIGEKLRDRFP----IWSDRSIFEVPAHLRNVYQDAYEPNILAIGPYHR  56

Query  231   GNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAG  410
             G ++L+ ME  K+ YL + L R  + ++ +    +    E+A   Y +   ++       
Sbjct  57    GKSRLNAMEEHKMSYLKVLLWRRGECNVTRYVTAMIALGERARKCYAESVSLK------Q  110

Query  411   DKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLL  590
             D+FV+M+LLD CFI E L+R+Y     +           D++ VF    +   + RDLLL
Sbjct  111   DQFVEMMLLDACFITE-LFRKYSMSNLRG----------DDDPVFNLRWIVKGLRRDLLL  159

Query  591   LENQLPFFVLQELHGM-VYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLG-----DNN  752
             +ENQLPFFVL E   M +    +  F  ++   F S L          P  G      + 
Sbjct  160   IENQLPFFVLHEFFAMTMMPNDREDFHGMIYAFFESAL----------PGAGYAHNSQHY  209

Query  753   ATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQE  932
               E+K HL++ +H    P    ++               K   D K     IR ATEL+E
Sbjct  210   PIEIK-HLVEFMHLNWQPSPSRMRNNN-----------SKVIADRKYREV-IRCATELEE  256

Query  933   AGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNM-YFTD  1109
             AG+   +  +  SLFH+KF +  ++ P+ +I D ++ F+RN+I YEQ S   + + Y TD
Sbjct  257   AGIKFMQA-EEESLFHVKFENGVMKFPRLNIDDESDPFWRNLIVYEQFSSKDDTLNYVTD  315

Query  1110  YAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCN  1289
             Y  L++ LI + KDV L   +G++ N +GDD+ + ++FN +   +V S     YYS +  
Sbjct  316   YMNLLECLIASRKDVELLCQHGIIKNCIGDDQVIANIFNTIGFFLVLSPES--YYSQLFY  373

Query  1290  KLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
              +N H ++ WN  MA LRH YFN PWA IS +AA+FLL L+  QT+  VL
Sbjct  374   DVNKHCSRRWNRWMANLRHTYFNNPWAFISFLAALFLLLLSFVQTLFTVL  423



>ref|XP_007203413.1| hypothetical protein PRUPE_ppa021442mg [Prunus persica]
 gb|EMJ04612.1| hypothetical protein PRUPE_ppa021442mg [Prunus persica]
Length=455

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 144/455 (32%), Positives = 227/455 (50%), Gaps = 50/455 (11%)
 Frame = +3

Query  96    SLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             ++++ I++   L  E CI+ V E  R+ N + Y P +++IGPYH  +A  +     K  Y
Sbjct  46    AIQQLIRSTPDLRPECCIYNVPERFRKGNEEFYKPRVVAIGPYHFKDASYAM---CKPKY  102

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             +D F +R K  +++ C   ++  + KA SYY   + I+L    + DKF  ++L+D  F+ 
Sbjct  103   VDAFFRRNKL-NLDHCLGLVRAWEAKARSYYV--KHIEL----SSDKFTFIMLMDATFVL  155

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E + R +    +           CD   +F    M   V+ D+LL+ENQLPFFVL+ L+ 
Sbjct  156   ELMLRHHFSRYRDN---------CD--PIFHKPRMIEDVYHDILLIENQLPFFVLEGLYE  204

Query  636   MVYDESKPKFLDIVKIT-----FASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLC  800
              +   S     D +  T     F     K+   P  V +     A +   H +  +    
Sbjct  205   QIGTNSLTPGDDHLSFTMLTHEFFKHFVKIDKFPAHVVS-----ANDQVNHFVDFI----  255

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
                       R Y+    P    +Q  ++ V      + T L EAGV  + +  S+SL +
Sbjct  256   ----------RRYYLAPPPPQEDQQKHNANVHEIP-PSVTALDEAGVKFETIKGSASLLN  304

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNL  1160
             I+F +  L+IP F + D TET FRN+IA+EQ  C     Y + +  LM  +I T KD +L
Sbjct  305   IEFKNGRLKIPNFIVDDWTETLFRNLIAFEQ--CHDTEKYISQFMFLMMCMIRTSKDADL  362

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
                +GV+ + LG  K+++ LFN + + V +   + F+Y  +C  LN + N P +   A L
Sbjct  363   LMDSGVISSMLGSSKDLSILFNHINRDVGFG--EPFHYFQICANLNAYCNTPRHRWKAIL  420

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             + DYFNTPW   STIAA+ LL LT  QT+ ++L L
Sbjct  421   KRDYFNTPWKLASTIAAIILLVLTFIQTICSILSL  455



>ref|XP_011091070.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
Length=432

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/433 (33%), Positives = 217/433 (50%), Gaps = 38/433 (9%)
 Frame = +3

Query  99    LKRDIKNLKQLSSEACIFKVHEGLRRTN-TDAYTPLLISIGPYHHGNAKLSKMENLKLMY  275
             + R +  L    S+  I++V   LR     D Y P ++SIGPYHHG  +L  M+ LK  Y
Sbjct  15    IHRQLDGLPSTPSKPTIYRVDSHLRSDKWNDVYDPEILSIGPYHHGILRLQNMQQLKFRY  74

Query  276   LDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIA  455
             L  +LKR  + S+E+    +   +++A   Y D  D+        + FV M+LLDG F+ 
Sbjct  75    LKRYLKRRNEQSVERYVLTVVHMEKRARKCYADSFDLD------ENAFVTMMLLDGFFLI  128

Query  456   EFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHG  635
             E L+R    +  ++           ++ +F    +  Q+  D+LLLENQLPFF+L +L  
Sbjct  129   E-LFRYSSFKHLRDA----------DDPIFRHERILSQLRHDILLLENQLPFFILNQLFN  177

Query  636   MVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNG  815
             M   +  P+  D+  IT A       L+   V  +      ++  HL  ++H++      
Sbjct  178   MTKTDENPE-EDL--ITLALRFFDGMLLNLSVSRVLTRLPVKIIDHLCGLIHDV------  228

Query  816   GIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNH  995
                     W L F  ++   S + +    ++ + + L+EAG+  K+    ++L  IKF +
Sbjct  229   --------WCLPFAEAISHTSNE-RDKWENVNSISGLREAGIKFKRAKVDNNLMDIKFVN  279

Query  996   AELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNG  1175
               L IP+  I D TE+   N+IAYEQ+  D    Y +DY   M  LINT  DV L R  G
Sbjct  280   GVLRIPQLIIYDETESQLMNLIAYEQYMSDGERRYVSDYTFFMHCLINTSNDVELLRSRG  339

Query  1176  VLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYF  1355
             ++ N LGDD+EV  +FNRL + ++ S+   F YS V   +N H  +      A LR +YF
Sbjct  340   IIENCLGDDEEVCLMFNRLGRNILTST--NFCYSQVFCSVNRHCQRRGKRWKANLRRNYF  397

Query  1356  NTPWAGISTIAAV  1394
             N+PW  IS +AAV
Sbjct  398   NSPWTIISFLAAV  410



>ref|XP_007224915.1| hypothetical protein PRUPE_ppa021930mg [Prunus persica]
 gb|EMJ26114.1| hypothetical protein PRUPE_ppa021930mg [Prunus persica]
Length=406

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 147/444 (33%), Positives = 216/444 (49%), Gaps = 70/444 (16%)
 Frame = +3

Query  141   ACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQ  320
              CI++V E LRR +  AYTP ++SIGP HHG   L  ME+ K  YL  +++R +  S+  
Sbjct  15    CCIYRVPERLRRVSEKAYTPQVVSIGPLHHGEEGLKAMEDHKKRYLQDYIRRTR-VSLAD  73

Query  321   CWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
               +K+KD + K  S Y   E IQ+    + D+FV+++L+D  FI E L R   +E +   
Sbjct  74    YVQKVKDQEAKLRSCYA--ETIQV----SSDEFVRIILVDAAFIIEVLLRYRFDELQD--  125

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                      + + +F    +   V+ D+ L ENQLPFF+L+EL    +D  K K      
Sbjct  126   ---------EIDRIFNKPWLLPDVWPDMRLFENQLPFFILEEL----FDPEKIK------  166

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNL-----------CNPQNGGIQE  827
                                +  NN    +  +L + HN             N +     +
Sbjct  167   -------------------VSSNNNNIERLSMLNLCHNFFKTLMHIEGTDGNMEKLCTSK  207

Query  828   ERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELE  1007
               H+   C      +   D K+ ++   + TEL  AGV  K V    +LF I+F +  LE
Sbjct  208   VEHFVDFC------RNLGDLKLLNTS--SITELHRAGVKFK-VGSPKNLFDIQFANGILE  258

Query  1008  IPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVN  1187
             IPK  I+D TE   RN++A+EQ  C +N  Y  +Y  ++D  +NT  DV L    G++ N
Sbjct  259   IPKLAISDETELTIRNLLAFEQCHCMEN--YINNYVVIVDRFVNTATDVELVVKQGIVEN  316

Query  1188  WLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPW  1367
              LGD    + L N L  GV+  S D FY++ +C  LN +    W+   A LR +Y NTPW
Sbjct  317   MLGDSSGGSTLINNLADGVIVDSND-FYFAILCADLNKYCRTSWHKWQANLRQNYCNTPW  375

Query  1368  AGISTIAAVFLLSLTIAQTVIAVL  1439
             A IS   A+FLL LT  Q V +V+
Sbjct  376   ATISIATAIFLLILTFIQAVCSVI  399



>gb|KDO79087.1| hypothetical protein CISIN_1g009939mg [Citrus sinensis]
Length=522

 Score =   205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 229/454 (50%), Gaps = 57/454 (13%)
 Frame = +3

Query  147   IFKVHEGLRRTNTD-AYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             I+KV + LR    D AY P ++S+GPYHHG  +L +M+  K   L   LKR  Q  ++  
Sbjct  94    IYKVPQHLREGGDDRAYVPQIVSLGPYHHGKKRLRQMDRHKWRSLHHVLKRNSQ-DIKIY  152

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +EKA + Y  +  I L    + + F +M++LDGCF+ E L+R   E   +   
Sbjct  153   LDSMKELEEKARACY--EGPISL----SSNDFAEMMVLDGCFVLE-LFRGASEGFTRLGY  205

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+++LENQLP F+L  L G+ + + + K L + K+
Sbjct  206   PR-------NDPVFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQFGKPEQKGL-VAKL  257

Query  684   TFASMLTKVRLIPPIVPN-----LGDNNATEMK---GHLLQIVHNLCNP-----------  806
                     +R   P++P       G+ N  E      +    + + C             
Sbjct  258   A-------LRFFDPLMPTDEPLTKGERNKLESSLGNANFFDPLSDQCGLHCLDVFRKSLL  310

Query  807   QNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSL  974
             ++G   E    W       + + SQ ++V        I   TEL+EAGV  +K  K+   
Sbjct  311   RSGPKPEPPKIW-------IKRWSQTNRVADKRRQQLIHCVTELREAGVKFRKR-KTDRF  362

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             + IKF +  L IP+  + D T++ F N+IA+EQ   D +N   T +   MDNLIN+ +DV
Sbjct  363   WDIKFKNGILSIPRLFVHDGTKSLFLNLIAFEQCHFDCSND-ITSFVIFMDNLINSPEDV  421

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
                   G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +YN  WN   A
Sbjct  422   GYLHYCGIIEHWLGSDAEVADLFNRLCEEVVFDINDS-YLSRLSEDVNQYYNHKWNAWRA  480

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              LRH YFN PWA IS +AAV LL LT AQT   V
Sbjct  481   SLRHKYFNNPWAIISLVAAVVLLLLTFAQTFYGV  514



>ref|XP_006442795.1| hypothetical protein CICLE_v10020219mg [Citrus clementina]
 ref|XP_006442796.1| hypothetical protein CICLE_v10020219mg [Citrus clementina]
 gb|ESR56035.1| hypothetical protein CICLE_v10020219mg [Citrus clementina]
 gb|ESR56036.1| hypothetical protein CICLE_v10020219mg [Citrus clementina]
Length=433

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 235/463 (51%), Gaps = 58/463 (13%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG-NAKLSKMENLKL  269
             ++L+   ++L +L  + CI++V + +R  N  A+TP L+SIGP+HHG N +L   E +K+
Sbjct  17    DTLRGKFRSLHRLPQKCCIYRVPQQIRGLNPKAHTPQLVSIGPFHHGDNEELRATEEIKI  76

Query  270   MYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
              YL+ FL+R  + S+E     +K+ +E+    Y   E I+L      + F+ M+L+D  F
Sbjct  77    RYLEYFLQR-TEVSIETFLAYVKNKEEQLRDCYA--ETIRL----ENEDFITMVLVDAVF  129

Query  450   IAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL  629
             + EFL R                     + +F  + +   ++ D+ LLENQLP F+L +L
Sbjct  130   LIEFLLRYSFPNLVST-----------GDPIFTKSRLISNMWLDIWLLENQLPLFILDDL  178

Query  630   HGMVYDESKPKFLDIVKITFASMLTKVRLI-------PPIVPNLGDNNATEMKGHLLQIV  788
               +          + V     S+L+  R         P +  NL + +  + + H L ++
Sbjct  179   FNLAKTAVNHDSYNGV-----SLLSLTRRFYKDNYEFPLMEANLFETHFKQAQ-HFLDLL  232

Query  789   HNLCNPQNGGIQEERHYWTLCF--PCSLGKQSQDS-KVGSSDIRTATELQEAGVNLKKVV  959
                                LCF  P     ++Q+  +  + +I TAT+L +AGV  + + 
Sbjct  233   R------------------LCFQPPQPRSCRAQNKLRTETQNIPTATQLHQAGVKFQ-LG  273

Query  960   KSSSLFHIKFN-HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLI  1136
              S++LF I FN    LEIP   I++ TE  FRN+ A+E+  C     Y  DY  +M+ L+
Sbjct  274   SSTNLFDITFNVEGILEIPLLRISESTEILFRNLQAFERLHCGTR--YINDYVIIMNYLV  331

Query  1137  NTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKP  1316
             NT  DV+L   N V+ NWL + + V++LF+ L +    S+   F Y+D+   L  +    
Sbjct  332   NTAHDVDLLVQNRVIENWLWNSEAVSNLFHNLVQETSLSA-KNFQYTDLVEDLRAYCRYR  390

Query  1317  WNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             W+   A LR DYFN+PWA IS IAAV LL LT+ Q + +++ L
Sbjct  391   WHRWKAMLRQDYFNSPWASISVIAAVILLLLTLIQAICSIIAL  433



>ref|XP_006478644.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis]
Length=433

 Score =   202 bits (515),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 235/463 (51%), Gaps = 58/463 (13%)
 Frame = +3

Query  93    ESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG-NAKLSKMENLKL  269
             ++L+   ++L +L  + CI++V + +R  N  A+TP L+SIGP+HHG N +L   E +K+
Sbjct  17    DTLRGKFRSLHRLPQKCCIYRVPQQIRGLNPKAHTPQLVSIGPFHHGDNEELRATEEIKI  76

Query  270   MYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
              YL+ FL+R  + S+E     +K+ +E+    Y   E I+L      + F+ M+L+D  F
Sbjct  77    RYLEYFLQR-TEVSIETFLAYVKNKEEQLRDCYA--ETIRL----ENEDFITMVLVDAVF  129

Query  450   IAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL  629
             + EFL R                     + +F  + +   ++ D+ LLENQLP F+L +L
Sbjct  130   LIEFLLRYSFPNLVST-----------GDPIFTKSRLISNMWLDIWLLENQLPLFILDDL  178

Query  630   HGMVYDESKPKFLDIVKITFASMLTKVRLI-------PPIVPNLGDNNATEMKGHLLQIV  788
               +          + V     S+L+  R         P +  NL + +  + + H L ++
Sbjct  179   FNLAKTAVNHDSYNGV-----SLLSLTRRFYKDNYEFPLMEANLFETHFKQAQ-HFLDLL  232

Query  789   HNLCNPQNGGIQEERHYWTLCF--PCSLGKQSQDS-KVGSSDIRTATELQEAGVNLKKVV  959
                                LCF  P     ++Q+  +  + +I TAT+L +AGV  + + 
Sbjct  233   R------------------LCFQPPQPRSCRAQNKLRTETQNIPTATQLHQAGVKFQ-LG  273

Query  960   KSSSLFHIKFN-HAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLI  1136
              S++LF I FN    LEIP   I++ TE  FRN+ A+E+  C     Y  DY  +M+ L+
Sbjct  274   SSTNLFDITFNVEGILEIPLLRISESTEILFRNLQAFERLHC--GTRYINDYVIIMNYLV  331

Query  1137  NTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKP  1316
             NT  DV+L   N V+ NWL + + V++LF+ L +    S+   F Y+D+   L  +    
Sbjct  332   NTAHDVDLLVQNRVIENWLWNSEAVSNLFHNLVQETSLSA-KNFQYTDLVEDLRAYCRYR  390

Query  1317  WNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             W+   A LR DYFN+PWA IS IAAV LL LT+ Q + +++ L
Sbjct  391   WHRWKAMLRQDYFNSPWASISVIAAVILLLLTLIQAICSIIAL  433



>ref|XP_008394044.1| PREDICTED: UPF0481 protein At3g47200-like isoform X2 [Malus domestica]
Length=445

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 151/454 (33%), Positives = 221/454 (49%), Gaps = 49/454 (11%)
 Frame = +3

Query  90    YESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKL  269
             Y+ L+ ++ +L  LS   CI++V E LR+ N  AYTP ++SIGP HHG   L  ME  K 
Sbjct  38    YDPLQEEL-DLLTLSPYLCIYRVPERLRQGNEKAYTPQVVSIGPLHHGEEHLKGMEEHKK  96

Query  270   MYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCF  449
              YL  FL R +  S   C + +K  + K    Y   E I+L      D+FV+++LLD  F
Sbjct  97    RYLLDFLSRTRV-SFYDCIKMIKIQEGKLRGCYA--EPIEL----GSDEFVRIVLLDAAF  149

Query  450   IAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQEL  629
             + EFL R Y      +           ++ V  P  M + V  D LLLENQLPFF+LQ L
Sbjct  150   VIEFLLRYYSVNFLGQA----------DDTVTKPM-MMWDVRPDFLLLENQLPFFILQVL  198

Query  630   HGMVYDES--KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN  803
                ++  +  +P  L+I   +    +   R               +    L++I++    
Sbjct  199   FNTLFSSADQQPSLLEISYFSLQREIDSKRKEEIFGEICSSGEEVQHFVDLIRILYRPLK  258

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
              + GG                       ++  + +   TEL +AGV  K V K SSLF I
Sbjct  259   SKTGG-----------------------ELKGTAVPNVTELVQAGVEFK-VGKGSSLFDI  294

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
              F+   L+IPK  + D T+   +N++A+E     + N Y T+Y  LM  L  T KDV L 
Sbjct  295   NFSCGTLKIPKLTVCDTTDLKLKNLLAFELCRHRETN-YLTNYVFLMKRLAKTPKDVELL  353

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
                G++ NWLGD K+++ L      GVV    + +YY+ +C  LN +     +  M  LR
Sbjct  354   VEYGIIDNWLGDAKKISTLLLDFDTGVV---GNDYYYASLCKDLNDYCRSRRHKWMTNLR  410

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              +YFNTPW  IS +AAV LL LT  QTV +++ +
Sbjct  411   RNYFNTPWRIISIVAAVILLILTSIQTVCSIISI  444



>ref|XP_004501993.1| PREDICTED: UPF0481 protein At3g47200-like [Cicer arietinum]
Length=450

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 157/479 (33%), Positives = 233/479 (49%), Gaps = 40/479 (8%)
 Frame = +3

Query  27    ELQRQ*GMIENTEGDQQDLPI-YESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPL  203
             ELQ Q G I+    + +DL I  E++ + I+    L S  CI+KV + LR+ N  AYTP 
Sbjct  5     ELQ-QNGFIQRENEENRDLIIRMETMLQSIE--LPLVSNCCIYKVPQKLRKLNEQAYTPA  61

Query  204   LISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDED  383
             ++SIGP+H+G+ +L  ME+LKL YL  FL+R  Q  +      +K S+E     Y +   
Sbjct  62    IVSIGPFHYGDKRLVSMEDLKLKYLKSFLER-TQKGLGDLIGYIKKSEEIIRCCYSET--  118

Query  384   IQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMK  563
                 ++  GD FVK++L D CFI E+  R  +                  + +     ++
Sbjct  119   ----IEQTGDDFVKIILTDACFIIEYFIRSLEWP--------------QEDPLLAKPWLR  160

Query  564   FQVFRDLLLLENQLPFFVLQELHGMVYDESK-PKFLDIVKITFASMLTKVRLIPPIVPNL  740
               V  DL+LLENQLP+FVL++L  +    S+   F D+    F     +V  +  I+PN 
Sbjct  161   CDVKLDLILLENQLPWFVLEDLFNLTEPSSEVSSFFDVAFHYF-----RVHFLHSILPNE  215

Query  741   GDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIR---  911
              +N+   +          +  P    +Q   H  T           +  K G   ++   
Sbjct  216   ANNSNFTLHYFHKHYQQYIMKPDQVSMQ--LHNLTDLLRVFYLPPDRLPKRGKQTVKHLY  273

Query  912   TATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKN  1091
             +A+ L EAGV L       S+  ++F    L IP+F +   TET  RN+IA+EQ  C   
Sbjct  274   SASRLVEAGVKLHVGQGYQSVLDLQFAKGVLTIPRFEVCHWTETLIRNVIAFEQ--CHYP  331

Query  1092  -NMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGF  1268
                Y TDY  L+D LI+T +DV+     G++ N LGD   V  + N LC  VV  +    
Sbjct  332   FQTYITDYIILLDFLIDTTQDVDTLVDEGIMTNTLGDSNAVAKMINNLCLNVVQENVSSS  391

Query  1269  YYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             Y S +C KLN  Y  P++   A   HDY +TPW   S  AA+ LL LT+ Q + +V+ L
Sbjct  392   YVS-LCTKLNRFYENPFHKYKAVFMHDYLSTPWKITSFAAAILLLLLTLVQAICSVISL  449



>ref|XP_006425970.1| hypothetical protein CICLE_v10025336mg [Citrus clementina]
 gb|ESR39210.1| hypothetical protein CICLE_v10025336mg [Citrus clementina]
Length=533

 Score =   205 bits (521),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 229/454 (50%), Gaps = 57/454 (13%)
 Frame = +3

Query  147   IFKVHEGLRRTNTD-AYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             I+KV + LR    D AY P ++S+GPYHHG  +L +M+  K   L   LKR  Q  ++  
Sbjct  105   IYKVPQHLREGGDDRAYVPQIVSLGPYHHGKKRLRQMDRHKWRSLHHVLKRNSQ-DIKIY  163

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +K+ +EKA + Y  +  I L    + + F +M++LDGCF+ E L+R   E   +   
Sbjct  164   LDSMKELEEKARACY--EGPISL----SSNDFAEMMVLDGCFVLE-LFRGASEGFTRLGY  216

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+++LENQLP F+L  L G+ + + + K L + K+
Sbjct  217   PR-------NDPVFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQFGKPEQKGL-VAKL  268

Query  684   TFASMLTKVRLIPPIVPN-----LGDNNATEMK---GHLLQIVHNLCNP-----------  806
                     +R   P++P       G+ N  E      +    + + C             
Sbjct  269   A-------LRFFDPLMPTDEPLTKGERNKLESSLGNANFFDPLSDQCGLHCLDVFRKSLL  321

Query  807   QNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSSL  974
             ++G   E    W       + + SQ ++V        I   TEL+EAGV  +K  K+   
Sbjct  322   RSGPKPEPPKIW-------IKRWSQTNRVADKRRQQLIHCVTELREAGVKFRKR-KTDRF  373

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             + IKF +  L IP+  + D T++ F N+IA+EQ   D +N   T +   MDNLIN+ +DV
Sbjct  374   WDIKFKNGILSIPRLFVHDGTKSLFLNLIAFEQCHFDCSND-ITSFVIFMDNLINSPEDV  432

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
                   G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +YN  WN   A
Sbjct  433   GYLHYCGIIEHWLGSDAEVADLFNRLCEEVVFDINDS-YLSRLSEDVNQYYNHKWNAWRA  491

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
              LRH YFN PWA IS +AAV LL LT AQT   V
Sbjct  492   SLRHKYFNNPWAIISLVAAVVLLLLTFAQTFYGV  525



>ref|XP_006494486.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis]
Length=533

 Score =   204 bits (520),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 158/459 (34%), Positives = 234/459 (51%), Gaps = 59/459 (13%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTD-AYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             ++  I+KV + LR    D AY P ++S+GPYHHG  +L +M+  K   L   LKR  Q  
Sbjct  101   AKLSIYKVPQHLREGGDDRAYVPQIVSLGPYHHGKKRLRQMDRHKWRSLHHVLKRNSQ-D  159

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             ++   + +K+ +EKA + Y  +  I L    + + F +M++LDGCF+ E L+R   E   
Sbjct  160   IKIYLDSMKELEEKARACY--EGPISL----SSNDFAEMMVLDGCFVLE-LFRGASEGFT  212

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
             +            N+ VF   G    + RD+++LENQLP F+L  L G+ + + + K L 
Sbjct  213   RLGYPR-------NDPVFAMRGSMHSIQRDMIMLENQLPLFILDRLLGLQFGKPEQKGL-  264

Query  672   IVKITFASMLTKVRLIPPIVP---------------NLGDNNA----TEMKG-HLLQIVH  791
             + K+        +R   P++P               +LG+ N     ++  G H L +  
Sbjct  265   VAKLA-------LRFFDPLMPTDEPLTKGERNKLESSLGNANTFDPLSDQGGLHCLDVFR  317

Query  792   NLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVV  959
                  ++G   E    W       + + SQ ++V        I   TEL+EAGV  +K  
Sbjct  318   KSL-LRSGPKPEPPKIW-------IKRWSQTNRVADKRRQQLIHCVTELREAGVKFRKR-  368

Query  960   KSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLIN  1139
             K+   + IKF +  L IP+  + D T++ F N+IA+EQ   D +N   T +   MDNLIN
Sbjct  369   KTDRFWDIKFKNGILSIPRLFVHDGTKSLFLNLIAFEQCHFDCSND-ITSFVIFMDNLIN  427

Query  1140  TEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPW  1319
             + +DV      G++ +WLG D EV DLFNRLC+ VV+   D  Y S +   +N +YN  W
Sbjct  428   SPEDVGYLHYCGIIEHWLGSDAEVADLFNRLCEEVVFDINDS-YLSRLSEDVNQYYNHKW  486

Query  1320  NVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             N   A LRH YFN PWA IS +AAV LL LT AQT   V
Sbjct  487   NAWRASLRHKYFNNPWAIISLVAAVVLLLLTFAQTFYGV  525



>ref|XP_009395231.1| PREDICTED: UPF0481 protein At3g47200-like [Musa acuminata subsp. 
malaccensis]
Length=697

 Score =   207 bits (528),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 151/480 (31%), Positives = 233/480 (49%), Gaps = 63/480 (13%)
 Frame = +3

Query  93    ESLKRDIKNLKQ---LSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENL  263
             ++L+R ++  K     + +A IFKV   L+     AY P ++S+GPYHHG ++L  ME L
Sbjct  243   DTLRRKVEEAKWDQWRTEQARIFKVPGVLQEAEPRAYKPRIVSLGPYHHGKSELQPMEEL  302

Query  264   KLMYLDLFLKREKQPSMEQCWEKLKDSKEKAAS-YYGD----DEDIQLLLDSAGDKFVKM  428
             K  YL  F++R+ Q  +E    + ++   ++   Y+GD    +E   ++ D   +KFV+M
Sbjct  303   KWNYLRRFVRRQPQKKLEDYLNETRELVNRSRRFYFGDKVNPNESSMIMSD---NKFVEM  359

Query  429   LLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLP  608
             +LLDG F+ E +             + ++++K   NA+         V +D+LLLENQLP
Sbjct  360   MLLDGSFVIEIM---------ISWVKGVSERKVGQNAIKNTIWSPLAVAQDMLLLENQLP  410

Query  609   FFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG--HLLQ  782
             FF+L  LH   + E      ++ +  F  M             + DN      G  H+L 
Sbjct  411   FFLLDCLHDTAFPEDAGGLTELTQ-EFLRMFIMF---------MNDNERVPRHGFHHILH  460

Query  783   IVHNLC-----NPQNGGIQEERHYWTLCFPCSLGKQSQ---------DSKVGSSD-----  905
             + H  C      P N   Q     W+L F    G Q +         D+ V         
Sbjct  461   LCH-FCIVAAKKPYNSKTQPS---WSLMFE---GMQKERMNMLSFFRDNPVPVEQPASMI  513

Query  906   --IRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHS  1079
               I +AT+L+ AG+  K   ++ S   I F + +LEIP+  + D T   F+N+IA+EQ S
Sbjct  514   PWIPSATQLKVAGIQFKMKTRAKSFLDITFQNGKLEIPQLVVDDQTNVLFKNLIAFEQCS  573

Query  1080  CDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSC  1259
              D    +   YA LMD++INT  DV L + + +++N  GD+ EV + FN+LCK V+    
Sbjct  574   QDAGT-HLAAYASLMDSIINTAADVELLQKDQIIINTSGDNTEVANFFNKLCKDVLIKDE  632

Query  1260  DGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             D  Y + +   +N H    +++    L  DYF  PW  I   AA+F   LTI QTV  VL
Sbjct  633   D--YLTSIYRDVNKHRGIKYHIWWRTLHRDYFKNPWTIIWLCAAIFAFILTITQTVYTVL  690


 Score = 84.3 bits (207),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 99/198 (50%), Gaps = 32/198 (16%)
 Frame = +3

Query  57   NTEGDQQDLPIYE----SLKRDIKNLKQ---LSSEACIFKVHEGLRRTNTDAYTPLLISI  215
            +T G+Q ++ I      SLK  +K  +Q    + +  IF+V   LR     AY P ++S+
Sbjct  18   STAGEQIEITIDRRWVVSLKDKLKVTEQPAWRTEQPTIFRVLPHLRGIEPKAYEPTIVSL  77

Query  216  GPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLL  395
            GP+HH  + L  M++LK  YL  FL R  +  +E   + +K+++ +A   Y ++      
Sbjct  78   GPFHHHKSHLKAMDHLKYKYLSKFLGRNPEKPLEDYLKLIKENERQARMAYSEE------  131

Query  396  LDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVF  575
            ++ + D FV+M+LLD CF+ E +  E                  +  A      +   + 
Sbjct  132  VEMSSDDFVQMMLLDCCFVIETILPEE-----------------EGQATIW--SLSPVLV  172

Query  576  RDLLLLENQLPFFVLQEL  629
            RD+L+LENQLPF +LQ L
Sbjct  173  RDMLILENQLPFCILQPL  190



>ref|XP_003618477.1| hypothetical protein MTR_6g011060 [Medicago truncatula]
 gb|AES74695.1| DUF247 domain protein [Medicago truncatula]
Length=425

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 218/454 (48%), Gaps = 70/454 (15%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             + + CI+KV   +R+ N DAYTP ++SIGP+HHG+ +L  ME  KL++   FL+R     
Sbjct  22    TGDCCIYKVPSKIRKLNADAYTPTVVSIGPFHHGHPQLQNMEPQKLIHFKAFLQRT----  77

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
              E C   L    +   S +         L  + D+ VK++L+D  FI E   R       
Sbjct  78    -EACLNDLVCYVDSILSNF--KRCYSETLPFSHDELVKLILIDSGFIIELFLR-------  127

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRD------LLLLENQLPFFVLQELHGMVYDES  653
                              +   G  F+++ D      L+LLENQLPFFV+++++ + +  +
Sbjct  128   -----------------YHYGGFVFELWFDDGITTNLMLLENQLPFFVIEKIYSLSFSST  170

Query  654   K--------PKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK--GHLLQIVHNLCN  803
                      P FL++  I F     K  L         D+    ++    L++I H L +
Sbjct  171   NASNPNTMIPCFLELT-INFFFSFNKSNL-------FFDDGDISIRHFTDLIRIFH-LQH  221

Query  804   PQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
             P      E R       P  +  +  +       + +ATEL EAGV  K   KS  L  +
Sbjct  222   PF-----ENR-------PGRIDIKDINIGEWMLHLPSATELLEAGVKFKVNTKSKCLLDL  269

Query  984   KFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLF  1163
             +F+   LEIP   + D TE  FRNM+A EQ     N +Y TDY  ++D LINT KDV++ 
Sbjct  270   RFSGEVLEIPSLIVEDRTEALFRNMVALEQFHY-TNKLYITDYVSVLDYLINTGKDVDIL  328

Query  1164  RMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLR  1343
                 +L NWLGD   V +LFN LC  VV+++     +S +C  LN     PW+ + A LR
Sbjct  329   VHKEILENWLGDSDSVANLFNGLCINVVHTNISS-QFSILCKDLNAFCRNPWHKLKATLR  387

Query  1344  HDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              DY  TPW   ++ A + LL LT  Q+V +VL +
Sbjct  388   RDYGKTPWQAAASFAGIVLLVLTFIQSVCSVLQV  421



>ref|XP_010927499.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010927500.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Elaeis 
guineensis]
Length=508

 Score =   204 bits (519),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 154/471 (33%), Positives = 231/471 (49%), Gaps = 51/471 (11%)
 Frame = +3

Query  78    DLPIYESLKRDIKNLKQLS-----SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAK  242
             D P   S++  +   +QL      ++  I++V + LR  +  AY P L+SIGPYH    +
Sbjct  63    DSPWVISIRDKLNQARQLECLSPWAKLSIYRVPKSLREGDEKAYIPHLVSIGPYHRDRRR  122

Query  243   LSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFV  422
             L  ME+ K   L   LKR     +      +K  +E+A S Y  +  I L    + + FV
Sbjct  123   LRDMEHHKWRALHHVLKRTGH-DVHLYLHAVKSLEERARSCY--EGHIHL----SSNDFV  175

Query  423   KMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQ  602
             + L+LDG F+ E L+R    E  +          CD   VF   G    + RD+++LENQ
Sbjct  176   ESLVLDGIFMLE-LFRGAVGEGFRTLGYSH----CD--PVFAIRGTMHSIQRDMIMLENQ  228

Query  603   LPFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKG----  770
             +P FVL  L  +     +     + ++        ++ + P++PN    N T+       
Sbjct  229   IPLFVLDRLLALQLRLPEQTSGLVARLA-------IQFLDPLMPNDHQLNKTDAAAFDPL  281

Query  771   -----HLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATE  923
                  H L +     N    G +     W       L + S   +V        +   TE
Sbjct  282   AEGGLHCLDVFRR--NLLRTGPRPVPRVW-------LRRWSHRGRVCDRRRQQLVHCVTE  332

Query  924   LQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYF  1103
             L++AG+  +K  K+   + I+F +  L+IP+  I D T++ F N+IA+EQ   D +N   
Sbjct  333   LRDAGIKFRKR-KTDRFWDIEFTNGVLKIPRLLIHDGTKSLFLNLIAFEQCHMDCSND-I  390

Query  1104  TDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDV  1283
             T Y   MDNLIN+E+DV      G++ +WLG+D EV DLFN+LC+ VV+   D  Y S +
Sbjct  391   TSYVIFMDNLINSEEDVRYLHYRGIIEHWLGNDDEVADLFNKLCQEVVFDINDS-YLSRL  449

Query  1284  CNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               +LN +YN  WN   A L+H YF+ PWA IS IAAV LL LT+AQT  +V
Sbjct  450   SQQLNRYYNHKWNSWRASLKHKYFSNPWAIISLIAAVVLLVLTLAQTFYSV  500



>ref|XP_011069330.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
 ref|XP_011069331.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
 ref|XP_011069332.1| PREDICTED: UPF0481 protein At3g47200-like [Sesamum indicum]
Length=437

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/414 (33%), Positives = 209/414 (50%), Gaps = 41/414 (10%)
 Frame = +3

Query  147   IFKVHEGLRRTNTDA-YTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             IFKV + LR    D  Y P ++SIGPYHHG + L  M+  K  YL   L R K  S+E+ 
Sbjct  29    IFKVDDHLRIPGRDNDYDPEILSIGPYHHGKSGLQNMDQHKCWYLKQLLSR-KNESVERY  87

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
                +   +E+A   Y +  D+ +      ++F+KM++LDGCF+ E L             
Sbjct  88    VIAVAAMEERARRCYAEPVDLDV------NEFIKMMVLDGCFLIELL-----------RY  130

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMV-YDESKPKFLDIVK  680
               L   +  N+ +F    +  Q+  D++LLENQLPFFVL +L  M   ++S+   + +  
Sbjct  131   HSLKDLRVANDPIFKNERILSQLRHDIMLLENQLPFFVLNQLFNMTKIEDSRDDIIGLTL  190

Query  681   ITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCN-PQNGGIQEERHYWTLCFP  857
                  M   +      V  +     T+   HL  ++H +C  P  G I  +      C  
Sbjct  191   CFIDGMFLNIS-----VSKVYQKLPTQNIDHLCSLIHEICCLPFAGTILHKNFGSNAC--  243

Query  858   CSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITDPT  1037
                  Q+ +S      I + + LQE G+  +K   +S    + F +  L IP  +I D T
Sbjct  244   -----QNWES------ILSVSGLQEVGIRFQKAEGTSGFMDMTFVNGVLRIPPLNIFDET  292

Query  1038  ETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTD  1217
             E+ FRN+IAYEQ+  D    Y +DY   M+ LINT +DV L R  G++ NWLGDDKE+ +
Sbjct  293   ESQFRNLIAYEQYLPDCEARYVSDYTFFMNCLINTPEDVRLLRNYGIIGNWLGDDKEICE  352

Query  1218  LFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGIS  1379
             +FNRL K ++ S+   F YS + N +N  + +  N  +  LR +YF +PW+ IS
Sbjct  353   MFNRLGKNILTST--KFSYSHIFNAVNWEFQRRSNSWITNLRRNYFGSPWSVIS  404



>ref|XP_006430221.1| hypothetical protein CICLE_v10013891mg, partial [Citrus clementina]
 gb|ESR43461.1| hypothetical protein CICLE_v10013891mg, partial [Citrus clementina]
Length=439

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 233/482 (48%), Gaps = 68/482 (14%)
 Frame = +3

Query  57    NTEGDQQDLPIYESLKR------DIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIG  218
             + E +  +L  + S+K       DI+   +  +E CI++V +GLR+ N +AYTP +ISIG
Sbjct  1     DMEMENNNLITFASIKERKELILDIEEFLEPQAECCIYRVPKGLRKVNEEAYTPQVISIG  60

Query  219   PYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLL  398
             P HHG A+LS ME  K+ Y+  F KR  + + ++    +++++++  + Y +    + + 
Sbjct  61    PLHHGKAELSDMEKQKIRYVREFSKRITEKTWQEFINFIEENEQRIRNCYAEMPKFEKM-  119

Query  399   DSAGDKFVKMLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFR  578
                  + + M+L D  FI E+  R  +                 ++ +     ++  + R
Sbjct  120   -----ELITMILYDAVFIIEYFLRGRNHTGF------------KSDFLLNNRRVRGSIRR  162

Query  579   DLLLLENQLPFFVLQELHGMVYD-----ESKPKFLDI-VKITFASMLTKVRLIPPIVPNL  740
             DL LLENQLP+FVL+ L+ + +D     +  P    +     + SM     L+P  V  +
Sbjct  163   DLQLLENQLPYFVLKGLYKLAFDSRPNQKGNPSLFSLSCGFFYDSMFNG--LMPKEVEVI  220

Query  741   GDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTAT  920
                + T+++ +++   H             R++     P   G           DI    
Sbjct  221   --EHFTDLRRYVITKTH-------------RYHAIAKAPKLRG--------AKKDIHCVV  257

Query  921   ELQEAGVNLKKVVKSSSLFHIKFNH----------AELEIPKFHITDPTETFFRNMIAYE  1070
             +L E+GV  +    +  L  I+F            +EL+IP+  I D TE   RN++A E
Sbjct  258   KLHESGVIFRHFKDAECLIDIRFKKPKLPQIILASSELQIPRIGIYDGTECLIRNVMALE  317

Query  1071  QHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVY  1250
             Q    +  +   +Y  LMD LI+TE DVNL    G++ N +GD  ++  +FN+LC+ + Y
Sbjct  318   QCHYPQETV-MCNYISLMDRLIDTEGDVNLLVEAGIISNGVGDTAKIAKMFNQLCQHISY  376

Query  1251  SSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVI  1430
             SS   +Y  D+   L  HYN PWN   A L+  YF   W G  TIAAV LL LT+ QT+ 
Sbjct  377   SSASCYY--DIFMNLQAHYNDPWNHAKATLKRVYFTNLWTGTGTIAAVVLLVLTLIQTIC  434

Query  1431  AV  1436
             ++
Sbjct  435   SI  436



>ref|XP_002298611.2| hypothetical protein POPTR_0001s34060g [Populus trichocarpa]
 gb|EEE83416.2| hypothetical protein POPTR_0001s34060g [Populus trichocarpa]
Length=436

 Score =   202 bits (514),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 146/438 (33%), Positives = 222/438 (51%), Gaps = 50/438 (11%)
 Frame = +3

Query  129   LSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLD-LFLKREKQ  305
             +S +ACIFKV + LRR +  AYTP   SIGP+H  +  +   E +KL YL  L  +R   
Sbjct  47    MSDKACIFKVPDILRRHSEKAYTPNAFSIGPWHRHHRLMKYTEKVKLKYLKGLLCRRSAS  106

Query  306   PSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydee  485
              +++   +  +  +++A S Y    D+ +      + FV+ML++DGCF+ E   ++ D  
Sbjct  107   ITLKGLIKSTRVIEKEARSCYAGPIDVGV------EDFVRMLVIDGCFLIELFRKDQDNH  160

Query  486   tkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKF  665
              ++           D++ +F  + M   ++ DL+L+ENQ+P+ VL+ L  M  +      
Sbjct  161   LRE-----------DDDPIFNMSCMLQYLYHDLILVENQIPWLVLEHLFKMTAEPGNTTT  209

Query  666   LDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWT  845
             L  + + F   +      P IVP      +     HLL ++ N               W 
Sbjct  210   LAQLALPFFQNIFSSN-PPSIVP------SNRGPKHLLDLLRN---------------WL  247

Query  846   LCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHI  1025
             +    S GK  +D + G   I + T L +AG+ LK V KSSS+  IKF +  LEIP   I
Sbjct  248   VL---SSGKD-EDGETGWEPIPSVTNLVDAGIKLK-VGKSSSILDIKFQNGVLEIPPLLI  302

Query  1026  TDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDK  1205
              + TE   RN+I+YEQ S  K     T YA L+DNLINT KD++ F  +G++ NWL  D 
Sbjct  303   QETTEVIIRNLISYEQCS-PKCTDRITSYAVLLDNLINTTKDMDTFTSSGIIDNWLNPD-  360

Query  1206  EVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAGISTI  1385
             E T  FN+L +         +YY  +C  +N +Y + +    A L  +YF TPWA +S  
Sbjct  361   EATQFFNKLYQDAYLKK---YYYLQLCQDVNKYYRRRFPRWRALLMSNYFGTPWAIVSIF  417

Query  1386  AAVFLLSLTIAQTVIAVL  1439
             AA  LL LTI QT+  ++
Sbjct  418   AAATLLILTIVQTIFTIV  435



>ref|XP_008800520.1| PREDICTED: UPF0481 protein At3g47200-like [Phoenix dactylifera]
Length=488

 Score =   203 bits (517),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 229/454 (50%), Gaps = 50/454 (11%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++  IF++ + LR  +  AY P L+SIGPYHHGN +L  ME +K   L    +  K   +
Sbjct  52    AKPSIFRIPQHLRLGHEHAYEPELVSIGPYHHGNPRLQAMEEIKWQILGHLWETSKD-DV  110

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
              +  + ++D + +A SYY +      +++    +F +MLLLDG FI +          + 
Sbjct  111   RRSLQIMQDKEAEARSYYSE------VINMKSRRFAEMLLLDGYFIIQLFTPCEKMAEEL  164

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
              +          +N+V++ + +     RDLLLLENQLP+F+   L   V D  +   + I
Sbjct  165   RDLL--------DNSVYLQSSLH----RDLLLLENQLPYFIFNVLLS-VLDIQEVSSVAI  211

Query  675   VKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVH-NLCNP------------QNG  815
              ++    +  K+       P L   +      HLL ++H ++ +P            +  
Sbjct  212   QRVFIIKLDMKL-------PGLMVPSEDSKMAHLLDLLHQSIASPNPRVEWVIGLIMETS  264

Query  816   GIQ--EERHYWTLCFPCSLG--KQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHI  983
             G Q  ++    + C P SL   ++S         + +ATEL EAGV +K V K  +   I
Sbjct  265   GPQSLQQSRSRSRC-PLSLQFLQRSGSRPPSPVGVPSATELVEAGVKIK-VRKEGNFLDI  322

Query  984   KFNHAE--LEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVN  1157
              F+     LEIP   + D T   FRN+IA EQ + D   M  T Y+  MD++I+TEKDV 
Sbjct  323   SFDKENGLLEIPAIRVQDSTNLIFRNLIALEQFNTD-FGMKITCYSIFMDSIIDTEKDVA  381

Query  1158  LFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAK  1337
             L R  G++     +DK++  LFN LCK +++ +    Y+  +C ++N + N  WN   A+
Sbjct  382   LLRQEGIICCRHVNDKDIALLFNELCKDIIFVASQN-YFDLLCMEVNDYCNSRWNRWRAR  440

Query  1338  LRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             L  DYF+ PWA +S IAA  LL LTI QTV +VL
Sbjct  441   LMRDYFSNPWAILSVIAAAVLLVLTILQTVFSVL  474



>emb|CDO99347.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   205 bits (521),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 145/450 (32%), Positives = 221/450 (49%), Gaps = 39/450 (9%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             +  L   S +  IFK+H  LR  N +AY P ++SIGPYHHG  KL +ME  KL Y +  L
Sbjct  115   LSELLDTSEKPSIFKIHGQLRSENEEAYEPQVVSIGPYHHGKPKLKEMEKHKLRYFNELL  174

Query  291   KREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYR  470
             +R  + S E+    L D +++A  YY   E+I L        FV ML LDGCF+ EFL +
Sbjct  175   RRRGESSAEKYIIALADLQDQARRYYA--EEINL----TDVDFVDMLCLDGCFVIEFLRK  228

Query  471   eydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDE  650
                                +N+ +F    ++     DL+L ENQLPFF L +L  M    
Sbjct  229   -----------RRRPGSHWENDPIFQMLWLRIATKNDLILFENQLPFFALLQLFDMTKSP  277

Query  651   SKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE  830
              + + L  + I F+       L  P + +           HLL +VH +           
Sbjct  278   GEEENLIDLAIHFS---LSFGLADPGLNSHSTIFEHYKPVHLLGLVHKIL----------  324

Query  831   RHYWTLCFPCSLGKQSQDSKVGSS-DIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELE  1007
                 +  F  +L   +  +   SS  +++A EL+++G+  +K     S FHI F +  L+
Sbjct  325   ----SASFSETLTSTTYSNTTRSSLFLKSAGELRQSGIKFEKAADGKSSFHITFENGVLK  380

Query  1008  IPKFHITDPTETFFRNMIAYEQHSCDKNNMY--FTDYAQLMDNLINTEKDVNLFRMNGVL  1181
             IP   + D TE+FFRN+IA E++  +    +   TDY   +D LI++  DV   R + ++
Sbjct  381   IPPLVVHDNTESFFRNLIACEEYMSNPIETWKCVTDYILFIDCLIDSPSDVETLRRHDII  440

Query  1182  VNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNT  1361
             VN LG D+  + +FN+L   V +     F Y+ + + ++ +  K W++  A L   YFNT
Sbjct  441   VNGLGSDEAASTMFNKLTNHVQF--FRRFCYTKIFDDVDKYTRKRWHIWRANLVRKYFNT  498

Query  1362  PWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             PWA IS +AA  LL LT  Q + ++L   K
Sbjct  499   PWAFISVLAACALLLLTSVQAIFSILQYTK  528



>gb|KCW86090.1| hypothetical protein EUGRSUZ_B02788, partial [Eucalyptus grandis]
Length=381

 Score =   200 bits (509),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 140/413 (34%), Positives = 211/413 (51%), Gaps = 54/413 (13%)
 Frame = +3

Query  132   SSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPS  311
             S E  IF+V   LR+ N  AY P +++IGPYH+GN K   ME  KL YL   L+R K+  
Sbjct  5     SPEHSIFRVRHQLRKVNEKAYDPEILAIGPYHYGNDKFKFMEEQKLRYLQQLLERRKE-R  63

Query  312   MEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetk  491
             +++    L++ +++A + Y +       +D + +KF+ M+L+DGCFI E   +   +   
Sbjct  64    VDRYMPTLREMEQRARNCYAE------TIDLSQEKFLAMMLVDGCFIVELFRKYNMKIPT  117

Query  492   keeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLD  671
                         +++ +    G++  + RDLLLLENQLP FVL  L+ +  D      + 
Sbjct  118   D-----------EDDPLMHELGIQNSIMRDLLLLENQLPLFVLSNLYDLTKDPGDQSEVG  166

Query  672   IVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWTLC  851
             +    +             VP        EMK HLL + H  C              T  
Sbjct  167   LHASEYFQ-----------VPMQNWTIGEEMK-HLLHLYHTWC--------------TSG  200

Query  852   FPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIPKFHITD  1031
              P +L    +  K       +ATEL+E+GV  +   +   L  IKF +  LEIP   + D
Sbjct  201   LPKTLQPDCKPVKF------SATELRESGVRFR-AAEGGELSDIKFENGTLEIPVLEVED  253

Query  1032  PTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWLGDDKEV  1211
              TE+ FRN++AYEQH   ++  +FTDY   MD+LIN+  DV + R  G++ N+LGDDK V
Sbjct  254   HTESKFRNLVAYEQHRRRRDINHFTDYVHFMDSLINSSMDVEVLRHKGIIKNYLGDDKVV  313

Query  1212  TDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWA  1370
               +FN +   V+     G YYS++   +N H +K  NV MAKL+ +YF++PWA
Sbjct  314   AQIFNNMGDYVI---VYGSYYSEIFKNVNAHCDKRRNVWMAKLKREYFHSPWA  363



>ref|XP_008394043.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Malus domestica]
Length=471

 Score =   202 bits (515),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 152/457 (33%), Positives = 222/457 (49%), Gaps = 49/457 (11%)
 Frame = +3

Query  81    LPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMEN  260
             L  Y+ L+ ++ +L  LS   CI++V E LR+ N  AYTP ++SIGP HHG   L  ME 
Sbjct  61    LSPYDPLQEEL-DLLTLSPYLCIYRVPERLRQGNEKAYTPQVVSIGPLHHGEEHLKGMEE  119

Query  261   LKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLD  440
              K  YL  FL R +  S   C + +K  + K    Y   E I+L      D+FV+++LLD
Sbjct  120   HKKRYLLDFLSRTRV-SFYDCIKMIKIQEGKLRGCYA--EPIEL----GSDEFVRIVLLD  172

Query  441   GCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVL  620
               F+ EFL R Y      +           ++ V  P  M + V  D LLLENQLPFF+L
Sbjct  173   AAFVIEFLLRYYSVNFLGQA----------DDTVTKPM-MMWDVRPDFLLLENQLPFFIL  221

Query  621   QELHGMVYDES--KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHN  794
             Q L   ++  +  +P  L+I   +    +   R               +    L++I++ 
Sbjct  222   QVLFNTLFSSADQQPSLLEISYFSLQREIDSKRKEEIFGEICSSGEEVQHFVDLIRILYR  281

Query  795   LCNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSL  974
                 + GG                       ++  + +   TEL +AGV  K V K SSL
Sbjct  282   PLKSKTGG-----------------------ELKGTAVPNVTELVQAGVEFK-VGKGSSL  317

Query  975   FHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDV  1154
             F I F+   L+IPK  + D T+   +N++A+E     + N Y T+Y  LM  L  T KDV
Sbjct  318   FDINFSCGTLKIPKLTVCDTTDLKLKNLLAFELCRHRETN-YLTNYVFLMKRLAKTPKDV  376

Query  1155  NLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMA  1334
              L    G++ NWLGD K+++ L      GVV    + +YY+ +C  LN +     +  M 
Sbjct  377   ELLVEYGIIDNWLGDAKKISTLLLDFDTGVV---GNDYYYASLCKDLNDYCRSRRHKWMT  433

Query  1335  KLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
              LR +YFNTPW  IS +AAV LL LT  QTV +++ +
Sbjct  434   NLRRNYFNTPWRIISIVAAVILLILTSIQTVCSIISI  470



>ref|XP_007137039.1| hypothetical protein PHAVU_009G094600g [Phaseolus vulgaris]
 gb|ESW09033.1| hypothetical protein PHAVU_009G094600g [Phaseolus vulgaris]
Length=419

 Score =   201 bits (512),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 139/444 (31%), Positives = 226/444 (51%), Gaps = 54/444 (12%)
 Frame = +3

Query  129   LSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHG-NAKLSKMENLKLMYLDLFLKREKQ  305
             ++ E CI++V   +RR   DAYTP ++SIGP+HH  + +L  ME  KLMY   FL+R  Q
Sbjct  22    VTDECCIYRVPYCIRRLKEDAYTPTVVSIGPFHHNRHPRLHTMERHKLMYCKAFLER-TQ  80

Query  306   PSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydee  485
              S+E+    ++ ++ +    Y +       ++   ++ VK++L+D  FI E  +R +D+ 
Sbjct  81    TSLERWIHYVEGAELQFRRCYSE------AIEFNKEELVKIILVDCGFILELFWRYHDDN  134

Query  486   tkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKF  665
               +           D+  + +P  +   +  DLLLLENQLPFF+L  L  + +  +    
Sbjct  135   KSQ-----------DDTFLSIP-WLSTHIRLDLLLLENQLPFFILHNLFRLSFSTTTNNI  182

Query  666   LDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEERHYWT  845
                +++TF                 G  N +++                G +   RH+  
Sbjct  183   PSFIQLTFNY--------------FGYYNTSKLSS--------------GNVSIIRHFTD  214

Query  846   L--CFPCSLGKQSQDSKVGS--SDIRTATELQEAGVNLKKVVKSSSLFHIKFNHAELEIP  1013
             L   F     ++S+ S++ +   +  +ATEL EAGV  K    S  L  ++F+    EIP
Sbjct  215   LLRTFHLQHPEESRPSRIDNPVENCPSATELSEAGVRFKVKTTSKCLLELRFSGGVFEIP  274

Query  1014  KFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFRMNGVLVNWL  1193
             +  + D TE  FRNM+A EQ     +  Y TDYA+++D LINT +DV++     VLVNWL
Sbjct  275   QLDVDDSTELLFRNMVALEQ-CYYPSKSYITDYAKVLDVLINTSRDVDILIRKRVLVNWL  333

Query  1194  GDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRHDYFNTPWAG  1373
             GD   V  +FN L + V  S+    Y+  +C  L+  +  PWN + + LR DY  +PW  
Sbjct  334   GDTDSVAKMFNALMQNVTESTLSLDYFR-ICQDLSAFHKNPWNNLKSTLRRDYCRSPWQT  392

Query  1374  ISTIAAVFLLSLTIAQTVIAVLDL  1445
              +TIAA+ +L L++ QT+ ++L +
Sbjct  393   AATIAAIVILVLSLVQTICSILQV  416



>ref|XP_009115692.1| PREDICTED: UPF0481 protein At3g47200-like [Brassica rapa]
Length=537

 Score =   204 bits (519),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 144/457 (32%), Positives = 224/457 (49%), Gaps = 62/457 (14%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M+  K   ++  LKR  Q +++  
Sbjct  109   CIYRVPYYLQENDNKSYFPQTVSLGPYHHGKKRLRPMDRHKWRAVNKILKRTNQ-NIKMY  167

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +++ +EKA + Y     +      + ++F++ML+LDGCF+ E L+R   E   +   
Sbjct  168   IDAMRELEEKARACYEGPFGL------SSNEFIEMLVLDGCFVLE-LFRGAVEGFTELGY  220

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+++LENQLP FVL  L  +         L     
Sbjct  221   -------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFVLNRLLELQ--------LGTRNQ  265

Query  684   TFASMLTKVRLIPPIVPNLGDNNATEMKG--------------------HLLQIVHN--L  797
             T       VR   P++P       T+                       H L +     L
Sbjct  266   TGLVAQLAVRFFDPLMPTDEPMTKTDQSKLENYLARDKAFDPFADMGELHCLDVFRRSLL  325

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKS  965
              +      +  R  W+          S++++V        I   TEL+EAG+  ++  K+
Sbjct  326   RSSPKPEPRLSRKRWS----------SRNTRVADKRRQQLIHCVTELREAGIKFRRR-KT  374

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
                + I+FN+  LEIP+  I D T++ F N+IA+EQ   D  N   T Y   MDNLI++ 
Sbjct  375   DRFWDIQFNNGYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSRND-ITSYIIFMDNLIDSH  433

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             +DV+     G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN 
Sbjct  434   EDVSYLHYCGIIEHWLGSDSEVANLFNRLCEEVVFDTEDS-YLSRLSVEVNRYYNQKWNA  492

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               A LRH YFN PWA +S  AAV LL LT++Q+  A 
Sbjct  493   WRATLRHKYFNNPWAIVSFCAAVILLVLTLSQSFYAA  529



>ref|XP_004231874.1| PREDICTED: UPF0481 protein At3g47200 [Solanum lycopersicum]
Length=543

 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 143/457 (31%), Positives = 229/457 (50%), Gaps = 57/457 (12%)
 Frame = +3

Query  135   SEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSM  314
             ++  I++V   LRR +  AY P ++S+GPYHHG  +L  M+  K   +   LKR  Q  +
Sbjct  113   AKLSIYRVPLSLRRDDDKAYIPQIVSLGPYHHGKKRLRNMDRHKWRAVLQILKRTDQ-EI  171

Query  315   EQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkk  494
             +   + +++ +EKA + Y      +  +    ++FV+M++LD CF+ E L+R      + 
Sbjct  172   KMYIDAVRELEEKARACY------EGTIAMNSNEFVEMMVLDSCFVLE-LFRGVAGGFQH  224

Query  495   eeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDI  674
                         N+ VF   G    + RD++++ENQ+P F+L  L+G+  D    K + +
Sbjct  225   LGY-------ARNDPVFAMRGSMHSIQRDMIMIENQIPLFILDRLYGIQSDMPHEKGI-V  276

Query  675   VKITFASMLTKVRLIPPIVPN---LGDNNATEMKGHL-----------LQIVHNL-----  797
              ++        +R   P++P    L  ++ T+++  +           L  +H L     
Sbjct  277   ARLA-------LRFFDPLMPTDEPLTKSDLTKLESSMGRSASFDPLADLAGLHCLDVFRR  329

Query  798   CNPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKS  965
                Q G     R +        + + S  S+V        I + +EL+EAGV  KK  K+
Sbjct  330   SLLQTGPKPTPRTW--------IKRWSHSSRVADKRRQQMIHSVSELKEAGVKFKKR-KT  380

Query  966   SSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTE  1145
                + +KF    L++P+  I D T++ F N+IA+EQ   D  N   T Y   +DNLI++ 
Sbjct  381   DRFWDVKFKKGILKMPRLLIHDGTKSLFLNLIAFEQCHLDCTND-ITSYVIFLDNLIDSP  439

Query  1146  KDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNV  1325
             +DV      G++ +WLG+D EV DLFNRLC+ VV+   D  Y S +  ++N +Y+  WN 
Sbjct  440   EDVKYLHYCGIIEHWLGNDAEVADLFNRLCQEVVFDVNDS-YLSQLSEQINRYYDHRWNA  498

Query  1326  MMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
               A LRH YFN PWA IS  AAV L+  T AQT   V
Sbjct  499   WRATLRHKYFNNPWAIISFAAAVILILFTFAQTFYGV  535



>gb|KHN41217.1| UPF0481 protein [Glycine soja]
Length=413

 Score =   201 bits (511),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 148/464 (32%), Positives = 222/464 (48%), Gaps = 62/464 (13%)
 Frame = +3

Query  66    GDQQDLPIYESLKRDIKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKL  245
             GD  ++ I E LK        +++E CI+KV   +RR N +AYTP ++SIGP+HHG+  L
Sbjct  5     GDAVEINIEEMLK---GAWAPVTTECCIYKVPFSIRRHNEEAYTPKVVSIGPFHHGHPHL  61

Query  246   SKMENLKLMYLDLFLKREKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVK  425
               ME  KL Y   FLKR  Q ++      +++ + +    Y         L+ + ++ VK
Sbjct  62    QDMEKHKLFYSMAFLKR-TQATVGSLIGNIQEMEPEFRRCYSHA------LEFSNEQLVK  114

Query  426   MLLLDGCFIAEFLYReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQL  605
             ++ +D  FI E   R +D+  K+           D++       +   +  DLLLLENQ+
Sbjct  115   IIFVDCAFILELFCRVHDQLLKE-----------DDDMCLSKPWLSNNIMYDLLLLENQV  163

Query  606   PFFVLQELHGMVYDESKPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQI  785
             PFFVL+ L  + +  S P FL +    F     +  L      N  D N       L++ 
Sbjct  164   PFFVLERLFNLSF--SSPSFLALT-FHFFQQFNRSGL------NFNDINRIMHFTDLIRT  214

Query  786   VHNLCNPQ----NGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKK  953
              H L +P     +G I E                          + + TEL EAG+  K 
Sbjct  215   FH-LQDPLPFRIDGNIIEH-------------------------LPSVTELSEAGLRFKV  248

Query  954   VVKSSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNL  1133
             +   S L  + F+   LEIP+  + D TET FRNM+A EQ      + Y TDY   +D L
Sbjct  249   LESESCLLKLDFSGEVLEIPQLVVDDRTETLFRNMMALEQCHYPFQS-YITDYVDFLDFL  307

Query  1134  INTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNK  1313
             +NT +DV++     V +NWLG+   V  + N L K +  S+     + DVC KLN  +  
Sbjct  308   VNTNRDVDILVRERVFLNWLGNTDSVATMINGLMKDITTSNISS-QFLDVCEKLNAFHKN  366

Query  1314  PWNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             PW  +M+ LR DY   PW   ++IAA+ LL L+  QTV ++L +
Sbjct  367   PWRKLMSALRRDYCRGPWQTAASIAAIILLILSFVQTVCSILQV  410



>ref|XP_009614262.1| PREDICTED: UPF0481 protein At3g47200-like, partial [Nicotiana 
tomentosiformis]
Length=378

 Score =   200 bits (508),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 202/373 (54%), Gaps = 46/373 (12%)
 Frame = +3

Query  117   NLKQLSSEAC-IFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLK  293
             +L   S+++C IF+V  GL  +N DAY  +L+SIGPYH  N++L  MEN KL YL  FL+
Sbjct  22    DLYHSSTKSCTIFRVSVGLSESNPDAYKSMLVSIGPYHKKNSQLRSMENYKLRYLQRFLR  81

Query  294   REKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYRe  473
             R+    ++ C  +L+  K++A   Y D EDI    D+   +F+KMLL+DGCFI EF+   
Sbjct  82    RKVGLDVKTCISELEKLKDEALKCYDDIEDI--YSDNNTGQFLKMLLVDGCFIVEFIRER  139

Query  474   ydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDES  653
                +              + + +   + +  QV RDLLLLE Q PFFVL +LH M  D  
Sbjct  140   CGRKPT------------EKDIIIPYSCIDGQVRRDLLLLETQHPFFVLTKLHNMTMDPI  187

Query  654   KPKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMKGHLLQIVHNLCNP---------  806
             +  FL +VK TF S   K+     +     +++A  +K HLLQ+VH  C+P         
Sbjct  188   RVPFLKLVKETFNSSFLKMSHASFLEI---ESDAKNIK-HLLQLVHMSCHPLEKKTSLTL  243

Query  807   QNGGIQEERHYWTLCF-PCSLGK-----QSQDSKVGSSDIRTATELQEAGVNLKKVVK--  962
             +N  ++ E     LC+ P  + +       +D +   +++  ATEL+EAGV   K+ K  
Sbjct  244   ENPSLEMEHCTKGLCWNPLQMVRLKNMPNGKDHQTWDANMPNATELREAGVTFSKIGKIY  303

Query  963   ----------SSSLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDY  1112
                       ++SLF IKF +  + IP F + D TE   RN+IAYEQ S D +  YF+D+
Sbjct  304   RRLEDHDLGDNTSLFDIKFENGVMTIPCFEVFDCTEMILRNLIAYEQQSSDVHPRYFSDF  363

Query  1113  AQLMDNLINTEKD  1151
             +  MD LI+++KD
Sbjct  364   SIFMDYLIDSDKD  376



>ref|XP_003523693.1| PREDICTED: putative UPF0481 protein At3g02645-like isoform X1 
[Glycine max]
 ref|XP_006578152.1| PREDICTED: putative UPF0481 protein At3g02645-like isoform X2 
[Glycine max]
 gb|KHN08120.1| UPF0481 protein [Glycine soja]
Length=425

 Score =   201 bits (511),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 222/453 (49%), Gaps = 66/453 (15%)
 Frame = +3

Query  129   LSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHH-GNAKLSKMENLKLMYLDLFLKREKQ  305
             ++ E CI++V   +R+ N DAYTP ++SIGP+HH GN +L  ME  KL+Y + FLKR   
Sbjct  22    VTDECCIYRVPFDIRKLNEDAYTPKVVSIGPFHHKGNPRLQNMEKHKLIYCNAFLKRSNT  81

Query  306   PSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydee  485
               +E     ++D + +  S Y D       L+   ++ +K++L+D  FI E  +      
Sbjct  82    -GLETWIRYIQDVEPRFRSCYSDA------LEFTKEELLKIILVDSGFIFELFW------  128

Query  486   tkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKF  665
                       +   +N ++ +   +   V  DLLLLENQLPFFVL  L G          
Sbjct  129   -----LTYYEENSGNNGSILLKPWLTTNVRLDLLLLENQLPFFVLDHLFG----------  173

Query  666   LDIVKITFASMLTKVRLIPPIVPNLGDN----NATEMKGHLLQIVH--------NLCNPQ  809
             L +   T  S     + IPP +    D     N +E+  H + I H        +L +PQ
Sbjct  174   LSMQSYTSTSGRGGKKNIPPFIAFTFDYFSFYNRSELNFHGVMIKHFTDLLRTFHLQHPQ  233

Query  810   NGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSS-LFHIK  986
                I++                          + +A EL EAGV  K    S   L  +K
Sbjct  234   QNRIEKT----------------------VVHLPSAAELSEAGVRFKANTTSKCCLLDLK  271

Query  987   FNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNLFR  1166
             F+   LEIP+  + D TE  FRNM+A EQ     ++ + TDY  ++D L+NT +DV++  
Sbjct  272   FSGGVLEIPQLKVQDWTELIFRNMVALEQCHYPYHS-FVTDYVAVLDFLVNTSRDVDVLV  330

Query  1167  MNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKLRH  1346
               GVLVNWLGD   V D+FN L K V + +    +YS++C KLN     P + + + LR 
Sbjct  331   RKGVLVNWLGDSDSVADMFNGLWKNVTHINFSS-HYSELCQKLNAFCRNPCHKLKSTLRR  389

Query  1347  DYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDL  1445
             DY  TPW    +IA + LL L++ Q+V +VL +
Sbjct  390   DYCKTPWQIAVSIAGIVLLVLSLVQSVCSVLQV  422



>emb|CDY23020.1| BnaC07g31670D [Brassica napus]
Length=532

 Score =   204 bits (518),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 147/455 (32%), Positives = 233/455 (51%), Gaps = 59/455 (13%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  + +GPYHHG  +L  M+  K   ++  LKR  Q S++  
Sbjct  105   CIYRVPYYLQENDNQSYFPQTVFLGPYHHGKKRLRSMDRHKWRAVNRILKRTNQ-SIKIY  163

Query  324   WEKLKDSKEKA-ASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkee  500
              + +++ +EKA A Y G        L  + ++FV+ML+LDGCF+ E L+R   E   +  
Sbjct  164   IDAMRELEEKARACYEGP-------LGLSSNEFVEMLVLDGCFVLE-LFRGAVEGFTELG  215

Query  501   eeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVK  680
                       N+ VF   G    + RD+++LENQLP FVL  L  +             K
Sbjct  216   Y-------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFVLNRLLELQLGTKN-------K  261

Query  681   ITFASMLTKVRLIPPIVPN---LGDNNATEMKGHL-----------LQIVHNLCNPQNGG  818
                 + L  VR   P++P    +   + ++++ +L           +  +H L   +   
Sbjct  262   TGLVAQLA-VRFFDPLMPTDEPMTKTDQSKLENYLAGDKAFDPFADMGELHCLDVFRRSL  320

Query  819   IQ-----EERHYWTLCFPCSLGKQSQDSKVGSSD----IRTATELQEAGVNLKKVVKSSS  971
             ++     E R         S  + S++++V        I   TEL+EAG+  ++  K+  
Sbjct  321   LRSSPKPEPR--------LSRRRWSRNTRVADKRRQQLIHCVTELKEAGIKFRRR-KTDR  371

Query  972   LFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKD  1151
              + I+FN+  LEIP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +D
Sbjct  372   FWDIQFNNGYLEIPRLLIHDGTKSLFLNLIAFEQCHIDSSND-ITSYIIFMDNLIDSHED  430

Query  1152  VNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMM  1331
             V+     G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   
Sbjct  431   VSYLHYCGIIEHWLGSDAEVANLFNRLCEEVVFDTEDS-YLSRLSAEVNRYYNQKWNAWR  489

Query  1332  AKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             A L+H YFN PWA +S  AAV LL LT+ Q+   V
Sbjct  490   AALKHKYFNNPWAVVSFCAAVILLVLTLCQSFYGV  524



>ref|XP_007022376.1| Uncharacterized protein TCM_032646 [Theobroma cacao]
 gb|EOY13901.1| Uncharacterized protein TCM_032646 [Theobroma cacao]
Length=455

 Score =   202 bits (513),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 153/465 (33%), Positives = 229/465 (49%), Gaps = 56/465 (12%)
 Frame = +3

Query  129   LSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQP  308
             L  EA + KV   LR+ N  AY P LISIGPYHHG   L +ME  K   L   L+R    
Sbjct  23    LDEEAYLLKVPHQLRQLNESAYEPQLISIGPYHHGKQHLIEMEVYKKRCLQRILER----  78

Query  309   SMEQCWEKLKDSKE--KAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReyde  482
             + +Q   + +D+ +  +A  +Y        L +    KF  ++L+DGCFI E L +   +
Sbjct  79    NGDQNHHRYRDAIDFVRARKWYSPS-----LPNDIEAKFKAIMLVDGCFIVELLRQMETD  133

Query  483   etkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPK  662
             E               ++ +F    ++  +  DL+L ENQLPFFVL  L+ ++ D +  K
Sbjct  134   EY--------------DDPIFQKKWVQNSLLGDLVLFENQLPFFVLVGLYHVIEDPTDGK  179

Query  663   FLDIVKITFASMLTKVRLIPPI----VPNLGDNNATEMKGHLLQIVHNLCNPQNGGIQEE  830
               D     F S+L+     P       P + D   T+    LL ++H+  +P   GI+  
Sbjct  180   --DFACRAF-SVLSDFLPGPGTWKENPPTIKD---TDHIKDLLSLLHDNWSPSPQGIRRH  233

Query  831   RHYWTLCFPCSLGKQSQDSKVGS--------SDIRTATELQ-----EAGVNLKKVVKSS-  968
             + Y+      + G +    K G         S I    E +     E+GV +    +   
Sbjct  234   QDYYRTKDEKAKGGEEAREKGGLEKKWKFTLSIIEKPKEKKFHGDVESGVTITCCAREKE  293

Query  969   ----SLFHIKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLI  1136
                  L   +  H  ++IP F ++D TE  FRN+IAYE +   + + Y  DY  LMDNLI
Sbjct  294   NLRKGLLEWQSLHGTMKIPSFVVSDRTERLFRNLIAYELYK--EGSTYVIDYVTLMDNLI  351

Query  1137  NTEKDVNLFRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKP  1316
             N+  DV L R++ ++ N LGDD+ V  + N+L   V+  + D FYY ++   +  H  + 
Sbjct  352   NSSNDVQLLRLSEIIENMLGDDEAVAKMLNKLRDHVILCA-DTFYYEEIFVDVKRHCARR  410

Query  1317  WNVMMAKLRHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVLDLRK  1451
             WN   AKLRHDYFN+PWA IS IAA+ ++ LTI Q + A++ L K
Sbjct  411   WNPWKAKLRHDYFNSPWALISFIAALLVILLTIGQFITALIPLVK  455



>ref|XP_011045459.1| PREDICTED: UPF0481 protein At3g47200-like [Populus euphratica]
Length=430

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 143/453 (32%), Positives = 220/453 (49%), Gaps = 63/453 (14%)
 Frame = +3

Query  111   IKNLKQLSSEACIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFL  290
             I NL  +S+ + I+KV   LR  N DAY P +ISIGP H G  +L  ME  KL Y+   L
Sbjct  25    IDNLSPVSNWS-IWKVSYSLRTVNEDAYDPHIISIGPLHKGKHQLLSMEVHKLYYMRSLL  83

Query  291   KR--EKQPSMEQCWEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFL  464
             +R  +   +++   E +K+ +E   + Y +       ++ +  +  ++LL+DGCF+ E  
Sbjct  84    QRTPDLHETLKSSAEAIKEFEEMVRACYAEP------IEMSSSELAEILLVDGCFMLELF  137

Query  465   YReydeetkkeeeeelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVY  644
              R    + +             ++ +F  + +   + RDL LLENQ+PFFVL+ L+  V 
Sbjct  138   IRYSKVDLR-----------VQDDPLFYSSWIILTLQRDLALLENQIPFFVLERLYSQVV  186

Query  645   DESK-----PKFLDIVKITFASMLTKVRLIPPIVPNLGDNNATEMK---GHLLQIVHNLC  800
             + S      P   ++    F S+L            + D N   ++    HLL ++HN  
Sbjct  187   ESSTIGQSLPSLPELALGFFKSVLY-----------INDENFRIIRRPYPHLLDLIHNCY  235

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
              P                P   G+ +    V +   + AT L EAG+  +K   + +LF 
Sbjct  236   LP----------------PAFSGRSNIGEWVST---QPATSLNEAGIVFRKGT-TRNLFD  275

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNL  1160
             ++F +  LEIP   I D T + F+N+IAYEQ S      Y T Y  LM  L+   +D  L
Sbjct  276   LRFRNGALEIPPLLIHDSTVSLFQNLIAYEQLS-RGTAQYITSYFALMSRLVYDRRDAEL  334

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
                 G++ N +   K+V+ LFN +C+ VV      FYY++VC  LN ++   W +  A L
Sbjct  335   LESKGIIKNDMSGWKDVSVLFNDMCRQVV---VQDFYYAEVCQDLNSNFRTRWALYKATL  391

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQTVIAVL  1439
             R  YF +PW  +S +AA  LLSL + QTV  VL
Sbjct  392   RKTYFRSPWTILSVMAACMLLSLAVIQTVYTVL  424



>ref|XP_006404055.1| hypothetical protein EUTSA_v10010280mg [Eutrema salsugineum]
 gb|ESQ45508.1| hypothetical protein EUTSA_v10010280mg [Eutrema salsugineum]
Length=533

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/452 (31%), Positives = 225/452 (50%), Gaps = 54/452 (12%)
 Frame = +3

Query  144   CIFKVHEGLRRTNTDAYTPLLISIGPYHHGNAKLSKMENLKLMYLDLFLKREKQPSMEQC  323
             CI++V   L+  +  +Y P  +S+GPYHHG  +L  M+  K   +   LKR  Q +++  
Sbjct  107   CIYRVPYYLQENDNKSYFPQTVSLGPYHHGKKRLRSMDRHKWRAVSRILKRTNQ-NIQIY  165

Query  324   WEKLKDSKEKAASYYGDDEDIQLLLDSAGDKFVKMLLLDGCFIAEFLYReydeetkkeee  503
              + +++ +EKA + Y     +      + ++F++ML+LDGCF+ E L+R   E   +   
Sbjct  166   IDAMREIEEKARACYEGPFGL------SSNEFIEMLVLDGCFVLE-LFRGAVEGFTELGY  218

Query  504   eelnkkkCDNNAVFMPTGMKFQVFRDLLLLENQLPFFVLQELHGMVYDESKPKFLDIVKI  683
                      N+ VF   G    + RD+++LENQLP FVL  L  +         L     
Sbjct  219   -------ARNDPVFAMRGSMHSIQRDMIMLENQLPLFVLNRLLELQ--------LGTRNQ  263

Query  684   TFASMLTKVRLIPPIVPN---LGDNNATEMKG----------------HLLQIVHN--LC  800
             T       +R   P++P    L   N ++++                 H L +     L 
Sbjct  264   TGLVAQLAIRFFDPLMPTDEPLTKTNKSKLENSLAREAFDPFTDMGELHCLDVFRRSLLR  323

Query  801   NPQNGGIQEERHYWTLCFPCSLGKQSQDSKVGSSDIRTATELQEAGVNLKKVVKSSSLFH  980
             +      +  R  WT     +  ++ Q        I   TEL+EAG+  ++  K+   + 
Sbjct  324   SSPTPESRLSRKRWTRNTRVADKRRQQL-------IHCVTELREAGIKFRRR-KTDRFWD  375

Query  981   IKFNHAELEIPKFHITDPTETFFRNMIAYEQHSCDKNNMYFTDYAQLMDNLINTEKDVNL  1160
             I+F +  LEIP+  I D T++ F N+IA+EQ   D +N   T Y   MDNLI++ +DV+ 
Sbjct  376   IQFKNGYLEIPRLLIHDGTKSLFLNLIAFEQCHVDSSND-ITSYIIFMDNLIDSHEDVSY  434

Query  1161  FRMNGVLVNWLGDDKEVTDLFNRLCKGVVYSSCDGFYYSDVCNKLNGHYNKPWNVMMAKL  1340
                 G++ +WLG D EV +LFNRLC+ VV+ + D  Y S +  ++N +YN+ WN   A L
Sbjct  435   LHYCGIIEHWLGSDSEVANLFNRLCEEVVFDTEDS-YLSRLSIEVNRYYNQKWNAWRAAL  493

Query  1341  RHDYFNTPWAGISTIAAVFLLSLTIAQTVIAV  1436
             +H YFN PWA +S  AAV LL LT++Q+  A 
Sbjct  494   KHKYFNNPWAIVSFCAAVILLVLTLSQSFYAA  525



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4480182883560