BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30906_g1_i1 len=1399 path=[1:0-1398]

Length=1399
                                                                      Score     E

ref|XP_004235944.1|  PREDICTED: probable N-acetyltransferase HLS1       498   1e-170   
ref|XP_006341342.1|  PREDICTED: probable N-acetyltransferase HLS1...    497   4e-170   
ref|XP_009613433.1|  PREDICTED: probable N-acetyltransferase HLS1       493   1e-168   
ref|XP_009762031.1|  PREDICTED: probable N-acetyltransferase HLS1       488   2e-166   
ref|XP_011073602.1|  PREDICTED: probable N-acetyltransferase HLS1       481   8e-164   
emb|CDO98232.1|  unnamed protein product                                472   3e-160   
ref|XP_002512722.1|  N-acetyltransferase, putative                      457   1e-154   Ricinus communis
ref|XP_006427628.1|  hypothetical protein CICLE_v10025742mg             456   7e-154   
ref|XP_010275833.1|  PREDICTED: probable N-acetyltransferase HLS1       455   1e-153   
ref|XP_006493357.1|  PREDICTED: probable N-acetyltransferase HLS1...    452   1e-152   
ref|XP_010265571.1|  PREDICTED: probable N-acetyltransferase HLS1...    452   2e-152   
ref|XP_002299247.2|  hypothetical protein POPTR_0001s03570g             452   2e-152   Populus trichocarpa [western balsam poplar]
ref|XP_007135825.1|  hypothetical protein PHAVU_010G161500g             446   3e-150   
ref|XP_003531740.1|  PREDICTED: probable N-acetyltransferase HLS1...    445   1e-149   
ref|XP_004137656.1|  PREDICTED: uncharacterized protein LOC101217889    445   1e-149   
ref|XP_011020602.1|  PREDICTED: probable N-acetyltransferase HLS1       445   1e-149   
ref|XP_011016503.1|  PREDICTED: probable N-acetyltransferase HLS1       444   2e-149   
ref|XP_011034550.1|  PREDICTED: probable N-acetyltransferase HLS1       444   3e-149   
ref|XP_002303853.1|  hypothetical protein POPTR_0003s18090g             444   3e-149   Populus trichocarpa [western balsam poplar]
ref|XP_003604253.1|  hypothetical protein MTR_4g007130                  442   1e-148   
ref|XP_007023438.1|  Acyl-CoA N-acyltransferases superfamily protein    442   1e-148   
gb|KHN04181.1|  hypothetical protein glysoja_032677                     442   2e-148   
ref|XP_003530256.1|  PREDICTED: probable N-acetyltransferase HLS1...    441   2e-148   
ref|XP_008465148.1|  PREDICTED: probable N-acetyltransferase HLS1       442   3e-148   
gb|KDP41968.1|  hypothetical protein JCGZ_26986                         441   6e-148   
ref|XP_004507072.1|  PREDICTED: uncharacterized protein LOC101511369    440   7e-148   
ref|XP_007217552.1|  hypothetical protein PRUPE_ppa022441mg             439   3e-147   
gb|AFK38196.1|  unknown                                                 439   3e-147   
gb|EYU21735.1|  hypothetical protein MIMGU_mgv1a021131mg                438   4e-147   
ref|XP_008228819.1|  PREDICTED: probable N-acetyltransferase HLS1       435   8e-146   
ref|XP_010094041.1|  hypothetical protein L484_018057                   430   5e-144   
ref|XP_008381110.1|  PREDICTED: probable N-acetyltransferase HLS1       425   8e-142   
ref|XP_004303239.1|  PREDICTED: uncharacterized protein LOC101300741    422   6e-141   
ref|XP_002264353.1|  PREDICTED: probable N-acetyltransferase HLS1...    405   2e-134   Vitis vinifera
ref|XP_010537846.1|  PREDICTED: probable N-acetyltransferase HLS1...    401   8e-133   
ref|XP_010063570.1|  PREDICTED: probable N-acetyltransferase HLS1       401   4e-132   
ref|XP_002889271.1|  hypothetical protein ARALYDRAFT_316871             390   2e-128   
ref|XP_009106710.1|  PREDICTED: probable N-acetyltransferase HLS1       388   9e-128   
gb|KFK42474.1|  hypothetical protein AALP_AA2G261600                    386   7e-127   
emb|CDX87350.1|  BnaA07g35230D                                          386   8e-127   
ref|XP_010537847.1|  PREDICTED: probable N-acetyltransferase HLS1...    381   3e-125   
emb|CDX88571.1|  BnaC06g40150D                                          381   6e-125   
ref|XP_010691581.1|  PREDICTED: probable N-acetyltransferase HLS1       376   8e-123   
ref|XP_010429890.1|  PREDICTED: probable N-acetyltransferase HLS1...    375   2e-122   
ref|XP_010655081.1|  PREDICTED: probable N-acetyltransferase HLS1...    372   9e-122   
ref|XP_010472858.1|  PREDICTED: probable N-acetyltransferase HLS1       371   7e-121   
ref|XP_006301652.1|  hypothetical protein CARUB_v10022096mg             353   3e-114   
ref|XP_010086949.1|  hypothetical protein L484_005908                   353   1e-113   
ref|XP_007047498.1|  Acyl-CoA N-acyltransferases (NAT) superfamil...    350   1e-112   
ref|XP_010272325.1|  PREDICTED: probable N-acetyltransferase HLS1       347   1e-111   
gb|KDP32061.1|  hypothetical protein JCGZ_12522                         342   2e-109   
ref|XP_011073697.1|  PREDICTED: probable N-acetyltransferase HLS1...    342   2e-109   
ref|XP_006380626.1|  constitutive photomorphogenic 3 family protein     341   3e-109   
gb|KFK30374.1|  hypothetical protein AALP_AA7G252700                    341   4e-109   
ref|XP_010939135.1|  PREDICTED: probable N-acetyltransferase HLS1       341   4e-109   
ref|XP_009379320.1|  PREDICTED: probable N-acetyltransferase HLS1       340   9e-109   
ref|XP_002525259.1|  N-acetyltransferase, putative                      338   3e-108   Ricinus communis
ref|XP_011099360.1|  PREDICTED: probable N-acetyltransferase HLS1       339   3e-108   
ref|XP_010277068.1|  PREDICTED: probable N-acetyltransferase HLS1       338   5e-108   
ref|XP_011013316.1|  PREDICTED: probable N-acetyltransferase HLS1       338   5e-108   
ref|XP_009787051.1|  PREDICTED: probable N-acetyltransferase HLS1       338   7e-108   
ref|XP_003550977.1|  PREDICTED: probable N-acetyltransferase HLS1...    338   8e-108   
ref|XP_006426077.1|  hypothetical protein CICLE_v10025754mg             337   8e-108   
ref|XP_008344342.1|  PREDICTED: probable N-acetyltransferase HLS1       337   1e-107   
gb|KDO44017.1|  hypothetical protein CISIN_1g0154291mg                  333   1e-107   
ref|XP_009587553.1|  PREDICTED: probable N-acetyltransferase HLS1...    337   1e-107   
ref|XP_006411873.1|  hypothetical protein EUTSA_v10025368mg             337   2e-107   
ref|XP_003517341.1|  PREDICTED: probable N-acetyltransferase HLS1...    337   2e-107   
ref|XP_003539284.1|  PREDICTED: probable N-acetyltransferase HLS1...    336   2e-107   
ref|XP_007208612.1|  hypothetical protein PRUPE_ppa021292mg             337   3e-107   
gb|KDO78948.1|  hypothetical protein CISIN_1g014721mg                   336   3e-107   
ref|XP_006579936.1|  PREDICTED: probable N-acetyltransferase HLS1...    339   3e-107   
gb|KHN12991.1|  hypothetical protein glysoja_027279                     336   4e-107   
ref|XP_008352544.1|  PREDICTED: probable N-acetyltransferase HLS1       336   6e-107   
gb|EPS59941.1|  hypothetical protein M569_14864                         335   7e-107   
ref|XP_007155838.1|  hypothetical protein PHAVU_003G235800g             335   7e-107   
ref|XP_006283849.1|  hypothetical protein CARUB_v10004955mg             335   8e-107   
ref|XP_007156726.1|  hypothetical protein PHAVU_002G012000g             335   9e-107   
ref|XP_009140446.1|  PREDICTED: probable N-acetyltransferase HLS1...    335   1e-106   
emb|CDY69760.1|  BnaC04g56110D                                          334   1e-106   
ref|XP_011007830.1|  PREDICTED: probable N-acetyltransferase HLS1       334   2e-106   
ref|NP_195474.1|  putative N-acetyltransferase                          333   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466477.1|  PREDICTED: probable N-acetyltransferase HLS1...    333   5e-106   
ref|XP_011007829.1|  PREDICTED: probable N-acetyltransferase HLS1       333   5e-106   
emb|CDY38924.1|  BnaA04g13450D                                          333   6e-106   
gb|AES94567.2|  acyl-CoA N-acyltransferase (NAT) superfamily protein    333   6e-106   
ref|XP_006573658.1|  PREDICTED: probable N-acetyltransferase HLS1...    332   1e-105   
ref|XP_010437208.1|  PREDICTED: probable N-acetyltransferase HLS1       332   1e-105   
emb|CDY12845.1|  BnaC07g15880D                                          330   2e-105   
ref|XP_010451018.1|  PREDICTED: probable N-acetyltransferase HLS1       331   2e-105   
ref|XP_006364416.1|  PREDICTED: probable N-acetyltransferase HLS1...    331   3e-105   
ref|XP_002868981.1|  hypothetical protein ARALYDRAFT_490860             331   4e-105   
ref|XP_010432047.1|  PREDICTED: probable N-acetyltransferase HLS1       330   4e-105   
ref|XP_004233456.1|  PREDICTED: probable N-acetyltransferase HLS1       330   8e-105   
ref|XP_006590631.1|  PREDICTED: probable N-acetyltransferase HLS1...    330   8e-105   
emb|CDY44036.1|  BnaA08g15700D                                          330   8e-105   
ref|XP_004173667.1|  PREDICTED: uncharacterized LOC101205672            330   8e-105   
ref|XP_010907395.1|  PREDICTED: probable N-acetyltransferase HLS1       330   1e-104   
ref|XP_004141871.1|  PREDICTED: uncharacterized protein LOC101205672    330   1e-104   
ref|XP_004288237.1|  PREDICTED: uncharacterized protein LOC101308505    330   1e-104   
emb|CDP02591.1|  unnamed protein product                                330   1e-104   
ref|XP_009134450.1|  PREDICTED: probable N-acetyltransferase HLS1       328   2e-104   
ref|XP_009109384.1|  PREDICTED: probable N-acetyltransferase HLS1       328   2e-104   
emb|CDY22424.1|  BnaC03g61370D                                          328   3e-104   
ref|XP_010429249.1|  PREDICTED: probable N-acetyltransferase HLS1...    328   3e-104   
ref|XP_008792559.1|  PREDICTED: probable N-acetyltransferase HLS1       328   4e-104   
ref|XP_011073696.1|  PREDICTED: probable N-acetyltransferase HLS1...    330   5e-104   
ref|XP_009138498.1|  PREDICTED: probable N-acetyltransferase HLS1       327   6e-104   
ref|XP_002880477.1|  hypothetical protein ARALYDRAFT_900772             327   8e-104   
ref|XP_009103420.1|  PREDICTED: probable N-acetyltransferase HLS1       326   9e-104   
ref|XP_010472304.1|  PREDICTED: probable N-acetyltransferase HLS1...    327   9e-104   
ref|XP_004509069.1|  PREDICTED: uncharacterized protein LOC101507964    327   1e-103   
emb|CDX72638.1|  BnaC07g46600D                                          327   1e-103   
emb|CDY70664.1|  BnaAnng34560D                                          325   2e-103   
gb|KFK28430.1|  hypothetical protein AALP_AA8G513600                    325   3e-103   
ref|XP_004511849.1|  PREDICTED: uncharacterized protein LOC101496495    325   4e-103   
ref|XP_006404772.1|  hypothetical protein EUTSA_v10000180mg             325   5e-103   
ref|NP_179888.1|  acyl-CoA N-acyltransferase-like protein               325   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417061.1|  PREDICTED: probable N-acetyltransferase HLS1...    325   7e-103   
gb|KFK32773.1|  hypothetical protein AALP_AA6G286800                    324   1e-102   
ref|XP_008440371.1|  PREDICTED: probable N-acetyltransferase HLS1       324   1e-102   
ref|XP_010652717.1|  PREDICTED: probable N-acetyltransferase HLS1       325   1e-102   
ref|XP_007199030.1|  hypothetical protein PRUPE_ppa017911mg             323   3e-102   
ref|XP_003611609.1|  hypothetical protein MTR_5g015810                  323   5e-102   
ref|XP_008777300.1|  PREDICTED: probable N-acetyltransferase HLS1       322   8e-102   
gb|EYU44482.1|  hypothetical protein MIMGU_mgv1a007915mg                320   3e-101   
emb|CAC80824.1|  putative N-acetyltransferase hookless1                 319   8e-101   Brassica napus [oilseed rape]
ref|XP_010548456.1|  PREDICTED: probable N-acetyltransferase HLS1       319   1e-100   
ref|XP_010908252.1|  PREDICTED: probable N-acetyltransferase HLS1       318   2e-100   
ref|XP_006295487.1|  hypothetical protein CARUB_v10024591mg             318   3e-100   
gb|KEH31526.1|  acyl-CoA N-acyltransferase (NAT) superfamily protein    317   1e-99    
ref|XP_008236470.1|  PREDICTED: probable N-acetyltransferase HLS1       317   2e-99    
ref|XP_010547548.1|  PREDICTED: probable N-acetyltransferase HLS1       315   3e-99    
emb|CDY50977.1|  BnaA06g37730D                                          315   4e-99    
ref|XP_002306502.2|  constitutive photomorphogenic 3 family protein     315   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_006393946.1|  hypothetical protein EUTSA_v10005629mg             314   7e-99    
ref|XP_010464048.1|  PREDICTED: probable N-acetyltransferase HLS1       313   2e-98    
emb|CDX75665.1|  BnaA01g00370D                                          313   2e-98    
ref|XP_009780713.1|  PREDICTED: probable N-acetyltransferase HLS1...    313   5e-98    
ref|NP_201544.1|  GCN5-related N-acetyltransferase (GNAT) family ...    311   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282234.1|  hypothetical protein CARUB_v10028507mg             311   6e-98    
ref|XP_010484497.1|  PREDICTED: probable N-acetyltransferase HLS1       311   7e-98    
ref|XP_010099607.1|  hypothetical protein L484_003680                   311   2e-97    
ref|XP_009629747.1|  PREDICTED: probable N-acetyltransferase HLS1       311   2e-97    
ref|XP_010444648.1|  PREDICTED: probable N-acetyltransferase HLS1       310   3e-97    
ref|XP_004231914.1|  PREDICTED: probable N-acetyltransferase HLS1       310   4e-97    
ref|XP_009386825.1|  PREDICTED: probable N-acetyltransferase HLS1...    310   5e-97    
ref|XP_002866703.1|  hypothetical protein ARALYDRAFT_358814             309   5e-97    
ref|XP_004981660.1|  PREDICTED: uncharacterized protein LOC101754705    309   6e-97    
ref|XP_009398287.1|  PREDICTED: probable N-acetyltransferase HLS1       310   1e-96    
ref|XP_010550336.1|  PREDICTED: probable N-acetyltransferase HLS1       308   2e-96    
ref|XP_006339812.1|  PREDICTED: probable N-acetyltransferase HLS1...    309   2e-96    
gb|EYU29636.1|  hypothetical protein MIMGU_mgv1a019093mg                308   2e-96    
ref|XP_010942830.1|  PREDICTED: probable N-acetyltransferase HLS1       306   1e-95    
ref|XP_004289797.1|  PREDICTED: uncharacterized protein LOC101314232    304   5e-95    
gb|EPS58026.1|  hypothetical protein M569_16789                         304   1e-94    
gb|ACR61548.1|  putative N-acetyltransferase                            301   1e-94    Turnera subulata [white alder]
ref|XP_010028104.1|  PREDICTED: probable N-acetyltransferase HLS1       304   2e-94    
ref|NP_001170084.1|  uncharacterized protein LOC100384002               303   3e-94    Zea mays [maize]
ref|XP_010028370.1|  PREDICTED: probable N-acetyltransferase HLS1       300   2e-93    
ref|XP_010679620.1|  PREDICTED: probable N-acetyltransferase HLS1       299   1e-92    
dbj|BAJ86600.1|  predicted protein                                      296   5e-92    
ref|XP_002466403.1|  hypothetical protein SORBIDRAFT_01g007180          296   8e-92    Sorghum bicolor [broomcorn]
ref|NP_001051365.1|  Os03g0764000                                       295   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787222.1|  PREDICTED: probable N-acetyltransferase HLS1       292   4e-90    
ref|XP_008238090.1|  PREDICTED: probable N-acetyltransferase HLS1       290   2e-89    
gb|KEH34353.1|  acyl-CoA N-acyltransferase (NAT) superfamily prot...    289   3e-89    
ref|XP_004500285.1|  PREDICTED: uncharacterized protein LOC101506528    287   2e-88    
gb|ACU19465.1|  unknown                                                 286   4e-88    Glycine max [soybeans]
ref|XP_006826701.1|  hypothetical protein AMTR_s00137p00096410          286   6e-88    
ref|XP_010257097.1|  PREDICTED: probable N-acetyltransferase HLS1...    283   5e-87    
ref|XP_010089518.1|  hypothetical protein L484_011679                   283   5e-87    
ref|XP_006488558.1|  PREDICTED: probable N-acetyltransferase HLS1...    283   6e-87    
ref|XP_010257096.1|  PREDICTED: probable N-acetyltransferase HLS1...    283   8e-87    
ref|XP_003538308.1|  PREDICTED: probable N-acetyltransferase HLS1...    283   9e-87    
ref|XP_003519260.1|  PREDICTED: probable N-acetyltransferase HLS1...    282   1e-86    
ref|XP_002278620.1|  PREDICTED: probable N-acetyltransferase HLS1...    282   1e-86    Vitis vinifera
ref|XP_009780719.1|  PREDICTED: probable N-acetyltransferase HLS1...    281   2e-86    
ref|XP_006425110.1|  hypothetical protein CICLE_v10028636mg             281   2e-86    
gb|KHN42226.1|  hypothetical protein glysoja_046964                     281   3e-86    
gb|KDO66958.1|  hypothetical protein CISIN_1g016609mg                   281   3e-86    
gb|KHN36291.1|  hypothetical protein glysoja_003414                     281   3e-86    
ref|XP_010264579.1|  PREDICTED: probable N-acetyltransferase HLS1...    281   3e-86    
ref|XP_007146796.1|  hypothetical protein PHAVU_006G070600g             280   1e-85    
ref|XP_007016925.1|  Acyl-CoA N-acyltransferases superfamily protein    279   2e-85    
ref|XP_010922585.1|  PREDICTED: probable N-acetyltransferase HLS1...    279   3e-85    
ref|XP_007142182.1|  hypothetical protein PHAVU_008G259100g             277   1e-84    
ref|XP_011024921.1|  PREDICTED: probable N-acetyltransferase HLS1       276   2e-84    
ref|NP_001031403.1|  acyl-CoA N-acyltransferase-like protein            275   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024922.1|  PREDICTED: probable N-acetyltransferase HLS1       276   3e-84    
ref|XP_009386512.1|  PREDICTED: probable N-acetyltransferase HLS1       276   3e-84    
ref|XP_009780724.1|  PREDICTED: probable N-acetyltransferase HLS1...    274   3e-84    
gb|ACU18403.1|  unknown                                                 275   6e-84    Atriplex canescens [shadscale]
ref|XP_003551239.1|  PREDICTED: probable N-acetyltransferase HLS1...    275   6e-84    
ref|XP_009421102.1|  PREDICTED: probable N-acetyltransferase HLS1...    275   1e-83    
ref|XP_009338961.1|  PREDICTED: probable N-acetyltransferase HLS1...    274   2e-83    
ref|XP_006843651.1|  hypothetical protein AMTR_s00007p00176580          273   3e-83    
gb|KEH27507.1|  acyl-CoA N-acyltransferase (NAT) superfamily protein    271   6e-83    
ref|XP_010043411.1|  PREDICTED: probable N-acetyltransferase HLS1...    272   2e-82    
ref|XP_009369588.1|  PREDICTED: probable N-acetyltransferase HLS1...    271   2e-82    
ref|XP_002461340.1|  hypothetical protein SORBIDRAFT_02g001200          272   3e-82    Sorghum bicolor [broomcorn]
ref|XP_002299994.1|  hypothetical protein POPTR_0001s28630g             271   3e-82    Populus trichocarpa [western balsam poplar]
emb|CDP09222.1|  unnamed protein product                                271   3e-82    
ref|XP_004294308.1|  PREDICTED: uncharacterized protein LOC101311451    271   3e-82    
ref|XP_009401028.1|  PREDICTED: probable N-acetyltransferase HLS1...    271   4e-82    
ref|XP_009354026.1|  PREDICTED: probable N-acetyltransferase HLS1       270   1e-81    
ref|XP_008645325.1|  PREDICTED: probable N-acetyltransferase HLS1       268   8e-81    
dbj|BAJ87030.1|  predicted protein                                      268   1e-80    
ref|XP_004153722.1|  PREDICTED: uncharacterized protein LOC101222130    266   3e-80    
ref|XP_001782216.1|  predicted protein                                  266   4e-80    
ref|XP_008354926.1|  PREDICTED: probable N-acetyltransferase HLS1       265   5e-80    
ref|XP_004171982.1|  PREDICTED: uncharacterized LOC101222130            264   9e-80    
ref|XP_008457342.1|  PREDICTED: probable N-acetyltransferase HLS1       263   3e-79    
ref|XP_011003801.1|  PREDICTED: probable N-acetyltransferase HLS1...    263   4e-79    
ref|XP_010233910.1|  PREDICTED: probable N-acetyltransferase HLS1       264   6e-79    
gb|KGN65831.1|  hypothetical protein Csa_1G533380                       262   7e-79    
ref|XP_008221351.1|  PREDICTED: probable N-acetyltransferase HLS1       262   7e-79    
dbj|BAC16204.1|  acetyltransferase-like protein                         262   8e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007205302.1|  hypothetical protein PRUPE_ppa006777mg             262   1e-78    
ref|XP_002313243.1|  GCN5-related N-acetyltransferase family protein    259   7e-78    Populus trichocarpa [western balsam poplar]
ref|XP_001755999.1|  predicted protein                                  259   9e-78    
dbj|BAQ15252.1|  acetyl transferase                                     259   3e-77    
ref|XP_010229419.1|  PREDICTED: probable N-acetyltransferase HLS1       258   5e-77    
ref|XP_008805049.1|  PREDICTED: probable N-acetyltransferase HLS1...    255   3e-76    
dbj|BAD38107.1|  GCN5-related N-acetyltransferase-like                  256   3e-76    Oryza sativa Japonica Group [Japonica rice]
gb|EAY82038.1|  hypothetical protein OsI_37224                          255   8e-76    Oryza sativa Indica Group [Indian rice]
dbj|BAJ91125.1|  predicted protein                                      252   9e-75    
ref|XP_006296397.1|  hypothetical protein CARUB_v10025573mg             250   2e-74    
ref|XP_004954689.1|  PREDICTED: uncharacterized protein LOC101782471    251   3e-74    
ref|XP_004143219.1|  PREDICTED: uncharacterized protein LOC101206936    249   7e-74    
ref|XP_006410062.1|  hypothetical protein EUTSA_v10016773mg             249   7e-74    
gb|KHN02087.1|  hypothetical protein glysoja_028290                     248   8e-74    
gb|KGN47059.1|  hypothetical protein Csa_6G182130                       247   1e-72    
ref|XP_002881084.1|  predicted protein                                  244   2e-72    
gb|KEH27508.1|  acyl-CoA N-acyltransferase (NAT) superfamily protein    241   6e-72    
ref|XP_002975895.1|  hypothetical protein SELMODRAFT_104443             243   2e-71    
ref|NP_180570.1|  GCN5-related N-acetyltransferase (GNAT) family ...    243   2e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KFK23396.1|  hypothetical protein AALP_AAs60744U000300               243   2e-71    
ref|XP_008465276.1|  PREDICTED: probable N-acetyltransferase HLS1...    243   2e-71    
ref|XP_002465676.1|  hypothetical protein SORBIDRAFT_01g043530          242   4e-71    Sorghum bicolor [broomcorn]
ref|XP_004985277.1|  PREDICTED: uncharacterized protein LOC101770019    242   6e-71    
ref|XP_010469898.1|  PREDICTED: probable N-acetyltransferase HLS1       240   3e-70    
ref|XP_003558548.1|  PREDICTED: probable N-acetyltransferase HLS1...    239   4e-70    
emb|CDY02031.1|  BnaC04g14700D                                          238   1e-69    
ref|XP_002968586.1|  hypothetical protein SELMODRAFT_231183             236   4e-69    
gb|AGT17212.1|  GCN5-related N-acetyltransferase-like protein           237   5e-69    
ref|XP_002438760.1|  hypothetical protein SORBIDRAFT_10g025680          238   6e-69    Sorghum bicolor [broomcorn]
ref|XP_002314944.2|  hypothetical protein POPTR_0010s15480g             235   2e-68    Populus trichocarpa [western balsam poplar]
ref|XP_006488559.1|  PREDICTED: probable N-acetyltransferase HLS1...    233   3e-68    
ref|XP_010414316.1|  PREDICTED: probable N-acetyltransferase HLS1       234   4e-68    
ref|XP_011010393.1|  PREDICTED: probable N-acetyltransferase HLS1       234   4e-68    
ref|XP_009775549.1|  PREDICTED: probable N-acetyltransferase HLS1       234   5e-68    
ref|XP_009144332.1|  PREDICTED: probable N-acetyltransferase HLS1       234   5e-68    
ref|XP_008649029.1|  PREDICTED: probable N-acetyltransferase HLS1       234   7e-68    
ref|XP_006425109.1|  hypothetical protein CICLE_v10028636mg             231   1e-67    
gb|KDO66957.1|  hypothetical protein CISIN_1g016609mg                   231   2e-67    
ref|XP_003559399.2|  PREDICTED: probable N-acetyltransferase HLS1...    232   3e-67    
ref|XP_003636620.1|  hypothetical protein MTR_049s0011                  229   3e-67    
emb|CDY29705.1|  BnaA04g17220D                                          231   4e-67    
emb|CDX97853.1|  BnaC04g40860D                                          231   5e-67    
ref|XP_002451663.1|  hypothetical protein SORBIDRAFT_04g005470          231   6e-67    Sorghum bicolor [broomcorn]
ref|XP_002272537.1|  PREDICTED: probable N-acetyltransferase HLS1...    231   6e-67    Vitis vinifera
ref|XP_010510412.1|  PREDICTED: probable N-acetyltransferase HLS1       231   7e-67    
ref|XP_010521965.1|  PREDICTED: probable N-acetyltransferase HLS1       231   8e-67    
ref|XP_009141034.1|  PREDICTED: probable N-acetyltransferase HLS1       229   4e-66    
ref|XP_008797477.1|  PREDICTED: probable N-acetyltransferase HLS1...    229   5e-66    
ref|XP_004967130.1|  PREDICTED: uncharacterized protein LOC101759075    228   1e-65    
ref|XP_002519221.1|  N-acetyltransferase, putative                      228   1e-65    Ricinus communis
ref|XP_010417654.1|  PREDICTED: probable N-acetyltransferase HLS1       221   2e-65    
ref|XP_010259269.1|  PREDICTED: probable N-acetyltransferase HLS1...    227   2e-65    
emb|CBI22885.3|  unnamed protein product                                227   3e-65    
ref|XP_004145309.1|  PREDICTED: uncharacterized protein LOC101222575    222   4e-64    
ref|XP_004169976.1|  PREDICTED: uncharacterized protein LOC101230974    223   6e-64    
ref|XP_008674544.1|  PREDICTED: HLS1 isoform X1                         223   8e-64    
ref|XP_010558876.1|  PREDICTED: probable N-acetyltransferase HLS1       223   2e-63    
ref|XP_010932014.1|  PREDICTED: probable N-acetyltransferase HLS1...    222   2e-63    
ref|XP_008659854.1|  PREDICTED: probable N-acetyltransferase HLS1...    219   5e-62    
ref|XP_009386826.1|  PREDICTED: probable N-acetyltransferase HLS1...    212   8e-61    
ref|XP_003528620.1|  PREDICTED: probable N-acetyltransferase HLS1...    214   1e-60    
ref|XP_003550641.1|  PREDICTED: probable N-acetyltransferase HLS1...    214   1e-60    
ref|XP_007154376.1|  hypothetical protein PHAVU_003G114000g             213   3e-60    
ref|XP_007035791.1|  Acyl-CoA N-acyltransferases superfamily protein    213   5e-60    
gb|EEC74724.1|  hypothetical protein OsI_10449                          213   7e-60    
ref|NP_001049316.1|  Os03g0205800                                       212   1e-59    
gb|ABF94546.1|  acetyltransferase, GNAT family protein, expressed       212   1e-59    
ref|XP_006488844.1|  PREDICTED: probable N-acetyltransferase HLS1...    211   2e-59    
ref|XP_007147361.1|  hypothetical protein PHAVU_006G117700g             210   7e-59    
gb|KHN12871.1|  hypothetical protein glysoja_029405                     209   8e-59    
ref|XP_003533167.2|  PREDICTED: probable N-acetyltransferase HLS1...    210   9e-59    
ref|XP_006419388.1|  hypothetical protein CICLE_v10006832mg             209   2e-58    
gb|EMT24699.1|  hypothetical protein F775_12300                         207   1e-57    
gb|KDO71935.1|  hypothetical protein CISIN_1g044426mg                   207   1e-57    
tpg|DAA59411.1|  TPA: hypothetical protein ZEAMMB73_309273              204   1e-57    
dbj|BAD25129.1|  GCN5-related N-acetyltransferase-like                  205   7e-57    
ref|XP_008653585.1|  PREDICTED: probable N-acetyltransferase HLS1       202   7e-57    
ref|XP_007224292.1|  hypothetical protein PRUPE_ppa019487mg             201   1e-55    
gb|EMS62901.1|  hypothetical protein TRIUR3_31724                       199   5e-55    
ref|XP_009369936.1|  PREDICTED: probable N-acetyltransferase HLS1...    197   2e-54    
ref|XP_006651843.1|  PREDICTED: LOW QUALITY PROTEIN: probable N-a...    194   1e-53    
ref|XP_004295085.1|  PREDICTED: uncharacterized protein LOC101309138    194   5e-53    
ref|XP_008223355.1|  PREDICTED: probable N-acetyltransferase HLS1...    194   6e-53    
ref|XP_008390526.1|  PREDICTED: probable N-acetyltransferase HLS1       192   2e-52    
ref|XP_004165484.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   3e-51    
ref|XP_008438951.1|  PREDICTED: LOW QUALITY PROTEIN: probable N-a...    189   7e-51    
gb|EEE58544.1|  hypothetical protein OsJ_09840                          185   8e-51    
ref|XP_004134504.1|  PREDICTED: uncharacterized protein LOC101215331    188   1e-50    
gb|KHN23236.1|  hypothetical protein glysoja_038453                     182   1e-50    
gb|KDP45784.1|  hypothetical protein JCGZ_17391                         174   5e-47    
ref|XP_006658228.1|  PREDICTED: probable N-acetyltransferase HLS1...    172   9e-47    
ref|XP_004508260.1|  PREDICTED: uncharacterized protein LOC101514829    175   8e-46    
ref|XP_010259270.1|  PREDICTED: probable N-acetyltransferase HLS1...    172   8e-46    
gb|EEE66129.1|  hypothetical protein OsJ_22176                          176   2e-45    
ref|XP_008680886.1|  PREDICTED: probable N-acetyltransferase HLS1       168   2e-44    
ref|XP_010914573.1|  PREDICTED: probable N-acetyltransferase HLS1...    167   9e-44    
gb|EEC81426.1|  hypothetical protein OsI_24681                          165   9e-44    
gb|EAY84732.1|  hypothetical protein OsI_06101                          169   2e-43    
ref|XP_003609769.1|  hypothetical protein MTR_4g122030                  166   3e-43    
ref|XP_010558445.1|  PREDICTED: probable N-acetyltransferase HLS1...    166   2e-42    
ref|XP_006651147.1|  PREDICTED: probable N-acetyltransferase HLS1...    156   1e-40    
ref|XP_010558446.1|  PREDICTED: probable N-acetyltransferase HLS1...    159   4e-40    
ref|XP_010229002.1|  PREDICTED: probable N-acetyltransferase HLS1...    156   7e-40    
ref|XP_010671716.1|  PREDICTED: probable N-acetyltransferase HLS1...    156   3e-39    
ref|XP_010671715.1|  PREDICTED: probable N-acetyltransferase HLS1...    157   3e-39    
ref|XP_010671717.1|  PREDICTED: probable N-acetyltransferase HLS1...    153   2e-38    
ref|NP_001147751.1|  HLS1                                               145   2e-36    
tpg|DAA43903.1|  TPA: HLS1                                              144   7e-36    
gb|ABA98942.1|  acetyltransferase, GNAT family protein                  145   2e-35    
gb|EMT16901.1|  hypothetical protein F775_43844                         132   4e-32    
gb|ABF94547.1|  acetyltransferase, GNAT family protein, expressed       129   2e-30    
gb|KDO44016.1|  hypothetical protein CISIN_1g0154292mg                  120   3e-29    
ref|XP_010671719.1|  PREDICTED: probable N-acetyltransferase HLS1...    112   2e-24    
ref|XP_010906876.1|  PREDICTED: probable N-acetyltransferase HLS1...    110   1e-23    
ref|XP_006606720.1|  PREDICTED: probable N-acetyltransferase HLS1...    104   2e-22    
gb|KHN30624.1|  hypothetical protein glysoja_049753                   88.6    4e-17    
ref|XP_010313238.1|  PREDICTED: probable N-acetyltransferase HLS1...  74.7    2e-12    
gb|EMS65253.1|  hypothetical protein TRIUR3_14524                     73.6    6e-12    
ref|XP_008662411.1|  PREDICTED: uncharacterized protein LOC103640704  75.9    3e-11    
gb|AFW55929.1|  hypothetical protein ZEAMMB73_169157                  74.3    1e-10    
ref|XP_007146798.1|  hypothetical protein PHAVU_006G0707002g          64.3    2e-09    
tpg|DAA40015.1|  TPA: hypothetical protein ZEAMMB73_643348            65.1    3e-08    
ref|XP_007146799.1|  hypothetical protein PHAVU_006G0707000g          59.3    1e-07    
ref|XP_005834117.1|  hypothetical protein GUITHDRAFT_107048           63.2    2e-07    
gb|ACR61547.1|  putative N-acetyltransferase                          58.5    2e-07    
ref|XP_002457416.1|  hypothetical protein SORBIDRAFT_03g006940        59.3    1e-06    
ref|XP_002862416.1|  hypothetical protein ARALYDRAFT_920751           54.3    1e-05    
gb|AFK43173.1|  unknown                                               53.9    2e-05    
ref|WP_017652004.1|  hypothetical protein                             50.8    4e-04    
gb|EEN85213.1|  acetyltransferase, GNAT family                        52.4    4e-04    
ref|WP_036199319.1|  aminoglycoside 6'-acetyltransferase              50.1    4e-04    
ref|WP_037131869.1|  acetyltransferase                                52.4    4e-04    
ref|WP_007730122.1|  acetyltransferase                                52.0    5e-04    
gb|AFW86442.1|  hypothetical protein ZEAMMB73_630537                  52.4    5e-04    
ref|WP_013012457.1|  aminoglycoside N(6')-acetyltransferase           49.7    6e-04    
ref|WP_008190112.1|  acetyltransferase                                50.1    7e-04    
tpg|DAA51553.1|  TPA: hypothetical protein ZEAMMB73_436841            48.9    8e-04    



>ref|XP_004235944.1| PREDICTED: probable N-acetyltransferase HLS1 [Solanum lycopersicum]
Length=410

 Score =   498 bits (1283),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/406 (59%), Positives = 304/406 (75%), Gaps = 11/406 (3%)
 Frame = +2

Query  116   AEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMV  295
               K  E+VVRQY+EE+DK+AVEELE QC+ GQ G+P L  DL+ DPI R+RN PLHVM+V
Sbjct  16    TNKKTEIVVRQYDEEKDKLAVEELEGQCDFGQRGQPSLFTDLMGDPISRIRNLPLHVMLV  75

Query  296   AEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQ  475
             AE+G + EIVGVIRG I++V+RG KG       YV +AYILGLRVSS HRRLGIGTKLV+
Sbjct  76    AEYGNNGEIVGVIRGCIKTVTRGNKGSTPCPV-YVKIAYILGLRVSSHHRRLGIGTKLVE  134

Query  476   SLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVA  655
             +LE W + NGA Y YMATD +N+ASI LF    NY KFRTPSVLVQPVH H KP+ SD+A
Sbjct  135   NLEEWSKINGAKYAYMATDSNNEASIKLFVSKCNYAKFRTPSVLVQPVHAHYKPVASDIA  194

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFP  835
             +VRV PQL+ES+YRR F  +SEFFPKDI+ +L+NKLN GTFMAVPK++L  W+P SG FP
Sbjct  195   IVRVSPQLSESFYRRIF-ANSEFFPKDIDHILDNKLNFGTFMAVPKKTLFNWDPKSGSFP  253

Query  836   TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
                AILS+W+ KEVYK+QV+G+S+LK AC LGTRVLD  +PW+R+PS+PN+ K FG+Y L
Sbjct  254   QTFAILSVWNTKEVYKLQVRGVSSLKYACCLGTRVLDSWMPWLRVPSIPNIFKMFGFYLL  313

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDL  1195
             +G+ MEG+ G  +M+SL+AFAHN+ RND+  C LL++EV  DDPV+  IP W  FSW DL
Sbjct  314   YGIHMEGKDGPRLMKSLYAFAHNMGRNDKE-CRLLVSEVGFDDPVKEAIPRWNKFSWGDL  372

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WC+K L++    +  +        S        +SS++IFVDPRD 
Sbjct  373   WCMKKLDVDELLSKEDDNWMESQVS--------NSSSVIFVDPRDF  410



>ref|XP_006341342.1| PREDICTED: probable N-acetyltransferase HLS1-like [Solanum tuberosum]
Length=409

 Score =   497 bits (1279),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/408 (59%), Positives = 304/408 (75%), Gaps = 19/408 (5%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             +K  E+VVRQY+EE+DK+AVEELE QC+ GQ G+P L  DL+ DPI R+RN PLHVM+VA
Sbjct  18    KKTEEIVVRQYDEEKDKLAVEELEGQCDFGQRGQPSLFTDLMGDPISRIRNLPLHVMLVA  77

Query  299   EHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
             E+G   +IVGVIRG I++V+RG  G       YV +AY+LGLRVSS HRRLGIGTKLV++
Sbjct  78    EYGNDGDIVGVIRGCIKTVTRGNNGSTPCPV-YVKIAYVLGLRVSSHHRRLGIGTKLVEN  136

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W + NGA Y YMATD SN+ASI LF    NY KFRTP VLVQPVH H KP+ SD+A+
Sbjct  137   LEEWSKINGAKYAYMATDSSNEASIKLFISKCNYAKFRTPFVLVQPVHAHYKPVASDIAI  196

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             VRV PQL+ES+YRR F  +SEFFPKDI+ +L+NKLN GTFMAVPK++L  W+P SG FPT
Sbjct  197   VRVSPQLSESFYRRIF-ANSEFFPKDIDHILDNKLNFGTFMAVPKKTLLNWDPKSGSFPT  255

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
               AILS+W+ KEVYK+QV+G+S+LK AC LGTRVLD  +PW+R+PS+PN+ K FG+Y L+
Sbjct  256   TFAILSVWNTKEVYKLQVRGVSSLKYACCLGTRVLDSWMPWLRVPSIPNIFKMFGFYLLY  315

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLW  1198
             G+ MEG+ G  +M+SL+AFAHN+ RND+  C LL++EV  DDP++  IP W  FSW DLW
Sbjct  316   GIHMEGKDGPRLMKSLYAFAHNMGRNDKE-CRLLVSEVGFDDPIKEAIPRWNKFSWGDLW  374

Query  1199  CIkhlnlvgdnnnnnkaanivhdSSEDSIM---YHDSSALIFVDPRDI  1333
             C+             K  ++   S +D+ M     +SS++IFVDPRD 
Sbjct  375   CM-------------KKLDVNELSKDDNWMESQVSNSSSVIFVDPRDF  409



>ref|XP_009613433.1| PREDICTED: probable N-acetyltransferase HLS1 [Nicotiana tomentosiformis]
Length=412

 Score =   493 bits (1270),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/362 (64%), Positives = 284/362 (78%), Gaps = 4/362 (1%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             +K P V+VRQY+EERDK+AVEELE QC+ GQ G+P L  DL+ DPI R+RN PLH+M+VA
Sbjct  23    DKKPVVIVRQYDEERDKLAVEELEGQCDFGQRGQPSLFTDLMGDPISRIRNLPLHLMLVA  82

Query  299   EHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
             E    +EIVG+IRG I++V+RG KG       YV +AYILGLRVSSQHRRLGIGTKLV+ 
Sbjct  83    E-AECREIVGIIRGCIKTVTRGNKGSTPCPV-YVKIAYILGLRVSSQHRRLGIGTKLVEE  140

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W RSNGA Y YMATD +NQASI LFT   NYVKFRTPSVLVQPVH H KPI SD+A+
Sbjct  141   LEEWSRSNGATYAYMATDSNNQASIKLFTSKCNYVKFRTPSVLVQPVHAHYKPIASDIAI  200

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             VRV PQL+ES+YRR F  +SEFFPKDIN +LNN L+ GTFMAVPK++L  W+P SG FP 
Sbjct  201   VRVSPQLSESFYRRIF-ANSEFFPKDINRILNNNLSFGTFMAVPKKTLLNWDPKSGSFPP  259

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
               AILS+W+ K++YK+QV G+S LK AC LGTRVLD  +PW+R+PS+PN+ K+FG++ L+
Sbjct  260   TFAILSVWNTKDIYKLQVSGISPLKYACCLGTRVLDSWMPWLRVPSIPNIFKSFGFHLLY  319

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLW  1198
             G+ MEG+ G  +M++L AFAHN+ RNDR  C LL+AEV  DDPVR  IP W  FSW DLW
Sbjct  320   GIHMEGKEGPRLMKNLCAFAHNMGRNDRE-CSLLVAEVGVDDPVREAIPRWNKFSWGDLW  378

Query  1199  CI  1204
             C+
Sbjct  379   CM  380



>ref|XP_009762031.1| PREDICTED: probable N-acetyltransferase HLS1 [Nicotiana sylvestris]
Length=434

 Score =   488 bits (1257),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/404 (60%), Positives = 298/404 (74%), Gaps = 20/404 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH--G  307
             V+VRQY+EERDK+AVEELE QC+ GQ G+P L  DL+ DPI R+RN PLHVM+VAE   G
Sbjct  47    VIVRQYDEERDKLAVEELEGQCDFGQRGQPSLFTDLMGDPISRIRNLPLHVMLVAEAECG  106

Query  308   ISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLEN  487
               +EIVG+IRG I++V+RG KG       YV +AYILGLRVSSQHRRLGIGTKLV+ LE 
Sbjct  107   KDREIVGIIRGCIKTVTRGNKGSTPCPV-YVKIAYILGLRVSSQHRRLGIGTKLVEKLEE  165

Query  488   WGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRV  667
             W  SNGA Y YMATD +N ASI LFT   NYVKFRTPSVLVQPVH H KPI SD+A+VRV
Sbjct  166   WCSSNGAKYAYMATDSNNLASIKLFTSKCNYVKFRTPSVLVQPVHAHYKPIASDIAIVRV  225

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHA  847
              PQL+ES+YRR F  +SEFFPKDIN +LNN L+ GTFMAVPK++L  W+P SG FP   A
Sbjct  226   SPQLSESFYRRIF-ANSEFFPKDINHILNNNLSFGTFMAVPKKTLLNWDPKSGSFPPTFA  284

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLR  1027
             ILS+W+ K++YK+QV+G+S LK AC LGTRVLD  +PW+R+PS+PN+ K+FG+Y L+G+ 
Sbjct  285   ILSVWNTKDIYKLQVRGISPLKYACCLGTRVLDSWMPWLRVPSIPNIFKSFGFYLLYGIH  344

Query  1028  MEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCIk  1207
             MEG+ G  +M++L AFAHN+ RNDR  C LL+AEV  DDPV+  IP W  FSW DLWC+ 
Sbjct  345   MEGKEGPRLMKNLCAFAHNMGRNDRE-CSLLVAEVGVDDPVKEAIPRWNKFSWGDLWCM-  402

Query  1208  hlnlvgdnnnnnkaanivhdSSEDS--IMYHDSSALIFVDPRDI  1333
                         K     +  SED+       SS++IFVDPRD 
Sbjct  403   ------------KNLEFKNGESEDNWVESPVSSSSVIFVDPRDF  434



>ref|XP_011073602.1| PREDICTED: probable N-acetyltransferase HLS1 [Sesamum indicum]
Length=407

 Score =   481 bits (1238),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 300/409 (73%), Gaps = 19/409 (5%)
 Frame = +2

Query  110   AVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVM  289
             A  E+ P VVVRQY+E  DK AVEELE +CEVGQ GKP LV DL+ DPI RVRN   H+M
Sbjct  17    AAEEEKPPVVVRQYDEASDKAAVEELERRCEVGQPGKPSLVTDLMGDPIARVRNFVSHIM  76

Query  290   MVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKL  469
             +VAE+G  +EIVGVIRG I++V+ G++  +     YV  AYILGLRVSS HRRLGI TKL
Sbjct  77    LVAEYGDVREIVGVIRGCIKTVTSGKRSSSTQLPVYVKFAYILGLRVSSTHRRLGIATKL  136

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ LE W + NGA+Y YMAT+CSN+ S+NLFT   +Y+KFR P+VLVQPVH H KP+ SD
Sbjct  137   VRELEGWCKQNGAEYAYMATECSNKPSLNLFTQKCHYLKFRNPTVLVQPVHLHSKPLASD  196

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             + +V+VPPQ  E  YRR F  SSEFFPKDI+ +L+NKLNLGTF+A+PK+S+S W P +G 
Sbjct  197   IMIVQVPPQQVELVYRRVF-SSSEFFPKDIDRLLSNKLNLGTFVALPKKSVSKWNPKAGE  255

Query  830   FPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYY  1009
             FP + AILSIWD KEV+++QVKG+S+L  A  LGTRVLD ++PW+++PS+PNV KNFG+Y
Sbjct  256   FPPSFAILSIWDTKEVFRLQVKGVSSLTHAACLGTRVLDAMVPWLKIPSIPNVFKNFGFY  315

Query  1010  FLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-  1186
             F++GL MEG+ G  +M++L  F HN ARND   C +++AEV   DPVR  IPHWK FSW 
Sbjct  316   FMYGLYMEGKDGPRLMKNLCKFVHNTARND-PDCRVVVAEVGQTDPVREAIPHWKKFSWD  374

Query  1187  QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             +D+WCIK L  V                +++   +H SS +IFVDPRD+
Sbjct  375   EDIWCIKKLGQV----------------NQNHYDWHKSSPVIFVDPRDL  407



>emb|CDO98232.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   472 bits (1214),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 302/422 (72%), Gaps = 16/422 (4%)
 Frame = +2

Query  92    MSFKVAAVA-------EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS K+AA +       EK   VVVR Y+ ERDK AVEELE Q EVG+ GKP +V DL+ D
Sbjct  1     MSTKIAAESFPNPPPGEKPVLVVVRVYDGERDKAAVEELERQYEVGKPGKPSVVTDLMGD  60

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             P  R+RN   H+M+VAE+G  + IVGVIRG ++SV++G K  +     YV +A ILGLRV
Sbjct  61    PTARIRNFTSHIMLVAEYGFERRIVGVIRGCLKSVTKG-KNPSGRFPAYVKLACILGLRV  119

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S+ HRRLGIGTKLVQ LE W R NGADY YMAT+CSNQ S+NLFT   NY+KFR+P+VLV
Sbjct  120   STAHRRLGIGTKLVQQLEEWCRKNGADYAYMATECSNQPSLNLFTTKFNYIKFRSPTVLV  179

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QP+H H KP+ S +A++RV P+LA   YRR F  SSEFFP+D++++LNNKL+LGTF+A+P
Sbjct  180   QPIHAHDKPLSSSIALIRVSPELATLVYRRIF-ASSEFFPEDVDMILNNKLSLGTFVALP  238

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K  LS W+P S  FP + AILSIW+ KEV+K++VKG+S+LK AC + +R +D  +PW+RL
Sbjct  239   KGYLSNWDPKSHTFPPSFAILSIWNTKEVFKLKVKGVSSLKYACSVASRAVDAFLPWLRL  298

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+PN+ + FG YFL+GL MEG  GS +M SL +FAHN+A++D RGC +L+AEV+P+DPV
Sbjct  299   PSIPNIFRQFGLYFLYGLHMEGPHGSYLMRSLCSFAHNMAKDD-RGCGILVAEVNPNDPV  357

Query  1151  RRGIPHWKNFSWQDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHD-SSALIFVDPR  1327
             +  IPHWK FSW DLWCI             +         +D I     SS++ FVDPR
Sbjct  358   KEAIPHWKRFSWDDLWCI-----KKLAVAKEEGQESGSFEPQDWIKSRACSSSVTFVDPR  412

Query  1328  DI  1333
             DI
Sbjct  413   DI  414



>ref|XP_002512722.1| N-acetyltransferase, putative [Ricinus communis]
 gb|EEF49225.1| N-acetyltransferase, putative [Ricinus communis]
Length=406

 Score =   457 bits (1176),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 301/422 (71%), Gaps = 24/422 (6%)
 Frame = +2

Query  92    MSFKVAAVAEKLP-------EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS +VAA  E  P       E+ VR+YEE RDK AVEE+E  CEVGQ GKP LV DLL D
Sbjct  1     MSLRVAA--ENFPLSPVTGEELTVREYEEGRDKAAVEEMEKLCEVGQRGKPSLVTDLLGD  58

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             PI RVR  P +VM+VAE+G  ++IVGVIR  I++V+RG      NS+DYV +AYILGLRV
Sbjct  59    PICRVRYFPSYVMLVAEYGKERQIVGVIRVCIKTVTRG------NSSDYVKLAYILGLRV  112

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRRLGIG+KLVQ +E W +  GA+Y YMATDC+N+ SINLFT   +Y KFRT S+LV
Sbjct  113   SPTHRRLGIGSKLVQEIEEWCKQKGAEYAYMATDCTNEPSINLFTRKCSYTKFRTLSMLV  172

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H KPI SDVA+VR+  +LAES Y R F   +EFFPKDI+ +L+++LNLGTFMA+P
Sbjct  173   QPVHAHYKPIDSDVAIVRLTAKLAESIYCRAF-ADAEFFPKDIDTILSSRLNLGTFMAMP  231

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K+ LS W+P +G+ P+N AILS+W+ KEV+K+QVKG+S L  AC  G+R+LD  +PW+RL
Sbjct  232   KKFLSKWDPKTGILPSNFAILSVWNTKEVFKLQVKGVSKLTYACCKGSRLLDSWMPWLRL  291

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V + FG YFL GL MEG+  S +M++L AFAHN+AR+D  GC  ++AEV   DPV
Sbjct  292   PSFPDVFRQFGVYFLHGLHMEGKHASRLMKALCAFAHNMARDD-DGCGAVVAEVGHCDPV  350

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
              + IPHW+ FSW +DLWCI         +++ K     +    D +    +S++IFVDPR
Sbjct  351   GKVIPHWRKFSWAEDLWCI------KKMSDDEKQNVDENCGPSDWMRSRPASSVIFVDPR  404

Query  1328  DI  1333
             D 
Sbjct  405   DF  406



>ref|XP_006427628.1| hypothetical protein CICLE_v10025742mg [Citrus clementina]
 gb|ESR40868.1| hypothetical protein CICLE_v10025742mg [Citrus clementina]
Length=407

 Score =   456 bits (1172),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 227/425 (53%), Positives = 299/425 (70%), Gaps = 29/425 (7%)
 Frame = +2

Query  92    MSFKVAAVAEKLPE----------VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDL  241
             MS K+AA  E  PE          V+VR+Y EERDK+ VEE+E +CE GQ GKP LV DL
Sbjct  1     MSMKIAA--ENSPEFPMKTKVNSVVIVREYNEERDKLGVEEIERRCETGQRGKPTLVTDL  58

Query  242   LDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILG  421
             + DP+ RVR+ P H+ +VAE+G  KEIVGVIRG +++V+ G        +++V +AY+LG
Sbjct  59    MGDPVCRVRHFPSHIALVAEYGEEKEIVGVIRGCVKTVTTG-------GSNFVKLAYLLG  111

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRRLGIGTKLVQ LE W +  GA+Y YMATDC N+ASINLFT   +Y KFRTP+
Sbjct  112   LRVSPTHRRLGIGTKLVQKLEEWCKQQGAEYSYMATDCGNEASINLFTRKCSYTKFRTPT  171

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LVQPVH H KP+G+ +++VR+P + AE+ YRR F  +SEFFPKDI+L+L++ LNLGTFM
Sbjct  172   MLVQPVHAHYKPVGAGISIVRLPRKSAETIYRRVF-ANSEFFPKDIDLILSSNLNLGTFM  230

Query  782   AVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPW  961
             AVPK+ +  W+P +G+ P + AILS+W+ KEV+K+Q+KG+SALK A  +G+R+LD  +PW
Sbjct  231   AVPKKFVPRWDPKTGILPPSFAILSVWNTKEVFKLQLKGVSALKYAFCVGSRLLDAWMPW  290

Query  962   IRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPD  1141
             +RLPS P+V + FG YFL+GL MEG+  S +M+SL AFAHN+AR+D   C  L+AEV   
Sbjct  291   LRLPSFPDVFRQFGVYFLYGLHMEGKHASLLMKSLCAFAHNMARDDGE-CGALVAEVGAK  349

Query  1142  DPVRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFV  1318
             DPVR  IPHW+ FSW +DLWCI                        D +    S+++IFV
Sbjct  350   DPVRETIPHWRKFSWAEDLWCI-------KKIGAVDEDRNERCPPSDWMKSRSSTSVIFV  402

Query  1319  DPRDI  1333
             DPRDI
Sbjct  403   DPRDI  407



>ref|XP_010275833.1| PREDICTED: probable N-acetyltransferase HLS1 [Nelumbo nucifera]
Length=416

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/421 (53%), Positives = 304/421 (72%), Gaps = 15/421 (4%)
 Frame = +2

Query  92    MSFKVAAVAEKLP------EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDP  253
             +S K+A    K P       +VVR+YEE++D+VAVEE+E +C+VG  GK  L  D + DP
Sbjct  4     LSVKIAEAPVKPPLKMEEGGLVVREYEEKKDRVAVEEMEQRCDVGPRGKASLFTDDMGDP  63

Query  254   IGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVS  433
             I R+R++P ++M+VAE+G  +EIVGVIRG I++V+RG++  +D S  YV VAYILGLRVS
Sbjct  64    ICRIRHSPSYLMLVAEYGEGREIVGVIRGCIKTVTRGKQPTSDFSI-YVKVAYILGLRVS  122

Query  434   SQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
               HRRLGIGTKLV+ +E W R  GA+Y YMATDC N+ASINLFT    YVKFRTP+VLVQ
Sbjct  123   PTHRRLGIGTKLVEKMEEWSREEGAEYAYMATDCDNEASINLFTLKCAYVKFRTPTVLVQ  182

Query  614   PVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK  793
             PVH H KP+GS VAVV++  QLAE  YRR F  +SEFFPKDI+++L+NKLNLGTFMA+PK
Sbjct  183   PVHAHYKPLGSGVAVVQLSAQLAEFVYRRVF-ANSEFFPKDIDVILSNKLNLGTFMALPK  241

Query  794   ESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
             ++L+ W+P +G  P ++AILS+W+ KEV+K+Q+KG+S++  AC +G+R+LD  +PW+R+P
Sbjct  242   KALAKWDPQTGHLPPSYAILSVWNTKEVFKLQMKGVSSITYACCIGSRLLDVWMPWLRIP  301

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S+P+V + FG YFL+GL MEG+  S +M+ L  FAHN+ R+D  GC  ++AEV   DPVR
Sbjct  302   SIPDVFRPFGVYFLYGLHMEGKGASRLMKGLCTFAHNMGRDD-PGCGAVVAEVGRRDPVR  360

Query  1154  RGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRD  1330
              GIPHW+ FSW +DLWCI            +       + + D I     S ++FVDPR+
Sbjct  361   EGIPHWRRFSWAEDLWCI-----KKLTTAKHDIEEEEEEGTLDWIRSPPPSPVVFVDPRE  415

Query  1331  I  1333
              
Sbjct  416   F  416



>ref|XP_006493357.1| PREDICTED: probable N-acetyltransferase HLS1-like [Citrus sinensis]
Length=407

 Score =   452 bits (1163),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 299/425 (70%), Gaps = 29/425 (7%)
 Frame = +2

Query  92    MSFKVAAVAEKLPE----------VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDL  241
             MS K+AA  E  PE          V+VR+Y EERDK+ VEE+E +CE GQ GKP LV DL
Sbjct  1     MSMKIAA--ENSPEFPMKIKVNSVVIVREYNEERDKLGVEEIERRCETGQRGKPTLVTDL  58

Query  242   LDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILG  421
             + DP+ RVR+ P H+ +VAE+G  KE VGVIRG +++V+ G        +++V +AY+LG
Sbjct  59    MGDPVCRVRHFPSHIALVAEYGEEKETVGVIRGCVKTVTTG-------GSNFVKLAYLLG  111

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRRLGIGTKLVQ LE W +  GA+Y YMAT+CSN+ASINLFT   +Y KFRTP+
Sbjct  112   LRVSPTHRRLGIGTKLVQKLEEWCKQQGAEYSYMATECSNEASINLFTRKCSYTKFRTPT  171

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LVQPVH H KP+G+ +++VR+P + AE+ YRR F  +SEFFPKDI+L+L++ LNLGTFM
Sbjct  172   MLVQPVHAHYKPVGAGISIVRLPRKSAETVYRRVF-ANSEFFPKDIDLILSSNLNLGTFM  230

Query  782   AVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPW  961
             A+PK+ +  W+P +G+ P + AILS+W+ KEV+K+Q+KG+SALK A  +G+R+LD  +PW
Sbjct  231   AMPKKFVPRWDPKTGILPPSFAILSVWNTKEVFKLQLKGVSALKYAFCVGSRLLDAWMPW  290

Query  962   IRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPD  1141
             +RLPS P+V + FG YFL+GL MEG+  S +M+SL AFAHN+AR+D   C  L+AEV   
Sbjct  291   LRLPSFPDVFRQFGVYFLYGLHMEGKHASLLMKSLCAFAHNMARDDGE-CGALVAEVGAK  349

Query  1142  DPVRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFV  1318
             DPVR  IPHW+ FSW +DLWCI                        D +    S+++IFV
Sbjct  350   DPVRETIPHWRKFSWAEDLWCI-------KKIGAVDEDRNERCPPSDWMKSRSSTSVIFV  402

Query  1319  DPRDI  1333
             DPRDI
Sbjct  403   DPRDI  407



>ref|XP_010265571.1| PREDICTED: probable N-acetyltransferase HLS1-like [Nelumbo nucifera]
Length=399

 Score =   452 bits (1162),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 296/401 (74%), Gaps = 10/401 (2%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+YEE+RD+VAVEE+E +CE+G  GKP L  D + DPI R+R++P ++M+VAE G +
Sbjct  8     VAVREYEEKRDRVAVEEMERRCELGPGGKPSLFTDDMGDPICRIRHSPAYLMLVAEFGKA  67

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWG  493
             +EIVGVIRG I++V+RG+K  +D S  YV VAYILGLRV   HRRLGIGTKLV+ LE W 
Sbjct  68    REIVGVIRGCIKTVTRGKKAMSDCSI-YVKVAYILGLRVLPTHRRLGIGTKLVEKLEEWC  126

Query  494   RSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPP  673
             +  GA+Y YMATDC+N+ASINLFT    Y+ FRTP+VLVQPVH H +P+GS VAVV++ P
Sbjct  127   KQKGAEYAYMATDCTNEASINLFTLKCAYMMFRTPTVLVQPVHAHYRPLGSGVAVVQLSP  186

Query  674   QLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAIL  853
              LAE  YRR F  +SEFFPKDI+++L+NKLNLGTFMA+PK++L+ W+P +G  P  +AI+
Sbjct  187   HLAELIYRRVF-ANSEFFPKDIDVILSNKLNLGTFMALPKKALAKWDPKTGHLPPCYAIM  245

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRME  1033
             S+W+ KEV+K+Q+KG+S L  AC + +R+LD  +PW+R+PS+P+V + FG YFL+GL ME
Sbjct  246   SVWNTKEVFKLQMKGVSRLTYACCVTSRLLDSWMPWLRIPSIPDVFRQFGVYFLYGLHME  305

Query  1034  GQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkh  1210
             G+  S +M+ L AFAHN+ R+D  GC  ++AEV   DPVR  IPHW+ FSW +DLWCI  
Sbjct  306   GKGASRLMKGLCAFAHNMGRDD-SGCGAVVAEVGRRDPVREVIPHWRRFSWAEDLWCI--  362

Query  1211  lnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                     +  +  +  +  + D I    S+ ++FVDPR+ 
Sbjct  363   ----KKLTSAKQDIDEENGGTLDWIRSRPSTPVVFVDPREF  399



>ref|XP_002299247.2| hypothetical protein POPTR_0001s03570g [Populus trichocarpa]
 gb|EEE84052.2| hypothetical protein POPTR_0001s03570g [Populus trichocarpa]
Length=408

 Score =   452 bits (1162),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 294/422 (70%), Gaps = 22/422 (5%)
 Frame = +2

Query  92    MSFKVAA-------VAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS ++AA       V E    VVVR+Y+E RDKVAVEE+E  CEVGQ GK  LV DL+ D
Sbjct  1     MSLRIAADNFPTLPVGEMENFVVVREYDEGRDKVAVEEMERSCEVGQRGKHSLVTDLMGD  60

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             PI RVR  P HVM+VAE G   EIVGVIR  + +V      +   S+ YV +AYILGLRV
Sbjct  61    PICRVRRFPSHVMLVAECGDGGEIVGVIRACVNTV------RTRESSGYVKLAYILGLRV  114

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRRLGIGTKLVQ +E W +  GA+Y YMATDCSN+ SINLFT    Y KFRT ++LV
Sbjct  115   SPSHRRLGIGTKLVQEIEEWCKQKGAEYSYMATDCSNEPSINLFTRKCFYTKFRTLTMLV  174

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H KP+GS +A++++PP+LAE+ Y R F   +EFFPKDI  +L++KLNLGTFMAVP
Sbjct  175   QPVHAHYKPLGSGIAIIQLPPKLAEAIYCRVF-ADAEFFPKDIGTILSSKLNLGTFMAVP  233

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K++L  W+P +G+ P++ A+LS+W+ KEV+K+QVKG+S L  AC  GTR+LD  +PW+RL
Sbjct  234   KKALPKWDPKTGILPSSFALLSVWNTKEVFKLQVKGVSKLTYACCTGTRLLDAWMPWLRL  293

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V + FG YFL+GL MEG++ S +M++L AFAHN+AR+D  GC  ++AEV+  DPV
Sbjct  294   PSFPDVFRQFGVYFLYGLHMEGKNASRLMKALCAFAHNMARDD-DGCGAVVAEVAQRDPV  352

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
             R  IPHW+ FSW +DLWCI          +             D + +  SS +IFVDPR
Sbjct  353   REVIPHWRRFSWAEDLWCI------KKLADEKLDDVDRRCGQSDWMKHGSSSPVIFVDPR  406

Query  1328  DI  1333
             DI
Sbjct  407   DI  408



>ref|XP_007135825.1| hypothetical protein PHAVU_010G161500g [Phaseolus vulgaris]
 gb|ESW07819.1| hypothetical protein PHAVU_010G161500g [Phaseolus vulgaris]
Length=401

 Score =   446 bits (1147),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 297/423 (70%), Gaps = 31/423 (7%)
 Frame = +2

Query  92    MSFKVAA-VAEKLPE-------VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLD  247
             MS K+AA +  K P        +VV +Y+E+R KVAVE+LE  CEVGQ GKP LV DL+ 
Sbjct  1     MSLKIAAEIYPKSPSETVEEPLIVVNEYDEDRHKVAVEKLERLCEVGQSGKPSLVTDLMG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLR  427
             DPI R+R+  LHVM+VAE+G   E+VGVIRG +++V+RG      NS  YV +AYILGLR
Sbjct  61    DPICRIRHFQLHVMLVAEYGEEGEVVGVIRGCVKTVTRG------NSV-YVKLAYILGLR  113

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS +HRR GIGTKLVQ LE+W +  GA Y YMATDC+N+ S+NLFT    Y KFRT ++L
Sbjct  114   VSPRHRRFGIGTKLVQHLEDWCKQKGAKYAYMATDCTNEPSVNLFTKKCGYSKFRTLTIL  173

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             VQPVH H KPI S+VAV+R+PP+LA S Y + F  +SEF+PKDI+L+L+N LNLGTFMA+
Sbjct  174   VQPVHAHYKPISSNVAVLRLPPRLAGSMYNQLF-ANSEFYPKDIDLILSNNLNLGTFMAI  232

Query  788   PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
             PK+ LS ++P  G+ P ++AILS+W+ K+V+K+QVKG+S L  AC +GTR+LD  +PW+R
Sbjct  233   PKKYLSKFDPKRGILPPSYAILSVWNTKDVFKLQVKGVSPLAHACCVGTRLLDEWMPWLR  292

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPS P+V + FG YF++GL MEG+ G+++M+ L AF HN+AR D  GC  ++AE+   DP
Sbjct  293   LPSFPDVFRPFGVYFVYGLHMEGKCGAQLMKCLCAFVHNMAR-DGGGCGAIVAELGQRDP  351

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDP  1324
             VR  +PHW  FSW +D+WCI             K  +     + D      SS +IFVDP
Sbjct  352   VRDAVPHWSKFSWAEDMWCI-------------KNLHKGSSQTSDWFTSRSSSPVIFVDP  398

Query  1325  RDI  1333
             RD 
Sbjct  399   RDF  401



>ref|XP_003531740.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
 gb|KHN38045.1| hypothetical protein glysoja_007087 [Glycine soja]
Length=403

 Score =   445 bits (1144),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 294/423 (70%), Gaps = 29/423 (7%)
 Frame = +2

Query  92    MSFKVAA-VAEKLPE-------VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLD  247
             MS K+AA V  K P        V+V++YEE+R KVAVE+LE  CEVGQ GKP LV DL+ 
Sbjct  1     MSLKIAAEVYPKSPSETGMEPLVLVKEYEEDRHKVAVEKLERLCEVGQSGKPSLVTDLMG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLR  427
             DPI R+R+  LH M+VAE+G   E+VGVIRG +++V+RG      NS  YV++AYILGLR
Sbjct  61    DPICRIRHFQLHAMLVAEYGEEGEVVGVIRGCVKTVTRG------NSV-YVELAYILGLR  113

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS +HRR GIGTKLV+ LE W +  G+ Y YMATDC+N+ S+NLFT    Y KFRT ++L
Sbjct  114   VSPRHRRFGIGTKLVEHLEEWCKQKGSKYAYMATDCTNEPSVNLFTKKCGYSKFRTLTIL  173

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             VQPVH H KPI S+VAV+R+PP+LA S Y   F  +SEF+PKDI L+L+NKLNLGTFMA+
Sbjct  174   VQPVHAHYKPISSNVAVLRLPPRLAGSMYNHMF-ANSEFYPKDIELILSNKLNLGTFMAI  232

Query  788   PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
             PK+ LS  +P  G+ P ++AILS+W+ K+V+K+QVKG+S    AC +GTR+LD  +PW+R
Sbjct  233   PKKYLSKCDPKRGILPPSYAILSVWNTKDVFKLQVKGVSPWAHACCVGTRLLDEWMPWLR  292

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPS P+V + FG YFL+GL MEG+ G+++M+SL  F HN+AR+D  GC  ++AE+   DP
Sbjct  293   LPSFPDVFRPFGVYFLYGLHMEGKCGAQLMKSLCGFVHNMARDD-GGCGAIVAELGQRDP  351

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDP  1324
             VR  +PHW+ FSW +D+WCI            N           D      SS +IFVDP
Sbjct  352   VRDAVPHWRKFSWAEDMWCI-----------KNLEDTKKDIQESDWFTSRSSSPVIFVDP  400

Query  1325  RDI  1333
             RD 
Sbjct  401   RDF  403



>ref|XP_004137656.1| PREDICTED: uncharacterized protein LOC101217889 [Cucumis sativus]
 ref|XP_004169181.1| PREDICTED: uncharacterized protein LOC101229410 [Cucumis sativus]
 gb|KGN58658.1| hypothetical protein Csa_3G710850 [Cucumis sativus]
Length=409

 Score =   445 bits (1144),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 286/401 (71%), Gaps = 16/401 (4%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y EERDKV+VE++E QC+VGQ+GKP +  DLL DPI RVR+ P HVM+VAE+G +
Sbjct  24    VVVREYCEERDKVSVEKMERQCDVGQKGKPSIFTDLLGDPICRVRHFPSHVMLVAEYGKA  83

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWG  493
             +EIVGVIRG I+ V+ G      +S   + +AYILGLRVS+ HRRLG+GTKLVQ +E W 
Sbjct  84    REIVGVIRGCIKHVTTG------HSHHVLKLAYILGLRVSTTHRRLGVGTKLVQHIEEWC  137

Query  494   RSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPP  673
             +  GADY Y+ATDC+NQ SI+LFT    Y KFR+P+VLVQPVH H KPIGS +++VRVPP
Sbjct  138   KQKGADYAYIATDCANQPSISLFTQKFAYTKFRSPTVLVQPVHAHYKPIGSGISIVRVPP  197

Query  674   QLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAIL  853
              +A   YR  F  ++EFF +DI+ +L NKLNLGTFMAVPK+ L  W+P++G+ P + A+L
Sbjct  198   HVAVKIYRHLF-ANAEFFAEDIDAILFNKLNLGTFMAVPKKLLPKWDPETGILPQSFAVL  256

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRME  1033
             S+W+ KEV+K+QVKG+S L  AC +G+R+LD  +PW+R+PS P+V   FG YFL+GL M 
Sbjct  257   SVWNTKEVFKLQVKGMSKLTYACCMGSRLLDSWLPWLRVPSFPDVFSQFGVYFLYGLTMR  316

Query  1034  GQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkh  1210
             G +G  +M+SL  F HN+A++D  GC  L+ EV   DPVR  IPHWK  SW +DLWCI  
Sbjct  317   GTNGQRLMKSLCTFVHNMAKDD-VGCGALVTEVGQQDPVRVAIPHWKRLSWNEDLWCI--  373

Query  1211  lnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                      + +  N     + D I    SSA IFVDPRDI
Sbjct  374   -----KKLTDLEGDNYEGSKTCDWIKSPPSSAGIFVDPRDI  409



>ref|XP_011020602.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=406

 Score =   445 bits (1144),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/421 (53%), Positives = 288/421 (68%), Gaps = 24/421 (6%)
 Frame = +2

Query  92    MSFKVAA-------VAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS K+AA       V E    VVVR+Y+E RDKVAVEE+E +CE+GQ GKP LV DL+ D
Sbjct  1     MSLKIAADNFPPLLVGETENFVVVREYDEGRDKVAVEEMEKRCEIGQRGKPSLVTDLMGD  60

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             PI R+R+ P HVM+VAE G   E+ GVIR  I++V+RG  G       YV +AYILGLRV
Sbjct  61    PICRIRHFPSHVMLVAECGEGGEMAGVIRACIKTVTRGSSG-------YVKLAYILGLRV  113

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRRLGIG KLVQ +E   +  GA+Y YMATDC+N++SINLFT    Y KFRT ++LV
Sbjct  114   SPSHRRLGIGIKLVQEIEKRCKQQGAEYSYMATDCTNESSINLFTRKCCYTKFRTLTMLV  173

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H KP+GSD+A +R+ P+LAE+ Y R F   +EFF KDI  +L++KLNLGTFMA P
Sbjct  174   QPVHAHYKPLGSDIATIRLTPKLAETIYSRVFV-DAEFFAKDIGTILSSKLNLGTFMAAP  232

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K  LS W+  +G+ P+N AILS+W+ KEV+K+QVKG+S L  AC  G+R+LD  +PW+RL
Sbjct  233   KNCLSQWDSKTGILPSNFAILSVWNTKEVFKLQVKGVSKLTHACCTGSRLLDAWMPWLRL  292

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V + FG YFL+GL MEG++   +M++L AFAHN+AR+D  GC  ++ EV   DPV
Sbjct  293   PSFPDVFRQFGVYFLYGLHMEGKNAPRLMKALCAFAHNMARDD-DGCGAVVTEVGQRDPV  351

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
             R  IPHW+ FSW +DLWCI           + K          D +    SS +IFVDPR
Sbjct  352   REAIPHWRKFSWAEDLWCI-------KKLADEKPDGGRESEPPDWMKCGTSSPVIFVDPR  404

Query  1328  D  1330
             D
Sbjct  405   D  405



>ref|XP_011016503.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=407

 Score =   444 bits (1142),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/422 (54%), Positives = 295/422 (70%), Gaps = 23/422 (5%)
 Frame = +2

Query  92    MSFKVAA-------VAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS ++AA       V E    VVVR+Y+E RDKVAVEE+E +CEVGQ GK  LV DL+ D
Sbjct  1     MSLRIAADNFPTLPVGEMENFVVVREYDEGRDKVAVEEMERRCEVGQRGKHSLVTDLMGD  60

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             PI RVR+ P HVM+VAE G   EIVGVIR  + +V+         S+  V +AYILGLRV
Sbjct  61    PICRVRHFPSHVMLVAECGDGGEIVGVIRACVNTVT------TRESSGSVKLAYILGLRV  114

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRRLGIGTKLVQ +E W +  GA+Y YMATD SN+ SINLFT    Y KFRT ++LV
Sbjct  115   SPSHRRLGIGTKLVQEIEEWCKQKGAEYSYMATDFSNEPSINLFTRKCFYTKFRTLTMLV  174

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H KP+GS +A++++PP+LAE+ Y R F   +EFFPKDI  +L++KLNLG+FMAVP
Sbjct  175   QPVHAHYKPLGSGIAIIQLPPKLAEAIYYRVF-ADAEFFPKDIGTILSSKLNLGSFMAVP  233

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K++L  W+P +G+ P++ A+LS+W+ KEV+K+QVKG+S L  AC  GTR+LD  +PW+RL
Sbjct  234   KKALPKWDPTTGILPSSFALLSVWNTKEVFKLQVKGVSKLTYACCTGTRLLDAWMPWLRL  293

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V + FG YFL+GL MEG++ S +M++L AFAHN+AR+D  GC  ++AE++  DPV
Sbjct  294   PSFPDVFRQFGVYFLYGLHMEGKNASRLMKALCAFAHNMARDD-DGCGAVVAELAQRDPV  352

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
             R  IPHW+ FSW +DLWCI           + K          D + +  SS +IFVDPR
Sbjct  353   REVIPHWRRFSWAEDLWCI-------KKLADEKLDVDRRCGQSDRMKHGSSSPVIFVDPR  405

Query  1328  DI  1333
             DI
Sbjct  406   DI  407



>ref|XP_011034550.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=407

 Score =   444 bits (1141),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/422 (54%), Positives = 295/422 (70%), Gaps = 23/422 (5%)
 Frame = +2

Query  92    MSFKVAA-------VAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS ++AA       V E    VVVR+Y+E RDKVAVEE+E +CEVGQ GK  LV DL+ D
Sbjct  1     MSLRIAADNFPTLPVGEMENFVVVREYDEGRDKVAVEEMERRCEVGQRGKHSLVTDLMGD  60

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             PI RVR+ P HVM+VAE G   EIVGVIR  + +V+         S+  V +AYILGLRV
Sbjct  61    PICRVRHFPSHVMLVAECGDGGEIVGVIRACVNTVT------TRESSGSVKLAYILGLRV  114

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRRLGIGTKLVQ +E W +  GA+Y YMATD SN+ SINLFT    Y KFRT ++LV
Sbjct  115   SPSHRRLGIGTKLVQEIEEWCKQKGAEYSYMATDFSNEPSINLFTRKCFYTKFRTLTMLV  174

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H KP+GS +A++++PP+LAE+ Y R F   +EFFPKDI  +L++KLNLG+FMAVP
Sbjct  175   QPVHAHYKPLGSGIAIIQLPPKLAEAIYYRVF-ADAEFFPKDIGTILSSKLNLGSFMAVP  233

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K++L  W+P +G+ P++ A+LS+W+ KEV+K+QVKG+S L  AC  GTR+LD  +PW+RL
Sbjct  234   KKALPKWDPTTGILPSSFALLSVWNTKEVFKLQVKGVSKLTYACCTGTRLLDAWMPWLRL  293

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V + FG YFL+GL MEG++ S +M++L AFAHN+AR+D  GC  ++AE++  DPV
Sbjct  294   PSFPDVFRQFGVYFLYGLHMEGKNASRLMKALCAFAHNMARDD-DGCGAVVAELALRDPV  352

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
             R  IPHW+ FSW +DLWCI           + K          D + +  SS +IFVDPR
Sbjct  353   REVIPHWRRFSWAEDLWCI-------KKLADEKLDVDRRCGQSDRMKHGSSSPVIFVDPR  405

Query  1328  DI  1333
             DI
Sbjct  406   DI  407



>ref|XP_002303853.1| hypothetical protein POPTR_0003s18090g [Populus trichocarpa]
 gb|EEE78832.1| hypothetical protein POPTR_0003s18090g [Populus trichocarpa]
Length=406

 Score =   444 bits (1141),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/421 (54%), Positives = 289/421 (69%), Gaps = 24/421 (6%)
 Frame = +2

Query  92    MSFKVAA-------VAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD  250
             MS K+AA       V E    VVVR+Y+E RDKVAVEE+E +CE+GQ GKP LV DL+ D
Sbjct  1     MSLKIAADNFPPLLVGETENFVVVREYDEGRDKVAVEEMEKRCEIGQRGKPSLVTDLMGD  60

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             PI R+R+ P HVM+VAE G   E+ GVIR  I++V+RG  G       YV +AYILGLRV
Sbjct  61    PICRIRHFPSHVMLVAECGEGGEMAGVIRACIKTVTRGSSG-------YVKLAYILGLRV  113

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRRLGIG KLVQ +E   +  GA+Y YMATDC+N++SINLFT    Y KFRT ++LV
Sbjct  114   SPSHRRLGIGIKLVQEIEKRCKQQGAEYSYMATDCTNESSINLFTRKCCYTKFRTLTMLV  173

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H KP+GS +A +R+ P+LAE+ Y R F   +EFF KDI  +L++KLNLGTFMAVP
Sbjct  174   QPVHAHYKPLGSGIATIRLTPKLAETIYSRVFV-DAEFFAKDIGTILSSKLNLGTFMAVP  232

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K  L  W+P +G+ P+N AILS+W+ KEV+K+QVKG+S L  AC  G+R+LD  +PW+RL
Sbjct  233   KNCLPQWDPKTGILPSNFAILSVWNTKEVFKLQVKGVSKLTHACCTGSRLLDAWMPWLRL  292

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V + FG YFL+GL MEG++   +M++L AFAHN+AR+D  GC  ++AEV   DPV
Sbjct  293   PSFPDVFRQFGVYFLYGLHMEGKNAPRLMKALCAFAHNMARDD-DGCGAVVAEVGQRDPV  351

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
             R  IPHW+ FSW +DLWCI           + K          D +    SS +IFVDPR
Sbjct  352   REVIPHWRKFSWAEDLWCI-------KKLADEKPDVDREFEPPDWMKRGSSSPVIFVDPR  404

Query  1328  D  1330
             D
Sbjct  405   D  405



>ref|XP_003604253.1| hypothetical protein MTR_4g007130 [Medicago truncatula]
 gb|AES86450.1| acyl-CoA N-acyltransferase (NAT) superfamily protein [Medicago 
truncatula]
Length=409

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 291/423 (69%), Gaps = 23/423 (5%)
 Frame = +2

Query  92    MSFKVAAVAEKLPE--------VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLD  247
             MS K+AA   + P         +V+R Y+EE+ KV VE+LE  CEVGQ GKP LV DLL 
Sbjct  1     MSLKIAAENWQKPSSKKVEEAVIVIRSYDEEKHKVGVEKLERLCEVGQRGKPSLVTDLLG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLR  427
             DPI R+R+  LHVM+VAE+    E+ GVIRG +++V+RG       ++ YV +AY+LGLR
Sbjct  61    DPICRIRHFQLHVMLVAEYEEEGEVAGVIRGCVKTVTRG-------NSAYVKLAYVLGLR  113

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS +HRR GIGTKLV+ LE W +  GA Y YMATDC+N+ SINLFT    Y KFRT ++L
Sbjct  114   VSPKHRRFGIGTKLVEHLEEWCKQKGAKYAYMATDCTNEPSINLFTKKCEYSKFRTLTML  173

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             VQPVH H KPI +++AV+R+PP+LA + Y   F  ++EFFP+DI+L+L+NKLNLGTFMA+
Sbjct  174   VQPVHAHYKPINTNIAVLRLPPRLAGTTYNHMF-ANAEFFPRDIDLILSNKLNLGTFMAI  232

Query  788   PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
             PK+ L+  +P +G+FP ++A+LS+W+ KEV+K+QVKG S    AC +GTR+LD  +PW+R
Sbjct  233   PKKDLTKCDPKNGIFPPSYAVLSVWNTKEVFKLQVKGASTFVHACCVGTRLLDECMPWLR  292

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPS PNV + FG Y ++GL MEG+ G ++M+SL  F HN+AR+D  GC  ++ EVS  DP
Sbjct  293   LPSFPNVFRPFGIYVMYGLHMEGKYGKQLMKSLCGFVHNMARDD-GGCGAIVTEVSQRDP  351

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDP  1324
             VR  IPHW+  SW +D+WCI         +     +        D   Y  SS++IFVDP
Sbjct  352   VREVIPHWRKLSWAEDMWCI-----KSLEHMKKDDSINEKCGPSDWFNYRSSSSVIFVDP  406

Query  1325  RDI  1333
             RD 
Sbjct  407   RDF  409



>ref|XP_007023438.1| Acyl-CoA N-acyltransferases superfamily protein [Theobroma cacao]
 gb|EOY26060.1| Acyl-CoA N-acyltransferases superfamily protein [Theobroma cacao]
Length=411

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/417 (54%), Positives = 295/417 (71%), Gaps = 20/417 (5%)
 Frame = +2

Query  95    SFKVAAVAEKLPE---VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRV  265
             S   AAVA +  E   VVVR+Y+EE+DKVAVEE+E +CE+G+ GKP LV DLL DPI RV
Sbjct  11    SRAAAAVATQDWEEDLVVVREYDEEKDKVAVEEMERRCEIGEGGKPSLVADLLGDPICRV  70

Query  266   RNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHR  445
             R+ P H+M+VAE+G   EIVGVIRG +++V+RG      NS  YV +AYILGLR+S  +R
Sbjct  71    RHFPSHIMLVAEYGEKGEIVGVIRGCVKTVTRG------NSV-YVKLAYILGLRISPSYR  123

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
             RLGIG KLVQ LE W + NGA+Y+YMATDCSN+ SINLFT    Y KFRTP++LV PVH 
Sbjct  124   RLGIGKKLVQKLEEWCKQNGAEYVYMATDCSNEPSINLFTRKCAYTKFRTPTMLVHPVHA  183

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS  805
             H KP+GS +A+VR+ P+LAES YRR F  +SEFFPKDI+ +L N+L+LGTFMA+P++ L 
Sbjct  184   HYKPLGSGIAIVRLNPRLAESIYRRVF-ANSEFFPKDIDNILCNRLSLGTFMALPRKCLP  242

Query  806   TWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
              W+P +G  P + AI SIW  K+++++QVKG+S L  AC + +RV+D  +PW+ LPS+P+
Sbjct  243   KWDPKTGTLPPSFAITSIWSTKQLFRLQVKGVSMLTYACCMASRVVDAWMPWLMLPSIPD  302

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + F  YFL+GL MEG++ S +M+SL AFAHN+ R+D  GC  ++AEV   DPVR  IP
Sbjct  303   VFRKFWVYFLYGLHMEGKNASRLMKSLCAFAHNMGRDD-DGCGAVLAEVGQRDPVREVIP  361

Query  1166  HWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             HW+ FS  +DLWCI           N    +     S D +    SS  +FVDPRDI
Sbjct  362   HWRKFSLSEDLWCI-------KKLGNANDGSNEICGSSDWMKSRPSSRFLFVDPRDI  411



>gb|KHN04181.1| hypothetical protein glysoja_032677 [Glycine soja]
Length=403

 Score =   442 bits (1136),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/423 (53%), Positives = 290/423 (69%), Gaps = 29/423 (7%)
 Frame = +2

Query  92    MSFKVAAV--------AEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLD  247
             MS K+AA           K P VVV++Y+E+R KVAVE LE  CEVGQ GKP LV DL+ 
Sbjct  1     MSLKIAAEIYPKSPSETVKEPLVVVKEYDEDRHKVAVERLERLCEVGQSGKPSLVTDLMG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLR  427
             DPI R+R+  LHVM+VAE+G   E+VGVIR  +++V+RG      NS  Y+ +AYILGLR
Sbjct  61    DPICRIRHFQLHVMLVAEYGEEGEVVGVIRVCVKTVTRG------NSV-YIKLAYILGLR  113

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS +HRR GIGTKLV+ LE W +  GA Y YMATDC+N+ S+NLFT    Y KFRT ++L
Sbjct  114   VSPRHRRFGIGTKLVEHLEEWCKKKGAKYAYMATDCTNEPSVNLFTKKCGYSKFRTLTIL  173

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             VQPVH H KPI S+VAV+ +PP+LA S Y   F  +SEF+PKDI L+L+NKLNLGTFMA+
Sbjct  174   VQPVHAHYKPISSNVAVLHLPPRLAGSMYNHMF-ANSEFYPKDIELILSNKLNLGTFMAI  232

Query  788   PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
             PK+ LS  +P  G+ P ++AILS+W+ K+V+K+QVKG+S L  AC +GTR+LD  +PW+R
Sbjct  233   PKKYLSRCDPKRGILPPSYAILSVWNTKDVFKLQVKGVSPLAHACCVGTRLLDEWMPWLR  292

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPS P+V + FG YFL+GL MEG+ G+++M+SL  F HN+AR+D  GC  ++AE+   DP
Sbjct  293   LPSFPDVFRPFGVYFLYGLHMEGKRGAQLMKSLCGFVHNMARDD-GGCGAIVAELGQRDP  351

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDP  1324
             VR  +PHW  FSW +D+WCI            N           D      SS +IFVDP
Sbjct  352   VRDAVPHWSKFSWAEDMWCI-----------KNLEDTKKDIQESDWFTSRSSSPVIFVDP  400

Query  1325  RDI  1333
             RD 
Sbjct  401   RDF  403



>ref|XP_003530256.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
Length=403

 Score =   441 bits (1135),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/423 (53%), Positives = 290/423 (69%), Gaps = 29/423 (7%)
 Frame = +2

Query  92    MSFKVAAV--------AEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLD  247
             MS K+AA           K P VVV++Y+E+R KVAVE LE  CEVGQ GKP LV DL+ 
Sbjct  1     MSLKIAAEIYPKSPSETVKEPLVVVKEYDEDRHKVAVERLERLCEVGQSGKPSLVTDLMG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLR  427
             DPI R+R+  LHVM+VAE+G   E+VGVIR  +++V+RG      NS  Y+ +AYILGLR
Sbjct  61    DPICRIRHFQLHVMLVAEYGEEGEVVGVIRVCVKTVTRG------NSV-YIKLAYILGLR  113

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS +HRR GIGTKLV+ LE W +  GA Y YMATDC+N+ S+NLFT    Y KFRT ++L
Sbjct  114   VSPRHRRFGIGTKLVEHLEEWCKKKGAKYAYMATDCTNEPSVNLFTKKCGYSKFRTLTIL  173

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             VQPVH H KPI S+VAV+ +PP+LA S Y   F  +SEF+PKDI L+L+NKLNLGTFMA+
Sbjct  174   VQPVHAHYKPISSNVAVLHLPPRLAGSIYNHMF-ANSEFYPKDIELILSNKLNLGTFMAI  232

Query  788   PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
             PK+ LS  +P  G+ P ++AILS+W+ K+V+K+QVKG+S L  AC +GTR+LD  +PW+R
Sbjct  233   PKKYLSRCDPKRGILPPSYAILSVWNTKDVFKLQVKGVSPLAHACCVGTRLLDEWMPWLR  292

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPS P+V + FG YFL+GL MEG+ G+++M+SL  F HN+AR+D  GC  ++AE+   DP
Sbjct  293   LPSFPDVFRPFGVYFLYGLHMEGKRGAQLMKSLCGFVHNMARDD-GGCGAIVAELGQRDP  351

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDP  1324
             VR  +PHW  FSW +D+WCI            N           D      SS +IFVDP
Sbjct  352   VRDAVPHWSKFSWAEDMWCI-----------KNLEDTKKDIQESDWFTSRSSSPVIFVDP  400

Query  1325  RDI  1333
             RD 
Sbjct  401   RDF  403



>ref|XP_008465148.1| PREDICTED: probable N-acetyltransferase HLS1 [Cucumis melo]
Length=434

 Score =   442 bits (1137),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 286/401 (71%), Gaps = 16/401 (4%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y EERDK +VE++E QC+VGQ+GKP +  DLL DPI RVR+ P HVM+VAE+G +
Sbjct  49    VVVREYCEERDKASVEKMERQCDVGQKGKPSIFTDLLGDPICRVRHFPSHVMLVAEYGKA  108

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWG  493
             +EIVGVIRG I+ V+ G      +S   + +AYILGLRVS+ HRRLG+GTKLVQ LE W 
Sbjct  109   REIVGVIRGCIKHVTTG------HSHHVLKLAYILGLRVSTTHRRLGVGTKLVQHLEEWC  162

Query  494   RSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPP  673
             +  GADY Y+ATDC+NQ SI+LFT   +Y KFR+P+VLVQPVH H KPIGS +A+VR+PP
Sbjct  163   KQKGADYAYIATDCANQPSISLFTEKFSYTKFRSPTVLVQPVHAHYKPIGSGIAIVRIPP  222

Query  674   QLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAIL  853
              +A   YR  F  ++EFF +DI+ +L NKLNLGTFMA+PK+ L  W+P++G+ P + A+L
Sbjct  223   HVAVKIYRYLF-ANAEFFAEDIDAILFNKLNLGTFMALPKKLLPKWDPETGILPQSFAVL  281

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRME  1033
             S+W+ KEV+K+QVKG+S L  AC +G+R+LD  +PW+R+PS P+V   FG YFL+GL M 
Sbjct  282   SVWNTKEVFKLQVKGMSKLTYACCMGSRLLDSWLPWLRVPSFPDVFSQFGVYFLYGLTMR  341

Query  1034  GQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkh  1210
             G +G  +M+SL  F HN+A++D  GC  ++ EV   DPVR  IPHW+  SW +DLWCI  
Sbjct  342   GTNGQRLMKSLCTFVHNMAKDD-VGCGAVVTEVGQQDPVRVAIPHWRRLSWNEDLWCI--  398

Query  1211  lnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                      + +  N     + D I    SSA IFVDPRDI
Sbjct  399   -----KKLTDLEGDNYEGSKTRDWIKSPPSSAGIFVDPRDI  434



>gb|KDP41968.1| hypothetical protein JCGZ_26986 [Jatropha curcas]
Length=413

 Score =   441 bits (1133),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 293/417 (70%), Gaps = 19/417 (5%)
 Frame = +2

Query  95    SFKVA--AVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVR  268
             +F VA  AVAE L  +VVR+Y+EERDK A E +E +CE+GQ GKP LV DLL DPI R+R
Sbjct  12    TFPVAGEAVAENL--LVVREYDEERDKAATERMEKRCEIGQRGKPSLVTDLLGDPICRIR  69

Query  269   NAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRR  448
             N   HVM+VAE+G  +E+VGVIR  ++ V+ G    N    +YV VAYILGLRVS  HRR
Sbjct  70    NFSSHVMLVAEYGEEREMVGVIRACVKIVTTG----NSLLANYVKVAYILGLRVSPTHRR  125

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             LGIGTKLV  +E W + NG +Y Y+ATDC+NQ SINLFT   +Y KFR+ S+LVQPVH H
Sbjct  126   LGIGTKLVDKIEEWCKKNGVEYSYIATDCTNQPSINLFTKRCSYTKFRSLSMLVQPVHAH  185

Query  629   KKPIGSD-VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS  805
              K + S+ +A+VR   +LAES YRR F   +EFFP+DI+ +L+++LNLGTFMA+PK+ L 
Sbjct  186   YKSLNSNNIAIVRFTSKLAESIYRRVF-SKAEFFPRDIDTILSSRLNLGTFMAMPKKYLP  244

Query  806   TWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
              W+P +G+ P+N AI+SIW+ KEV+K+QVKG+S L  AC  G+R+LD  +PW+RLPS P+
Sbjct  245   KWDPKTGILPSNFAIISIWNTKEVFKLQVKGVSKLTCACCKGSRLLDSWMPWLRLPSFPD  304

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + FG YFL+GL MEG+  S ++++L AFAHN+AR+D  GC  L+AE    DPVR  IP
Sbjct  305   VFRKFGVYFLYGLHMEGKGASRLLKALCAFAHNMARDD-DGCGALVAEAGQLDPVRDVIP  363

Query  1166  HWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             HW+ FSW +DLWCI           + K        S D +    SS++IFVDPRD 
Sbjct  364   HWRKFSWAEDLWCI-------KKLTDEKINVDESCRSYDWMKSRPSSSVIFVDPRDF  413



>ref|XP_004507072.1| PREDICTED: uncharacterized protein LOC101511369 [Cicer arietinum]
Length=405

 Score =   440 bits (1132),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 284/401 (71%), Gaps = 21/401 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +V+R+Y+EE+ KVAVE+LE  CEVGQ GKP LV DLL DP+ R+R+  LHVM+VAE+G  
Sbjct  25    IVIREYDEEKHKVAVEKLERLCEVGQRGKPCLVTDLLGDPLCRIRHFQLHVMLVAEYGED  84

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWG  493
              E+VGVIRG +++V+RG       ++ YV +AY+LGLRVS +HRR GIGTKLV+ LE W 
Sbjct  85    GEVVGVIRGCVKTVTRG-------NSAYVKLAYVLGLRVSLRHRRYGIGTKLVEHLEEWC  137

Query  494   RSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPP  673
             +  GA Y YMATDC+N+ SINLFT    Y KFRT ++LVQPVH H K I S++ V+ +PP
Sbjct  138   KQKGAKYSYMATDCTNEPSINLFTKKCGYSKFRTLTMLVQPVHAHYKSISSNIVVLHLPP  197

Query  674   QLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAIL  853
             +LA S Y   F  +SEFFPKDI+L+L+NKLNLGTFMA+ K+ ++  +P  G+FP ++AIL
Sbjct  198   RLAASIYNPIF-ANSEFFPKDIDLILSNKLNLGTFMAIQKKYITKCDPKKGIFPPSYAIL  256

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRME  1033
             S+W+ KEV+K+QVKG+S +  AC +GTR+LD  +PW+RLPS PNV + FG YF++GL ME
Sbjct  257   SVWNTKEVFKLQVKGVSPIAHACCVGTRLLDECLPWLRLPSFPNVFRPFGIYFMYGLHME  316

Query  1034  GQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkh  1210
             G+ G ++M+SL  F HN+AR D  GC  ++AEVS  DP+R  +PHW  FSW +D+WCI  
Sbjct  317   GKCGKKLMKSLCGFVHNMAR-DEGGCGAIVAEVSKRDPIREVVPHWSKFSWDEDMWCI--  373

Query  1211  lnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                       N           D   Y  SS++IFVDPRD 
Sbjct  374   ---------KNLEDIHEKCGPFDWFNYRSSSSMIFVDPRDF  405



>ref|XP_007217552.1| hypothetical protein PRUPE_ppa022441mg [Prunus persica]
 gb|EMJ18751.1| hypothetical protein PRUPE_ppa022441mg [Prunus persica]
Length=410

 Score =   439 bits (1128),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/406 (54%), Positives = 288/406 (71%), Gaps = 19/406 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVVVR+Y++ERDK AVEE+E +CE+GQ GKP LV DL+ DPI R+R+ P HVM+VAE+G 
Sbjct  19    EVVVREYDKERDKAAVEEMERRCELGQRGKPSLVTDLMGDPICRIRHFPTHVMLVAEYG-  77

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               EIVGVIRG ++  +RG      NS  +V +AYILGLRVS  H RLGIGTKLV+ LE W
Sbjct  78    ENEIVGVIRGCVKEATRG------NSV-FVKLAYILGLRVSPTHWRLGIGTKLVRHLEEW  130

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS----DVAV  658
              +  GA+Y+YMATDC+N+ASINLFT    Y KFRTP++LVQPVH H KPI S    ++A+
Sbjct  131   CKEKGAEYVYMATDCTNEASINLFTIKCAYKKFRTPTILVQPVHAHYKPISSSANTNIAI  190

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             V++P  LA S YR+ F  SSEFFPKDI+ +L   L+LGTFMA+P +SL+ W+P     P 
Sbjct  191   VQLPTTLAASIYRQLFSQSSEFFPKDIDAILACNLSLGTFMALPVKSLAKWDPQKWTLPP  250

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             N AILS+W+ KEV+++QVKG+S+L  AC +GTR++D  +PW+RLPS PN  K FG YF++
Sbjct  251   NFAILSVWNTKEVFRLQVKGVSSLTYACCVGTRLVDAWLPWLRLPSFPNFFKQFGVYFMY  310

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             GL MEG+ G+ +M+ L  F HN+AR+D RGC  ++AEV   DPVR  +PHW+ FSW +D 
Sbjct  311   GLHMEGEHGNRLMKGLCNFVHNMARDD-RGCAAVVAEVGQRDPVRESVPHWRKFSWAEDT  369

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WC+K L+        + +      ++  S     SS+ IFVDPRD 
Sbjct  370   WCVKKLDEAKQGGERSSSDQFDWTNTPSS-----SSSHIFVDPRDF  410



>gb|AFK38196.1| unknown [Medicago truncatula]
Length=409

 Score =   439 bits (1128),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/423 (51%), Positives = 289/423 (68%), Gaps = 23/423 (5%)
 Frame = +2

Query  92    MSFKVAAVAEKLPE--------VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLD  247
             MS K+AA   + P         +V+R Y+EE+ KV VE+LE  CEV Q GKP LV DLL 
Sbjct  1     MSLKIAAENWQKPSSKKVEEAVIVIRSYDEEKHKVGVEKLERLCEVEQRGKPSLVTDLLG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLR  427
             DPI R+R+  LHVM+VAE+    E+ GVIRG +++V+RG       ++ YV +AY+LGLR
Sbjct  61    DPICRIRHFQLHVMLVAEYEEEGEVAGVIRGCVKTVTRG-------NSAYVKLAYVLGLR  113

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS +HRR GIGTKLV+ LE W +  GA Y YMATDC+N+ SINLFT    Y KFRT ++L
Sbjct  114   VSPKHRRFGIGTKLVEHLEEWCKQKGAKYAYMATDCTNEPSINLFTKKCEYSKFRTLTML  173

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             VQPVH H KPI + +AV+R+PP+LA + Y   F  ++EFFP+DI+L+L+NKLNLGTFMA+
Sbjct  174   VQPVHAHYKPINTSIAVLRLPPRLAGTTYNHMF-ANAEFFPRDIDLILSNKLNLGTFMAI  232

Query  788   PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
             PK+ L+  +P +G+FP ++A+LS+W+ KEV+K+QVKG S    AC +GTR+LD  +PW+R
Sbjct  233   PKKDLTKCDPKNGIFPPSYAVLSVWNTKEVFKLQVKGASTFVHACCVGTRLLDECMPWLR  292

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPS PNV + FG Y ++GL MEG+ G ++M+SL  F HN+AR+D  GC  ++ EVS  DP
Sbjct  293   LPSFPNVFRPFGIYVMYGLHMEGKYGKQLMKSLCGFVHNMARDD-GGCGAIVTEVSQRDP  351

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDP  1324
             VR  IPHW+  SW +D+WCI         +     +        D   Y  SS++IFVDP
Sbjct  352   VREVIPHWRKLSWAEDMWCI-----KSLEHMKKDDSINEKCGPSDWFNYRSSSSVIFVDP  406

Query  1325  RDI  1333
             RD 
Sbjct  407   RDF  409



>gb|EYU21735.1| hypothetical protein MIMGU_mgv1a021131mg [Erythranthe guttata]
Length=410

 Score =   438 bits (1127),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 226/427 (53%), Positives = 296/427 (69%), Gaps = 30/427 (7%)
 Frame = +2

Query  92    MSFKVAA----VAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIG  259
             M  K+AA     AE  P VVVR+Y+   DK AVEELE +CEVG  GKP LV DL+ DPI 
Sbjct  1     MEKKIAAEANFPAEHSPPVVVREYDGGSDKAAVEELERRCEVGPPGKPSLVTDLMGDPIA  60

Query  260   RVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQ  439
             RVRN   H+M+VAE+G   EIVGVIRG I++V+ G+K  +     YV +AYILGLRVSS 
Sbjct  61    RVRNFVSHIMLVAEYGHGGEIVGVIRGCIKTVTSGKKISSTEFPVYVKLAYILGLRVSST  120

Query  440   HRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPV  619
             HRRLGI TKL+Q LENW   NGA+Y YMAT+ +NQ S+NLF    NYVKFR P+VLVQP+
Sbjct  121   HRRLGIATKLIQELENWSTKNGAEYSYMATERTNQPSLNLFIKKCNYVKFRNPTVLVQPI  180

Query  620   HRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES  799
             H H+KP+ SD+ +VR+PP ++E  Y+  F   SEFFPKDI+ +LNNKLNLGTFMA+PK S
Sbjct  181   HLHQKPLPSDITIVRIPPNISEQIYQTLF-SCSEFFPKDIDKLLNNKLNLGTFMALPKNS  239

Query  800   LSTWEPDSG--VFP-TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              S W P     + P ++ AILS+W+ KEVY++Q+KG+SA   A  +GTRVLD ++PW+++
Sbjct  240   HSKWNPKKTEDLLPKSSFAILSVWNTKEVYRLQMKGVSAFTHAACVGTRVLDAMVPWLKI  299

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+PNV +NFG++F++GL MEG  GS +M +L  F HN+A++D     +L+AEV+P D V
Sbjct  300   PSIPNVFENFGFHFMYGLHMEGNDGSRLMRNLCKFVHNMAQDD-VDIRVLVAEVAPMDRV  358

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYH-----DSSALI  1312
             R  +PHWK FSW +D+WCIK L +                  E++   H     DSS +I
Sbjct  359   REAVPHWKRFSWEEDIWCIKRLGVQV---------------DENNCHDHWYKSSDSSEVI  403

Query  1313  FVDPRDI  1333
             FVDPR++
Sbjct  404   FVDPREL  410



>ref|XP_008228819.1| PREDICTED: probable N-acetyltransferase HLS1 [Prunus mume]
Length=410

 Score =   435 bits (1119),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 216/406 (53%), Positives = 287/406 (71%), Gaps = 19/406 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVVVR+Y++ERDK AVEE+E +CE+GQ GKP LV DL+ DPI R+R+ P HVM+VAE+G 
Sbjct  19    EVVVREYDKERDKAAVEEMERRCELGQRGKPSLVTDLMGDPICRIRHLPTHVMLVAEYG-  77

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               EIVGVIRG ++  +RG       ++ +V +AYILGLRVS  H RLGIGTKLV+ LE W
Sbjct  78    ENEIVGVIRGCVKEATRG-------NSVFVKLAYILGLRVSPTHWRLGIGTKLVRHLEEW  130

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS----DVAV  658
              +  GA+Y YMATDC+N+ASINLFT    Y KFRTP++LVQPVH H KPI S    ++A+
Sbjct  131   CKEKGAEYAYMATDCTNEASINLFTIKCAYKKFRTPTILVQPVHAHYKPISSSANNNIAI  190

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             V++P  LA S YR+ F  SSEFFPKDI+ +L   L+LGTFMA+P++SL+ W+P     P 
Sbjct  191   VQLPTTLAASIYRQLFSQSSEFFPKDIDSILACNLSLGTFMALPEKSLAKWDPQKWTLPP  250

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             N AILS+W+ KEV+++QVKG+S+L  AC +GTR++D  +PW+RLPS PN  K FG YF++
Sbjct  251   NFAILSVWNTKEVFRLQVKGVSSLTYACCVGTRLVDAWLPWLRLPSFPNFFKQFGVYFMY  310

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             GL MEG+ G+ +M+ L  F HN+AR+D  GC  ++AEV   DPVR  +PHW+ FSW +D 
Sbjct  311   GLHMEGEHGNRLMKGLCNFVHNMARDD-LGCAAVVAEVGQRDPVRESVPHWRKFSWAEDT  369

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WC+K L+        + +      ++  S     SS+ IFVDPRD 
Sbjct  370   WCVKKLDETKQGGERSPSDQFDWTNTPSS-----SSSHIFVDPRDF  410



>ref|XP_010094041.1| hypothetical protein L484_018057 [Morus notabilis]
 gb|EXB55131.1| hypothetical protein L484_018057 [Morus notabilis]
Length=409

 Score =   430 bits (1106),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 294/425 (69%), Gaps = 27/425 (6%)
 Frame = +2

Query  92    MSFKVAAVAEKLPE-------VVVRQYEEERDKVAVEELESQCEVGQEG---KPRLVIDL  241
             M  K+AA  E+ P+       VV+R+Y+EERDKVA EELE +CEVG  G   KP LV DL
Sbjct  1     MVIKIAA--EQSPKADRYNDHVVIREYDEERDKVAAEELERRCEVGGGGGRGKPSLVTDL  58

Query  242   LDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILG  421
             + DPI RVR    H+M+VAE+G  K+IVGV+RG +++V+ G      NS  Y  +AYILG
Sbjct  59    MGDPICRVRLFQTHIMLVAEYGEQKDIVGVVRGCVKNVTTG------NSV-YAKLAYILG  111

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRR GIG KLV+ LE W + NGA+Y+YMATDC+N+ SINLFT   +Y KFRTP+
Sbjct  112   LRVSPTHRRHGIGIKLVRRLEEWCKENGAEYVYMATDCTNEPSINLFTKKCDYKKFRTPT  171

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LVQPVH H K I S VA+V++PP+LA S YRR F  SSEFFPKDI+ ++ +KLNLGTFM
Sbjct  172   MLVQPVHAHYKSISSSVAIVKIPPKLAGSMYRRVFT-SSEFFPKDIDTIMASKLNLGTFM  230

Query  782   AVPKESLSTWEP-DSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIP  958
             AVPK+ L  W+  ++ +FP + A+LS+W+ KEV+K+Q KG+S L  AC +G+RVLD  +P
Sbjct  231   AVPKKCLHKWDTRETNIFPQSFALLSVWNTKEVFKLQFKGVSPLTYACCVGSRVLDTWMP  290

Query  959   WIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP  1138
             W+RLPS+P+V + FG YFL+GL +EG+ G  +M+SL  FA+N+AR+D  GC  L+AEV  
Sbjct  291   WLRLPSIPDVFRQFGIYFLYGLHVEGKQGLRLMKSLCTFAYNMARDD-GGCGALVAEVGQ  349

Query  1139  DDPVRRGIPHWKNFSWQDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFV  1318
              DPVR  IPHW+ FS  DLWCI         +   +          D I    SS++IFV
Sbjct  350   RDPVRGAIPHWRRFSGDDLWCI-----KSLKDAKQEGEYEKGSQPSDWINSRSSSSVIFV  404

Query  1319  DPRDI  1333
             DPRD 
Sbjct  405   DPRDF  409



>ref|XP_008381110.1| PREDICTED: probable N-acetyltransferase HLS1 [Malus domestica]
Length=409

 Score =   425 bits (1092),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 216/410 (53%), Positives = 285/410 (70%), Gaps = 24/410 (6%)
 Frame = +2

Query  125   LPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH  304
             L ++VVR+Y+EERDK AVEE+E +CE+ Q G P LV DL+ DP  R+R  P HVM++AE+
Sbjct  17    LLQLVVREYDEERDKTAVEEMERKCELEQCGNPSLVTDLMGDPTCRIRRFPTHVMLIAEY  76

Query  305   GISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
             G  + IVGVIRG ++  + G      NS  +V +AYILGLRVS  HRRLGIG+KLV  LE
Sbjct  77    G-EQNIVGVIRGCVKEATSG------NSV-FVRLAYILGLRVSPTHRRLGIGSKLVTHLE  128

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS-DVAVV  661
              W + NGA+Y YMATDC+N+ASINLFT    Y KFRTP++LVQPVH HKKPI S  +A+V
Sbjct  129   EWCKQNGANYAYMATDCTNEASINLFTIKCAYQKFRTPTILVQPVHAHKKPISSTKIAIV  188

Query  662   RVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS-GVFPT  838
             ++P +LAES Y + F   SEFFPKDI+ +L++ LNLG+FMA+PK+SL  ++P      PT
Sbjct  189   QLPAKLAESIYCQLF-AQSEFFPKDIHNILSSHLNLGSFMALPKKSLLKFDPQKDTTLPT  247

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             N AILS+W+ KEV+K+QVKG+S+L  AC +G RVLD  +PW+RLPS PNV K FG +F++
Sbjct  248   NFAILSVWNTKEVFKLQVKGVSSLTYACCVGARVLDAWLPWLRLPSFPNVFKQFGVHFMY  307

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             GL MEG++G  +M++L  F HN+AR D  GC  ++ EVS  DPVR  IPHW+  SW +D+
Sbjct  308   GLHMEGKNGKWLMKALCNFVHNMARED-DGCAAVVTEVSQRDPVREAIPHWRKLSWEEDM  366

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDS----IMYHDSSALIFVDPRDI  1333
             WC+           +         SS+D     I    SS+++FVDPRD 
Sbjct  367   WCV-------KKLADQAKQGEKTTSSDDGQFDWINTRSSSSVVFVDPRDF  409



>ref|XP_004303239.1| PREDICTED: uncharacterized protein LOC101300741 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   422 bits (1086),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 217/416 (52%), Positives = 286/416 (69%), Gaps = 26/416 (6%)
 Frame = +2

Query  107   AAVAEKLPEVVVRQYEEERDKVAVEELESQCEV-GQEG--KPRLVIDLLDDPIGRVRNAP  277
             +A  +++  VVVR+Y EE DKVAVEE+E  CE+ GQ G  +P LV DLL DP  R+R+ P
Sbjct  13    SATLDEVCMVVVREYNEESDKVAVEEMERLCEMAGQRGGKQPSLVTDLLGDPKCRIRHFP  72

Query  278   LHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGI  457
              H+M+VA +G  KEIVGVIRG ++ V+RG      NS  +V +AYILGLRVS  HRRLGI
Sbjct  73    THIMLVAVYGEQKEIVGVIRGCVKKVTRG------NSV-FVKLAYILGLRVSPMHRRLGI  125

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             GTKLV+ LE W +  GA+Y YMATDC+N+ASINLFT   +Y KFRTP++LVQPVH H KP
Sbjct  126   GTKLVKHLEEWCKQKGAEYAYMATDCTNEASINLFTLKCSYQKFRTPTILVQPVHAHYKP  185

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEP  817
             + S +A+VR+P  LAES YR+ +  +SEFFP+DI+ +L++ LNLGTFMA+P++ L  W+P
Sbjct  186   VPSTIAIVRLPACLAESIYRQIY-ANSEFFPEDIDAILSSALNLGTFMALPRKYLLKWDP  244

Query  818   DSGVFP--TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
                 FP  +  AILS+W+ K+V+K+QVKG+S L QAC +G+R++D  +PW+RLPS PNV 
Sbjct  245   KKSTFPPRSAFAILSVWNTKQVFKLQVKGVSKLTQACCVGSRLVDAWLPWLRLPSFPNVF  304

Query  992   KNFGYYFLFGLRM-EGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
             K FG YF++GL   +G+ G  +M+ L  F HNV R+D  GC  ++AEVS  DPVR  +PH
Sbjct  305   KQFGVYFMYGLHADQGKHGLRLMKGLCNFVHNVGRDD-HGCAAVVAEVSQRDPVREAVPH  363

Query  1169  WKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             W   SW +D+WC+               A     S  D I    SS +IFVDPRD 
Sbjct  364   WTKLSWAEDMWCV----------KKLTEAKQGLSSPSDWINSRPSSPMIFVDPRDF  409



>ref|XP_002264353.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X1 [Vitis 
vinifera]
 emb|CBI25171.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   405 bits (1042),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 284/421 (67%), Gaps = 28/421 (7%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRN  271
             MS +VAA       VVVR+++E RDK AVEE+E +CE+GQ GKP LV DL+ DPI R+R+
Sbjct  1     MSQRVAAETCPPKVVVVREFDEGRDKAAVEEMEKRCEIGQRGKPSLVTDLMGDPICRIRH  60

Query  272   APLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRL  451
                HVM+VAE+G  + +VGV+RG +++V+RG+       + YV VAYILGLRV   HRRL
Sbjct  61    FSTHVMLVAEYGEERRVVGVVRGCVKTVTRGK-------SMYVKVAYILGLRVCPAHRRL  113

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIGTKLVQ LE W   NGA+Y YMATDC+N+ SINLFT   +Y KFRTP++LVQPVH H 
Sbjct  114   GIGTKLVQHLEKWCERNGAEYAYMATDCTNEPSINLFTKKCSYAKFRTPTMLVQPVHAHY  173

Query  632   KPI-GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES---  799
             KP+  S   ++ +PPQLAE  YRR F  +SEFFPKDI+ +L NKLNLGTF+A+PK+S   
Sbjct  174   KPLPSSKTLILPLPPQLAELIYRRIF-ANSEFFPKDIDQILTNKLNLGTFIALPKKSNFK  232

Query  800   --LSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
                S    +  + P   AILS+W+ K+V+K+Q+KG S L  A   GTR LD  +PW+  P
Sbjct  233   CNPSNNNNNLLLLPPTFAILSVWNTKDVFKLQLKGASPLTYAWCAGTRALDAYLPWLHFP  292

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S+PNV K FG YFL GL MEG+ G  +M+SL AFAHN+AR+D  GC  L+AEV+  DPVR
Sbjct  293   SIPNVFKQFGVYFLHGLHMEGKHGLRLMKSLCAFAHNMARDD-AGCGALVAEVAHRDPVR  351

Query  1154  RGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRD  1330
              GIPHW  FSW +DLWCI             K     H   +D +    +S +IFVDPRD
Sbjct  352   DGIPHWSKFSWAEDLWCI------------KKFTPANHHPDDDWVTSRPASPVIFVDPRD  399

Query  1331  I  1333
              
Sbjct  400   F  400



>ref|XP_010537846.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X1 [Tarenaya 
hassleriana]
Length=396

 Score =   401 bits (1031),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 200/400 (50%), Positives = 274/400 (69%), Gaps = 25/400 (6%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQC-EVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             R+Y+E+ DK AVEE+E++C E G  GKP +V DLL DP+ RVR+ P HVM+VAE+G  +E
Sbjct  19    REYDEDSDKTAVEEMETKCDETGPRGKPTMVSDLLGDPLRRVRHFPSHVMLVAEYGEGRE  78

Query  320   IVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRS  499
             +VGV+RG +++V+RG        +DYV +AY+LGLRVS  HR LG+GTKLVQ+LE W + 
Sbjct  79    VVGVVRGCVKTVTRGD-------SDYVKLAYVLGLRVSPLHRNLGVGTKLVQALEEWFKR  131

Query  500   NGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQL  679
              GA Y YMATDC+N  SINLFT   +Y KFRTP++LVQPVH H KP+GSD++++R+ P+ 
Sbjct  132   QGATYAYMATDCTNAPSINLFTKKCSYTKFRTPTMLVQPVHAHIKPVGSDISIIRLTPKS  191

Query  680   AESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSI  859
             +ES Y R F  +S+FFP DI  VL ++ +LGTFMAVP++  +  +   G FP++ AILS+
Sbjct  192   SESIYSRVFK-NSDFFPLDIGSVLASRSSLGTFMAVPRKPRTKPDETDGDFPSSFAILSV  250

Query  860   WDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQ  1039
             W  +EV+K+Q+KG+S L  AC  G+R+LD  +PW+RLPS PNV   F  YF++GL MEG+
Sbjct  251   WSTEEVFKLQMKGVSRLMHACCSGSRLLDSCMPWLRLPSFPNVFDKFWVYFMYGLHMEGE  310

Query  1040  SGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkhln  1216
              G  +M+ L  F HN+ R D  GC  ++ E+SP DPV   +PHW+  SW +DLWC+    
Sbjct  311   DGPHLMKGLCKFVHNLGRFD-GGCGAVVTELSPSDPVAAVVPHWRRLSWAEDLWCL----  365

Query  1217  lvgdnnnnnkaanivhdSSEDSIMYHDSSA-LIFVDPRDI  1333
                      K  +     + D I    SS+ +IFVDPRDI
Sbjct  366   ---------KKLSADGPETSDWIRSRSSSSPVIFVDPRDI  396



>ref|XP_010063570.1| PREDICTED: probable N-acetyltransferase HLS1 [Eucalyptus grandis]
 gb|KCW70805.1| hypothetical protein EUGRSUZ_F03960 [Eucalyptus grandis]
Length=434

 Score =   401 bits (1030),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 206/422 (49%), Positives = 282/422 (67%), Gaps = 31/422 (7%)
 Frame = +2

Query  128   PEVVVRQYEEERDKVAVEELESQCEV-GQEGKPR---------------LVIDLLDDPIG  259
             P VVVR+YEEERDK  VE +E  CEV GQ   P                LV DLL DP+ 
Sbjct  24    PPVVVREYEEERDKAGVERMEMLCEVTGQRSGPDNKKKKKRKKNKKKAILVTDLLGDPLC  83

Query  260   RVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKN--DNSTDYVDVAYILGLRVS  433
             RVR+ P HVM+VAE G   EIVGVIRG I+ V     G N   +S+DYV  A +LGLRVS
Sbjct  84    RVRSFPSHVMLVAEWGEGGEIVGVIRGCIKRVKIRGNGNNTTSSSSDYVTAANVLGLRVS  143

Query  434   SQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
               HRR GI T+L+Q++E W + +GADY YMATD +N  S+ LFT   +++KFRTP++ ++
Sbjct  144   PSHRRHGIATRLIQAIEIWCKQHGADYAYMATDATNSPSLKLFTTKCDFIKFRTPTLRMR  203

Query  614   PVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK  793
             PVH H+KP+GSDV+++R+ P+LAES YRR   G S+FFP+D++ ++ + LNLGTF+ VPK
Sbjct  204   PVHAHRKPLGSDVSIIRMTPRLAESMYRRVLAG-SDFFPEDMDEIVAHPLNLGTFVGVPK  262

Query  794   ESLSTWEPDSGVF-PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             ES  TW+P+SG   P++ A++S+W+ K VY  +VKG S L QAC  G+R+LD  +PW+R+
Sbjct  263   ESARTWDPESGTLPPSSFAVMSVWNTKGVYNFRVKGASGLMQACCAGSRMLDSCMPWLRI  322

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS P+V K FG+YFL+GL M G+ G  +M+SL   AHN+AR+D  GC  ++AEV  +DP+
Sbjct  323   PSFPDVFKQFGFYFLYGLYMTGERGPSLMKSLCDLAHNMARDD-AGCGAVVAEVGQEDPI  381

Query  1151  RRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPR  1327
             +  IPHWK F+W +D+WCIK+L+    +   +              M    S ++FVDPR
Sbjct  382   KAAIPHWKRFAWSEDVWCIKNLHEELVHKRGDLDWVH---------MSKGRSPVLFVDPR  432

Query  1328  DI  1333
             D+
Sbjct  433   DV  434



>ref|XP_002889271.1| hypothetical protein ARALYDRAFT_316871 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65530.1| hypothetical protein ARALYDRAFT_316871 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 254/361 (70%), Gaps = 18/361 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQC-EVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISK  316
             +R+Y+EERDK  VE++E +C E G  GKP +V DLL DP+ RVR+ P H M+VAE+G  +
Sbjct  18    IREYDEERDKRDVEDMERKCDETGNHGKPVMVSDLLGDPVRRVRHFPSHTMLVAEYGEGR  77

Query  317   EIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             +IVGV+RG +++V+RG       ++ +V +AY+LGLRVS  HR LGIGTKLVQ+LE W +
Sbjct  78    KIVGVVRGCVKTVTRG-------NSIFVKLAYVLGLRVSPSHRNLGIGTKLVQALEEWFK  130

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
               GA Y YMATDC+N+ SINLFT   +YVKFRTP++LVQPVH H KPI SDVA++R+ PQ
Sbjct  131   QQGATYAYMATDCTNEHSINLFTKKCSYVKFRTPTMLVQPVHAHTKPISSDVAILRLTPQ  190

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF----PTNH  844
              AES Y R F  +SEFFP DI+ +L ++ +LGTF+AVP E      P S       P N 
Sbjct  191   TAESIYTRIFK-NSEFFPSDIDAILTSRNSLGTFIAVPNEKHG---PKSNCLDRDIPANF  246

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             AILS+W  K+V+++Q+KG+S L  A   G+R LD  +PW++LPS PNV   F  YF++G+
Sbjct  247   AILSVWSTKDVFRLQMKGVSRLTHAFCSGSRFLDSCMPWMKLPSFPNVFDKFWVYFMYGM  306

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWC  1201
              MEG+ G  +M+SL +F HN+ R D RGC  L AE+SP D V   +PHWK  SW QDLWC
Sbjct  307   HMEGKDGPRLMKSLCSFVHNIGRYD-RGCGALAAELSPSDAVALVVPHWKRLSWAQDLWC  365

Query  1202  I  1204
             +
Sbjct  366   L  366



>ref|XP_009106710.1| PREDICTED: probable N-acetyltransferase HLS1 [Brassica rapa]
Length=395

 Score =   388 bits (997),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 265/377 (70%), Gaps = 18/377 (5%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQC-EVGQEGKPRLVIDLLDDPIGRVR  268
             MS K+AA       VVVR+Y+EE DK  VEE+E +C E G  GKP +V DLL DP+ RVR
Sbjct  1     MSSKIAAEVAAAAVVVVREYDEETDKRDVEEMERECDETGPHGKPVMVSDLLGDPVRRVR  60

Query  269   NAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRR  448
             + P H M+VAE+G  +++VGV+RG +++V+RG       ++ YV +AY+LGLRVS  HR 
Sbjct  61    HFPCHTMLVAEYGEGRKMVGVVRGCVKTVTRG-------NSIYVKLAYVLGLRVSPSHRN  113

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             LGIGTKLVQ+LE W +  GA Y YMATDC+N++SINLFT   +Y+KFRTP++LVQPVH H
Sbjct  114   LGIGTKLVQTLEEWFKQQGATYSYMATDCTNESSINLFTKKCSYIKFRTPTMLVQPVHAH  173

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE----  796
              KPI SD+ ++R+  + AES Y R F   SEFFP+DI+ +L ++ +LGTF+A PKE    
Sbjct  174   SKPICSDITILRLTTKTAESIYTRVFK-DSEFFPRDIDAILTSRNSLGTFIAFPKEEHGH  232

Query  797   SLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPS  976
               +  + D   FPT++AILS+W  K+V+++Q+KG+S L  AC  G+R+LD  +PW++LPS
Sbjct  233   KSNRLDRD---FPTDYAILSVWSTKDVFRLQMKGVSRLTHACCSGSRLLDSCMPWMKLPS  289

Query  977   VPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRR  1156
              PNV   F  YF++G+ MEG+ G  +M+SL  F HN+ R+D  GC  +  E+SP DPV  
Sbjct  290   FPNVFDKFWVYFMYGMHMEGRDGPRLMKSLCYFVHNIGRHD-GGCGAVATEISPLDPVAS  348

Query  1157  GIPHWKNFSW-QDLWCI  1204
              +PHWK  SW QDLWC+
Sbjct  349   AVPHWKRLSWAQDLWCL  365



>gb|KFK42474.1| hypothetical protein AALP_AA2G261600 [Arabis alpina]
Length=395

 Score =   386 bits (992),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/402 (50%), Positives = 268/402 (67%), Gaps = 27/402 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQC-EVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             VVVR+Y+E  DK  VEE+E +C E GQ GKP ++ DLL DP+ RVR+ P H M+VAE+G 
Sbjct  19    VVVREYDEGTDKSHVEEMEMKCDETGQHGKPVMISDLLGDPVSRVRHFPCHKMLVAEYGE  78

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
              ++IVGV+RG +++V+RG       ++ YV VAY+LGLRVS  HR LGIGTKL+Q+LE W
Sbjct  79    GRKIVGVVRGCVKTVTRG-------NSIYVKVAYVLGLRVSPSHRNLGIGTKLMQALEEW  131

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
              +  GA Y YMATDC+N+ SINLFT   +YVKFRTP++LVQPVH H KPIGSD+ ++++ 
Sbjct  132   LKQQGATYAYMATDCTNEPSINLFTKKCSYVKFRTPTMLVQPVHAHTKPIGSDITILQLT  191

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAI  850
             P+ AES Y R F   SEFFP DI+ +L N+ +LGTF+AVP    +  + D   FP + A+
Sbjct  192   PKTAESVYTRIFK-DSEFFPSDIDSILTNRNSLGTFIAVPSHKSNRLDRD---FPADFAV  247

Query  851   LSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRM  1030
             LS+W  K+V+K+Q+KG+S L      G+R +D  IPW++LPS PNV   F  YF++G+ M
Sbjct  248   LSVWSTKDVFKLQMKGVSRLTHLFCSGSRFIDSCIPWLKLPSCPNVFDKFWVYFMYGMHM  307

Query  1031  EGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIk  1207
              G+ G  +M+SL  F HN+A  D  GC  +  E+SP D V   +PHWK  SW QDLWCI 
Sbjct  308   GGKDGPRLMKSLCNFVHNIASYD-GGCGAVATELSPSDAVALAVPHWKRLSWTQDLWCI-  365

Query  1208  hlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                         K  +   + S+ S     S+++IFVDPRDI
Sbjct  366   ------------KKLSDESEPSDWSRSRSSSTSVIFVDPRDI  395



>emb|CDX87350.1| BnaA07g35230D [Brassica napus]
Length=396

 Score =   386 bits (991),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 266/378 (70%), Gaps = 19/378 (5%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQC-EVGQEGKPRLVIDLLDDPIGRVR  268
             MS K+AA       VVVR+Y+EE DK  VEE+E +C E G  GKP +V DLL DP+ RVR
Sbjct  1     MSSKIAAEVAAAAVVVVREYDEETDKRDVEEMERECDETGPHGKPVMVSDLLGDPVRRVR  60

Query  269   NAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRR  448
             + P H M+VAE+G  +++VGV+RG +++V+RG       ++ YV +AY+LGLRVS  HRR
Sbjct  61    HFPCHTMLVAEYGEGRKMVGVVRGCVKTVTRG-------NSIYVKLAYVLGLRVSPSHRR  113

Query  449   -LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
              LGIGTKLVQ+LE W +  GA Y YMATDC+N++SINLFT   +Y+KFRTP++LVQPVH 
Sbjct  114   NLGIGTKLVQTLEEWFKQQGATYSYMATDCTNESSINLFTKKCSYIKFRTPTMLVQPVHA  173

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE---  796
             H KPI SD+ ++R+  + AES Y R F   SEFFP+DI+ +L ++ +LGTF+A PKE   
Sbjct  174   HSKPICSDITILRLTTKTAESIYTRVFK-DSEFFPRDIDAILTSRNSLGTFIAFPKEEHG  232

Query  797   -SLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
                +  + D   FPT++AILS+W  K+V+++Q+KG+S L  AC  G+R+LD  +PW++LP
Sbjct  233   HKSNRLDRD---FPTDYAILSVWSTKDVFRLQMKGVSRLTHACCSGSRLLDSCMPWMKLP  289

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S PNV   F  YF++G+ MEG+ G  +M+SL  F HN+ R+D  GC  +  E+SP DPV 
Sbjct  290   SFPNVFDKFWVYFMYGMHMEGRDGPRLMKSLCYFVHNIGRHD-GGCGAVATEISPLDPVA  348

Query  1154  RGIPHWKNFSW-QDLWCI  1204
               +PHWK  SW QDLWC+
Sbjct  349   SAVPHWKRLSWAQDLWCL  366



>ref|XP_010537847.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X2 [Tarenaya 
hassleriana]
Length=364

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 262/386 (68%), Gaps = 25/386 (6%)
 Frame = +2

Query  185   LESQC-EVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSR  361
             +E++C E G  GKP +V DLL DP+ RVR+ P HVM+VAE+G  +E+VGV+RG +++V+R
Sbjct  1     METKCDETGPRGKPTMVSDLLGDPLRRVRHFPSHVMLVAEYGEGREVVGVVRGCVKTVTR  60

Query  362   GQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSN  541
             G        +DYV +AY+LGLRVS  HR LG+GTKLVQ+LE W +  GA Y YMATDC+N
Sbjct  61    GD-------SDYVKLAYVLGLRVSPLHRNLGVGTKLVQALEEWFKRQGATYAYMATDCTN  113

Query  542   QASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSE  721
               SINLFT   +Y KFRTP++LVQPVH H KP+GSD++++R+ P+ +ES Y R F  +S+
Sbjct  114   APSINLFTKKCSYTKFRTPTMLVQPVHAHIKPVGSDISIIRLTPKSSESIYSRVFK-NSD  172

Query  722   FFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGL  901
             FFP DI  VL ++ +LGTFMAVP++  +  +   G FP++ AILS+W  +EV+K+Q+KG+
Sbjct  173   FFPLDIGSVLASRSSLGTFMAVPRKPRTKPDETDGDFPSSFAILSVWSTEEVFKLQMKGV  232

Query  902   SALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAH  1081
             S L  AC  G+R+LD  +PW+RLPS PNV   F  YF++GL MEG+ G  +M+ L  F H
Sbjct  233   SRLMHACCSGSRLLDSCMPWLRLPSFPNVFDKFWVYFMYGLHMEGEDGPHLMKGLCKFVH  292

Query  1082  NVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaani  1258
             N+ R D  GC  ++ E+SP DPV   +PHW+  SW +DLWC+             K  + 
Sbjct  293   NLGRFD-GGCGAVVTELSPSDPVAAVVPHWRRLSWAEDLWCL-------------KKLSA  338

Query  1259  vhdSSEDSIMYHDSSA-LIFVDPRDI  1333
                 + D I    SS+ +IFVDPRDI
Sbjct  339   DGPETSDWIRSRSSSSPVIFVDPRDI  364



>emb|CDX88571.1| BnaC06g40150D [Brassica napus]
Length=396

 Score =   381 bits (978),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 262/378 (69%), Gaps = 19/378 (5%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQC-EVGQEGKPRLVIDLLDDPIGRVR  268
             MS K+AA       VVVR+Y+EE DK  VEE+E +C E G  GKP +V DLL DP+ RVR
Sbjct  1     MSSKIAAEVAAAAVVVVREYDEETDKRDVEEMERECDETGPPGKPLMVSDLLGDPVRRVR  60

Query  269   NAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRR  448
             + P H M+VAE+G  +++VGV+RG +++V+RG       ++ YV +AY+LGLRVS  HRR
Sbjct  61    HFPCHTMLVAEYGEGRKMVGVVRGCVKTVTRG-------NSIYVKLAYVLGLRVSPSHRR  113

Query  449   -LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
              LGIGTKLVQ+LE W +  GA Y YMATDC+N++SINLFT    Y+KFRTP++LVQPVH 
Sbjct  114   NLGIGTKLVQTLEEWFKQQGATYSYMATDCTNESSINLFTKKCAYIKFRTPTMLVQPVHA  173

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE---  796
             H KPI SD+ ++R+  + AES Y   F   SEFFP DI+ +L ++ +LGTF+A PKE   
Sbjct  174   HSKPICSDITILRLTTKTAESIYTGVFK-DSEFFPSDIDAILTSRNSLGTFIAFPKEEHG  232

Query  797   -SLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
                +  + D   FPT++AILS+W  K+V+++Q+KG+S L  AC  G+R+LD  +PW++LP
Sbjct  233   HKSNRLDRD---FPTDYAILSVWSTKDVFRLQMKGVSRLTHACCSGSRLLDSCMPWMKLP  289

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S PNV   F  YF++G+ MEG  G  +M+SL  F HN+ R+D  GC  +  E+SP DPV 
Sbjct  290   SFPNVFDKFWVYFMYGMHMEGNDGPRLMKSLCYFVHNIGRHD-EGCGAVATEISPLDPVA  348

Query  1154  RGIPHWKNFSW-QDLWCI  1204
               +PHWK  SW QDLWC+
Sbjct  349   SAVPHWKRLSWAQDLWCL  366



>ref|XP_010691581.1| PREDICTED: probable N-acetyltransferase HLS1 [Beta vulgaris subsp. 
vulgaris]
Length=403

 Score =   376 bits (965),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 204/379 (54%), Positives = 268/379 (71%), Gaps = 17/379 (4%)
 Frame = +2

Query  92    MSFKVAAVAEKLP------EVVVRQYEEERDKVAVEELESQCEVGQE-GKPRLVIDLLDD  250
             MS K+  VAEK P       VV+R+Y+E++DK  VEELE QCE GQ+ G P L+  LL D
Sbjct  1     MSLKI--VAEKSPIKKSVEVVVIREYDEKKDKEEVEELERQCEFGQQQGNPSLITHLLGD  58

Query  251   PIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRV  430
             P+GR+R+    +MMVAE G   EIVGVIRG I+ V+RG+K  +     YV +AYILGLRV
Sbjct  59    PLGRIRHFSTRIMMVAEFG--GEIVGVIRGGIKDVTRGKKAAD--LPVYVKLAYILGLRV  114

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HR+ GI TKLV+ LE W +    DY+YM TDC+N+ASINLF   LNY KF TP+VLV
Sbjct  115   SPMHRQKGIATKLVKKLEEWCKEKEVDYVYMMTDCANEASINLFNYKLNYTKFCTPTVLV  174

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPVH H+KPI S  A+VRVPP +AES Y R F  +SE FPKDI  +L++KL+LGTF+ VP
Sbjct  175   QPVHAHRKPISSGTAIVRVPPLVAESIYGRIFT-NSECFPKDIGSILSSKLHLGTFVGVP  233

Query  791   KESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
             K+ L  W+P  G+ P   AI+S+W+ KE+Y++Q+KG+S L +AC LG+RVLD  +PW+++
Sbjct  234   KKYLQKWDPLKGL-PPCFAIMSVWNTKEIYQLQLKGVSKLTKACCLGSRVLDAHMPWLKV  292

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+PN+ K FG+YFL+GL +EG+    +M+SL  FAHN+AR+D     ++       DPV
Sbjct  293   PSIPNMFKPFGFYFLYGLHLEGKGSLGLMKSLCNFAHNMARDDVACAAVVAEVAQ-WDPV  351

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
                IPHWK FSW +DLWC+
Sbjct  352   SEAIPHWKRFSWSEDLWCM  370



>ref|XP_010429890.1| PREDICTED: probable N-acetyltransferase HLS1-like [Camelina sativa]
Length=393

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/417 (50%), Positives = 271/417 (65%), Gaps = 27/417 (6%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQC-EVG-QEGKPRLVIDLLDDPIGRV  265
             MS KVA  A     VVVR+Y EE DK  VEE+E +C E G   GKP +V DLL DP+ RV
Sbjct  1     MSSKVATSAAVAAAVVVREYNEESDKCNVEEMERKCDETGNHHGKPVMVSDLLGDPVRRV  60

Query  266   RNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHR  445
             R+ P H M+VAE+G  +++VGV+RG +++V+RG      NST +V +AY+LGLRVS  HR
Sbjct  61    RHFPSHTMLVAEYGDGRKMVGVVRGCVKTVTRGS-----NST-FVKLAYVLGLRVSPSHR  114

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
              LGIGTKLV++LE W +  GA Y YMATD +N+ SINLFT   +YVKFRTP++LVQPVH 
Sbjct  115   NLGIGTKLVRALEEWFKQQGATYAYMATDYTNEPSINLFTKKCSYVKFRTPTMLVQPVHA  174

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS  805
             H KPIGSD+ ++R+ P+ AES Y R F   SEFFP+DI+ +L ++ +LGTF+AVPKE   
Sbjct  175   HTKPIGSDITILRLTPETAESIYTRIFK-DSEFFPRDIDAILTSRNSLGTFIAVPKEKHV  233

Query  806   TWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
             T          N AILS+W  K+V+++Q+KG+S L  A   G R +D  +PW++LPS PN
Sbjct  234   TKSNREA----NFAILSVWSTKDVFRLQMKGVSRLTHAVCSGLRFIDSCMPWMKLPSFPN  289

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V   F  YF++G+ MEG+ G  +M SL +F HN+ R D  GC  L AE+SP D V   +P
Sbjct  290   VFDKFWVYFMYGMHMEGKDGPRLMRSLCSFVHNIGRYD-GGCGALAAELSPSDAVALAVP  348

Query  1166  HWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             HWK  SW QDLWC+             K +     S         SS++IFVDPRDI
Sbjct  349   HWKRLSWAQDLWCL------------KKLSGEPEPSDWTRSTSSSSSSVIFVDPRDI  393



>ref|XP_010655081.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X2 [Vitis 
vinifera]
Length=383

 Score =   372 bits (956),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 211/421 (50%), Positives = 270/421 (64%), Gaps = 45/421 (11%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRN  271
             MS +VAA       VVVR+++E RDK AVEE+E +CE+GQ GKP LV DL+ DPI R+R+
Sbjct  1     MSQRVAAETCPPKVVVVREFDEGRDKAAVEEMEKRCEIGQRGKPSLVTDLMGDPICRIRH  60

Query  272   APLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRL  451
                HVM+VAE+G  + +VGV+RG +++V+RG+                          RL
Sbjct  61    FSTHVMLVAEYGEERRVVGVVRGCVKTVTRGKS------------------------MRL  96

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIGTKLVQ LE W   NGA+Y YMATDC+N+ SINLFT   +Y KFRTP++LVQPVH H 
Sbjct  97    GIGTKLVQHLEKWCERNGAEYAYMATDCTNEPSINLFTKKCSYAKFRTPTMLVQPVHAHY  156

Query  632   KPI-GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES---  799
             KP+  S   ++ +PPQLAE  YRR F  +SEFFPKDI+ +L NKLNLGTF+A+PK+S   
Sbjct  157   KPLPSSKTLILPLPPQLAELIYRRIF-ANSEFFPKDIDQILTNKLNLGTFIALPKKSNFK  215

Query  800   --LSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
                S    +  + P   AILS+W+ K+V+K+Q+KG S L  A   GTR LD  +PW+  P
Sbjct  216   CNPSNNNNNLLLLPPTFAILSVWNTKDVFKLQLKGASPLTYAWCAGTRALDAYLPWLHFP  275

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S+PNV K FG YFL GL MEG+ G  +M+SL AFAHN+AR+D  GC  L+AEV+  DPVR
Sbjct  276   SIPNVFKQFGVYFLHGLHMEGKHGLRLMKSLCAFAHNMARDD-AGCGALVAEVAHRDPVR  334

Query  1154  RGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRD  1330
              GIPHW  FSW +DLWCI             K     H   +D +    +S +IFVDPRD
Sbjct  335   DGIPHWSKFSWAEDLWCI------------KKFTPANHHPDDDWVTSRPASPVIFVDPRD  382

Query  1331  I  1333
              
Sbjct  383   F  383



>ref|XP_010472858.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=395

 Score =   371 bits (952),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 274/417 (66%), Gaps = 25/417 (6%)
 Frame = +2

Query  92    MSFKVAAVAEKLPEVVVRQYEEERDKVAVEELESQC-EVG-QEGKPRLVIDLLDDPIGRV  265
             MS K+AA A     VVVR+Y+EE DK  VEE+E +C E G   GKP LV DLL DP+ RV
Sbjct  1     MSSKIAASAAVAAAVVVREYDEESDKCDVEEMERKCDETGNHHGKPVLVSDLLGDPVRRV  60

Query  266   RNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHR  445
             R+ P H M+VAE+G  +++VGV+RG +++V+RG       ++ +V +AY+LGLRVS  HR
Sbjct  61    RHFPSHTMLVAEYGDGRKMVGVVRGCVKTVTRG------GNSIFVKLAYVLGLRVSPSHR  114

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
              LGIGTKLV++LE W +  GA Y YMATD  N+ SINLFT   +YVKFRTP++LVQPVH 
Sbjct  115   NLGIGTKLVRALEEWFKQQGATYAYMATDYINEPSINLFTKKCSYVKFRTPTMLVQPVHA  174

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS  805
             H KPIGSD+ ++R+ P+ AES Y R F   SEFFP+DI+ +L ++ +LGTF+AVP E   
Sbjct  175   HTKPIGSDITILRLTPETAESIYTRIFK-DSEFFPRDIDAILTSRNSLGTFLAVPNEKHG  233

Query  806   TWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                        N AILS+W  K+V+++Q+KG+S L  A   G R LD  +PW++LPS PN
Sbjct  234   LKSNSEA----NFAILSVWSTKDVFRLQMKGVSRLTHAVCSGLRFLDSCMPWMKLPSFPN  289

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V   F  YF++G+ MEG+ G  +M SL +F HN+ R D  GC  L AE+SP D V   +P
Sbjct  290   VFDKFWVYFMYGMHMEGKDGPRLMRSLCSFVHNIGRYD-GGCGALAAELSPSDAVALAVP  348

Query  1166  HWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             HWK  SW QDLWC+K L+   D ++           +  +     SS++IFVDPRDI
Sbjct  349   HWKRLSWAQDLWCLKKLSGEPDPSDW----------TNSTSSSSSSSSVIFVDPRDI  395



>ref|XP_006301652.1| hypothetical protein CARUB_v10022096mg [Capsella rubella]
 gb|EOA34550.1| hypothetical protein CARUB_v10022096mg [Capsella rubella]
Length=401

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 194/397 (49%), Positives = 262/397 (66%), Gaps = 30/397 (8%)
 Frame = +2

Query  164   DKVAVEELESQCEVG---QEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS-KEIVGV  331
             DK  VEE+E +CE     Q GKP +V DLL DP+ RVR+ P H M+VAE+G   K++VGV
Sbjct  28    DKHDVEEMERKCEETGNHQHGKPVMVSDLLGDPVCRVRHFPSHTMLVAEYGEGRKKVVGV  87

Query  332   IRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGAD  511
             +RG +++V+RG  G N     +V +A +LGLRVS  HR LGIGTKLV++LE W +  GA 
Sbjct  88    VRGCVKTVTRG--GGN---PIFVKLACVLGLRVSPSHRNLGIGTKLVRALEEWFKQQGAT  142

Query  512   YIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESY  691
             Y YMATD +N+ SINLFT   +YVKFRTP++LVQPVH H KPIGSD++++ + PQ AES 
Sbjct  143   YAYMATDYTNEPSINLFTKKCSYVKFRTPTMLVQPVHAHSKPIGSDISILELTPQTAESI  202

Query  692   YRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV--FPTNHAILSIWD  865
             Y R F   SEFFP+DI+ +L ++ +LGTF+AV  E+     P S +     N AILS+W 
Sbjct  203   YTRIFK-DSEFFPRDIDAILTSRNSLGTFIAVLNENHG---PKSNLDDLSANFAILSVWS  258

Query  866   AKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSG  1045
              K+V+++Q+KG+S L  A   G+R+LD  +PW++LPS PNV   F  YF++G+ MEG+ G
Sbjct  259   TKDVFRLQMKGVSWLTHAFCSGSRLLDSCMPWMKLPSFPNVFDKFWVYFMYGMHMEGKDG  318

Query  1046  SEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkhlnlv  1222
               +M+SL +F HN+ R D  GC  L AE+SP D V   +PHWK  SW QDLWC+      
Sbjct  319   PRLMKSLCSFVHNIGRYD-GGCGALAAELSPSDAVALVVPHWKRLSWAQDLWCL------  371

Query  1223  gdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                    K  +   + S+ +     SS++IFVDPRDI
Sbjct  372   -------KKLSDEPEQSDWTRSRSSSSSVIFVDPRDI  401



>ref|XP_010086949.1| hypothetical protein L484_005908 [Morus notabilis]
 gb|EXB25085.1| hypothetical protein L484_005908 [Morus notabilis]
Length=413

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 253/386 (66%), Gaps = 24/386 (6%)
 Frame = +2

Query  104   VAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLH  283
             V  V EK+  +V+R+Y+ + D   VE++E +CEVG  GK  L  DLL DPI RVRN+P  
Sbjct  2     VGEVVEKV--LVIREYDPKTDLSGVEDVERRCEVGPSGKLSLFTDLLGDPICRVRNSPAF  59

Query  284   VMMVAEHGISKEIVGVIRGSIRSVSRGQK----GKNDNSTD---------YVDVAYILGL  424
              M+VAE G  KE+VG+IRG I++V+ G+K     KN+NS           Y  +AYILGL
Sbjct  60    FMLVAEMGDEKEMVGMIRGCIKTVTCGKKLSRKAKNNNSETIAKAKALPVYTKLAYILGL  119

Query  425   RVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSV  604
             RVS  HRR+GIG KLV+ +E W R NGA+Y Y+AT+  NQAS+NLFT    Y +FRTPS+
Sbjct  120   RVSPSHRRMGIGLKLVRGMEEWFRENGAEYSYLATENDNQASVNLFTHKCGYSRFRTPSI  179

Query  605   LVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA  784
             LV PV  H+  + S V V+R+ P+ AES YR  F  ++EFFP+DI+ VLNNKL LGTF+A
Sbjct  180   LVNPVFAHRVKVSSRVTVIRLSPRDAESIYRTRFS-TTEFFPRDIDSVLNNKLTLGTFLA  238

Query  785   VPKESLS--TWEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDR  949
             VP+ S S  +W          P + AILS+W+ K+V+ ++VKG S +K+     TRV+DR
Sbjct  239   VPRGSYSAESWIGSDQFLADPPESWAILSVWNTKDVFTLEVKGASRVKRTLARTTRVIDR  298

Query  950   LIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAE  1129
              +PW+RLPSVP+  + FG +F++GL  EG     M+ +L   AHN+A+   RGC  +  E
Sbjct  299   ALPWLRLPSVPDFFRPFGLHFMYGLGGEGPRAGRMVRALCGQAHNLAKE--RGCGAVATE  356

Query  1130  VSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             VS  +P+R  IPHWK  S  +DLWCI
Sbjct  357   VSSREPLRLAIPHWKRLSCAEDLWCI  382



>ref|XP_007047498.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
 gb|EOX91655.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
Length=407

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 252/371 (68%), Gaps = 17/371 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D  +VEE+E +CEVG  GK  L  DLL DPI RVR++P  +M+VAE   +
Sbjct  9     IVVREFDPSKDLTSVEEVEKRCEVGPSGKLSLFTDLLGDPICRVRHSPAFLMLVAELSST  68

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTD-------YVDVAYILGLRVSSQHRRLGIGTKLV  472
             KEIVG+IRG I++V+ G+K   +  +D       Y  +AYILGLRVS  HRR+GIG KLV
Sbjct  69    KEIVGMIRGCIKTVTCGKKLSRNTKSDPTKPVPIYTKLAYILGLRVSPSHRRMGIGLKLV  128

Query  473   QSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDV  652
               +E W   NGA+Y Y+AT+  NQAS+NLFT    Y KFRTPS+LV PV  H+ P+ + V
Sbjct  129   LRMEEWFTQNGAEYAYLATENDNQASVNLFTDKCGYSKFRTPSILVNPVFAHRLPVSNRV  188

Query  653   AVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV-  829
              ++++PP  AES YRR F  ++EFFP+DI+ VLNN+LNLGTF+AVP     T E  SG  
Sbjct  189   TLIKLPPSDAESLYRRRF-STTEFFPRDIDSVLNNRLNLGTFLAVPPGCCYTQESWSGTD  247

Query  830   -----FPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSK  994
                   P + A+LS+W+ K+ + ++V+G S +++     TR++D+L+P++RLPS+P V +
Sbjct  248   EFLSDPPESWAVLSVWNCKDAFMLEVRGASRMRKTLAKTTRIVDKLLPFLRLPSIPEVFR  307

Query  995   NFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWK  1174
              FG +FL+GL  EG   ++ +++L A AHN+A+    GC ++  EV+  +P++ G+PHWK
Sbjct  308   PFGLHFLYGLGGEGPRAAKFVKALCAHAHNLAKEG--GCSVVATEVANCEPLKIGVPHWK  365

Query  1175  NFSW-QDLWCI  1204
               S  +DLWCI
Sbjct  366   RLSCDEDLWCI  376



>ref|XP_010272325.1| PREDICTED: probable N-acetyltransferase HLS1, partial [Nelumbo 
nucifera]
Length=400

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/376 (49%), Positives = 254/376 (68%), Gaps = 23/376 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++ E+D + VEE+E +CEVG  GK  L  DLL DPI RVR++P  +M+VAE    
Sbjct  7     IVVREFDAEKDCLGVEEVERRCEVGPSGKLSLFTDLLGDPICRVRHSPAFLMLVAEMDEE  66

Query  314   KEIVGVIRGSIRSVSRGQK-------GKNDNST-----DYVDVAYILGLRVSSQHRRLGI  457
             KEIVGVIRG I++V+ G+K       G NDN+       Y  VAYILGLRVS  HRR+GI
Sbjct  67    KEIVGVIRGCIKTVTCGKKLSRNGKNGGNDNTPLKPLPVYTKVAYILGLRVSPSHRRMGI  126

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV  +E+W R NGA+Y YMAT+  N+AS+ LFT    Y KFRTPS+LV PV  H   
Sbjct  127   GLKLVSRMEDWFRENGAEYAYMATEKDNEASVKLFTDRCGYNKFRTPSILVHPVFAHPLR  186

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TW  811
             I   V V R+ P  AE+ YRR F  ++EFFP+DI+ +LNNKLNLGTF+AVP  S +  +W
Sbjct  187   IPKRVQVFRLHPSDAETLYRRRFS-TTEFFPRDIDAILNNKLNLGTFVAVPSGSYNPESW  245

Query  812   EPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSV  979
              P    F    P + AILS+W++K+V+ ++V+G S +K+     TR++D+  PW+R+PSV
Sbjct  246   -PGIERFLSEPPESWAILSVWNSKDVFTLEVRGASRVKRGLAKTTRIVDKAFPWLRIPSV  304

Query  980   PNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRG  1159
             P V + FG +FL+GL  +G    +++++L  FAHN+A++  RGC +++ EVS  +P++ G
Sbjct  305   PEVFRPFGVHFLYGLGGDGPDSVKLIKALCGFAHNLAKD--RGCSVVVTEVSSREPLKSG  362

Query  1160  IPHWKNFSW-QDLWCI  1204
             IPHWK     +DLWC+
Sbjct  363   IPHWKWLGCAEDLWCM  378



>gb|KDP32061.1| hypothetical protein JCGZ_12522 [Jatropha curcas]
Length=406

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 255/377 (68%), Gaps = 28/377 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  RD V VEE+E +CEVG  G+  L  DLL DPI RVR++P  +M+VAE G  
Sbjct  7     IVVREFDPSRDGVGVEEVERRCEVGPSGELSLFTDLLGDPICRVRHSPAFLMLVAELG--  64

Query  314   KEIVGVIRGSIRSVSRGQKGKN--DNSTD---------YVDVAYILGLRVSSQHRRLGIG  460
             +EIVG+IRG I++V+ G+K      N+T+         Y  VAYILGLRVS  HRR+GIG
Sbjct  65    EEIVGMIRGCIKTVTCGKKLSRHVKNTTNNEPPKPLPVYTKVAYILGLRVSPSHRRMGIG  124

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              KLV+ +E W R NGA+Y Y+AT+  NQAS+ LFT    Y KFRTPS+LV PV  H+ P+
Sbjct  125   LKLVRMIEEWFRENGAEYSYLATENDNQASVKLFTDKCGYSKFRTPSILVNPVFAHRLPV  184

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPD  820
                V V ++P   AE  YRR F  ++EFFP+DI+ VLNNKL+LGTF+AVP+    T+E D
Sbjct  185   SHKVTVFQLPTDDAELLYRRRFS-TTEFFPRDIDSVLNNKLSLGTFLAVPR---GTYESD  240

Query  821   S--------GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPS  976
             S           P + A+LS+W+ K+V++++V+G S +K+     TR++D+ +P++RLPS
Sbjct  241   SWPGFDKFLSDPPESWAVLSVWNCKDVFRLEVRGASRVKRTFAKTTRMVDKALPFLRLPS  300

Query  977   VPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRR  1156
             VP V + FG +FL+GL  EG    +M+++L A+AHN+A+    GCE++  EVS  +P++ 
Sbjct  301   VPEVFRPFGLHFLYGLGGEGPRAVKMVKALCAYAHNLAKE--LGCEVVATEVSSREPLKL  358

Query  1157  GIPHWKNFSW-QDLWCI  1204
             GIPHWK  S  +DLWCI
Sbjct  359   GIPHWKMLSCAEDLWCI  375



>ref|XP_011073697.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X2 [Sesamum 
indicum]
Length=433

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 255/379 (67%), Gaps = 29/379 (8%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI----  310
             R+Y+ E+D+ AVEE+E++CEVG  GK  L  DLL DPI RVR++P ++M+VAE  +    
Sbjct  28    REYDAEKDRRAVEEVENRCEVGPSGKLSLYTDLLGDPICRVRHSPAYLMLVAELLVVGGG  87

Query  311   ----SKEIVGVIRGSIRSVSRGQK----GKNDNSTD------YVDVAYILGLRVSSQHRR  448
                  +EIVG+IRG I++V+ G K    GKN ++        Y  +AYILGLRVS  HRR
Sbjct  88    EDKERREIVGMIRGCIKTVTCGTKLSRYGKNCSTKPPEPLPVYTKLAYILGLRVSPSHRR  147

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             +GIG KLV+ +E W   NGA+Y YMAT+  NQAS+ LFT   +Y KFRTP++LVQPV  H
Sbjct  148   MGIGLKLVRRMEQWFGENGAEYSYMATETDNQASVKLFTQKCDYCKFRTPAILVQPVFAH  207

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL--  802
             +  I   V ++++ P  AE  YRR F  ++EFFP+DI+ VLNNKL+LGTF+AVPK S   
Sbjct  208   RVRIDKRVTIIKLSPADAEVLYRRRFS-TTEFFPRDIDAVLNNKLSLGTFLAVPKGSYWP  266

Query  803   STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              +W P +  F    P   A+LS+W+  +V++++V+G S +++A    TRV+DR +PW+ L
Sbjct  267   ESW-PGAAEFLVAPPETWAVLSVWNCMDVFRLEVRGASRVRRAVAKTTRVVDRALPWLHL  325

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+P V + FG++FL+GL  EG + ++ M +L   AHN+A+    GC ++  EV+  +P+
Sbjct  326   PSIPEVFRPFGFHFLYGLGGEGPNAAKFMRALCGLAHNLAQE--HGCGVVATEVASREPL  383

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             R GIPHWK+ S  +DLWCI
Sbjct  384   RLGIPHWKSLSCAEDLWCI  402



>ref|XP_006380626.1| constitutive photomorphogenic 3 family protein [Populus trichocarpa]
 gb|ERP58423.1| constitutive photomorphogenic 3 family protein [Populus trichocarpa]
Length=407

 Score =   341 bits (875),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 180/380 (47%), Positives = 256/380 (67%), Gaps = 28/380 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D V VEE+E +CEVG  GK  L  DLL DPI RVRN+P  +M+VAE  I 
Sbjct  2     IVVREFDPRKDGVGVEEVERRCEVGPGGKLSLFTDLLGDPICRVRNSPAFLMLVAE--IG  59

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-------------YVDVAYILGLRVSSQH  442
             +EIVG+IRG I++V+ G+K     KN+ S +             Y  VAYILGLRVS  H
Sbjct  60    EEIVGMIRGCIKTVTCGKKLSRTVKNNYSYNVINNNDLSKPVPVYTKVAYILGLRVSPSH  119

Query  443   RRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVH  622
             RR+GIG KLV  +E+W R NGA+Y Y+AT+  N AS+ LFT    Y KFRTPS+LV PV 
Sbjct  120   RRMGIGLKLVHQMEDWFRQNGAEYSYIATENDNHASVKLFTDKCGYSKFRTPSILVNPVF  179

Query  623   RHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL  802
              H+ P+ + V ++++ P  AE  YRR F  ++EFFP+DI+ VL NKLN+G F+AVP+ SL
Sbjct  180   AHRVPVSNRVTIIKLTPHDAELLYRRRF-ATTEFFPRDIDSVLKNKLNVGNFLAVPRGSL  238

Query  803   --STWE-PDSGVF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
                +W  PDS +   P + A+LS+W+ K+V++++V+G S +K+     TRV+D+ +P++R
Sbjct  239   KSGSWAGPDSFLSDPPESWAVLSVWNCKDVFRLEVRGASRVKRTFAKTTRVVDKALPFLR  298

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPSVP V + FG YF++GL  EG   ++MM++L    HN+A+    GC +++ EV+  +P
Sbjct  299   LPSVPAVFRPFGLYFMYGLGGEGPRAAKMMKALCGHVHNLAKES--GCGVVVTEVANREP  356

Query  1148  VRRGIPHWKNFSW-QDLWCI  1204
             ++ GIPHWK  S  +DLWCI
Sbjct  357   LKLGIPHWKMLSCAEDLWCI  376



>gb|KFK30374.1| hypothetical protein AALP_AA7G252700 [Arabis alpina]
Length=405

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 252/376 (67%), Gaps = 22/376 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P  +M+VAE G  
Sbjct  2     TVVREYDPTRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQK-------GKNDNSTD--YVDVAYILGLRVSSQHRRLGIGT  463
              KEIVG+IRG I++V+ GQK        +ND      Y  +AY+LGLRVS  HRR GIG 
Sbjct  62    KKEIVGMIRGCIKTVTCGQKIDLNTHNPQNDTVFKPLYTKLAYVLGLRVSPSHRRQGIGF  121

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
             KLV+ +E W   NGA+Y Y+AT+  NQAS+NLFTG   Y KFRTPS+LV PV+ HK  + 
Sbjct  122   KLVKMMEEWFSQNGAEYSYIATENDNQASVNLFTGKCGYSKFRTPSILVNPVYAHKVNVS  181

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS  823
             S V ++++ P  AE+ YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S
Sbjct  182   SQVTIIKLDPVDAETLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGS  240

Query  824   GVF--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSV  979
                        P + A+LS+W+  E ++++V+G S L++     TRV+D+ +P+++LPSV
Sbjct  241   WPGSAKFLEYPPESWAVLSVWNCNESFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSV  300

Query  980   PNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRG  1159
             P+V K FG  F++G+  EG    +M++SL A AHN+A+N  RGC +L AEV+ ++P+RRG
Sbjct  301   PSVFKPFGLCFMYGIGGEGPRAVKMVKSLSAHAHNIAKN--RGCGVLAAEVAGEEPLRRG  358

Query  1160  IPHWKNFSW-QDLWCI  1204
             IPHWK  S  +DLWCI
Sbjct  359   IPHWKVLSCAEDLWCI  374



>ref|XP_010939135.1| PREDICTED: probable N-acetyltransferase HLS1 [Elaeis guineensis]
Length=412

 Score =   341 bits (875),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 249/375 (66%), Gaps = 20/375 (5%)
 Frame = +2

Query  137   VVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH-GIS  313
             VVR+YEEERD++ VE +E  CEVG  G+  L  D L DP+ RVR++P  +M+VAE  G  
Sbjct  7     VVREYEEERDRLRVEAMERMCEVGPSGEMSLFTDHLGDPVSRVRHSPAFLMLVAEKSGPV  66

Query  314   KEIVGVIRGSIRSVSRGQK------GKNDNSTD---YVDVAYILGLRVSSQHRRLGIGTK  466
             KEIVG+IRGS+++V+ G+        K+ N      Y  VAYILGLRVS  HRR+GIG K
Sbjct  67    KEIVGLIRGSVKTVTCGKTIPRNAAAKHQNPPPIPIYSKVAYILGLRVSPFHRRMGIGGK  126

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ LE W ++ GA+Y YMAT+  N+ASI LFTG   Y KFRTP++LV PV  H+ PI  
Sbjct  127   LVRRLEGWFKAQGAEYAYMATEKDNEASIRLFTGRCGYSKFRTPAILVHPVFAHRLPIPG  186

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE---SLSTWE-  814
              V ++R+PP  AE+ YRR F  ++EFFP+DI+ VL+N L+LGTF+AVP         WE 
Sbjct  187   SVRIIRLPPADAETLYRRRFS-TTEFFPRDIDAVLSNPLSLGTFLAVPAAGGGGRGGWEW  245

Query  815   PDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
             P +  F    P + A++S+W+   V++++V+G S +++     TR  DR +PW+R+PSVP
Sbjct  246   PGAEEFLAAPPESWAVVSVWNCGGVFRLEVRGASRVRRGLAWATRAADRALPWLRIPSVP  305

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
             ++ + FG  FL+G+  EG + + M+ +L   AHN+ R    GC ++ AEV+  +P+R+GI
Sbjct  306   DIFRPFGALFLYGIGGEGPAAAGMVGALCRHAHNMGRGAPGGCRVVAAEVAACEPLRQGI  365

Query  1163  PHWKNFSW-QDLWCI  1204
             PHW+  S  +DLWC+
Sbjct  366   PHWRRLSCAEDLWCV  380



>ref|XP_009379320.1| PREDICTED: probable N-acetyltransferase HLS1 [Pyrus x bretschneideri]
Length=416

 Score =   340 bits (873),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 258/379 (68%), Gaps = 26/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE---H  304
             +VVR+++  +D   V+++E +CEVG  G   L  DLL DPI RVR++P ++M+VAE    
Sbjct  11    LVVREFDPIKDCEMVQDVERRCEVGPSGGLSLFTDLLGDPICRVRHSPAYLMLVAEVVGA  70

Query  305   GISKEIVGVIRGSIRSVSRGQK----GKNDNSTD--------YVDVAYILGLRVSSQHRR  448
                +EIVG+IRG I++V+ G+K    GK+  + D        Y  +AYILGLRVS  HRR
Sbjct  71    EKEREIVGMIRGCIKTVTCGKKLSRNGKSVTAGDVTLKPLPVYTKLAYILGLRVSPSHRR  130

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             +GIG KLV  +E W R NGA+Y YMAT+  NQAS+ LFT    YVKFRTP++LV PV+ H
Sbjct  131   MGIGLKLVSRVEEWFRENGAEYSYMATENDNQASVKLFTDKCGYVKFRTPTILVNPVYAH  190

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS-  805
             +  + S V V+ + P  AE+ YRR F  ++EFFP+DI+ VLNN+L+LGTF+AVP+ S++ 
Sbjct  191   RVKVSSRVTVIELSPSDAEALYRRRF-ATTEFFPRDIDSVLNNRLSLGTFLAVPRGSVTE  249

Query  806   -TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              TW P +  F    P + AILS+W++K+V+ ++VKG S +K+     TR++DR +PW+RL
Sbjct  250   DTW-PGADHFLADPPESWAILSVWNSKDVFTLEVKGASLVKRTLAKTTRLVDRALPWMRL  308

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PSVP++ + FG +FL+GL  EG    + +++L   AHN+A++  RGC ++  EVS  +P+
Sbjct  309   PSVPDIFRPFGVHFLYGLGGEGPRAVKFVKALCGHAHNLAKD--RGCAVVATEVSSREPL  366

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             R GIPHWK  S  +D+WCI
Sbjct  367   RLGIPHWKRLSCDEDMWCI  385



>ref|XP_002525259.1| N-acetyltransferase, putative [Ricinus communis]
 gb|EEF37087.1| N-acetyltransferase, putative [Ricinus communis]
Length=403

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 257/372 (69%), Gaps = 21/372 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  RD+V VEE+E +CEVG  GK  L  DLL DPI RVR++P  +M+VAE G  
Sbjct  7     IVVREFDPSRDRVGVEEVERRCEVGPSGKLSLFTDLLGDPICRVRHSPAFLMLVAELG--  64

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD----YVDVAYILGLRVSSQHRRLGIGTKL  469
             +EIVG+IRG I++V+ G+K     KN++       Y  VAYILGLRVS  HRR+GIG KL
Sbjct  65    EEIVGMIRGCIKTVTCGRKLSRHVKNNDPPKPLPVYTKVAYILGLRVSPSHRRMGIGLKL  124

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+++E W R NGA+Y Y+AT+  N AS+ LFT    Y KFRTPS+LV PV  H+  + + 
Sbjct  125   VRTIEEWFRENGAEYSYLATENDNHASVKLFTDKCGYTKFRTPSILVNPVFAHRLAVSNR  184

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEPDS  823
             V + ++PP  AE  YRR F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S +  +W P  
Sbjct  185   VTIFKLPPNDAELLYRRRF-ATTEFFPRDIDSVLNNKLSLGTFLAVPRGSYTHNSW-PGF  242

Query  824   GVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
               F    P + A+LS+W+ K+V++++V+G S +K+     TR++D+ +P+++LPSVP + 
Sbjct  243   DKFLSDPPESWAVLSVWNCKDVFRLEVRGASRVKRTFAKTTRIVDKALPFLKLPSVPELF  302

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + FG +FL+G+  EG    +M+++L A AHN+A+   RGC ++  EVS  +P++ GIP+W
Sbjct  303   RPFGLHFLYGVGGEGPHAVKMVKALCAHAHNLAKE--RGCGVVATEVSSCEPLKLGIPYW  360

Query  1172  KNFSW-QDLWCI  1204
             K  S  +DLWCI
Sbjct  361   KMLSCAEDLWCI  372



>ref|XP_011099360.1| PREDICTED: probable N-acetyltransferase HLS1 [Sesamum indicum]
Length=425

 Score =   339 bits (870),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 253/385 (66%), Gaps = 35/385 (9%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI----  310
             R+Y+ ++D+ AVEE+E++CEVG  G+  L  DLL DPI RVRN+P ++M+VAE  +    
Sbjct  14    REYDADKDRTAVEEVENKCEVGPSGELSLYTDLLGDPICRVRNSPAYLMLVAEMVVLGGG  73

Query  311   ----SKEIVGVIRGSIRSVSRGQK----GKNDNSTD------------YVDVAYILGLRV  430
                  +EIVG+IRG I++ + G K    GKN                 Y  +AYILGLRV
Sbjct  74    GDEERREIVGMIRGCIKTATCGTKLSRNGKNCTVKPKTPQLQPVPLPIYTKLAYILGLRV  133

Query  431   SSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLV  610
             S  HRR+GIG KLV+ +E W R NGA+Y YMAT+  NQAS+ LFT    Y KFRTPS+LV
Sbjct  134   SPSHRRMGIGLKLVRRMEEWFRENGAEYSYMATENDNQASVKLFTQKCGYSKFRTPSILV  193

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPV  H+  +     ++++    AE+ YRR F  S+EFFP+DI+ VLNNKLNLGTF+AV 
Sbjct  194   QPVFAHRLRLDKRFTIIKLGHADAETLYRRRFS-STEFFPRDIDAVLNNKLNLGTFLAVM  252

Query  791   KESL--STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRL  952
             K S    TW P +  F    P + A+LS+W++K+V++++V+G S L++A    TR+LDR 
Sbjct  253   KGSYDADTW-PGADEFLASQPESWAVLSVWNSKDVFRLEVRGASRLRKALAKTTRMLDRA  311

Query  953   IPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEV  1132
             +PW+ LPS P V + FG++FL+GL  EG +  +M+++L   AHN+A    RGC ++  EV
Sbjct  312   VPWLHLPSAPEVFRPFGFHFLYGLGGEGPNAVKMIKALCGLAHNLAME--RGCGVVATEV  369

Query  1133  SPDDPVRRGIPHWKNFSW-QDLWCI  1204
             +  +P+R GIPHWK+ S  +DLWCI
Sbjct  370   ASREPLRLGIPHWKSLSCAEDLWCI  394



>ref|XP_010277068.1| PREDICTED: probable N-acetyltransferase HLS1 [Nelumbo nucifera]
Length=403

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 250/370 (68%), Gaps = 16/370 (4%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++ E+D + VEE+E +CEVG   K  L  DL  DPI RVR++P  +M+VAE    
Sbjct  6     IVVREFDAEKDCLGVEEMERRCEVGPSDKFSLFTDLYGDPICRVRHSPAFLMLVAETSEE  65

Query  314   KEIVGVIRGSIRSVSRGQK-------GKNDNSTD----YVDVAYILGLRVSSQHRRLGIG  460
             KEIVGVIRG I++V+ G+K       G NDN+      Y  +AYILGLRVS  HRR+GIG
Sbjct  66    KEIVGVIRGCIKTVTCGKKLSRNGKNGGNDNTLKPLPVYTKLAYILGLRVSPSHRRMGIG  125

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              KLV  +E+W R NGA+Y YMAT+  N+AS+ LFT    Y KFR PS+LV PV  H+  I
Sbjct  126   LKLVSRMEHWFRENGAEYAYMATEKDNEASVKLFTDRCGYAKFRAPSILVHPVFAHRLRI  185

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV-PKESLSTWEP  817
                + V R+ P  AE+ YRR F  ++EFFP+DI+ +LNNKLNLGTF+A   +ES    E 
Sbjct  186   PRRIHVFRLDPSEAETLYRRRFS-TTEFFPRDIDSILNNKLNLGTFVATYDQESWPGAER  244

Query  818   DSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
                  P + A+LS+W++K+V+ ++V+G+S +K+     +R++D+  PW+ +PSVP V + 
Sbjct  245   FLADPPESWAVLSVWNSKDVFALEVRGVSRVKRGLAKTSRIVDKAFPWLCIPSVPEVFRP  304

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG +FL+GL  +G   +++M+SL +FAHN+A++  RGC +++ EVS  +P++  IPHWK 
Sbjct  305   FGGHFLYGLGGDGPHAAKLMKSLCSFAHNLAKD--RGCRVVVTEVSSREPLKLAIPHWKW  362

Query  1178  FSW-QDLWCI  1204
             F   +DLWC+
Sbjct  363   FGCAEDLWCM  372



>ref|XP_011013316.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=406

 Score =   338 bits (867),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 248/377 (66%), Gaps = 20/377 (5%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             +++  +VVR+++  RD V VEE+E  CEVG  GK  L  DLL DPI RVRN+P  +M+VA
Sbjct  4     DRMDMMVVREFDPSRDVVGVEEVERSCEVGSSGKFSLFTDLLGDPICRVRNSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK---GKNDNSTDY------VDVAYILGLRVSSQHRRL  451
             E G   EIVG+IRG I++V+ G++     N+ S  Y        VAYILGLR+S  HRR+
Sbjct  64    EMG--GEIVGMIRGCIKTVTCGERISRKVNNYSVSYKPVPVYTKVAYILGLRISPSHRRM  121

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             G+G KLV  +E+W R NGA+Y YMAT+  N AS+ LFTG   Y  FRTPS+LV PV  H+
Sbjct  122   GLGLKLVCQMEDWFRQNGAEYSYMATESDNHASVKLFTGKCGYSTFRTPSILVNPVFAHR  181

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL--S  805
               + + V ++++ P  AE  YRR F  ++EFFP+DI+ VL NKLN+GTF+AVP++SL   
Sbjct  182   VTVSNRVTIIKLTPPDAELLYRRRF-ATTEFFPRDIDSVLKNKLNVGTFLAVPRDSLRFG  240

Query  806   TWEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPS  976
              W          P +  +LS+W+ K+V++++V+G S LK+     TR++D+  P+++LPS
Sbjct  241   LWAGSDHFLSDPPESWTVLSVWNCKDVFRLEVRGASRLKRTFAKTTRIVDKAFPFLKLPS  300

Query  977   VPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRR  1156
             VP V + FG YF++GL  EG   ++MM++L    HN+AR    GC ++  EV+  +P++ 
Sbjct  301   VPAVFRPFGLYFMYGLGGEGPRAAKMMKALCGHVHNLARES--GCGVVATEVANSEPLKF  358

Query  1157  GIPHWKNFSW-QDLWCI  1204
             GIPHWK  S  +DLWCI
Sbjct  359   GIPHWKMLSCAEDLWCI  375



>ref|XP_009787051.1| PREDICTED: probable N-acetyltransferase HLS1 [Nicotiana sylvestris]
Length=415

 Score =   338 bits (866),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 255/387 (66%), Gaps = 24/387 (6%)
 Frame = +2

Query  104   VAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLH  283
             + AV +K+  +VVR+++ ++D   VEE+E  CEVG  GK  L  DLL DPI RVR++P  
Sbjct  2     IVAVGDKV-RIVVREFDGKKDCREVEEVERSCEVGPTGKLSLFTDLLGDPISRVRHSPAF  60

Query  284   VMMVAEHGISK------EIVGVIRGSIRSVSRGQKGKNDNSTD----------YVDVAYI  415
             +M+VAE  +S       EIVG+IRG I++V+ G++   +N             + ++AYI
Sbjct  61    LMLVAEMVVSNVGEEKGEIVGMIRGCIKTVTCGKRVCRNNHDFTKLPHQHLPVFTNIAYI  120

Query  416   LGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRT  595
             LGLRVS  HRR GIG KLV+ +E W R NGA+Y Y+AT+  N AS+ LFT    Y KFRT
Sbjct  121   LGLRVSPFHRRKGIGLKLVRKMEEWFRENGAEYSYIATENDNHASVKLFTHKCGYTKFRT  180

Query  596   PSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGT  775
             PS+LVQPV  HK  I  +VA++++ P  AE+ YR  F  ++EFFPKDI+ +LNNKLNLGT
Sbjct  181   PSILVQPVFAHKVKISRNVAIIKLSPVEAETLYRHKFS-TTEFFPKDIDSILNNKLNLGT  239

Query  776   FMAVPKESLSTWEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLD  946
             F+A+PK + S W   +      P + A+LS+W+ K+V+K++V+G S + +     +R++D
Sbjct  240   FLAIPKGNFSCWNGVNEFLTSQPESWAVLSVWNCKDVFKLEVRGASRITRGLAKTSRLMD  299

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIA  1126
             R  PW+++PSVP V + FG +FL+GL  EG    +++++L  FAHN+A   R  C +++ 
Sbjct  300   RAFPWLKVPSVPEVFRPFGLHFLYGLGGEGPLSVKLIKALCDFAHNLAGESR--CGVVVT  357

Query  1127  EVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             EV+  +P++ GIPHWK  S  +DLWCI
Sbjct  358   EVASCEPLKLGIPHWKRLSCAEDLWCI  384



>ref|XP_003550977.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
Length=409

 Score =   338 bits (866),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 180/373 (48%), Positives = 240/373 (64%), Gaps = 22/373 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+++  +D   VE +E  CEVG  GK  L  DL  DPI RVRN+P  +M++AE  I 
Sbjct  12    VSVREFDPTKDIEKVEAVERICEVGPSGKLSLFTDLHGDPICRVRNSPTFLMLIAE--IG  69

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD----YVDVAYILGLRVSSQHRRLGIGTKL  469
             +E VG+IRG I++V+ G+K    GKN+        Y  +AYILGLRVS  HRR+GIG KL
Sbjct  70    QETVGMIRGCIKTVTCGKKLHRQGKNNTEPKQVPIYTKLAYILGLRVSPHHRRMGIGMKL  129

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W R NGA+Y YMAT+  N AS+ LFT    Y KFRTP +L  PV  H   I   
Sbjct  130   VKKMEEWFRDNGAEYAYMATEKDNVASVKLFTDKCGYSKFRTPCILANPVFSHPARISHK  189

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDS  823
             V ++ + P  AE  YR  F  ++EFFP+D++ VL NKL+LGTF+AVPK      TW P S
Sbjct  190   VTIIELSPSDAEILYRSKFS-TTEFFPRDVDSVLRNKLSLGTFLAVPKGLYRADTW-PGS  247

Query  824   GVF-----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
               F     P + A++S+W+ K+V+ ++VKG S +K+     TRVLDR  PW+RLPSVPN 
Sbjct  248   TRFLEGPPPCSWALVSVWNCKDVFTLEVKGASRVKKTLAKTTRVLDRAFPWLRLPSVPNF  307

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
              + FG++FL+GL  EG    +M+ +L  FAHN+AR+  RGCE++  EVS  +P+R  IPH
Sbjct  308   FEPFGFHFLYGLGGEGPQAQKMIRALCGFAHNLARD--RGCEVVATEVSSQEPLRCAIPH  365

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +DLWCI
Sbjct  366   WKMLSCEEDLWCI  378



>ref|XP_006426077.1| hypothetical protein CICLE_v10025754mg [Citrus clementina]
 gb|ESR39317.1| hypothetical protein CICLE_v10025754mg [Citrus clementina]
Length=406

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 253/375 (67%), Gaps = 23/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D + VE++E +CEVG  GK  L  DLL DPI RVR++P  +M+VAE G  
Sbjct  6     IVVREFDPNKDCLGVEDVERRCEVGPSGKLCLFTDLLGDPICRVRHSPAFLMLVAEVG--  63

Query  314   KEIVGVIRGSIRSVSRGQK-GKNDNSTD-----------YVDVAYILGLRVSSQHRRLGI  457
              EIVG+IRG I++V+ G++  +N   T            Y  +AYILGLRVS  HRR+GI
Sbjct  64    DEIVGMIRGCIKTVTCGKRISRNTKYTTNDIEPPKPLPVYTKLAYILGLRVSPSHRRMGI  123

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV+ +E W R +G +Y Y+AT+  N AS+ LFT    Y KFRTPS+LV PV  H+  
Sbjct  124   GLKLVKRMEEWFRESGVEYSYIATENDNYASVKLFTDKCGYSKFRTPSILVNPVFAHRLI  183

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TW  811
             +   V ++++ P  AE++YRR F  ++EFFP+DI+ VLNNKLNLGTF+AVP+ + S  +W
Sbjct  184   VPKQVTIIQLNPSDAEAFYRRKFS-TTEFFPRDIDSVLNNKLNLGTFLAVPRGTYSPDSW  242

Query  812   EPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
                   F   P + AILS+W++K+V+K++V+G S +K+     TRV+DR++PW+R+PSVP
Sbjct  243   AGSDSFFSCPPESWAILSVWNSKDVFKLEVRGASRVKRTLAKTTRVVDRVLPWLRIPSVP  302

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
              V   FG +FL+GL  EG   ++++++L   AHN+A+   RGC ++  EVS  +P++ GI
Sbjct  303   EVFSPFGLHFLYGLGGEGPRAAKLVKALCGHAHNLAKE--RGCGVVATEVSSREPLKLGI  360

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  361   PHWKMLSCDEDLWCI  375



>ref|XP_008344342.1| PREDICTED: probable N-acetyltransferase HLS1 [Malus domestica]
Length=416

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/379 (47%), Positives = 258/379 (68%), Gaps = 26/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE---H  304
             +VVR+++  +D   V+ +E +CEVG  G   +  DLL DPI RVR++P ++M+VAE    
Sbjct  11    LVVREFDPSKDCEMVQNVERRCEVGPSGGLSIFTDLLGDPICRVRHSPAYLMLVAELVGE  70

Query  305   GISKEIVGVIRGSIRSVSRGQK----GKNDNSTD--------YVDVAYILGLRVSSQHRR  448
                KEIVG+IRG I++V  G+K    GKN  + D        Y  +AYILGLRVS  HRR
Sbjct  71    DKDKEIVGMIRGCIKTVXCGKKLSRNGKNVTADDVTLKPLPVYTKLAYILGLRVSPXHRR  130

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             +GIG KLVQ +E W R NGA+Y YMAT+  NQAS+NLF     Y KFRTP++LV PV+ H
Sbjct  131   MGIGLKLVQRVEEWFRENGAEYSYMATENDNQASVNLFVDKCGYAKFRTPTILVNPVYAH  190

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS-  805
             +  + S V V+ + P  +E+ YRR F  ++EFFP+DI+ VL+N+L+LGTF+AVP+ S++ 
Sbjct  191   RVKLSSRVTVIHLSPSDSEALYRRRFS-TTEFFPRDIDSVLSNRLSLGTFLAVPRGSVTA  249

Query  806   -TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              TW P +  F    P + A+LS+W++K+V+ ++VKG+S +K+     TR++DR +PW++L
Sbjct  250   ETW-PGADHFLADPPESWAVLSVWNSKDVFTLEVKGVSLVKRMLAKTTRLVDRALPWMQL  308

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PSVP++ + FG +FL+GL  EG   ++ +++L   AHN+A+   RGC ++  EVS  +P+
Sbjct  309   PSVPDIFRPFGVHFLYGLGGEGPLAAKFVKALCGHAHNLAKE--RGCGVVATEVSSREPL  366

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             R GIPHWK+ S  +DLWCI
Sbjct  367   RLGIPHWKSLSCAEDLWCI  385



>gb|KDO44017.1| hypothetical protein CISIN_1g0154291mg, partial [Citrus sinensis]
Length=288

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 214/297 (72%), Gaps = 10/297 (3%)
 Frame = +2

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
             RLGIGTKLVQ LE W +  GA+Y YMAT+CSN+ASINLFT   +Y KFRTP++LVQPVH 
Sbjct  1     RLGIGTKLVQKLEEWCKQQGAEYSYMATECSNEASINLFTRKCSYTKFRTPTMLVQPVHA  60

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS  805
             H KP+G+ +++VR+P + AE+ YRR F  +SEFFPKDI+L+L++ LNLGTFMA+PK+ + 
Sbjct  61    HYKPVGAGISIVRLPRKSAETVYRRVF-ANSEFFPKDIDLILSSNLNLGTFMAMPKKFVP  119

Query  806   TWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
              W+P +G+ P + AILS+W+ KEV+K+Q+KG+SALK A  +G+R+LD  +PW+RLPS P+
Sbjct  120   RWDPKTGILPPSFAILSVWNTKEVFKLQLKGVSALKYAFCVGSRLLDAWMPWLRLPSFPD  179

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + FG YFL+GL MEG+  S +M+SL AFAHN+AR+D   C  L+AEV   DPVR  IP
Sbjct  180   VFRQFGVYFLYGLHMEGKHASLLMKSLCAFAHNMARDDGE-CGALVAEVGAKDPVRETIP  238

Query  1166  HWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             HW+ FSW +DLWCI                        D +    S+++IFVDPRDI
Sbjct  239   HWRKFSWAEDLWCI-------KKIGAVDEDRNERCPPSDWMKSRSSTSVIFVDPRDI  288



>ref|XP_009587553.1| PREDICTED: probable N-acetyltransferase HLS1-like [Nicotiana 
tomentosiformis]
Length=402

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/374 (45%), Positives = 250/374 (67%), Gaps = 11/374 (3%)
 Frame = +2

Query  104   VAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLH  283
             + AV +K+  ++VR+++ ++D   VEE+E  CEVG  GK  L  DLL DPI RVR++P  
Sbjct  2     IVAVGDKV-RIIVREFDGKKDCREVEEVERSCEVGPTGKLSLFTDLLGDPICRVRHSPAF  60

Query  284   VMMVAEHGISKE---IVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLG  454
             +M+VAE    +E   IVG+IRG I++V+ G++   +N   +  +AYILGLRVS  HRR G
Sbjct  61    LMLVAETEGKEEKRGIVGMIRGCIKTVTCGKRLSRNNLPVFTKIAYILGLRVSPLHRRKG  120

Query  455   IGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK  634
             IG KLV+ +E W R NGA+Y Y+AT+  N AS+ LFT    Y KFRTPS+LVQPV  H+ 
Sbjct  121   IGLKLVRKMEEWFRENGAEYSYIATENDNHASVKLFTHKCGYTKFRTPSILVQPVFAHRV  180

Query  635   PIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWE  814
              I + V ++++ P  AE+ YR  F  ++EFFP DI+ +L NKLNLGTF+AVPK + S W 
Sbjct  181   KISTSVTIIKLSPIEAETLYRHKFS-TTEFFPTDIDSILTNKLNLGTFLAVPKGNFSGWN  239

Query  815   PDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
               +      P + A+LS+W+ K+V+K++V+G S + +     +R++DR  PW+++PSVP 
Sbjct  240   GVNEFLTSRPESWAVLSVWNCKDVFKLEVRGASKITRGLAKTSRLMDRAFPWLKVPSVPE  299

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + FG +FL+GL  EG    +++++L  FAHN+A   R  C +++ E++  +P++ GIP
Sbjct  300   VFRPFGLHFLYGLGGEGPLAVKLVKALCDFAHNLAGESR--CGVVVTEIASCEPLKLGIP  357

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  358   HWKKLSCAEDLWCI  371



>ref|XP_006411873.1| hypothetical protein EUTSA_v10025368mg [Eutrema salsugineum]
 gb|ESQ53326.1| hypothetical protein EUTSA_v10025368mg [Eutrema salsugineum]
Length=401

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 250/372 (67%), Gaps = 18/372 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P  +M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTKLVQ  475
              KEIVG+IRG I++V+ G+   +    D     Y  +AY+LGLRVS  HRR GIG KLV+
Sbjct  62    KKEIVGMIRGCIKTVTCGKNHDSPKLNDVVKPLYTKLAYVLGLRVSPSHRRQGIGFKLVK  121

Query  476   SLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVA  655
              +E W R NGA+Y Y+AT+  NQAS+NLFTG   Y KFRTPS+LV PV+ H+  I   V 
Sbjct  122   MMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSKFRTPSILVNPVYAHRINISRRVT  181

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS----  823
             ++++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S    
Sbjct  182   IIKLDPSDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWPGS  240

Query  824   ----GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
                 G  P + A+LS+W+  + ++++V+G S L++     TRV+D+++P+++LPS+P+V 
Sbjct  241   AKFLGYPPESWAVLSVWNCNDSFRLEVRGASGLRRVMAKTTRVVDKMLPFLKLPSIPSVF  300

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             K FG +F++G+  EGQ   +M++SL   AHN+A+    GC ++  EV+ ++P+RRGIP+W
Sbjct  301   KPFGLHFMYGIGGEGQHAEKMVKSLCGHAHNLAKEG--GCGVVATEVAGEEPLRRGIPYW  358

Query  1172  KNFSW-QDLWCI  1204
             K  S  +DLWCI
Sbjct  359   KVLSCEEDLWCI  370



>ref|XP_003517341.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X1 
[Glycine max]
Length=405

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 250/371 (67%), Gaps = 19/371 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VAE  I 
Sbjct  9     LVVREFDLNKDRERVEAVERSCEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVAE--IG  66

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTK  466
              E+VG+IRG I++V+ G++    GK++N+       Y  VAYILGLRVS   RR+GIG K
Sbjct  67    GELVGMIRGCIKTVTCGKRLSRNGKHNNTNAKHVPVYTKVAYILGLRVSPNRRRMGIGLK  126

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E W R NG +Y YM T+ +N AS+ LFT    Y KFR PS+LV PV  H   +  
Sbjct  127   LVRKMETWFRDNGTEYSYMTTEKNNLASVKLFTDKCGYSKFRNPSILVNPVFAHPARVSP  186

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLST--W-EP  817
              V ++ + P  AE  YR +F  ++EFFP+D++ VLNNKLNLGTF+AVP ES  +  W  P
Sbjct  187   KVRIISLSPSEAEVLYRHHF-ATTEFFPRDVDSVLNNKLNLGTFLAVPNESYKSDIWLGP  245

Query  818   DSGVF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
             D  +   P + A++S+W++KEV+  +++G S + +     TRV+DR +PW+RLPS+P++ 
Sbjct  246   DLFLSDPPHSWAMVSVWNSKEVFTFELRGASRVSRTLAKTTRVVDRALPWLRLPSMPDLF  305

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + FG++F++GL  EG  G +M+++L  FAHN+A    +GC +L  EVSP++P+R GIPHW
Sbjct  306   RPFGFHFMYGLGGEGPEGVKMVKALCGFAHNLAME--KGCRVLATEVSPNEPLRFGIPHW  363

Query  1172  KNFSWQDLWCI  1204
             K  S +DLWC+
Sbjct  364   KMLSGEDLWCM  374



>ref|XP_003539284.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X1 
[Glycine max]
Length=405

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 252/377 (67%), Gaps = 21/377 (6%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             E  P +VVR+++  +D+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VA
Sbjct  4     ELSPTLVVREFDLNKDRERVETVERSCEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRL  451
             E  I +EIVG+IRG I++V+ G++    GK +N+       Y  VAYILGLRV+   RR+
Sbjct  64    E--IGEEIVGMIRGCIKTVTCGKRLSRNGKYNNTNVKHVPVYTRVAYILGLRVAPNQRRM  121

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIG KLV  +E+W R N A+Y YMAT+  N ASI LFT    Y KFR PS+LV PV  H+
Sbjct  122   GIGLKLVHRMESWFRDNDAEYSYMATERDNLASIKLFTDKCGYSKFRNPSILVNPVFAHR  181

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--  805
               +   V +V + P  AE  YRR+F  ++E+FP+DI+ +LNNKLNLGTF+A+P  S S  
Sbjct  182   ARVSPRVTIVSLSPSDAEFVYRRHF-ATTEYFPRDIDSILNNKLNLGTFLALPNGSYSAE  240

Query  806   TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
             TW P   +F    P + A++S+W+ KEV+ ++V+G S LK+     +R++DR +PW+RLP
Sbjct  241   TW-PGPDLFLSDPPHSWAMVSVWNTKEVFTLEVRGASRLKRTLAKTSRLVDRALPWLRLP  299

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S+P++ + FG+ F++GL  EG  G +M+++L  F HN+A    +GC ++  EVS ++P+R
Sbjct  300   SMPDLFRPFGFQFMYGLGGEGPEGVKMVKALCGFVHNLAME--KGCSVVATEVSSNEPLR  357

Query  1154  RGIPHWKNFSWQDLWCI  1204
              GIPHWK  S +DLWC+
Sbjct  358   FGIPHWKMLSCEDLWCM  374



>ref|XP_007208612.1| hypothetical protein PRUPE_ppa021292mg [Prunus persica]
 gb|EMJ09811.1| hypothetical protein PRUPE_ppa021292mg [Prunus persica]
Length=426

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 252/387 (65%), Gaps = 34/387 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH---  304
             VV+R+++  +D   VEE+E +CEVG  G+  L  DLL DPI RVR++P ++M+VAE    
Sbjct  13    VVLREFDPSKDCEGVEEVERRCEVGPGGELSLFTDLLGDPICRVRHSPAYLMLVAEQVGE  72

Query  305   -GISKEIVGVIRGSIRSVSRGQK-----------GKNDNSTD--------YVDVAYILGL  424
                 K++VG+IRG I++V+ G+K            KND+  D        Y  +AYILGL
Sbjct  73    EQEEKQVVGMIRGCIKTVTCGKKLSRNGKNVTHHNKNDDVLDDTLKPLPVYTKLAYILGL  132

Query  425   RVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSV  604
             RVS  HRR+GIG KLV  +E W R NGA+Y YMATD  N+ SINLFT    Y KFRTP++
Sbjct  133   RVSPSHRRMGIGLKLVHRVEEWFRENGAEYSYMATDNDNKPSINLFTDKCGYSKFRTPAI  192

Query  605   LVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA  784
             LV PV  H+  + S V V+++ P  AES YRR F  ++EFFP+DI+ VLNN+L+LGTF+A
Sbjct  193   LVNPVFAHRVKLSSGVHVIKLSPSDAESLYRRRF-ATTEFFPRDIDAVLNNRLSLGTFLA  251

Query  785   VPKESLST--WEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLD  946
             VP+ + +   W P S  F    P + A+LS+W+ K+ Y ++V+G S +K+     TR++D
Sbjct  252   VPRGTFTAGNW-PGSDQFLADPPESWAVLSVWNCKDAYTLEVRGASRVKRTLAKTTRIVD  310

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIA  1126
             R +PW+RLPSVP + + FG++FL+GL   G    + +++L   AHN+A+   RGC ++  
Sbjct  311   RALPWLRLPSVPELFRPFGFHFLYGLGGSGPRAEKFVKALCDHAHNLAKE--RGCGVVAT  368

Query  1127  EVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             EVS  +P+R GIPHWK  S  +DLWCI
Sbjct  369   EVSSREPLRLGIPHWKRLSCDEDLWCI  395



>gb|KDO78948.1| hypothetical protein CISIN_1g014721mg [Citrus sinensis]
Length=419

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 252/375 (67%), Gaps = 23/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D + VE++E +CEVG  GK  L  DLL DPI RVR++P  +M+VAE G  
Sbjct  19    IVVREFDPNKDCLGVEDVERRCEVGPSGKLCLFTDLLGDPICRVRHSPAFLMLVAEVG--  76

Query  314   KEIVGVIRGSIRSVSRGQK-GKNDNSTD-----------YVDVAYILGLRVSSQHRRLGI  457
              EIVG+IRG I++V+ G++  +N   T            Y  +AYILGLRVS  HRR+GI
Sbjct  77    DEIVGMIRGCIKTVTCGKRISRNTKYTTNDIEPPKPLPVYTKLAYILGLRVSPSHRRMGI  136

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV+ +E W R +G +Y Y+AT+  N AS+ LFT    Y KFRTPS+LV PV  H+  
Sbjct  137   GLKLVKRMEEWFRESGVEYSYIATENDNYASVKLFTDKCGYSKFRTPSILVNPVFAHRLI  196

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TW  811
             +   V ++++ P  AE++YRR F  ++EFFP+DI+ VLNNKLNLGTF+AVP+ + S  +W
Sbjct  197   VPKQVTIIQLNPSDAEAFYRRKFS-TTEFFPRDIDSVLNNKLNLGTFLAVPRGTYSPDSW  255

Query  812   EPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
                   F   P + AILS+W++K+V+K++V+G S +K+     TR++DR+ PW+R+PSVP
Sbjct  256   AGSDSFFSCPPESWAILSVWNSKDVFKLEVRGASRVKRTLAKTTRIVDRVFPWLRIPSVP  315

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
              V   FG +FL+GL  EG   ++++++L   AHN+A+   RGC ++  EVS  +P++ GI
Sbjct  316   EVFSPFGLHFLYGLGGEGPRAAKLVKALCGHAHNLAKE--RGCGVVATEVSSREPLKLGI  373

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  374   PHWKMLSCDEDLWCI  388



>ref|XP_006579936.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
Length=511

 Score =   339 bits (870),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/376 (48%), Positives = 247/376 (66%), Gaps = 26/376 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+++   D+  VE +E  CEVG  GK  L  DL  DPI RVRN+P  +M++AE  I 
Sbjct  112   VSVREFDPNNDREGVEAVERICEVGPNGKLSLFTDLHGDPICRVRNSPTFLMLIAE--IG  169

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD------YVDVAYILGLRVSSQHRRLGIGT  463
             +E VG+IRG I++V+ G+K    GK++  T+      Y  +AYILGLRVS  HRR+GIG 
Sbjct  170   QETVGMIRGCIKTVTCGKKLHRQGKSNTETEPKQVPIYTKLAYILGLRVSPHHRRMGIGF  229

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
             KLVQS+E W R NGA+Y YMAT+  N AS+ LFT    Y KFRTP +L  PV  H   I 
Sbjct  230   KLVQSMEEWFRDNGAEYAYMATEKDNVASVKLFTDKCGYSKFRTPCILANPVFAHHVRIS  289

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPD-  820
             + V ++ + P  AE  YR     ++EFFP+D++ VL N+L+LGTF+AVP+  + +++PD 
Sbjct  290   NKVTIIELSPNDAELLYRSKL-ATTEFFPRDVDSVLGNRLSLGTFLAVPR--VGSYQPDT  346

Query  821   ---SGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSV  979
                S  F    P + AILS+W+ K+V+ ++VKG+S +K+     TRVLDR+ PW+RLPSV
Sbjct  347   WSGSARFLLDPPPSWAILSVWNCKDVFTLEVKGVSRVKKTLAKTTRVLDRVFPWLRLPSV  406

Query  980   PNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRG  1159
             PN  + FG+ FL+GL  EG    +M+ +L  FAHN+A++  RGCE++  EVS  +P+R  
Sbjct  407   PNFFEPFGFLFLYGLGGEGPQAQQMLRALCGFAHNLAKD--RGCEVVATEVSSQEPLRCA  464

Query  1160  IPHWKNFSW-QDLWCI  1204
             IPHWK  S  +DLWCI
Sbjct  465   IPHWKMLSCEEDLWCI  480



>gb|KHN12991.1| hypothetical protein glysoja_027279 [Glycine soja]
Length=405

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 252/377 (67%), Gaps = 21/377 (6%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             E  P +VVR+++  +D+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VA
Sbjct  4     ELSPTLVVREFDLNKDRERVETVERSCEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRL  451
             E  I +EIVG+IRG I++V+ G++    GK +N+       Y  VAYILGLRV+   RR+
Sbjct  64    E--IGEEIVGMIRGCIKTVTCGKRLSRNGKYNNTNVKHVPVYTRVAYILGLRVAPNQRRM  121

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIG KLV  +E+W R N A+Y YMAT+  N ASI LFT    Y KFR PS+LV PV  H+
Sbjct  122   GIGLKLVHRMESWFRDNDAEYSYMATERDNLASIKLFTDKCGYSKFRNPSILVNPVFAHR  181

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--  805
               +   V ++ + P  AE  YRR+F  ++E+FP+DI+ +LNNKLNLGTF+A+P  S S  
Sbjct  182   ARVSPRVTIISLSPSDAEFVYRRHF-ATTEYFPRDIDSILNNKLNLGTFLALPNGSYSAE  240

Query  806   TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
             TW P   +F    P + A++S+W+ KEV+ ++V+G S LK+     +R++DR +PW+RLP
Sbjct  241   TW-PGPDLFLSDPPHSWAMVSVWNTKEVFTLEVRGASRLKRTLAKTSRLVDRALPWLRLP  299

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S+P++ + FG+ F++GL  EG  G +M+++L  F HN+A    +GC ++  EVS ++P+R
Sbjct  300   SMPDLFRPFGFQFMYGLGGEGPEGVKMVKALCGFVHNLAME--KGCSVVATEVSSNEPLR  357

Query  1154  RGIPHWKNFSWQDLWCI  1204
              GIPHWK  S +DLWC+
Sbjct  358   FGIPHWKMLSCEDLWCM  374



>ref|XP_008352544.1| PREDICTED: probable N-acetyltransferase HLS1 [Malus domestica]
Length=416

 Score =   336 bits (861),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/379 (47%), Positives = 256/379 (68%), Gaps = 26/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE---H  304
             +VVR+++  +D   V+++E +CEVG  G   L  DLL DPI RVR++P ++M+VAE    
Sbjct  11    LVVREFDPIKDCEMVQDVERRCEVGPSGGLSLFTDLLGDPICRVRHSPAYLMLVAEVVGA  70

Query  305   GISKEIVGVIRGSIRSVSRGQK----GKNDNSTD--------YVDVAYILGLRVSSQHRR  448
                +EIVG+IRG I++V+ G+K    GK+  + D        Y  +AYILGLRVS  HRR
Sbjct  71    EKEREIVGMIRGCIKTVTCGKKLSRNGKSVTAGDVTLKPLPVYTKLAYILGLRVSPSHRR  130

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             +GIG  LV  +E W R NGA+Y YMAT+  NQAS+ LFT    YVKFRTP++LV PV+ H
Sbjct  131   MGIGLXLVSRVEEWFRENGAEYSYMATENDNQASVKLFTDKCGYVKFRTPTILVNPVYAH  190

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS-  805
             +  + S V V+ + P  AE+ YRR F  ++EFFP+DI+ VLNN+L+LGTF+A P+ S++ 
Sbjct  191   RVKVSSRVTVIELSPSDAEALYRRRF-ATTEFFPRDIDSVLNNRLSLGTFLAXPRGSVTE  249

Query  806   -TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              TW P +  F    P + AILS+W++K+V+ ++VKG S +K+     TR++DR +PW+RL
Sbjct  250   ETW-PGADHFXADPPESWAILSVWNSKDVFTLEVKGASLVKRTLAKTTRLVDRALPWMRL  308

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PSVP++ + FG +FL+GL  EG   ++ +++L   AHN+A+   RGC ++  EVS  +P+
Sbjct  309   PSVPDIFRPFGVHFLYGLGGEGPRAAKXVKALCGHAHNLAKE--RGCGVVATEVSSREPL  366

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             R GIPHWK  S  +D+WCI
Sbjct  367   RLGIPHWKRLSCDEDMWCI  385



>gb|EPS59941.1| hypothetical protein M569_14864, partial [Genlisea aurea]
Length=404

 Score =   335 bits (859),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 185/386 (48%), Positives = 251/386 (65%), Gaps = 33/386 (9%)
 Frame = +2

Query  101   KVAAVAEKLPE---VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRN  271
             KVA  A   PE     VR+Y+   DK AVEELE +CEVG  GK  LV DL+ DP+ RVRN
Sbjct  2     KVADCAFFSPEKSPAFVREYDAATDKAAVEELERRCEVG--GKTALVTDLMGDPLARVRN  59

Query  272   APLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRL  451
                H+M+V E G  +EIVG+IRG I++V+ G+KG       +V + YILGLRVS  +RRL
Sbjct  60    FSSHIMLVGEIGAGREIVGIIRGCIKTVTFGRKGT------FVKLGYILGLRVSPTYRRL  113

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GI  KLV+ +E W   NGA+Y YMAT+ +N  S+NLFT   NY +FR  +VLVQPVH H+
Sbjct  114   GIARKLVEEMEGWFIKNGAEYSYMATESNNLPSLNLFTKRCNYARFRNLTVLVQPVHHHR  173

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK------  793
              P+ SDV ++R+PP LA S YRR F G S+FFP+DI+ +L+N LNLGTFMAV +      
Sbjct  174   HPLPSDVHILRLPPALASSVYRRLFRG-SDFFPQDIDRLLDNDLNLGTFMAVRRRRRNPC  232

Query  794   -------ESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRL  952
                    E  +  +P S  F    A+LS+W+ KEV++++VKG S L +    GTR+ D +
Sbjct  233   DDDDDDDEGRTAPDPSSSPF----AVLSVWNTKEVFRLRVKGASPLTRLACRGTRLADAM  288

Query  953   IPWIRLPSVPNVSKNFGYYFLFGL-RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAE  1129
              PW+R+PSVPNV ++FG+YF++G+    G+    +M +L  + H+ A  D  GC+ ++AE
Sbjct  289   APWLRIPSVPNVFESFGFYFVYGVCMGGGEGCEGLMRALCRWVHDRAGED-EGCKAVVAE  347

Query  1130  V-SPDDPVRRGIPHWKNFSW-QDLWC  1201
             V   D+  RR IPHW+ FSW  D+WC
Sbjct  348   VEKSDEAARRAIPHWRRFSWDDDVWC  373



>ref|XP_007155838.1| hypothetical protein PHAVU_003G235800g [Phaseolus vulgaris]
 gb|ESW27832.1| hypothetical protein PHAVU_003G235800g [Phaseolus vulgaris]
Length=402

 Score =   335 bits (859),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 246/374 (66%), Gaps = 23/374 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+++  +D   VE +E  CEVG  GK  L  DL  DPI RVRN+P  +M+VAE  I 
Sbjct  4     VTVREFDPNKDTERVEAVERICEVGPSGKLSLFTDLHGDPICRVRNSPTFLMLVAE--IG  61

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD------YVDVAYILGLRVSSQHRRLGIGT  463
             +E VG+IRG I++V+ G+K    GKN           Y  +AYILGLRVS  HRR+GIG 
Sbjct  62    QETVGMIRGCIKTVTCGKKLHRHGKNSTEPGSKQVPVYTKLAYILGLRVSPHHRRMGIGL  121

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
             KLVQ +E W R NGA+Y YMAT+  N AS+ LFT    Y KFR+P +LV PV  H     
Sbjct  122   KLVQRVEEWFRENGAEYAYMATEKDNVASVKLFTDKCGYSKFRSPCILVNPVFAHALTPS  181

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEP  817
             S+ +++++ P  AE  YR  F  ++EFFP+D++ +L N L+LGTF+AVP+ S S  TW P
Sbjct  182   SNFSIIQLAPNDAELLYRTKF-ATTEFFPRDVDSILTNHLSLGTFLAVPRGSYSPDTW-P  239

Query  818   DSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                 F    P++ A+LS+W+ K+V+ +QV+G S +K+A    TR+LDR  PW+RLPS+PN
Sbjct  240   GLPRFLADPPSSWALLSVWNCKDVFTLQVRGASRVKKALAKTTRLLDRAFPWLRLPSIPN  299

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             + + FG++FL+GL  EG    +M+ +L AFAHN+A++   GC+++  EVS  +P+R GIP
Sbjct  300   LFQPFGFHFLYGLGGEGPQAQKMVRALCAFAHNLAKDG--GCQVVATEVSGLEPLRCGIP  357

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  358   HWKMLSCEEDLWCI  371



>ref|XP_006283849.1| hypothetical protein CARUB_v10004955mg [Capsella rubella]
 gb|EOA16747.1| hypothetical protein CARUB_v10004955mg [Capsella rubella]
Length=404

 Score =   335 bits (859),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 253/376 (67%), Gaps = 23/376 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G  
Sbjct  2     TVVREYDPTRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQK------GKNDNSTD--YVDVAYILGLRVSSQHRRLGIGTK  466
              KEIVG+IRG I++V+ G+K       +ND      Y  +AY+LGLRVS  HRR GIG K
Sbjct  62    KKEIVGMIRGCIKTVTCGKKLDLNHKSQNDAVVKPLYTKLAYVLGLRVSPFHRRQGIGFK  121

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E W R NGA+Y Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  I  
Sbjct  122   LVKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNISR  181

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL-----STW  811
              V V+++ P  AE+ YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S        W
Sbjct  182   RVTVIKLDPVDAETLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGAW  240

Query  812   EPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSV  979
              P S  F    P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+
Sbjct  241   -PGSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVLAKTTRVVDKTLPFLKLPSI  299

Query  980   PNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRG  1159
             P V + FG +F++G+  EG    +M+ SL A AHN+A+    GC ++  EV+ ++P+RRG
Sbjct  300   PCVFEPFGLHFMYGIGGEGPRAVKMVRSLCAHAHNLAKEG--GCGVVATEVAGEEPLRRG  357

Query  1160  IPHWKNFSW-QDLWCI  1204
             IPHWK  S  +DLWC+
Sbjct  358   IPHWKVLSCAEDLWCV  373



>ref|XP_007156726.1| hypothetical protein PHAVU_002G012000g [Phaseolus vulgaris]
 gb|ESW28720.1| hypothetical protein PHAVU_002G012000g [Phaseolus vulgaris]
Length=406

 Score =   335 bits (858),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 175/373 (47%), Positives = 251/373 (67%), Gaps = 22/373 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR ++  RD+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VAE  I 
Sbjct  9     VVVRVFDPNRDRERVEAVERICEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVAE--IG  66

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTK  466
             +E+VG+IRG I++V+ G++    GK++ +       Y  VAYILGLRVS   RR+GIG K
Sbjct  67    EEVVGMIRGCIKTVTCGKRVSRNGKHNANNAKHVPVYTKVAYILGLRVSPNQRRMGIGLK  126

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV  +E W R NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV  H+  +  
Sbjct  127   LVHRIEEWFRDNGAEYSYMATENDNLASVKLFTDKCGYSKFRTPSMLVNPVFAHRARVSP  186

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL--STWEPD  820
              V ++ + P  AE+ YRR F  ++EFFP+DI+ VL NKL+LGTF+AVP  S    TW P 
Sbjct  187   KVTIISLSPSDAEAIYRRRF-ATTEFFPRDIDSVLKNKLSLGTFLAVPGGSYRAETW-PG  244

Query  821   SGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
               +F    P + A++S+W++KEV+ ++V+G S +K+     TRV+DR +PW+R+PS+P++
Sbjct  245   PDLFLSDPPKSWALVSVWNSKEVFTLEVRGASRVKRTLAKTTRVVDRALPWLRVPSIPDL  304

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
              + FG++F++GL  EG    +M+++L  FAHN+A    +GC ++  EVSP++P+R GIPH
Sbjct  305   FRPFGFHFMYGLGGEGPDAVKMVKALCGFAHNLAME--KGCRVVATEVSPNEPLRFGIPH  362

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +DLWC+
Sbjct  363   WKMLSCDEDLWCM  375



>ref|XP_009140446.1| PREDICTED: probable N-acetyltransferase HLS1-like [Brassica rapa]
Length=401

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 251/370 (68%), Gaps = 17/370 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE    
Sbjct  5     VEVREYDPSKDLATVEDVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIATE  64

Query  311   -SKEIVGVIRGSIRSVSRGQKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
               KE+VG+IRG I++V+ G K  +  +   Y  +AY+LGLRVS  HRRLGIG +LV+ +E
Sbjct  65    DKKELVGMIRGCIKTVTCGSKTLDVTTKPLYTKLAYVLGLRVSPTHRRLGIGFQLVKEIE  124

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
              W   NGA+Y Y+AT+  N AS+NLFTG   Y KFRTPS+LV PV+ H+  + + V V R
Sbjct  125   KWFNQNGAEYSYIATENDNHASVNLFTGKCGYTKFRTPSILVNPVYAHRVNVSNQVTVFR  184

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----LSTWEPDSGV  829
             + P  AES YR NF  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       +W P S  
Sbjct  185   LEPSDAESLYRLNFS-TTEFFPQDIDSVLNNKLSLGTFIAVPRGSCYGSGFGSW-PGSAK  242

Query  830   F----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
             F    P + A+LS+W+ K+ +K++V+G S L++     TR++D+ +P++++PS+P + + 
Sbjct  243   FLEYPPDSWAVLSVWNCKDSFKLEVRGASRLRRVLAKTTRLVDKTLPFLKIPSIPAIFQP  302

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AEV+  +PVRRGIPHWK 
Sbjct  303   FGLHFMYGIGGEGPCVEKMVKALCGHAHNLAKEG--GCGVIAAEVAVGEPVRRGIPHWKV  360

Query  1178  FSW-QDLWCI  1204
              S  +DLWCI
Sbjct  361   LSCDEDLWCI  370



>emb|CDY69760.1| BnaC04g56110D [Brassica napus]
Length=401

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/370 (46%), Positives = 253/370 (68%), Gaps = 17/370 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE    
Sbjct  5     VEVREYDPSKDLATVEDVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIATE  64

Query  311   -SKEIVGVIRGSIRSVSRGQKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
               KE+VG+IRG I++V+ G K  +  +   Y  +AY+LGLRVS  HRRLGIG +LV+ +E
Sbjct  65    DKKELVGMIRGCIKTVTCGSKTLDVTTKPLYTKLAYVLGLRVSPTHRRLGIGFQLVKEIE  124

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
              W   NGA+Y Y+AT+  N AS+NLFTG   Y KFRTPS+LV PV+ H+  I + V V+R
Sbjct  125   KWFNQNGAEYSYIATENDNHASVNLFTGKCGYTKFRTPSILVNPVYAHRVNISNQVTVLR  184

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----LSTWEPDSGV  829
             + P  AES YR +F  ++EFFP+DI+ V+NNKL+LGTF+AVP++S       +W P S  
Sbjct  185   LDPSDAESLYRLHFS-TTEFFPRDIDSVINNKLSLGTFIAVPRDSCYGSGFGSW-PGSAK  242

Query  830   F----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
             F    P + A+LS+W+ K+ +K++V+G S L++     TRV+D+ +P++++PS+P + + 
Sbjct  243   FLEYPPDSWAVLSVWNCKDSFKLEVRGASRLRRVLAKTTRVVDKTLPFLKIPSIPAIFQP  302

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AE++  +PVRRGIPHWK 
Sbjct  303   FGLHFMYGIGGEGPCVEKMVKALCGHAHNLAKEG--GCGVVAAELAVGEPVRRGIPHWKV  360

Query  1178  FSW-QDLWCI  1204
              S  +DLWCI
Sbjct  361   LSCDEDLWCI  370



>ref|XP_011007830.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=414

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 250/385 (65%), Gaps = 28/385 (7%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             E++  +VVR+++   D   VEE+E +CEVG  GK  L  DLL DPI RVRN+P  +M+VA
Sbjct  4     ERVNMIVVREFDPRTDGFGVEEVERRCEVGPGGKLSLFTDLLGDPICRVRNSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK--------------GKNDNSTD---YVDVAYILGLR  427
             E  I +EIVG+IRG I++V+ G+K                ND S     Y  VAYILGLR
Sbjct  64    E--IGEEIVGMIRGCIKTVTCGKKLSRTVKNSYSYNVISNNDLSKPVPVYTKVAYILGLR  121

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS  HRR+GIG KLV  +E W R NGA+Y Y+AT+  N AS+ LFT    Y KFRTPS+L
Sbjct  122   VSPSHRRMGIGLKLVHQMEAWFRQNGAEYSYIATENDNHASVKLFTDKCGYSKFRTPSIL  181

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             V PV  H+ P+ + V ++++ P  AE  YRR F  ++EFFP+DI+ VL NKLN+G F+AV
Sbjct  182   VNPVFAHRVPVSNRVTIIKLTPYDAELLYRRRF-ATTEFFPRDIDSVLKNKLNVGNFLAV  240

Query  788   PKESLST--WEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRL  952
             P+ SL++  W          P + A+LS+W+ K+V++++V+G S +K+     TRV+D+ 
Sbjct  241   PRGSLNSGLWAGSENFLSDPPESWAVLSVWNCKDVFRLEVRGASRVKRTFAKTTRVVDKA  300

Query  953   IPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEV  1132
             +P++RLPSVP V + FG YF++GL  EG   ++M ++L    HN+A+    GC +++ EV
Sbjct  301   LPFLRLPSVPAVFRPFGLYFMYGLGGEGPRAAKMTKALCGHVHNLAKES--GCGVVVTEV  358

Query  1133  SPDDPVRRGIPHWKNFSW-QDLWCI  1204
             +  +P++ GIPHWK  S  +DLWCI
Sbjct  359   ANREPLKLGIPHWKMLSCAEDLWCI  383



>ref|NP_195474.1| putative N-acetyltransferase [Arabidopsis thaliana]
 sp|Q42381.1|HLS1_ARATH RecName: Full=Probable N-acetyltransferase HLS1; AltName: Full=Protein 
CONSTITUTIVE PHOTOMORPHOGENIC 3; AltName: Full=Protein 
HOOKLESS 1; AltName: Full=Protein UNUSUAL SUGAR RESPONSE 
2 [Arabidopsis thaliana]
 gb|AAB03773.1| putative N-acetyltransferase hookless1 [Arabidopsis thaliana]
 gb|AAB03774.1| putative N-acetyltransferase hookless1 [Arabidopsis thaliana]
 emb|CAB38297.1| probable N-acetyltransferase hookless 1 [Arabidopsis thaliana]
 emb|CAB80423.1| probable N-acetyltransferase hookless 1 [Arabidopsis thaliana]
 dbj|BAD43423.1| probable N-acetyltransferase hookless 1 [Arabidopsis thaliana]
 dbj|BAD43880.1| probable N-acetyltransferase hookless 1 [Arabidopsis thaliana]
 gb|ABH04542.1| At4g37580 [Arabidopsis thaliana]
 gb|AEE86813.1| putative N-acetyltransferase [Arabidopsis thaliana]
Length=403

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/373 (47%), Positives = 253/373 (68%), Gaps = 20/373 (5%)
 Frame = +2

Query  137   VVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-S  313
             VVR+Y+  RD V VE++E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G   
Sbjct  3     VVREYDPTRDLVGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTEK  62

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTD-------YVDVAYILGLRVSSQHRRLGIGTKLV  472
             KEIVG+IRG I++V+ GQK   ++ +        Y  +AY+LGLRVS  HRR GIG KLV
Sbjct  63    KEIVGMIRGCIKTVTCGQKLDLNHKSQNDVVKPLYTKLAYVLGLRVSPFHRRQGIGFKLV  122

Query  473   QSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDV  652
             + +E W R NGA+Y Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  +   V
Sbjct  123   KMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNVSRRV  182

Query  653   AVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF  832
              V+++ P  AE+ YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S   
Sbjct  183   TVIKLEPVDAETLYRIRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWPG  241

Query  833   --------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
                     P + A+LS+W+ K+ + ++V+G S L++     TRV+D+ +P+++LPS+P+V
Sbjct  242   SAKFLEYPPESWAVLSVWNCKDSFLLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPSV  301

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
              + FG +F++G+  EG    +M++SL A AHN+A+    GC ++ AEV+ +DP+RRGIPH
Sbjct  302   FEPFGLHFMYGIGGEGPRAVKMVKSLCAHAHNLAKAG--GCGVVAAEVAGEDPLRRGIPH  359

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +DLWCI
Sbjct  360   WKVLSCDEDLWCI  372



>ref|XP_006466477.1| PREDICTED: probable N-acetyltransferase HLS1-like [Citrus sinensis]
Length=419

 Score =   333 bits (855),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 250/373 (67%), Gaps = 23/373 (6%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             VR+++  +D + VE++E +CEVG  GK  L  DLL DPI RVR++P  +M+VAE G   E
Sbjct  21    VREFDPNKDCLGVEDVERRCEVGPSGKLCLFTDLLGDPICRVRHSPAFLMLVAEVG--DE  78

Query  320   IVGVIRGSIRSVSRGQK-GKNDNSTD-----------YVDVAYILGLRVSSQHRRLGIGT  463
             IVG+IRG I++V+ G++  +N   T            Y  +AYILGLRVS  HRR+GIG 
Sbjct  79    IVGMIRGCIKTVTCGKRISRNTKYTTNDIEPPKPLPVYTKLAYILGLRVSPSHRRMGIGL  138

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
             KLV+ +E W R +G +Y Y+AT+  N AS+ LFT    Y KFRTPS+LV PV  H+  + 
Sbjct  139   KLVKRMEEWFRESGVEYSYIATENDNYASVKLFTDKCGYSKFRTPSILVNPVFAHRLIVP  198

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEP  817
               V ++++ P  AE++YRR F  ++EFFP+DI+ VLNNKLNLGTF+AVP+ + S  +W  
Sbjct  199   KQVTIIQLNPSDAEAFYRRKFS-TTEFFPRDIDSVLNNKLNLGTFLAVPRGTYSPDSWAG  257

Query  818   DSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
                 F   P + AILS+W++K+V+K++V+G S +K+     TR++DR+ PW+R+PSVP V
Sbjct  258   SDSFFSCPPESWAILSVWNSKDVFKLEVRGASRVKRTLAKTTRIVDRVFPWLRIPSVPEV  317

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
                FG +FL+GL  EG   ++++++L   AHN+A+   RGC ++  EVS  +P++ GIPH
Sbjct  318   FSPFGLHFLYGLGGEGPRAAKLVKALCGHAHNLAKE--RGCGVVATEVSSREPLKLGIPH  375

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +DLWCI
Sbjct  376   WKMLSCDEDLWCI  388



>ref|XP_011007829.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=414

 Score =   333 bits (854),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 250/385 (65%), Gaps = 28/385 (7%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             E++  +VVR+++   D   VEE+E +CEVG  GK  L  DLL DPI RVRN+P  +M+VA
Sbjct  4     ERVNMIVVREFDPRTDGFGVEEVERRCEVGPGGKLSLFTDLLGDPICRVRNSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK--------------GKNDNSTD---YVDVAYILGLR  427
             E  I +EIVG+IRG I++V+ G+K                ND S     Y  VAYILGLR
Sbjct  64    E--IGEEIVGMIRGCIKTVTCGKKLSRTVKNSYSYNVISNNDLSKPVPVYTKVAYILGLR  121

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS  HRR+GIG KLV  +E W R NGA+Y Y+AT+  N AS+ LFT    Y KFRTPS+L
Sbjct  122   VSPSHRRMGIGLKLVHQMEAWFRQNGAEYSYIATENDNHASVKLFTDKCGYSKFRTPSIL  181

Query  608   VQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV  787
             V PV  H+ P+ + V ++++ P  AE  YRR F  ++EFFP+DI+ VL NKLN+G F+AV
Sbjct  182   VNPVFAHRVPVSNRVTIIKLTPYDAELLYRRRF-ATTEFFPRDIDSVLKNKLNVGNFLAV  240

Query  788   PKESLST--WEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRL  952
             P+ SL++  W          P + A+LS+W+ K+V++++V+G S +K+     TRV+D+ 
Sbjct  241   PRGSLNSGLWVGSENFLSDPPESWAVLSVWNCKDVFRLEVRGASRVKRTFAKTTRVVDKA  300

Query  953   IPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEV  1132
             +P++RLPSVP V + FG YF++GL  EG   ++M ++L    HN+A+    GC +++ EV
Sbjct  301   LPFLRLPSVPAVFRPFGLYFMYGLGGEGPRAAKMTKALCGHVHNLAKES--GCGVVVTEV  358

Query  1133  SPDDPVRRGIPHWKNFSW-QDLWCI  1204
             +  +P++ GIPHWK  S  +DLWCI
Sbjct  359   ANREPLKLGIPHWKMLSCAEDLWCI  383



>emb|CDY38924.1| BnaA04g13450D [Brassica napus]
Length=401

 Score =   333 bits (853),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 251/370 (68%), Gaps = 17/370 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE    
Sbjct  5     VEVREYDPSKDLATVEDVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIATE  64

Query  311   -SKEIVGVIRGSIRSVSRGQKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
               KE+VG+IRG I++V+ G K  +  +   Y  +AY+LGLRVS  HRRLGIG +LV+ +E
Sbjct  65    DKKELVGMIRGCIKTVTCGSKTLDVTTKPLYTKLAYVLGLRVSPTHRRLGIGFQLVKEIE  124

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
              W   NGA+Y Y+AT+  N AS+NLFT    Y KFRTPS+LV PV+ H+  + + V V+R
Sbjct  125   KWFNQNGAEYSYIATENDNHASVNLFTEKCGYTKFRTPSILVNPVYAHRVNVSNQVTVLR  184

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----LSTWEPDSGV  829
             + P  AES YR +F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       +W P S  
Sbjct  185   LEPSDAESLYRLHFS-TTEFFPRDIDSVLNNKLSLGTFIAVPRGSCYGSGFGSW-PGSAK  242

Query  830   F----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
             F    P + A+LS+W+ K+ +K++V+G S L++     TRV+D+ +P++++PS+P + + 
Sbjct  243   FLEYPPDSWAVLSVWNCKDSFKLEVRGASRLRRVLAKTTRVVDKTLPFLKIPSIPAIFQP  302

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG +F++G+  EG    +M+++L   AHN+AR    GC ++ AEV+  +PVRRGIPHWK 
Sbjct  303   FGLHFMYGIGGEGPCVEKMVKALCGHAHNLAREG--GCGVIAAEVAVGEPVRRGIPHWKV  360

Query  1178  FSW-QDLWCI  1204
              S  +DLWCI
Sbjct  361   LSCDEDLWCI  370



>gb|AES94567.2| acyl-CoA N-acyltransferase (NAT) superfamily protein [Medicago 
truncatula]
Length=403

 Score =   333 bits (853),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 246/369 (67%), Gaps = 17/369 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V+VR++E  +DK  VE +E  CEVG   +  L  D+L DPI RVR++P ++M+VAE  I 
Sbjct  9     VIVREFEVNKDKERVEAVERTCEVGPSNQLSLFTDMLGDPICRVRHSPSYLMLVAE--ID  66

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNST------DYVDVAYILGLRVSSQHRRLGIGTKLVQ  475
             KEIVG+IRG I++V+ G+      ++       Y  +AYILGLRVS   RR+GIG KLV+
Sbjct  67    KEIVGMIRGCIKTVTCGKNLSRSKTSVTKHIPIYTKLAYILGLRVSPNQRRMGIGLKLVK  126

Query  476   SLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVA  655
              +E W + NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV+ H+  I   V 
Sbjct  127   KMEAWFKDNGAEYSYMATETENLASVKLFTEKCGYTKFRTPSILVNPVYAHRTKISRKVT  186

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWE-PDSG  826
             ++ + P  A  +YR  F  ++EFFP DI+ V+NNKL+LGTF+AVP  S S  TW  PD  
Sbjct  187   IIPLTPSDAVIFYRNRFS-TTEFFPNDIDAVVNNKLSLGTFLAVPSGSYSVKTWPGPDRF  245

Query  827   VF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNF  1000
             +   P + AILS+W++KEV+K++V+G S +K+     TR+LDR +PW+++PSVP++ + F
Sbjct  246   LLGPPCSWAILSVWNSKEVFKLEVRGASRVKRGLAKTTRILDRALPWLKVPSVPDLFRPF  305

Query  1001  GYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNF  1180
             G++FL+GL  EG    +M+++L  FAHN+A     GC ++  EV+  +P+R GIPHWK  
Sbjct  306   GFHFLYGLGGEGPKKLKMVKALCEFAHNLAMEC--GCGVVATEVASCEPLRFGIPHWKML  363

Query  1181  SW-QDLWCI  1204
             S   DLWCI
Sbjct  364   SCANDLWCI  372



>ref|XP_006573658.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X2 
[Glycine max]
Length=404

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 251/371 (68%), Gaps = 20/371 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VAE  I 
Sbjct  9     LVVREFDLNKDRERVEAVERSCEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVAE--IG  66

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTK  466
              E+VG+IRG I++V+ G++    GK++N+       Y  VAYILGLRVS  +RR+GIG K
Sbjct  67    GELVGMIRGCIKTVTCGKRLSRNGKHNNTNAKHVPVYTKVAYILGLRVS-PNRRMGIGLK  125

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E W R NG +Y YM T+ +N AS+ LFT    Y KFR PS+LV PV  H   +  
Sbjct  126   LVRKMETWFRDNGTEYSYMTTEKNNLASVKLFTDKCGYSKFRNPSILVNPVFAHPARVSP  185

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLST--W-EP  817
              V ++ + P  AE  YR +F  ++EFFP+D++ VLNNKLNLGTF+AVP ES  +  W  P
Sbjct  186   KVRIISLSPSEAEVLYRHHF-ATTEFFPRDVDSVLNNKLNLGTFLAVPNESYKSDIWLGP  244

Query  818   DSGVF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
             D  +   P + A++S+W++KEV+  +++G S + +     TRV+DR +PW+RLPS+P++ 
Sbjct  245   DLFLSDPPHSWAMVSVWNSKEVFTFELRGASRVSRTLAKTTRVVDRALPWLRLPSMPDLF  304

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + FG++F++GL  EG  G +M+++L  FAHN+A    +GC +L  EVSP++P+R GIPHW
Sbjct  305   RPFGFHFMYGLGGEGPEGVKMVKALCGFAHNLAME--KGCRVLATEVSPNEPLRFGIPHW  362

Query  1172  KNFSWQDLWCI  1204
             K  S +DLWC+
Sbjct  363   KMLSGEDLWCM  373



>ref|XP_010437208.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=403

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 252/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G  
Sbjct  2     MVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQKG--KNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G+K   K+ +  D     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGRKLDLKHKSQNDAVKPLYTKLAYVLGLRVSPFHRRQGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W R NGA+Y Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  I   
Sbjct  122   VKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNISRR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V+++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VTVIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P 
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPC  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + FG +F++G+  EG    +M+ SL A AHN+A+    GC +L  EV+ ++P+RRGIP
Sbjct  301   VFEPFGLHFMYGIGGEGPRAVKMVRSLCAHAHNLAKEG--GCGVLATEVAGEEPLRRGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWC+
Sbjct  359   HWKALSCAEDLWCV  372



>emb|CDY12845.1| BnaC07g15880D [Brassica napus]
Length=381

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 254/405 (63%), Gaps = 36/405 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR Y+  RD   VEELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VVVRDYDPSRDLKRVEELEKSCEVGS-----LLVDLMGDPLARIRQSPSFYMLVAE--ID  60

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVD---VAYILGLRVSSQHRRLGIGTKLVQSLE  484
              EIVG+IRG+I++V+RG    +D ++  +    +A++ GLRVS  +RR+GIG KLVQ LE
Sbjct  61    TEIVGMIRGTIKTVTRGGNALHDGNSPVISTTKLAFVSGLRVSPYYRRMGIGLKLVQRLE  120

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
             +W R N A Y Y+ T+  N AS+ LFT    Y K+RTP+ LV PV  H+  +   V +++
Sbjct  121   DWFRLNDAAYAYVQTENDNAASVKLFTEKSGYSKYRTPTFLVNPVFNHRVTVSRRVKIIK  180

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNH  844
             V P  AES YR  F  S+EFFP DIN +L NKL+LGTF+AVP+ S    +  SG  P + 
Sbjct  181   VDPSDAESIYRNRFS-STEFFPSDINSILTNKLSLGTFLAVPRGS----DYVSGSLPGSW  235

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A++SIW++KEVYK+QV+G S LK+     TRVLD  +P++++PS PN+ K F  +FL+G+
Sbjct  236   AVISIWNSKEVYKLQVQGTSRLKRTLAKTTRVLDGALPFLKIPSFPNLFKPFAMHFLYGI  295

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCI  1204
               EG   +EM+E+L + AHN+A+  + GC ++ AEV   +P+R GIPHWK  S +DLWC+
Sbjct  296   GGEGPQAAEMVEALCSHAHNIAK--KSGCAVVAAEVGSCEPLRAGIPHWKALSPEDLWCL  353

Query  1205  khlnlvgdnnnnnkaanivhdSSEDSIMYHDSSA--LIFVDPRDI  1333
                                    +D + +  S+    +FVDPRD+
Sbjct  354   -----------------KRLRDDDDGVDWTKSTPGLSVFVDPRDL  381



>ref|XP_010451018.1| PREDICTED: probable N-acetyltransferase HLS1, partial [Camelina 
sativa]
Length=402

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 249/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRG------QKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G       K +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGTKLDLNHKPQNDAVKPLYTKLAYVLGLRVSPFHRRQGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W R NGADY Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  I   
Sbjct  122   VKMMEEWFRQNGADYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNISRR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V+++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VTVIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P 
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPC  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + FG +F++G+  EG    +M+ SL A AHN+A+    GC ++  EV+ ++P+RRGIP
Sbjct  301   VFEPFGLHFMYGIGGEGPRAVKMVRSLCAHAHNLAKEG--GCGVVATEVAGEEPLRRGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWC+
Sbjct  359   HWKALSCAEDLWCV  372



>ref|XP_006364416.1| PREDICTED: probable N-acetyltransferase HLS1-like [Solanum tuberosum]
Length=414

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/386 (45%), Positives = 249/386 (65%), Gaps = 23/386 (6%)
 Frame = +2

Query  104   VAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLH  283
             + AV E++  +V+R++   +D   VEE+E +CEVG  GK  L  DLL DPI RVR++P +
Sbjct  2     MMAVNEQV-RIVIREFNANKDCRQVEEVERRCEVGPSGKLSLFTDLLGDPICRVRHSPAY  60

Query  284   VMMVAEHGISKE---IVGVIRGSIRSVSRGQKGKNDNSTD-----------YVDVAYILG  421
             +M+VAE  + +E   IVG+IRG I+SV+ G++   +N              +  +AYILG
Sbjct  61    LMLVAEIVVGEENRGIVGMIRGCIKSVTCGKRLWRNNHDFPKLSHQQHRPVFTKLAYILG  120

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRR GIG KLV+ +E W R NGA+Y Y+AT+  N AS+ LFT    Y KFRTPS
Sbjct  121   LRVSPHHRRKGIGLKLVRKMEEWFRENGAEYSYIATENDNHASVKLFTHKCGYAKFRTPS  180

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LVQPV  H+  I   + + ++ P  AE+ YR  F  ++EFFPKDI+ +LNNKLNLGTF+
Sbjct  181   ILVQPVFAHRVKISKTITIFKLTPTEAETLYRHKFS-TTEFFPKDIDAILNNKLNLGTFL  239

Query  782   AVPKESLSTWEPDSGVFPTNH----AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDR  949
             AVPK + S   P    F TN      +LS+W+ K+V+K++V+G S + +     TR++DR
Sbjct  240   AVPKGTFSCNWPGINEFLTNRPESWGVLSVWNCKDVFKLEVRGASRMTKGLAKTTRLMDR  299

Query  950   LIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAE  1129
               PW+++PSVP V + FG++F++GL  EG    ++ ++L   AHN+A     GC +++ E
Sbjct  300   AFPWLKVPSVPEVFRPFGFHFMYGLGGEGPLSVKLTKALCDLAHNLAAES--GCGVVVTE  357

Query  1130  VSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             V+  +P++ GIPHWK  S  +DLWCI
Sbjct  358   VASCEPLKLGIPHWKKLSCDEDLWCI  383



>ref|XP_002868981.1| hypothetical protein ARALYDRAFT_490860 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45240.1| hypothetical protein ARALYDRAFT_490860 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/375 (46%), Positives = 253/375 (67%), Gaps = 21/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTD--------YVDVAYILGLRVSSQHRRLGIGTK  466
              KEIVG+IRG I++V+ G+K   +++          Y  +AY+LGLRVS  HRR GIG K
Sbjct  62    KKEIVGMIRGCIKTVTCGKKLDLNHTKSQNDVVKPLYTKLAYVLGLRVSPFHRRQGIGFK  121

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E W R NGA+Y Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  +  
Sbjct  122   LVKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNVSR  181

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSG  826
              V V+++ P  AE+ YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S 
Sbjct  182   RVTVIKLDPVDAETLYRIRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSW  240

Query  827   VF--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
                       P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P
Sbjct  241   PGSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIP  300

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
             +V + FG +F++G+  EG    +M++SL A AHN+A+    GC ++ AEV+ ++P+RRGI
Sbjct  301   SVFEPFGLHFMYGIGGEGPRAVKMVKSLCAHAHNLAKEG--GCGVVAAEVAGEEPLRRGI  358

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  359   PHWKVLSCAEDLWCI  373



>ref|XP_010432047.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=403

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 250/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQK------GKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G+K       +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGKKIDLNHKSQNDAVKPLYTKLAYVLGLRVSPFHRRQGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W R NGA+Y Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  I   
Sbjct  122   VKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNISRR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V+++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VTVIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P 
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPC  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V + FG +F++G+  EG    +M+ SL A AHN+A+    GC ++  EV+ ++P+RRGIP
Sbjct  301   VFEPFGLHFMYGIGGEGPRAVKMVRSLCAHAHNLAKEG--GCGVVATEVAGEEPLRRGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWC+
Sbjct  359   HWKALSCAEDLWCV  372



>ref|XP_004233456.1| PREDICTED: probable N-acetyltransferase HLS1 [Solanum lycopersicum]
Length=413

 Score =   330 bits (846),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 251/386 (65%), Gaps = 23/386 (6%)
 Frame = +2

Query  104   VAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLH  283
             + AV E++  +V+R++   +D   VEE+E +CEVG  GK  L  DLL DP+ RVR++P +
Sbjct  1     MMAVNEQV-RIVIREFNVNKDCRQVEEVERRCEVGPSGKLSLFTDLLGDPVCRVRHSPAY  59

Query  284   VMMVAEHGISKE---IVGVIRGSIRSVSRGQKGKNDNSTD-----------YVDVAYILG  421
             +M+VAE  + +E   IVG+IRG I+SV+ G++   +N              +  ++YILG
Sbjct  60    LMLVAEIVVGEESRGIVGMIRGCIKSVTCGKRLWRNNHDFPKLPHQQHLPVFTKLSYILG  119

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRR GIG KLV+ +E W R NGA+Y Y+AT+  NQAS+ LFT    Y KFRTPS
Sbjct  120   LRVSPHHRRKGIGLKLVRKMEEWFRENGAEYSYIATENDNQASVKLFTHKCGYAKFRTPS  179

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LVQPV  H+  I   V + ++ P  AE+ YR  F  ++EFFPKD++ +LNNKLNLGTF+
Sbjct  180   ILVQPVFAHRVKISKSVTIFKLTPTEAETLYRHKFS-TTEFFPKDMDSILNNKLNLGTFL  238

Query  782   AVPKESLSTWEPDSGVFPTNH----AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDR  949
             AVPK + +   P    F TN     A+LS+W+ K+V+K++V+G S + +     TR++DR
Sbjct  239   AVPKGTFTCHWPGINEFLTNPPESWAVLSVWNCKDVFKLEVRGASRMTKGLAKTTRLMDR  298

Query  950   LIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAE  1129
               PW+++PSVP V + FG +F++GL  EG    ++ ++L   AHN+A     GCE+++ E
Sbjct  299   AFPWLKVPSVPEVFRPFGLHFMYGLGGEGPLSVKLTKALCDLAHNLAAES--GCEVVVTE  356

Query  1130  VSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             V+  +P++ GIPHW+  S  +DLWCI
Sbjct  357   VASCEPLKLGIPHWRKLSCAEDLWCI  382



>ref|XP_006590631.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X2 
[Glycine max]
Length=404

 Score =   330 bits (845),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 253/377 (67%), Gaps = 22/377 (6%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             E  P +VVR+++  +D+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VA
Sbjct  4     ELSPTLVVREFDLNKDRERVETVERSCEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRL  451
             E  I +EIVG+IRG I++V+ G++    GK +N+       Y  VAYILGLRV+  ++R+
Sbjct  64    E--IGEEIVGMIRGCIKTVTCGKRLSRNGKYNNTNVKHVPVYTRVAYILGLRVAP-NQRM  120

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIG KLV  +E+W R N A+Y YMAT+  N ASI LFT    Y KFR PS+LV PV  H+
Sbjct  121   GIGLKLVHRMESWFRDNDAEYSYMATERDNLASIKLFTDKCGYSKFRNPSILVNPVFAHR  180

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--  805
               +   V +V + P  AE  YRR+F  ++E+FP+DI+ +LNNKLNLGTF+A+P  S S  
Sbjct  181   ARVSPRVTIVSLSPSDAEFVYRRHF-ATTEYFPRDIDSILNNKLNLGTFLALPNGSYSAE  239

Query  806   TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
             TW P   +F    P + A++S+W+ KEV+ ++V+G S LK+     +R++DR +PW+RLP
Sbjct  240   TW-PGPDLFLSDPPHSWAMVSVWNTKEVFTLEVRGASRLKRTLAKTSRLVDRALPWLRLP  298

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             S+P++ + FG+ F++GL  EG  G +M+++L  F HN+A    +GC ++  EVS ++P+R
Sbjct  299   SMPDLFRPFGFQFMYGLGGEGPEGVKMVKALCGFVHNLAME--KGCSVVATEVSSNEPLR  356

Query  1154  RGIPHWKNFSWQDLWCI  1204
              GIPHWK  S +DLWC+
Sbjct  357   FGIPHWKMLSCEDLWCM  373



>emb|CDY44036.1| BnaA08g15700D [Brassica napus]
Length=403

 Score =   330 bits (845),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 250/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DP+ R+R++P  +M+VAE G  
Sbjct  2     IVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPLCRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRG------QKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G       K +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGIKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRREGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W    GA+Y Y+AT+  NQASINLFTG   Y KFR PS+LV PV+ H+  +   
Sbjct  122   VEMMEEWFTQTGAEYSYIATENDNQASINLFTGKCGYSKFRKPSILVNPVYAHRVNVSRQ  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V ++++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VTIIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRVSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P+
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPS  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A+  + GC ++ AEV+ ++P+R+GIP
Sbjct  301   VFKPFGLHFMYGIGGEGPRATKMVKSLCGHAHNMAK--KGGCGVVAAEVAGEEPLRQGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  359   HWKVLSCDEDLWCI  372



>ref|XP_004173667.1| PREDICTED: uncharacterized LOC101205672 [Cucumis sativus]
 gb|KGN48601.1| hypothetical protein Csa_6G495060 [Cucumis sativus]
Length=403

 Score =   330 bits (845),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 243/375 (65%), Gaps = 22/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +V+R+++  +D +AVE++E +CEVG  GK  L  DLL DPI RVRN+P  +M+VA     
Sbjct  2     IVIREFDPSKDCIAVEDVERRCEVGPSGKLCLFTDLLGDPICRVRNSPAFLMLVAATADQ  61

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTD-----------YVDVAYILGLRVSSQHRRLGIG  460
              EIVG+IRG I++V+ GQK       +           Y  +AYILGLRVS  HRR+GIG
Sbjct  62    NEIVGMIRGCIKTVTCGQKLSRSAIPNSDHQPPKHLPVYTKLAYILGLRVSPAHRRMGIG  121

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              KLV+ +E W R +GA+Y Y+AT+  N AS+NLFT    Y KFRTP++LV PV  H  P+
Sbjct  122   IKLVKKMEEWFRESGAEYSYIATEKDNVASVNLFTEKCEYSKFRTPAILVNPVFAHPVPL  181

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWE  814
                V ++ +    AE  YRR F  ++EFFP+DI+ VLNN L LGTF+A+P+ + +  TW 
Sbjct  182   SKRVTILPLSRSDAEILYRRRF-STTEFFPRDIDAVLNNPLTLGTFLAIPRGTYTPHTW-  239

Query  815   PDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
             P S  F    P + A+LS+W+  +V+++QV+G+S LK++    TRVLD+  PW+RLPSVP
Sbjct  240   PGSDRFLVDPPQSWAVLSVWNCNDVFRLQVRGVSRLKRSFARTTRVLDKAFPWLRLPSVP  299

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
              +   FG +F++GL  EG     M+++L  +AHN+A+   +GC ++  EVS  + +R  I
Sbjct  300   ELFSPFGLHFMYGLGGEGPDAERMLKALCGYAHNLAKE--KGCGVVATEVSAGERLRTAI  357

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  358   PHWKMLSCEEDLWCI  372



>ref|XP_010907395.1| PREDICTED: probable N-acetyltransferase HLS1 [Elaeis guineensis]
Length=403

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 239/368 (65%), Gaps = 14/368 (4%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-HGI  310
             VVVR ++ ERD   VE +E  CEVG  G+  L  DLL DP+ RVR++P ++M+VAE  G 
Sbjct  8     VVVRAFDRERDCEGVEAVERMCEVGPSGEMTLFTDLLGDPVCRVRHSPAYLMLVAETSGP  67

Query  311   SKEIVGVIRGSIRSVSRGQKGK--------NDNSTDYVDVAYILGLRVSSQHRRLGIGTK  466
              +EIVG++RG I++V+ G+K             S  Y  VAY+LGLRVS  HRR GI  +
Sbjct  68    EREIVGLVRGCIKTVACGKKPHRVGAPARHQTPSPIYTKVAYLLGLRVSPSHRRKGIALR  127

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV  +E W R  GA+Y YMATD  N+AS+ LFT    Y KFRTP++LVQPV  H+ P+  
Sbjct  128   LVSRMEEWFREKGAEYAYMATDKDNEASVRLFTERCGYSKFRTPAILVQPVFAHRLPVSH  187

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV-PKESLSTWEPDS  823
                ++R+P   AE+ YRR F  ++EFFP+DI+ VL+N L+LGT++AV P    +  E   
Sbjct  188   RTQILRIPAADAETLYRRRF-ATTEFFPRDIDAVLSNPLSLGTYLAVEPGFRWAGIEAFL  246

Query  824   GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFG  1003
                P + A+LS+W++KEV++++V+G S  ++     TR +DR +PW+R+PSVP++ + FG
Sbjct  247   AAPPESWAVLSVWNSKEVFRLEVRGASRWRRGLARTTRAVDRALPWLRIPSVPDLFRPFG  306

Query  1004  YYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS  1183
              YFL+G+  EG+ G  M+ +L   AHNVAR     C ++  EV+  DP+RRGIPHW   S
Sbjct  307   LYFLYGVGGEGRKGEAMVRALCRHAHNVAREG--SCGVVATEVAACDPLRRGIPHWVRLS  364

Query  1184  W-QDLWCI  1204
               +DLWC+
Sbjct  365   CAEDLWCV  372



>ref|XP_004141871.1| PREDICTED: uncharacterized protein LOC101205672 [Cucumis sativus]
Length=410

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 243/375 (65%), Gaps = 22/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +V+R+++  +D +AVE++E +CEVG  GK  L  DLL DPI RVRN+P  +M+VA     
Sbjct  9     IVIREFDPSKDCIAVEDVERRCEVGPSGKLCLFTDLLGDPICRVRNSPAFLMLVAATADQ  68

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTD-----------YVDVAYILGLRVSSQHRRLGIG  460
              EIVG+IRG I++V+ GQK       +           Y  +AYILGLRVS  HRR+GIG
Sbjct  69    NEIVGMIRGCIKTVTCGQKLSRSAIPNSDHQPPKHLPVYTKLAYILGLRVSPAHRRMGIG  128

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              KLV+ +E W R +GA+Y Y+AT+  N AS+NLFT    Y KFRTP++LV PV  H  P+
Sbjct  129   IKLVKKMEEWFRESGAEYSYIATEKDNVASVNLFTEKCEYSKFRTPAILVNPVFAHPVPL  188

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWE  814
                V ++ +    AE  YRR F  ++EFFP+DI+ VLNN L LGTF+A+P+ + +  TW 
Sbjct  189   SKRVTILPLSRSDAEILYRRRF-STTEFFPRDIDAVLNNPLTLGTFLAIPRGTYTPHTW-  246

Query  815   PDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
             P S  F    P + A+LS+W+  +V+++QV+G+S LK++    TRVLD+  PW+RLPSVP
Sbjct  247   PGSDRFLVDPPQSWAVLSVWNCNDVFRLQVRGVSRLKRSFARTTRVLDKAFPWLRLPSVP  306

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
              +   FG +F++GL  EG     M+++L  +AHN+A+   +GC ++  EVS  + +R  I
Sbjct  307   ELFSPFGLHFMYGLGGEGPDAERMLKALCGYAHNLAKE--KGCGVVATEVSAGERLRTAI  364

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  365   PHWKMLSCEEDLWCI  379



>ref|XP_004288237.1| PREDICTED: uncharacterized protein LOC101308505 [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 248/387 (64%), Gaps = 31/387 (8%)
 Frame = +2

Query  125   LPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH  304
             L  + VR+++  +D   +E++E +C+VG  G+  L  DLL DPI RVRN+P  +M+VAE 
Sbjct  7     LFNITVREFDPNKDCSGIEDVERRCDVGPSGEVSLFTDLLGDPICRVRNSPAFLMLVAEL  66

Query  305   GISKEIVGVIRGSIRSVSRGQKG-----------KNDNSTD---------YVDVAYILGL  424
             G  KEIVG++RG I++V+ G+K            +N+N  D         Y  +AYILGL
Sbjct  67    GEEKEIVGMVRGCIKTVTCGKKHSRNSKNVTVSHRNNNDGDDNIIKPVPVYTKLAYILGL  126

Query  425   RVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSV  604
             RVS  HRR+GIG KLV+ +E W   NGA+Y YMATD  NQAS+ LFTG   Y KFRTPS+
Sbjct  127   RVSPSHRRMGIGLKLVKRMEEWFAENGAEYSYMATDNDNQASVKLFTGKCGYAKFRTPSI  186

Query  605   LVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA  784
             LV PV  H+  +   V ++++ P  AE  YRR F  ++EFFP+DI+ VLNN L+LGTF+A
Sbjct  187   LVNPVFAHRVKVTRLVTIIKLTPSEAEKLYRRRFS-TTEFFPRDIDSVLNNTLSLGTFLA  245

Query  785   VPKESLS--TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLD  946
             VP  + S  +W P S  F    P + A++S+W+  +V+K++V+G S +K+     TR++D
Sbjct  246   VPHGAFSGKSW-PGSDQFLADPPESWAVISVWNCNDVFKLEVRGASRVKRTFAKTTRIVD  304

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIA  1126
             R +PW+ +PSVP + + FG +FL+GL   G    + +++L   AHN+A+    GC ++  
Sbjct  305   RALPWLNIPSVPELFRPFGAHFLYGLGGVGPRAVKFLKALCDHAHNLAKES--GCGVVAT  362

Query  1127  EVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             EVS  +P++ GIPHWK  S  +DLWCI
Sbjct  363   EVSNHEPLKAGIPHWKRLSCAEDLWCI  389



>emb|CDP02591.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 249/382 (65%), Gaps = 32/382 (8%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-------  301
             R+++ +RD  AV ELE +CEVG  G+  L  DL+ DPI RVRN+P ++M+VAE       
Sbjct  11    REFDAKRDSSAVVELEGRCEVGPSGEMSLFTDLMGDPICRVRNSPAYLMLVAELVVVASK  70

Query  302   --HGISKEIVGVIRGSIRSVSRGQK-------GKNDNSTD-----YVDVAYILGLRVSSQ  439
                 + +EIVG+IRG I++V+ G+K        K+   T+     Y  +AY+LGLRVS  
Sbjct  71    EESQVRREIVGMIRGCIKTVTCGKKFSRISNGNKDRRPTNPFLPIYTKLAYVLGLRVSPS  130

Query  440   HRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPV  619
             HRR+GIG KLV  +E W R NGA+Y YMAT+  N+ASI LFT    Y KFRTP++LVQPV
Sbjct  131   HRRMGIGMKLVCKMEEWFRENGAEYSYMATESDNKASIQLFTHKCGYSKFRTPAILVQPV  190

Query  620   HRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES  799
               H+  +   V VV++    AE+ YR  F  ++EFFP+DI+ +LNN+LNLGT++AVP+ +
Sbjct  191   FEHRVRLTRRVTVVKLTSSDAETLYRSRFS-TTEFFPRDIDSILNNRLNLGTYLAVPRGA  249

Query  800   LS--TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPW  961
              S  +W P    F    P + A+LS+W+  +V+K++V+G SAL+      TR++DR  PW
Sbjct  250   YSAESW-PGMDEFLASPPESWAVLSVWNCSDVFKLEVRGASALRTGLARTTRLVDRAFPW  308

Query  962   IRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPD  1141
             +R+PSVP V + FG +FL+GL  EG    + M++L  FAHN+A+    GC ++  EV+  
Sbjct  309   LRIPSVPEVFRPFGLHFLYGLGGEGPLSVKFMKALCGFAHNLAKEC--GCGVVATEVAGR  366

Query  1142  DPVRRGIPHWKNFSW-QDLWCI  1204
             +P++ GIPHWK+ S  +DLWCI
Sbjct  367   EPLKLGIPHWKSLSCAEDLWCI  388



>ref|XP_009134450.1| PREDICTED: probable N-acetyltransferase HLS1 [Brassica rapa]
Length=403

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 249/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P  +M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPISRIRHSPSFLMLVAETGTE  61

Query  314   -KEIVGVIRGSIRSVSRGQK----GKNDNSTD---YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G+K     K+ N T    Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    EKEIVGMIRGCIKTVTCGKKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRRQGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W   NGA+Y Y+AT+  NQAS+NLFTG   Y +FR PS+LV PV+ HK  +   
Sbjct  122   VKMMEAWFMQNGAEYSYIATENENQASVNLFTGKCGYSEFRKPSILVNPVYAHKVNVSRR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V+++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VTVIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S  ++     TRV+D+ +P+++LPS+P 
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASLWRRVVAKTTRVVDKTLPFLKLPSIPP  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A+  R GC +L  EV+ ++P++RGIP
Sbjct  301   VFKPFGLHFMYGIGGEGPRAAKMVKSLCGHAHNLAK--RGGCGVLATEVAGEEPLQRGIP  358

Query  1166  HWKNFSWQ-DLWCI  1204
             HWK  S Q DLWCI
Sbjct  359   HWKVLSCQEDLWCI  372



>ref|XP_009109384.1| PREDICTED: probable N-acetyltransferase HLS1 [Brassica rapa]
Length=403

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 250/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DP+ R+R++P  +M+VAE G  
Sbjct  2     IVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPLCRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRG------QKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G       K +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGIKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRREGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W    GA+Y Y+AT+  NQASINLFTG   Y KFR PS+LV PV+ H+  +   
Sbjct  122   VKMMEEWFTQTGAEYSYIATENDNQASINLFTGKCGYSKFRKPSILVNPVYAHRVNVSHQ  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V ++++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VTIIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P+
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPS  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A+  + GC ++ AEV+ ++P+R+GIP
Sbjct  301   VFKPFGLHFMYGIGGEGPRATKMVKSLCGHAHNMAK--KGGCGVVAAEVAGEEPLRQGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  359   HWKVLSCDEDLWCI  372



>emb|CDY22424.1| BnaC03g61370D [Brassica napus]
Length=403

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 250/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DP+ R+R++P  +M+VAE G  
Sbjct  2     IVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPLCRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRG------QKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G       K +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGIILDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRREGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W    GA+Y Y+AT+  NQASINLFTG  +Y KFR PS+LV PV+ H+  +   
Sbjct  122   VKMMEEWFTQTGAEYSYIATENDNQASINLFTGKCSYSKFRKPSILVNPVYAHRVNVSRQ  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V ++++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  182   VIIIKLDPVDAESLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P+
Sbjct  241   GSAKFLEYTPESWAVLSVWNCKDSFRLEVRGASRLRRVVATTTRVVDKTLPFLKLPSIPS  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A+  + GC ++ AEV+  +P+R+GIP
Sbjct  301   VFKPFGLHFMYGIGGEGPRATKMVKSLCGHAHNMAK--KGGCGVVAAEVAGAEPLRQGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  359   HWKVLSCDEDLWCI  372



>ref|XP_010429249.1| PREDICTED: probable N-acetyltransferase HLS1-like [Camelina sativa]
Length=410

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 250/379 (66%), Gaps = 26/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  +D   VEE+E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE G  
Sbjct  5     VEVREYDPSKDLATVEEVEQRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIGTD  64

Query  311   -SKEIVGVIRGSIRSVSRGQKGKN-DNSTD---------YVDVAYILGLRVSSQHRRLGI  457
               KE+VG+IRG I++V+ G   K  DN +          Y  +AYILGLRVS  HRR GI
Sbjct  65    EKKELVGMIRGCIKTVTCGSSTKRLDNKSQNDVVITKPLYTKLAYILGLRVSPTHRRQGI  124

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV+++E+W   NGA+Y Y AT+  N AS+NLFTG   Y +FRTPS+LV PV+ H+  
Sbjct  125   GFKLVKTMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGYSEFRTPSILVNPVYAHRVN  184

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----L  802
             I   V ++++ P  AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S     L
Sbjct  185   ISRRVTIIKLDPTDAELLYRIRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGL  243

Query  803   STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              +W P S  F    P + A+LS+W+  E ++++V+G S L++     TRV+D+ +P++++
Sbjct  244   GSW-PGSAKFLEYPPDSWAVLSVWNCNESFRLEVRGASKLRRVLAKTTRVVDKTLPFLKI  302

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+P V + FG +F++G+  EG    +M++ L   AHN+A+    GC ++ AEV+  +P+
Sbjct  303   PSIPAVFQPFGLHFMYGIGGEGPRAEKMVKVLCNHAHNLAKEG--GCGVVAAEVAGGEPL  360

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             RRGIPHWK  S  +DLWCI
Sbjct  361   RRGIPHWKVLSCAEDLWCI  379



>ref|XP_008792559.1| PREDICTED: probable N-acetyltransferase HLS1 [Phoenix dactylifera]
Length=403

 Score =   328 bits (840),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 241/368 (65%), Gaps = 14/368 (4%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-HGI  310
             +VVR++  ERD   VE +E  CEVG  G+  L  DLL DP+ RVR++P ++M+VAE  G 
Sbjct  8     IVVREFNRERDGEGVEAVERMCEVGPSGEMTLFTDLLGDPVCRVRHSPAYLMLVAETSGP  67

Query  311   SKEIVGVIRGSIRSVSRGQKGK--------NDNSTDYVDVAYILGLRVSSQHRRLGIGTK  466
               EIVG++RG I++V+ G+K          +  S  Y  VAY+LGLRVS  HRR GI  K
Sbjct  68    EGEIVGLVRGCIKTVACGKKPHRAGAPPRHHTPSPIYTKVAYLLGLRVSPSHRRRGIALK  127

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E W R  GA+Y YMATD  N+AS+ LFT    Y KFRTP++LV PV  H+ P+  
Sbjct  128   LVRRMEEWFREKGAEYAYMATDKDNEASVRLFTERCGYSKFRTPAILVHPVFAHRLPVSR  187

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAV-PKESLSTWEPDS  823
                ++R+P   AE+ YRR F  ++EFFP+DI+ VL+N L+LGT++AV P       E   
Sbjct  188   RAQILRLPAADAETLYRRRF-ATTEFFPRDIDAVLSNPLSLGTYLAVEPGFRWEGIEAFL  246

Query  824   GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFG  1003
              V P + A+LS+W++KEV++++V+G S   +     TR +DR +PW+R+PSVP++ + FG
Sbjct  247   AVPPESWAVLSVWNSKEVFRLEVRGASRWCRGLARTTRAVDRALPWLRIPSVPDLFRPFG  306

Query  1004  YYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS  1183
             ++FL+G+  EG+ G+ M  +L   AHN+AR+   GC ++  EV+  DP+RRGIPHW+  S
Sbjct  307   FHFLYGVGGEGRRGAAMARALCRHAHNMARDG--GCGVVATEVAACDPLRRGIPHWERLS  364

Query  1184  W-QDLWCI  1204
                DLWC+
Sbjct  365   CADDLWCV  372



>ref|XP_011073696.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X1 [Sesamum 
indicum]
Length=464

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 180/410 (44%), Positives = 255/410 (62%), Gaps = 60/410 (15%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE--HGIS-  313
             R+Y+ E+D+ AVEE+E++CEVG  GK  L  DLL DPI RVR++P ++M+V E  H  S 
Sbjct  28    REYDAEKDRRAVEEVENRCEVGPSGKLSLYTDLLGDPICRVRHSPAYLMLVGEIHHFFSF  87

Query  314   ------------------------------------KEIVGVIRGSIRSVSRGQK----G  373
                                                 +EIVG+IRG I++V+ G K    G
Sbjct  88    WFLLSLFYLYLGCSDGGGRVQVAELLVVGGGEDKERREIVGMIRGCIKTVTCGTKLSRYG  147

Query  374   KNDNSTD------YVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDC  535
             KN ++        Y  +AYILGLRVS  HRR+GIG KLV+ +E W   NGA+Y YMAT+ 
Sbjct  148   KNCSTKPPEPLPVYTKLAYILGLRVSPSHRRMGIGLKLVRRMEQWFGENGAEYSYMATET  207

Query  536   SNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGS  715
              NQAS+ LFT   +Y KFRTP++LVQPV  H+  I   V ++++ P  AE  YRR F  +
Sbjct  208   DNQASVKLFTQKCDYCKFRTPAILVQPVFAHRVRIDKRVTIIKLSPADAEVLYRRRFS-T  266

Query  716   SEFFPKDINLVLNNKLNLGTFMAVPKESL--STWEPDSGVF----PTNHAILSIWDAKEV  877
             +EFFP+DI+ VLNNKL+LGTF+AVPK S    +W P +  F    P   A+LS+W+  +V
Sbjct  267   TEFFPRDIDAVLNNKLSLGTFLAVPKGSYWPESW-PGAAEFLVAPPETWAVLSVWNCMDV  325

Query  878   YKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMM  1057
             ++++V+G S +++A    TRV+DR +PW+ LPS+P V + FG++FL+GL  EG + ++ M
Sbjct  326   FRLEVRGASRVRRAVAKTTRVVDRALPWLHLPSIPEVFRPFGFHFLYGLGGEGPNAAKFM  385

Query  1058  ESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              +L   AHN+A+    GC ++  EV+  +P+R GIPHWK+ S  +DLWCI
Sbjct  386   RALCGLAHNLAQE--HGCGVVATEVASREPLRLGIPHWKSLSCAEDLWCI  433



>ref|XP_009138498.1| PREDICTED: probable N-acetyltransferase HLS1 [Brassica rapa]
 emb|CDY29565.1| BnaA03g54100D [Brassica napus]
Length=403

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 249/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+Y+  RD   VE +E +CEVG  GK  L  DLL DP+ R+R++P  +M+VAE G  
Sbjct  2     IVVREYDSSRDLADVEAVERRCEVGPSGKLSLFTDLLGDPLCRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRG------QKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G       K +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGIKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRRQGIGVKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W R NGA+Y Y+AT+  N+AS+NLFTG   Y +FR PS+LV PV+ H+  +   
Sbjct  122   VKMMEEWFRQNGAEYSYIATENDNEASVNLFTGKCGYSEFRKPSILVNPVYAHRVNVSRR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V+++ P  AES YR  F  + EFFP+DI+ VLNN+L+LGTF+AVP+ S       S  
Sbjct  182   VTVIKLDPVDAESLYRLRFS-TIEFFPRDIDSVLNNELSLGTFVAVPRSSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S LK+     TRV+D+ +P+++LPS+P+
Sbjct  241   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLKRVVAKTTRVVDKTLPFLKLPSIPS  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A++   GC +L  EV+ ++P+R+GIP
Sbjct  301   VFKPFGLHFMYGIGGEGPQAAKMVKSLCGHAHNLAKDG--GCGVLATEVAGEEPLRQGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  359   HWKVLSCDEDLWCI  372



>ref|XP_002880477.1| hypothetical protein ARALYDRAFT_900772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56736.1| hypothetical protein ARALYDRAFT_900772 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   327 bits (839),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 175/381 (46%), Positives = 252/381 (66%), Gaps = 28/381 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE G  
Sbjct  5     VEVREYDPSRDLATVEDVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIGPK  64

Query  311   -SKEIVGVIRGSIRSVSRGQ---------KGKND---NSTDYVDVAYILGLRVSSQHRRL  451
              +KE+VG+IRG I++V+ G          K +ND       Y  +AYILGLRVS  HRR 
Sbjct  65    ENKELVGMIRGCIKTVTCGSTKRLDLTHSKSQNDVVITKPLYTKLAYILGLRVSPTHRRQ  124

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIG KLV+++E+W   NGA+Y Y AT+  N AS+NLFTG   Y +FRTPS+LV PV+ H+
Sbjct  125   GIGFKLVKAMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGYSEFRTPSILVNPVYAHR  184

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES----  799
               I   V V+++    AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S    
Sbjct  185   VNISRRVTVIKLEASDAELLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGS  243

Query  800   -LSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWI  964
                +W P S  F    P + A+LS+W+ K+ ++++V+G S LK+     TRV+D+ +P++
Sbjct  244   GFGSW-PGSAKFLEYPPDSWAVLSVWNCKDSFRLEVRGASRLKRVVSKATRVVDKTLPFL  302

Query  965   RLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDD  1144
             ++PS+P V ++FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AEV+  +
Sbjct  303   KIPSIPAVFRSFGLHFMYGIGGEGPRAEKMVKALCGHAHNLAKEG--GCGVVAAEVAGGE  360

Query  1145  PVRRGIPHWKNFSW-QDLWCI  1204
             P+RRGIPHWK  S  +DLWCI
Sbjct  361   PLRRGIPHWKVLSCAEDLWCI  381



>ref|XP_009103420.1| PREDICTED: probable N-acetyltransferase HLS1 [Brassica rapa]
Length=381

 Score =   326 bits (836),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 176/405 (43%), Positives = 254/405 (63%), Gaps = 36/405 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR Y+  RD   VEELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VVVRDYDPNRDLKRVEELEKSCEVGS-----LLVDLMGDPLARIRQSPSFYMLVAE--ID  60

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVD---VAYILGLRVSSQHRRLGIGTKLVQSLE  484
              EIVG+IRG+I++V+RG    +D ++  +    +A++ GLRVS  +RR+GIG KLVQ LE
Sbjct  61    NEIVGMIRGTIKTVTRGGNALHDGNSPVISTTKLAFVSGLRVSPYYRRMGIGLKLVQRLE  120

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
             +W R N A Y Y+ T+  N AS+ LFT    Y K+RTP+ +V PV  H+  +   V +++
Sbjct  121   DWFRLNDAAYAYVQTENDNAASVKLFTEKSGYSKYRTPTFMVNPVFNHRVTVSRRVNIIK  180

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNH  844
             + P  AES +R  F  S+EFFP DIN +L NKL+LGTF+AVP+ S    +  SG  P + 
Sbjct  181   LVPSDAESIFRNRFS-STEFFPSDINSILTNKLSLGTFLAVPRGS----DYVSGSLPGSW  235

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A++SIW++KEVYK+QV+G S LK+     TRVLD  +P++++PS PN+ K F  +FL+G+
Sbjct  236   AVISIWNSKEVYKLQVQGTSRLKRTLAKTTRVLDGALPFLKIPSFPNLFKPFAMHFLYGI  295

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCI  1204
               EG   +EM+E+L + AHN+A+  + GC ++ AEV   +P+R GIPHWK  S +DLWC+
Sbjct  296   GGEGPQAAEMVEALCSHAHNIAK--KSGCAVVAAEVGSCEPLRAGIPHWKALSPEDLWCL  353

Query  1205  khlnlvgdnnnnnkaanivhdSSEDSIMYHDSSA--LIFVDPRDI  1333
                                    +D + +  S+    +FVDPRD+
Sbjct  354   -----------------KRLRDDDDGVDWTKSTPGLSVFVDPRDL  381



>ref|XP_010472304.1| PREDICTED: probable N-acetyltransferase HLS1-like [Camelina sativa]
Length=412

 Score =   327 bits (839),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 175/381 (46%), Positives = 250/381 (66%), Gaps = 28/381 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  +D   VEE+E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE G  
Sbjct  5     VEVREYDPSKDLATVEEVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIGTD  64

Query  311   -SKEIVGVIRGSIRSVSRG---------QKGKND---NSTDYVDVAYILGLRVSSQHRRL  451
               KE+VG+IRG I++V+ G          K +ND       Y  +AYILGLRVS  HRR 
Sbjct  65    EKKELVGMIRGCIKTVTCGSTKRLDLTHNKSQNDVVITKPLYTKLAYILGLRVSPTHRRQ  124

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIG KLV ++E+W R NGA+Y Y AT+  N AS+NLFTG   Y +FRTPS+LV P++ HK
Sbjct  125   GIGFKLVNTMEDWFRQNGAEYSYFATENDNHASVNLFTGKCGYSEFRTPSILVNPIYAHK  184

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES----  799
               I   V ++++ P  AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S    
Sbjct  185   VNISRRVTIIKLDPTDAELLYRIRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGS  243

Query  800   -LSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWI  964
              L +W P S  F    P + A+LS+W+  + ++++V+G S L++     TRV+D+ +P++
Sbjct  244   GLGSW-PGSAKFLEYPPDSWAVLSVWNCNDSFRLEVRGASKLRRVLAKTTRVVDKTLPFL  302

Query  965   RLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDD  1144
             ++PS+P V + FG +F++G+  EG    +M++ L   AHN+A+    GC ++ AEV+  +
Sbjct  303   KIPSIPAVFQPFGLHFMYGIGGEGPRAEKMVKVLCNHAHNLAKEG--GCGVVAAEVAGGE  360

Query  1145  PVRRGIPHWKNFSW-QDLWCI  1204
             P+RRGIPHWK  S  +DLWCI
Sbjct  361   PLRRGIPHWKVLSCAEDLWCI  381



>ref|XP_004509069.1| PREDICTED: uncharacterized protein LOC101507964 [Cicer arietinum]
Length=414

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/384 (46%), Positives = 247/384 (64%), Gaps = 33/384 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+++  +D+ +VE +E  CEVG  GK  L  DL  DPI RVRN+P  +M+VAE  I 
Sbjct  6     VSVREFDPNKDRESVEAVEKICEVGPSGKLSLFTDLHGDPICRVRNSPTFLMLVAE--IG  63

Query  314   KEIVGVIRGSIRSVSRGQK-----------------GKNDNSTDYVDVAYILGLRVSSQH  442
              E VG+IRG I++V+ G+K                   + N   +  +AYILGLRVS  H
Sbjct  64    NETVGMIRGCIKTVTCGKKLIRPTKNTITNNGNNTESNSKNVPVFTKLAYILGLRVSPNH  123

Query  443   RRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVH  622
             RR+GIG KLV+ +E W R NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV+
Sbjct  124   RRMGIGLKLVEKMEEWFRENGAEYSYMATENDNVASVKLFTDKCGYSKFRTPSILVNPVY  183

Query  623   RHKKPIGSD-VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES  799
              H+  I S  V ++++ P  AE+ YR  F  ++EFFP+DI+ VL NKL LGTF+AVP  S
Sbjct  184   AHRVRISSSKVTIIKLTPNDAEALYRNKFS-TTEFFPRDIDSVLKNKLTLGTFLAVPT-S  241

Query  800   LSTWEPDS----GVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLI  955
              ST+ P++     VF    PT+ A++SIW+ K+V+ ++VKG S +++A    TRVLD+  
Sbjct  242   GSTYGPNNWPGPDVFLKTPPTSWALVSIWNCKDVFTLEVKGASRVRRAMAKTTRVLDKAF  301

Query  956   PWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVS  1135
             PW+RLPS+PN  + FG++ ++G+  EG    +M+++L  FAHN+A    RGC  +  EVS
Sbjct  302   PWLRLPSIPNFFEPFGFHLMYGIGGEGPEALKMVKALCGFAHNLAM--ERGCSAVATEVS  359

Query  1136  PDDPVRRGIPHWKNFSW-QDLWCI  1204
              ++P+R  IPHWK  S  +DLWCI
Sbjct  360   SNEPLRFAIPHWKVLSCEEDLWCI  383



>emb|CDX72638.1| BnaC07g46600D [Brassica napus]
Length=403

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 249/374 (67%), Gaps = 20/374 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+Y+  RD   VE +E +CEVG  GK  L  DLL DP+ R+R++P  +M+VAE G  
Sbjct  2     IVVREYDSSRDLADVEAVERRCEVGPSGKLSLFTDLLGDPLCRIRHSPSFLMLVAEMGTE  61

Query  311   SKEIVGVIRGSIRSVSRG------QKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G       K +ND     Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    KKEIVGMIRGCIKTVTCGIKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRRQGIGLKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W R NGA+Y Y+AT+  N+AS+NLFTG   Y +FR PS+LV PV+ H+  +   
Sbjct  122   VKMMEEWFRQNGAEYSYIATENDNEASVNLFTGKCGYSEFRKPSILVNPVYAHRVNVSRR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V+++ P  AES YR  F  ++EFFP DI+ VLNN+L+LGTF+AVP+ S       S  
Sbjct  182   VTVIKLDPVDAESLYRLRFS-TTEFFPGDIDSVLNNELSLGTFVAVPRSSCYGSGSGSWP  240

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S LK+     TRV+D+ +P+++LPS+P+
Sbjct  241   GSSKFLEYPPESWAVLSVWNCKDSFRLEVRGASRLKRVVAKTTRVVDKTLPFLKLPSIPS  300

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A++   GC +L  EV+ ++P+R+GIP
Sbjct  301   VFKPFGLHFMYGIGGEGPQAAKMVKSLCGHAHNLAKDG--GCGVLATEVAGEEPLRQGIP  358

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  359   HWKVLSCDEDLWCI  372



>emb|CDY70664.1| BnaAnng34560D [Brassica napus]
Length=381

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 253/405 (62%), Gaps = 36/405 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR Y+  RD   VEELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VVVRDYDPNRDLKRVEELEKSCEVGS-----LLVDLMGDPLARIRQSPSFYMLVAE--ID  60

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTDYVD---VAYILGLRVSSQHRRLGIGTKLVQSLE  484
              EIVG+IRG+I++V+RG    +D ++  +    +A++ GLRVS  +RR+GIG KLVQ LE
Sbjct  61    NEIVGMIRGTIKTVTRGGNALHDGNSPVISTTKLAFVSGLRVSPYYRRMGIGLKLVQRLE  120

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
             +W R N A Y Y+ T+  N AS+ LFT    Y K+RTP+ LV PV  H+  +   V +++
Sbjct  121   DWFRLNDAAYAYVQTENDNAASVKLFTEKSGYSKYRTPTFLVNPVFNHRVTVSRRVNIIK  180

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNH  844
             + P  AES YR  F  S+EFFP DIN +L NKL+LGTF+AVP+ S    +  SG  P + 
Sbjct  181   LDPSDAESIYRNRFS-STEFFPSDINSILTNKLSLGTFLAVPRGS----DYVSGSLPGSW  235

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A++SIW++KEVYK+QV+G S LK+     TRVLD  +P++++PS PN+ K F  +FL+G+
Sbjct  236   AVISIWNSKEVYKLQVQGTSRLKRTLAKTTRVLDGALPFLKIPSFPNLFKPFAMHFLYGI  295

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCI  1204
               EG   +EM+E+L + AHN+A+  + GC ++ AEV   +P+R GI HWK  S +DLWC+
Sbjct  296   GGEGPQAAEMVEALCSHAHNIAK--KSGCAVVAAEVGSCEPLRAGITHWKALSPEDLWCL  353

Query  1205  khlnlvgdnnnnnkaanivhdSSEDSIMYHDSSA--LIFVDPRDI  1333
                                    +D + +  S+    +FVDPRD+
Sbjct  354   -----------------KRLRDDDDGVDWTKSTPGLSVFVDPRDL  381



>gb|KFK28430.1| hypothetical protein AALP_AA8G513600 [Arabis alpina]
Length=387

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 240/363 (66%), Gaps = 18/363 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V++R+Y+  RD  +VEELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VMIREYDPTRDLTSVEELEKSCEVGS-----LLVDLMGDPLARIRQSPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNS-----TDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+RG     D S          +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  61    DEIVGIIRGTIKMVTRGGYTLLDRSDVSPEISTTKLAFVSGLRVSPFYRRMGIGLKLVQR  120

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             +E+W R NGA Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  + + V +
Sbjct  121   IEDWFRRNGAAYAYVQTENDNTASVKLFTEKTGYSKFRTPTFLVNPVFNHRATVSNRVKI  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             + + P +AES YR  F  S+EFFP DIN +L NKL+LGT+MA+P+   S + P S   PT
Sbjct  181   INLAPSVAESLYRNRF-SSTEFFPSDINSILANKLSLGTYMALPRG--SDYVPSSLPDPT  237

Query  839   NH-AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
             +  A+LSIW++KEVYK+QV+G S LK+     TRV D + P++++PS PN+ K F  +FL
Sbjct  238   DSWAVLSIWNSKEVYKLQVQGTSRLKRILAKTTRVFDGVFPFLKIPSFPNLFKPFSMHFL  297

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDL  1195
             +G+  EG    EM+E+L + AHN+AR  + GC ++ AEV+  +P+R G+PHWK  S +DL
Sbjct  298   YGIGGEGPRAVEMVEALCSHAHNIAR--KSGCSVVAAEVASCEPLRVGVPHWKLLSPEDL  355

Query  1196  WCI  1204
             WC+
Sbjct  356   WCL  358



>ref|XP_004511849.1| PREDICTED: uncharacterized protein LOC101496495 [Cicer arietinum]
Length=407

 Score =   325 bits (834),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 245/375 (65%), Gaps = 24/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V+VR+++  +D+  VE +E  CEVG   K  L  ++  DPI RVR++P  +M+VAE  I 
Sbjct  8     VIVREFDVNKDRERVEAVEMSCEVGPNHKLSLFTNMFGDPICRVRHSPSFLMLVAE--IG  65

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-------YVDVAYILGLRVSSQHRRLGIG  460
             +EIVG+IRG I++V+ G+K     K  N T        Y  +AYILGLRVS   RR+GIG
Sbjct  66    EEIVGMIRGCIKTVTCGKKLSRKSKQYNITTHTNQIPIYTKLAYILGLRVSPNQRRMGIG  125

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              KLV  +E W R NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV+ HK  +
Sbjct  126   LKLVNEIEAWFRKNGAEYSYMATENDNLASVKLFTDKCGYSKFRTPSILVNPVYAHKIKV  185

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPD  820
               +V V+ + P  A   YR  F  ++EFFP+DI+ VL NKL++GTF+AVP  S ST E  
Sbjct  186   SPNVTVIPLTPSEAVILYRNRFS-TTEFFPRDIDSVLKNKLSIGTFLAVPSGSYST-ESW  243

Query  821   SGVF------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
              G++      P + A+LS+W++KEV+ +QV+G S +K+A    +RVLDR +PW+ LPS+P
Sbjct  244   PGLYKFLLGPPYSWAVLSVWNSKEVFTLQVRGASRVKRALAKTSRVLDRALPWLNLPSIP  303

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
             ++   FG++FL+GL  EG    +M+++L  FAHN+A    RGC ++  EV+  +P+R GI
Sbjct  304   DLFSPFGFHFLYGLGGEGPKSVKMIKALCGFAHNMAL--ERGCAVVATEVASCEPLRFGI  361

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  362   PHWKMLSCAEDLWCI  376



>ref|XP_006404772.1| hypothetical protein EUTSA_v10000180mg [Eutrema salsugineum]
 gb|ESQ46225.1| hypothetical protein EUTSA_v10000180mg [Eutrema salsugineum]
Length=410

 Score =   325 bits (834),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 251/379 (66%), Gaps = 26/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V +R+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE    
Sbjct  5     VEIREYDASKDLATVEDVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIVTE  64

Query  311   -SKEIVGVIRGSIRSVSRG-------QKGKNDNSTD---YVDVAYILGLRVSSQHRRLGI  457
               KE+VG+IRG I++V+ G        K +ND  T    Y  +AY+LGLRVS  HRR GI
Sbjct  65    EKKELVGMIRGCIKTVTCGSKTLDLTHKSRNDVVTTKPLYTKLAYVLGLRVSPTHRRRGI  124

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV+ +E W   NGA+Y Y+AT+  N AS+NLFTG   Y +FR PS+LV PV+ H+  
Sbjct  125   GFKLVKEIEKWFNQNGAEYSYIATENDNDASVNLFTGKCGYSEFRKPSILVNPVYAHRVN  184

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----L  802
             I + V V+++ P  AES YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S      
Sbjct  185   ISNRVTVIKLEPSDAESLYRLQFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGF  243

Query  803   STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              +W P S  F    P + A+LS+W+ K+ ++++V+G S L++     TR++D+ +P+++L
Sbjct  244   GSW-PGSAKFLEYPPDSWAVLSVWNCKDSFRLEVRGASRLRRVVAKTTRIVDKTLPFLKL  302

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+P V + FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AEV+  +P+
Sbjct  303   PSIPAVFRPFGLHFMYGIGGEGPYAEKMVKALCGHAHNLAKEG--GCSVVAAEVAGGEPL  360

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             RRGIPHWK  S  +DLWC+
Sbjct  361   RRGIPHWKVLSCAEDLWCM  379



>ref|NP_179888.1| acyl-CoA N-acyltransferase-like protein [Arabidopsis thaliana]
 sp|O64815.1|HLS1L_ARATH RecName: Full=Probable N-acetyltransferase HLS1-like [Arabidopsis 
thaliana]
 gb|AAC17822.1| similar to hookless1 (HLS1) [Arabidopsis thaliana]
 gb|ABN04795.1| At2g23060 [Arabidopsis thaliana]
 gb|AEC07401.1| acyl-CoA N-acyltransferase-like protein [Arabidopsis thaliana]
Length=413

 Score =   325 bits (834),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 252/382 (66%), Gaps = 29/382 (8%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE G  
Sbjct  5     VEVREYDPSKDLATVEDVERRCEVGPAGKLSLFTDLLGDPICRVRHSPSYLMLVAEIGPK  64

Query  314   --KEIVGVIRGSIRSVSRG----------QKGKND---NSTDYVDVAYILGLRVSSQHRR  448
               KE+VG+IRG I++V+ G           K +ND       Y  +AYILGLRVS  HRR
Sbjct  65    EKKELVGMIRGCIKTVTCGITTKRLDLTHNKSQNDVVITKPLYTKLAYILGLRVSPTHRR  124

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
              GIG KLV+++E+W   NGA+Y Y AT+  N AS+NLFTG   Y +FRTPS+LV PV+ H
Sbjct  125   QGIGFKLVKAMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGYAEFRTPSILVNPVYAH  184

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL--  802
             +  I   V V+++ P  AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S   
Sbjct  185   RVNISRRVTVIKLEPSDAELLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYG  243

Query  803   ---STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPW  961
                 +W P S  F    P + A+LS+W+ K+ ++++V+G S L++     TR++D+ +P+
Sbjct  244   SGSRSW-PGSAKFLEYPPDSWAVLSVWNCKDSFRLEVRGASRLRRVVSKATRMVDKTLPF  302

Query  962   IRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPD  1141
             +++PS+P V + FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AEV+ +
Sbjct  303   LKIPSIPAVFRPFGLHFMYGIGGEGPRAEKMVKALCDHAHNLAKEG--GCGVVAAEVAGE  360

Query  1142  DPVRRGIPHWKNFSW-QDLWCI  1204
             +P+RRGIPHWK  S  +DLWCI
Sbjct  361   EPLRRGIPHWKVLSCAEDLWCI  382



>ref|XP_010417061.1| PREDICTED: probable N-acetyltransferase HLS1-like [Camelina sativa]
Length=412

 Score =   325 bits (833),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 170/381 (45%), Positives = 252/381 (66%), Gaps = 28/381 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE G +
Sbjct  5     VEVREYDPSKDLATVEDVEQRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIGTA  64

Query  314   --KEIVGVIRGSIRSVSRGQKGKNDNSTD------------YVDVAYILGLRVSSQHRRL  451
               KE+VG+IRG I++V+ G   ++D + +            Y  +AYILGLRVS  HRR 
Sbjct  65    EKKELVGMIRGCIKTVTCGSTKRHDLTHNKSQNDVVITKPLYTKLAYILGLRVSPTHRRQ  124

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             G+G KLV+++E+W   NGA+Y Y AT+  N AS+NLFTG   Y +FRTPS+LV PV+ H+
Sbjct  125   GVGFKLVKTMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGYSEFRTPSILVNPVYAHR  184

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES----  799
               I   V ++++ P  AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S    
Sbjct  185   VNISRRVTIIKLDPTDAELLYRIRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGS  243

Query  800   -LSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWI  964
              L +W P S  F    P + A+LS+W+  + ++++V+G S L++     TRV+D+ +P++
Sbjct  244   GLGSW-PGSAKFLEYPPDSWAVLSVWNCNDSFRLEVRGASKLRRVLAKTTRVVDKTLPFL  302

Query  965   RLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDD  1144
             ++PS+P V + FG +F++G+  EG    +M++ L   AHN+A+    GC ++ AEV+  +
Sbjct  303   KIPSIPAVFQPFGLHFMYGIGGEGPRAEKMVKVLCNHAHNLAKEG--GCGVVAAEVAGGE  360

Query  1145  PVRRGIPHWKNFSW-QDLWCI  1204
             P+RRGIPHWK  S  +DLWCI
Sbjct  361   PLRRGIPHWKVLSCAEDLWCI  381



>gb|KFK32773.1| hypothetical protein AALP_AA6G286800 [Arabis alpina]
Length=410

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 252/379 (66%), Gaps = 26/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE--HG  307
             V VR+Y+  +D   VE++E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE    
Sbjct  5     VEVREYDPSKDLATVEDVERRCEVGPTGKLSLFTDLLGDPICRVRHSPSYLMLVAEIITE  64

Query  308   ISKEIVGVIRGSIRSVSRGQK-------GKNDNSTD---YVDVAYILGLRVSSQHRRLGI  457
               +E+VG+IRG I++V+ G K        +ND  T    Y  +AY+LGLRVS  HRR GI
Sbjct  65    EKQELVGMIRGCIKTVTCGTKILDLSHNSQNDVVTSKPLYTKLAYVLGLRVSPTHRRKGI  124

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV+ +E+W   NGA+Y Y+AT+  NQAS+NLFTG   Y +FRTPS+LV PV+ H+  
Sbjct  125   GFKLVKKMEDWFSQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVN  184

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----L  802
             I + V ++++ P  AES YR  F  ++EFFP+DI  VLNNKL+LGTF+AVP+ S      
Sbjct  185   ISNRVTIIKLDPSDAESLYRLRFS-TTEFFPRDIESVLNNKLSLGTFVAVPRGSCYGSGF  243

Query  803   STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              +W P S  F    P + A+LS+W+ K+ ++++V+G S +++     TR++D+ +P++++
Sbjct  244   GSW-PGSAKFLEYPPDSWAVLSVWNCKDSFRLEVRGASKIRRMLAKTTRMVDKTLPFLKI  302

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+P V + FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AEV+  +P 
Sbjct  303   PSIPAVFRPFGLHFMYGIGGEGPRSEKMVKALCGHAHNLAKEG--GCGVVAAEVAGGEPF  360

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             RRGIPHWK  S  +DLWCI
Sbjct  361   RRGIPHWKVLSCAEDLWCI  379



>ref|XP_008440371.1| PREDICTED: probable N-acetyltransferase HLS1 [Cucumis melo]
Length=410

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/375 (45%), Positives = 242/375 (65%), Gaps = 22/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +V+R+++  +D +AVE++E +CEVG  GK  L  DLL DPI RVRN+P  +M+VA     
Sbjct  9     IVIREFDPSKDCIAVEDVERRCEVGPSGKLCLFTDLLGDPICRVRNSPAFLMLVAATADH  68

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTD-----------YVDVAYILGLRVSSQHRRLGIG  460
              EIVG+IRG I++V+ GQK       +           Y  +AYILGLRVS  HRR+GIG
Sbjct  69    NEIVGMIRGCIKTVTCGQKLSRSAIPNSDHQPPKHLPVYTKLAYILGLRVSPAHRRMGIG  128

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              KLV+ +E W R +GA+Y Y+AT+  N AS+NLFT    Y KFRTP++LV PV  H  P+
Sbjct  129   IKLVKKMEEWFRESGAEYSYIATEKDNVASVNLFTEKCEYSKFRTPAILVNPVFAHPVPL  188

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWE  814
                V ++ +    AE  YRR F  ++EFFP+DI+ VLNN L LGTF+A+P+ + +  TW 
Sbjct  189   SKRVTILPLSRSDAEILYRRRF-STTEFFPRDIDAVLNNPLTLGTFLAIPRGTYTPHTW-  246

Query  815   PDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
             P S  F    P + A+LS+W+  +V+++QV+G+S LK++    TRVLD+  P +RLPSVP
Sbjct  247   PGSDRFLCDPPQSWAVLSVWNCNDVFRLQVRGVSRLKRSFARTTRVLDKAFPCLRLPSVP  306

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
              +   FG +F++GL  EG     M+++L  +AHN+A+   +GC ++  EVS  + +R  I
Sbjct  307   ELFSPFGLHFMYGLGGEGPDAERMVKALCGYAHNLAKE--KGCGVVATEVSAGERLRPAI  364

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  365   PHWKMLSCEEDLWCI  379



>ref|XP_010652717.1| PREDICTED: probable N-acetyltransferase HLS1 [Vitis vinifera]
 emb|CBI33703.3| unnamed protein product [Vitis vinifera]
Length=421

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 245/373 (66%), Gaps = 25/373 (7%)
 Frame = +2

Query  149   YEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-----HGIS  313
             +  E+D   VEE+E +CEVG  G+  L  DLL DPI RVR++P   M+VAE     +  +
Sbjct  22    FHPEKDCRRVEEVERRCEVGPSGELSLFTDLLGDPICRVRHSPAFRMLVAEMVGEENEEA  81

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTK  466
             KEIVG+IRG I++V+ G+K    G+  N        Y  +AYILGLRVS  HRR+GIG K
Sbjct  82    KEIVGMIRGCIKTVTCGKKLSRNGRTSNDPTKPLPVYTKLAYILGLRVSPSHRRMGIGLK  141

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV  +E W R NGA+Y Y+AT+  NQAS+NLFT    Y KFRTPS+LV PV  H   +  
Sbjct  142   LVCRMEEWFRDNGAEYSYIATENDNQASVNLFTDKCGYSKFRTPSILVNPVFAHTVRLPK  201

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLST--WEPD  820
              V + ++ P  AE+ YRR F  ++EFFP+DI+ VLNNKLNLGTF+AV  ES  T  W P 
Sbjct  202   RVHIFKLSPSDAEALYRRRFS-TTEFFPRDIDSVLNNKLNLGTFVAVFSESNPTESW-PG  259

Query  821   SGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
             S  F    P + A+LS+W+ K+V+ ++V+G S +K+     TR++DR +PW++LPSVP V
Sbjct  260   SDSFLADPPESWAVLSVWNCKDVFTLEVRGASRVKRGFAKTTRLVDRALPWLQLPSVPEV  319

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
              + FG +F++GL  EG    +++++L  +AHN+A+   RGC ++  EVS  +P+R GIPH
Sbjct  320   FRPFGLHFMYGLGGEGPRAVKLVKALCGYAHNLAKE--RGCGVVATEVSSREPLRLGIPH  377

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +DLWC+
Sbjct  378   WKRLSCAEDLWCM  390



>ref|XP_007199030.1| hypothetical protein PRUPE_ppa017911mg [Prunus persica]
 gb|EMJ00229.1| hypothetical protein PRUPE_ppa017911mg [Prunus persica]
Length=415

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 244/379 (64%), Gaps = 28/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVG--QEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHG  307
             +V+R+ +  +D  +VEELE +CEVG    GK  L  DLL DPI R+RN+P  +M+VAE G
Sbjct  12    LVIRELDMNKDTESVEELERKCEVGGSSSGKMSLFTDLLGDPICRIRNSPSFLMLVAEMG  71

Query  308   ISKEIVGVIRGSIRSVSRGQK----------GKNDNSTDYVD-----VAYILGLRVSSQH  442
               KEIVGVIRG I+ V+ G+K            N++S   ++     +AYILGLRVS  H
Sbjct  72    PGKEIVGVIRGCIKIVTCGKKLIRSTNGIANSSNEDSDPKLEPICTKLAYILGLRVSPSH  131

Query  443   RRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVH  622
             RR G+G KLV  +E W R NGA+Y YMAT+  N  S+NLFT   +Y KFRTPS+LVQPV 
Sbjct  132   RRRGMGLKLVNQMEEWFRRNGAEYSYMATENDNMPSLNLFTKKCHYTKFRTPSILVQPVF  191

Query  623   RHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL  802
              H+    + V ++++ P  AE+ YR  F  ++EFFP+DI+ V+ NKLNLGTF+AVP  + 
Sbjct  192   AHRVKTHNRVTIIKLSPPDAEALYRSRF-CTTEFFPQDIDRVVKNKLNLGTFLAVP--TG  248

Query  803   STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
              +W P    F    P + A+LS W+ KEV+ +++KG S  ++     TRV+DR +PW+R+
Sbjct  249   FSW-PGLVKFLSEPPESWAVLSAWNCKEVFTLEIKGASLARRFAAKATRVVDRALPWLRI  307

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PSVP V + FG  FL+GL  +G    +M+E+L   AHN+AR    GC ++  EV+  +P+
Sbjct  308   PSVPEVFRPFGLVFLYGLGGQGPRAVKMVEALCGHAHNMARE--LGCGVVATEVASQEPL  365

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             R GIPHWK  S  +D+WCI
Sbjct  366   RLGIPHWKTLSCAEDMWCI  384



>ref|XP_003611609.1| hypothetical protein MTR_5g015810 [Medicago truncatula]
Length=417

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/383 (45%), Positives = 246/383 (64%), Gaps = 31/383 (8%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V+VR++E  +DK  VE +E  CEVG   +  L  D+L DPI RVR++P ++M+VAE  I 
Sbjct  9     VIVREFEVNKDKERVEAVERTCEVGPSNQLSLFTDMLGDPICRVRHSPSYLMLVAE--ID  66

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNST------DYVDVAYILGLRVSSQHR----------  445
             KEIVG+IRG I++V+ G+      ++       Y  +AYILGLRVS   R          
Sbjct  67    KEIVGMIRGCIKTVTCGKNLSRSKTSVTKHIPIYTKLAYILGLRVSPNQRYATNISNVYA  126

Query  446   ----RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
                 R+GIG KLV+ +E W + NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV 
Sbjct  127   TLFDRMGIGLKLVKKMEAWFKDNGAEYSYMATETENLASVKLFTEKCGYTKFRTPSILVN  186

Query  614   PVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK  793
             PV+ H+  I   V ++ + P  A  +YR  F  ++EFFP DI+ V+NNKL+LGTF+AVP 
Sbjct  187   PVYAHRTKISRKVTIIPLTPSDAVIFYRNRFS-TTEFFPNDIDAVVNNKLSLGTFLAVPS  245

Query  794   ESLS--TWE-PDSGVF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIP  958
              S S  TW  PD  +   P + AILS+W++KEV+K++V+G S +K+     TR+LDR +P
Sbjct  246   GSYSVKTWPGPDRFLLGPPCSWAILSVWNSKEVFKLEVRGASRVKRGLAKTTRILDRALP  305

Query  959   WIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP  1138
             W+++PSVP++ + FG++FL+GL  EG    +M+++L  FAHN+A     GC ++  EV+ 
Sbjct  306   WLKVPSVPDLFRPFGFHFLYGLGGEGPKKLKMVKALCEFAHNLAMEC--GCGVVATEVAS  363

Query  1139  DDPVRRGIPHWKNFSW-QDLWCI  1204
              +P+R GIPHWK  S   DLWCI
Sbjct  364   CEPLRFGIPHWKMLSCANDLWCI  386



>ref|XP_008777300.1| PREDICTED: probable N-acetyltransferase HLS1 [Phoenix dactylifera]
Length=419

 Score =   322 bits (826),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 168/383 (44%), Positives = 242/383 (63%), Gaps = 27/383 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH-GI  310
             +VVR+YEEERD++  E +E  CEVG  G+  L  D L DP  RVR++P  +M+VAE  G 
Sbjct  6     IVVREYEEERDRLRAEAMERMCEVGPSGEMSLFTDHLGDPASRVRHSPAFLMLVAEKSGP  65

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTD---------------YVDVAYILGLRVSSQHR  445
              KEIVG+IRGS+++V+ G+    + +                 Y  VAYILGLRVS  +R
Sbjct  66    VKEIVGLIRGSVKTVTCGKTISRNAAAAPAAAAKRHDPLPIPIYTKVAYILGLRVSPFYR  125

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
             R+G G KLV+ LE W +  GA+Y YMAT+  N+ASI LFTG   Y KFRTP++LV PV  
Sbjct  126   RMGTGMKLVRRLEEWFKEQGAEYAYMATEKDNEASIRLFTGRCGYSKFRTPAILVHPVFA  185

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM----AVPK  793
             H++ I   V ++R+PP  AE+ YRR F  ++EFFP+DI+ VL+N L+ GTF+    A   
Sbjct  186   HRRTIPGSVRILRLPPADAETLYRRRFS-TTEFFPRDIDAVLSNPLSFGTFLAVPAAAAG  244

Query  794   ESLSTWE-PDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIP  958
                  WE P +  F    P + A++S+W+   V++++V+G S +++     TR  DR +P
Sbjct  245   GGRGGWEWPGAEEFLAAPPESWAVVSVWNCGGVFRLEVRGASRVRRGLAWATRAADRALP  304

Query  959   WIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP  1138
             W+R+PSVP++ + FG  FL+G+  EG + + M+ +L   AHN+ R    GC ++ AEV+ 
Sbjct  305   WLRIPSVPDIFRPFGALFLYGIGGEGPAAAGMVGALCRHAHNMGRGAPGGCGVVAAEVAA  364

Query  1139  DDPVRRGIPHWKNFSW-QDLWCI  1204
              DP+RRGIPHW+  S  +DLWC+
Sbjct  365   CDPLRRGIPHWRRLSCAEDLWCV  387



>gb|EYU44482.1| hypothetical protein MIMGU_mgv1a007915mg [Erythranthe guttata]
Length=391

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 238/364 (65%), Gaps = 28/364 (8%)
 Frame = +2

Query  185   LESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI--------SKEIVGVIRG  340
             +E++CEVG  G+  L  D L DPI RVR++P ++M+VAE  +         +EIVG+IRG
Sbjct  1     MENRCEVGPTGELSLFTDQLGDPICRVRHSPAYLMLVAEMVVVGGGEDKERREIVGIIRG  60

Query  341   SIRSVSRGQK-GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSN  502
              +++V+ G K  +N  +       Y  VAYILGLRVS  HRR+GIG KLV+ +E W   N
Sbjct  61    CVKTVTCGTKLSRNSKNCPFKLPIYTKVAYILGLRVSPSHRRMGIGMKLVRGMEKWCGEN  120

Query  503   GADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLA  682
             GA+Y YMAT+  N AS+ LFT    Y KFRTPS+LVQPV  H+      VAV+++    A
Sbjct  121   GAEYSYMATENDNLASVELFTHKCGYSKFRTPSILVQPVFEHRVKSDKRVAVIKLAAADA  180

Query  683   ESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----LSTWEPDSGVF----P  835
             E+ YRR F  ++EFFP+DI+ VL NKLNLGTF+AVPK S       +W P +  F    P
Sbjct  181   EALYRRRFS-ATEFFPRDIDAVLKNKLNLGTFLAVPKGSPYAAAAGSW-PGADEFLASQP  238

Query  836   TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
              + A+LS+W++K+VY ++V+G S +++A    TR +DR +PW+RLPSVP V + FG++FL
Sbjct  239   ESWAVLSVWNSKDVYTLEVRGASRVRRALARTTRAVDRALPWLRLPSVPEVFRPFGFHFL  298

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QD  1192
             +G+  EG   + M+ SL   AHN+A+    GC ++ AEV+  DP+R GIPHW+  S  +D
Sbjct  299   YGIGGEGPKAARMVRSLCGVAHNLAKE--HGCGVVAAEVAGRDPLRLGIPHWERLSCAED  356

Query  1193  LWCI  1204
             LWCI
Sbjct  357   LWCI  360



>emb|CAC80824.1| putative N-acetyltransferase hookless1 [Brassica napus]
Length=390

 Score =   319 bits (817),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 244/368 (66%), Gaps = 20/368 (5%)
 Frame = +2

Query  152   EEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS-KEIVG  328
             +  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P  +M+VAE G   KEIVG
Sbjct  1     DPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPISRIRHSPSFLMLVAETGTEEKEIVG  60

Query  329   VIRGSIRSVSRGQK----GKNDNSTD---YVDVAYILGLRVSSQHRRLGIGTKLVQSLEN  487
             +IRG I++V+ G+K     K+ N T    Y  +AY+LGLRVS  HRR GIG KLV+ +E 
Sbjct  61    MIRGCIKTVTCGKKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRRQGIGFKLVKMMEA  120

Query  488   WGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRV  667
             W   NGA+Y Y+AT+  NQAS+NLFTG   Y +FR PS+LV PV+ HK  +   V V+++
Sbjct  121   WFMQNGAEYSYIATENENQASVNLFTGKCGYSEFRKPSILVNPVYAHKVNVSRRVTVIKL  180

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF-----  832
              P  AES YR  F  ++EFFP+DI+ VLNN L+LGTF+AVP+ S       S        
Sbjct  181   DPVDAESLYRLRFS-TTEFFPRDIDSVLNNNLSLGTFVAVPRGSCYGSGSGSWPGSSKFL  239

Query  833   ---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFG  1003
                P + A+LS+W+ K+ ++++V+G S  ++     TRV+D+ +P+++LPS+P+V K FG
Sbjct  240   EYPPESWAVLSVWNCKDSFRLEVRGASLWRRVVAKTTRVVDKTLPFLKLPSIPSVFKPFG  299

Query  1004  YYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS  1183
              +F++G+  EG   ++M++SL   AHN+A+  R GC +L  EV+ ++P++RGIPHWK  S
Sbjct  300   LHFMYGIGGEGPRAAKMVKSLCGHAHNLAK--RGGCGVLATEVAGEEPLQRGIPHWKVLS  357

Query  1184  WQ-DLWCI  1204
              Q DLWCI
Sbjct  358   CQEDLWCI  365



>ref|XP_010548456.1| PREDICTED: probable N-acetyltransferase HLS1 [Tarenaya hassleriana]
Length=408

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 238/369 (64%), Gaps = 19/369 (5%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-SKE  319
             R+Y+  RD   VE++E +CEVG  GK  L  DL+ DPI RVR++P  +M+VAE G   KE
Sbjct  13    REYDPTRDLAGVEDVERRCEVGPSGKLSLFTDLMGDPICRVRHSPAFLMLVAEMGTEKKE  72

Query  320   IVGVIRGSIRSVSRGQKGKNDNSTD-------YVDVAYILGLRVSSQHRRLGIGTKLVQS  478
             IVG+IRG I++V+ G++      T        Y  +AY+LGLRVS  HRR GIG +LV  
Sbjct  73    IVGMIRGCIKTVTCGKRLDRTYKTQNDVVKPVYTKLAYVLGLRVSPSHRRQGIGFRLVTR  132

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             +E W R NGA+Y Y+AT+  N AS+ LFTG   Y KFRTPS+LV PV  H+  +   V +
Sbjct  133   MEQWFRQNGAEYSYIATENDNHASVELFTGKCGYSKFRTPSILVNPVFAHRVSVNRRVTI  192

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVF  832
              ++ P  AE  YR  F  ++EFFP+D++ +LNNKL+LGTF+AVP+      +W P S  F
Sbjct  193   FKLDPIDAELLYRLRFR-TTEFFPRDVDSILNNKLSLGTFVAVPRVDSGTGSW-PGSVKF  250

Query  833   ----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNF  1000
                 P + A+LS+W+ K+ Y+++V+G S +++     TR++D+ +P+++LPS+P V + F
Sbjct  251   LDDPPESWAVLSVWNCKDAYRLEVRGASRVRRTVAKTTRLIDKTLPFLKLPSIPEVFRPF  310

Query  1001  GYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNF  1180
             G YF++G+  EG     M+ +L   AHN+A+    GC ++  EV+  +P RRGIPHWK  
Sbjct  311   GLYFMYGIGGEGPRAERMVRALSGHAHNMAKAG--GCGVVAGEVAGGEPFRRGIPHWKML  368

Query  1181  SW-QDLWCI  1204
             S  +DLWCI
Sbjct  369   SCAEDLWCI  377



>ref|XP_010908252.1| PREDICTED: probable N-acetyltransferase HLS1 [Elaeis guineensis]
Length=400

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 245/415 (59%), Gaps = 35/415 (8%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEG-------KPR--------LVIDLLDDPIGRVRNA  274
             VR++  E D  AVEE+E QCEVG          K R        L +DLL DP+ RVR+ 
Sbjct  4     VREFNME-DSRAVEEMEKQCEVGPSATSTAGITKKRNKNKRTTSLYVDLLGDPMCRVRHT  62

Query  275   PLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLG  454
             P HVM+VAE+G  KE+VGVIR  ++ VSRG++  +     YV VAYILGLRVS  HRRLG
Sbjct  63    PDHVMLVAEYGEKKEMVGVIRACVKMVSRGREPTSQIPA-YVKVAYILGLRVSPSHRRLG  121

Query  455   IGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK  634
             IGTKLV+ +E W  + GA+Y YMATD SN AS+ LF+G L+YV+FR+P+VLV PVH H  
Sbjct  122   IGTKLVEKVEAWCLARGAEYAYMATDGSNVASLKLFSG-LSYVRFRSPAVLVHPVHAHHL  180

Query  635   PIGSDVAVVRVPPQLAESYYRRNFDGSS-EFFPKDINLVLNNKLNLGTFMAVPKESLSTW  811
             P  S   ++R+ P LA + Y  +   SS EF P D+  +L++ L LG+F+AVP       
Sbjct  181   PPSSSATLLRLSPTLAAALYSHHLPPSSTEFLPSDLPSLLSHPLTLGSFLAVPSSVSPPL  240

Query  812   EPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
                +   P + A+LS+WD   V+ ++V G  A  ++     R LD   PW+RLPSV ++ 
Sbjct  241   YSLTKALPESFAMLSLWDCTRVFHLRVAGAPAAARSALALLRFLDERAPWMRLPSVRDLF  300

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + FG YF++GLRM G  G  ++ +L   AHN+A  D   C  ++AEV   DPVR  +PHW
Sbjct  301   RPFGVYFMYGLRMAGPEGPRLLRALCHLAHNLAVAD-EACAAVVAEVGRHDPVRAAVPHW  359

Query  1172  KNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             + FSW +D+WC+                       +D I    S+ +IFVDPR+ 
Sbjct  360   RRFSWDEDVWCM--------------KRLKADTKDDDWIASPPSTDVIFVDPREF  400



>ref|XP_006295487.1| hypothetical protein CARUB_v10024591mg [Capsella rubella]
 gb|EOA28385.1| hypothetical protein CARUB_v10024591mg [Capsella rubella]
Length=413

 Score =   318 bits (816),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/381 (44%), Positives = 249/381 (65%), Gaps = 28/381 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             V VR+Y+  +D   VEE+E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE G  
Sbjct  6     VEVREYDPSKDLATVEEVERRCEVGPTGKLSLFTDLLGDPICRIRHSPSYLMLVAEIGTD  65

Query  311   -SKEIVGVIRGSIRSVSRG---------QKGKNDNSTD---YVDVAYILGLRVSSQHRRL  451
               KE+VG+IRG I++V+ G         Q  +ND  T    Y  +AYILGLRVS  HRR 
Sbjct  66    EKKELVGMIRGCIKTVTCGSTTKRLDLTQNVQNDVVTTKPLYTKLAYILGLRVSPTHRRQ  125

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
              IG KLV+++E+W   NGA+Y Y AT+  N AS+NLFTG   Y +FR PS+LV PV+ H+
Sbjct  126   RIGFKLVKAMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGYSEFRKPSILVNPVYAHR  185

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES----  799
               I   V ++++ P  AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S    
Sbjct  186   VNISRRVTIIKLDPTDAELLYRIRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGS  244

Query  800   -LSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWI  964
                +W P S  F    P + A+LS+W+  + ++++V+G S L++     TR++D+ +P++
Sbjct  245   GFGSW-PGSAKFLEYPPDSWAVLSVWNCNDSFRLEVRGASRLRRVLAKTTRLVDKTLPFL  303

Query  965   RLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDD  1144
             ++PS+P V + FG +F++G+  EG    +M+++L   AHN+A+    GC ++ AEV+  +
Sbjct  304   KIPSIPAVFRPFGLHFMYGIGGEGPCAEKMVKALCNHAHNMAKEG--GCSVVAAEVAGGE  361

Query  1145  PVRRGIPHWKNFSW-QDLWCI  1204
             P+RRGIPHWK  S  +DLWC+
Sbjct  362   PLRRGIPHWKVLSCAEDLWCM  382



>gb|KEH31526.1| acyl-CoA N-acyltransferase (NAT) superfamily protein [Medicago 
truncatula]
Length=411

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/379 (44%), Positives = 241/379 (64%), Gaps = 27/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V VR+++  +D+ +VE +E  CEVG  GK  L  DL  DPI RVRN+P  +M+VAE  I 
Sbjct  7     VNVREFDPNKDRESVEAVEKICEVGPSGKLSLFTDLHGDPICRVRNSPTFLMLVAE--IG  64

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD--------YVDVAYILGLRVSSQHRRLGI  457
              E VG+IRG I++V+ G+K     KN   T+        +  +AY+LGLRVS  HRR+GI
Sbjct  65    NETVGMIRGCIKTVTCGKKLTRPTKNSTETNQNSNHVPVFTKLAYVLGLRVSPNHRRMGI  124

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK-K  634
             G KLV+ +E W R NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV +H+ K
Sbjct  125   GLKLVEKMEQWFRENGAEYSYMATENDNVASVKLFTDKCGYSKFRTPSILVNPVFKHRLK  184

Query  635   PIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL----  802
                S   ++++ P  AE+ YR  F  ++EFFP+DI+ VL NKL LGTF+A+P++      
Sbjct  185   TSSSKTTILKLTPNDAETLYRYKFS-TTEFFPRDIDSVLKNKLTLGTFLAIPRDGKYGAG  243

Query  803   -STWEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRL  970
                W          P++ A++S+W+ K+V+ ++VKG S +++     TR++D+ +PW++L
Sbjct  244   SDNWSGSESFLMDPPSSWALVSVWNCKDVFTLEVKGASRVRRVLAKTTRLIDKALPWLKL  303

Query  971   PSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPV  1150
             PS+PN  K FG++ ++G+  EG    +M+++L  FAHN+A  +  GC  +  EVS  +P+
Sbjct  304   PSIPNFFKPFGFHLMYGIGGEGAEVLKMVKALCGFAHNLAMEN--GCSAVATEVSSCEPL  361

Query  1151  RRGIPHWKNFSW-QDLWCI  1204
             R  IPHWK  S  +DLWCI
Sbjct  362   RFAIPHWKVLSCEEDLWCI  380



>ref|XP_008236470.1| PREDICTED: probable N-acetyltransferase HLS1 [Prunus mume]
Length=416

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/383 (46%), Positives = 242/383 (63%), Gaps = 32/383 (8%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVG--QEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHG  307
             +V+R+ +  +D  +VEELE +CEVG    GK  L  DLL DPI R+RN+P  +M+VAE G
Sbjct  9     LVIRELDLNKDTRSVEELERKCEVGGSSSGKMSLFTDLLGDPICRIRNSPSFLMLVAEMG  68

Query  308   ISKEIVGVIRGSIRSVSRGQK------GKNDNSTDYVD---------VAYILGLRVSSQH  442
               KEIVG+IRG I+ V+ G+K      G  ++S +  D         +AYILGLRVS  H
Sbjct  69    PDKEIVGIIRGCIKIVTCGKKLIRSNNGIANSSNEDSDPKLEPICTKLAYILGLRVSHSH  128

Query  443   RRLGIGTKLVQSLENWGRSNGADYIYMATD----CSNQASINLFTGTLNYVKFRTPSVLV  610
             RR GIG KLV  +E W   NGA+Y YMAT+      N  S+NLFT   +Y KFRTPS+LV
Sbjct  129   RRRGIGLKLVNQMEEWFTRNGAEYSYMATEKLSFNDNMPSLNLFTKKCHYTKFRTPSILV  188

Query  611   QPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             QPV  H+    + V ++++ P  AE+ YR  F  ++EFFP+DI+ V+ NKLNLGTF+AVP
Sbjct  189   QPVFAHRVKTHNRVTIIKLSPPEAEALYRSRF-CTTEFFPQDIDRVVKNKLNLGTFLAVP  247

Query  791   KESLSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIP  958
               +  +W P    F    P + A+LS W+ KEV+ +++KG S  ++     TRV+DR IP
Sbjct  248   --TGFSW-PGLAEFLFEPPESWAVLSAWNCKEVFTLEIKGASLARRFAAKATRVVDRAIP  304

Query  959   WIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP  1138
             W+R+PSVP V + FG  FL+GL  +G    +M+E+L   AHN+AR    GC ++  EV+ 
Sbjct  305   WLRIPSVPEVFRPFGLVFLYGLGGQGPRAGKMVEALCGHAHNMARE--LGCGVVATEVAS  362

Query  1139  DDPVRRGIPHWKNFSW-QDLWCI  1204
              +P+R  IPHWK  S  +D+WCI
Sbjct  363   QEPLRLAIPHWKTLSCAEDMWCI  385



>ref|XP_010547548.1| PREDICTED: probable N-acetyltransferase HLS1 [Tarenaya hassleriana]
Length=386

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/364 (46%), Positives = 233/364 (64%), Gaps = 20/364 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+E  D    E LE  C VG      L +DL+ DP+ R+R +P   M+VAE G  
Sbjct  8     VVVREYDENTDLEKAEALEKSCAVGS-----LSVDLMGDPLARIRQSPSFHMLVAEIGYE  62

Query  314   -KEIVGVIRGSIRSVSRGQKG------KNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLV  472
              KEIVG+IRGSI++V+ G             S +   +A++ GLRVS  +RR+GIG KLV
Sbjct  63    RKEIVGMIRGSIKTVTCGNIAPFHRLQDGGVSPESTKLAFVSGLRVSPFYRRVGIGLKLV  122

Query  473   QSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDV  652
             Q LE W R NGA Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  I   V
Sbjct  123   QRLEEWFRRNGAVYAYVQTESDNDASVKLFTDKCGYSKFRTPTFLVNPVFNHRVTISRRV  182

Query  653   AVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF  832
              ++R+ P  AE  YR  F  S+EFFP DI  +LNNKL+LGTF+AVP+   ST     G +
Sbjct  183   TIIRLAPSEAEILYRSRFS-STEFFPSDIGTILNNKLSLGTFLAVPRGEYST-----GSW  236

Query  833   PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
             P + A+LS+W++KEVY++QV+G S  K+     TR++D  +P++++PS P+V + F  +F
Sbjct  237   PESWAVLSVWNSKEVYRLQVRGTSRFKRTLAKTTRLVDGALPFLKIPSFPDVFRPFSMHF  296

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQD  1192
             L+G+  EG   +EM+E+L + AHN+AR  + GC ++ AEV+  +P+R GIPHWK  S +D
Sbjct  297   LYGIGGEGPRAAEMVEALCSHAHNLAR--KCGCAVVAAEVASCEPLRLGIPHWKVLSPED  354

Query  1193  LWCI  1204
             LWC+
Sbjct  355   LWCL  358



>emb|CDY50977.1| BnaA06g37730D [Brassica napus]
Length=390

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 244/374 (65%), Gaps = 33/374 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P  +M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPISRIRHSPSFLMLVAEIGTE  61

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTD-------YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G+K   ++ +        Y  +AY+LGLRVS  HRR G+G KL
Sbjct  62    KKEIVGMIRGCIKTVTCGKKLDLNHKSQNDIVKPLYTKLAYVLGLRVSPSHRRQGVGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W   NGA+Y Y+AT+  NQAS+NLFTG   Y +FR PS+LV PV+ HK      
Sbjct  122   VKMMEAWFMQNGAEYSYIATENENQASVNLFTGKCGYTEFRKPSILVNPVYAHKV-----  176

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
                      +++S YR  F+ ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  177   --------NVSQSLYRLRFN-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  227

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S L++     TRV+D+ +P+++LPS+P+
Sbjct  228   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASLLRRVVAKTTRVVDKTLPFLKLPSIPS  287

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A+    GC +L  EV+ ++P+RRGIP
Sbjct  288   VFKPFGLHFMYGIGGEGPRAAKMVKSLCGHAHNLAKGG--GCGVLATEVAGEEPLRRGIP  345

Query  1166  HWKNFSW-QDLWCI  1204
             HWK  S  +DLWCI
Sbjct  346   HWKVLSCEEDLWCI  359



>ref|XP_002306502.2| constitutive photomorphogenic 3 family protein [Populus trichocarpa]
 gb|EEE93498.2| constitutive photomorphogenic 3 family protein [Populus trichocarpa]
Length=396

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 241/378 (64%), Gaps = 32/378 (8%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             +++  +VVR+++  RD V VEE+E  CEVG  GK  L  DLL DPI RVRN+P  +M+VA
Sbjct  4     DRMDMMVVREFDPSRDVVGVEEVERSCEVGSSGKLSLFTDLLGDPICRVRNSPAFLMLVA  63

Query  299   EHGISKEIVGVIRGSIRSVSRGQK----GKNDNSTD------YVDVAYILGLRVSSQHRR  448
             E G   EIVG+IRG I++V+ G++     KN+ S        Y  VAYILGLR+      
Sbjct  64    EMG--GEIVGMIRGCIKTVTCGERISRRVKNNYSISNKPVPVYTKVAYILGLRL------  115

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
                  KLV  +E+W R NGA+Y YMAT+  N AS+ LFTG   Y  FRTPS+LV PV  H
Sbjct  116   -----KLVCQMEDWFRQNGAEYSYMATESDNHASVKLFTGKCGYSTFRTPSILVNPVFAH  170

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESL--  802
             +  + + + ++++ P  AE  YRR F  ++EFFP+DI+ VL NKLN+GTF+AVP++SL  
Sbjct  171   RVTVSNRITIIKLTPPDAELLYRRRF-ATTEFFPRDIDSVLENKLNVGTFLAVPRDSLRF  229

Query  803   STWEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
               W          P +  +LS+W+ K+V++++V+G S LK+     TR++D+  P+++LP
Sbjct  230   GLWAGSDHFLSDPPESWTVLSVWNCKDVFRLEVRGASRLKRTFAKTTRIVDKAFPFLKLP  289

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             SVP V + FG +F++GL  EG   ++MM++L    HN+AR    GC ++  EV+  +P++
Sbjct  290   SVPAVFRPFGLFFMYGLGGEGPRAAKMMKALCGHVHNLARES--GCGVVATEVANSEPLK  347

Query  1154  RGIPHWKNFSW-QDLWCI  1204
              GIPHWK  S  +DLWCI
Sbjct  348   LGIPHWKMLSCAEDLWCI  365



>ref|XP_006393946.1| hypothetical protein EUTSA_v10005629mg [Eutrema salsugineum]
 gb|ESQ31232.1| hypothetical protein EUTSA_v10005629mg [Eutrema salsugineum]
Length=389

 Score =   314 bits (804),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 240/369 (65%), Gaps = 26/369 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR Y+  RD   VEELE  CEVG      LV+DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VVVRDYDPNRDLRRVEELEKSCEVGS-----LVVDLMGDPLARIRQSPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRG------QKGKNDNSTDYVD---VAYILGLRVSSQHRRLGIGTK  466
              EIVG+IRG+I+ V+RG       + K+D  +  +    +A++ GLRVS+ +RR+GIG K
Sbjct  61    NEIVGMIRGTIKIVTRGGNALLDPRSKDDGVSPEISTTKLAFVSGLRVSTFYRRMGIGLK  120

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV  LE W R NGA Y Y+ T+  N AS+ LFT    Y K+RTP  LV PV  H+  +  
Sbjct  121   LVHRLEEWFRLNGAVYAYVQTENDNTASVKLFTEKSGYSKYRTPVFLVNPVFNHRVTVSR  180

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES--LSTWEPD  820
              V +V++ P  AES YR  F  S+EFFP DIN +L NKL+LGTF+A+P+ S  +S + PD
Sbjct  181   RVKIVKLDPSDAESLYRHRFS-STEFFPSDINSILTNKLSLGTFLALPRGSDYVSGYSPD  239

Query  821   SGVFPTNH-AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
                 PT   A++SIW++K+VY++QV+G S LK+     TRVLD    ++++PS PN+ K 
Sbjct  240   ----PTGSWAVISIWNSKDVYRLQVQGTSRLKRTLAKTTRVLDGAFQFLKIPSFPNLFKP  295

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             F  +FL+G+  EG   +EM+E+L + AHN+AR  + GC ++ AEV+  +P+R GIPHWK 
Sbjct  296   FAMHFLYGIGGEGPRAAEMVEALCSHAHNIAR--KSGCAVVAAEVACCEPLRVGIPHWKA  353

Query  1178  FSWQDLWCI  1204
              S +DLWC+
Sbjct  354   LSPEDLWCL  362



>ref|XP_010464048.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=388

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 231/363 (64%), Gaps = 18/363 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ +RD   VEELE  CEVG      L++DL+ DP+ R+R  P   M+VAE  I 
Sbjct  8     VVVREYDPKRDLTRVEELEESCEVGS-----LLVDLMGDPLARIRQCPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRG-----QKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+RG     Q+           +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  61    NEIVGMIRGTIKMVTRGGNALRQEDGVSPGISTTKLAFVSGLRVSPFYRRMGIGLKLVQR  120

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W   NGA Y YM T+  N AS+ LFT    Y KFRTP+ LV PV  H+  +   V +
Sbjct  121   LEEWFIQNGAVYSYMQTENDNTASVKLFTEKSGYSKFRTPAFLVNPVFNHRVTVSRRVKI  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             +++ P  AES YR  F  S+EFFP DIN +L NKL LGT+MAVP+       P S   P+
Sbjct  181   IKLTPSDAESLYRNRFS-STEFFPSDINSILTNKLCLGTYMAVPRNEHHV--PGSLPDPS  237

Query  839   NH-AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
                A++SIW++K+VY++QVKG S LK+     TRV D   P +++PS PN+ K+F  +F+
Sbjct  238   GSWAVISIWNSKDVYRLQVKGTSRLKRILAKTTRVFDGAFPLLKIPSFPNLFKSFAMHFM  297

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDL  1195
             +G+   G   +EM+ESL + AHN+AR  + GC +L AEV+  +P+R GIPHWK  S +DL
Sbjct  298   YGIGGGGPRAAEMVESLCSHAHNLAR--KSGCSVLAAEVASCEPLRVGIPHWKVLSPEDL  355

Query  1196  WCI  1204
             WC+
Sbjct  356   WCL  358



>emb|CDX75665.1| BnaA01g00370D [Brassica napus]
Length=391

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 174/374 (47%), Positives = 243/374 (65%), Gaps = 32/374 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
              VVR+Y+  RD   VE++E +CEVG  GK  L  DLL DPI R+R++P  +M+VAE G  
Sbjct  2     TVVREYDPSRDLAGVEDVERRCEVGPSGKLSLFTDLLGDPISRIRHSPSFLMLVAETGTE  61

Query  314   -KEIVGVIRGSIRSVSRGQK----GKNDNSTD---YVDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG I++V+ G+K     K+ N T    Y  +AY+LGLRVS  HRR GIG KL
Sbjct  62    EKEIVGMIRGCIKTVTCGKKLDLNHKSQNDTVKPLYTKLAYVLGLRVSPSHRRQGIGFKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V+ +E W   NGA+Y Y+AT+  NQAS+NLFTG   Y +FR PS+LV PV+ HK      
Sbjct  122   VKMMEAWFMQNGAEYSYIATENENQASVNLFTGKCGYSEFRKPSILVNPVYAHK------  175

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGV  829
             V V R       S YR  F  ++EFFP+DI+ VLNNKL+LGTF+AVP+ S       S  
Sbjct  176   VNVSR------RSLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP  228

Query  830   F--------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
                      P + A+LS+W+ K+ ++++V+G S  ++     TRV+D+ +P+++LPS+P 
Sbjct  229   GSAKFLEYPPESWAVLSVWNCKDSFRLEVRGASLWRRVVAKTTRVVDKTLPFLKLPSIPP  288

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             V K FG +F++G+  EG   ++M++SL   AHN+A+  R GC +L  EV+ ++P++RGIP
Sbjct  289   VFKPFGLHFMYGIGGEGPRAAKMVKSLCGHAHNLAK--RGGCGVLATEVAGEEPLQRGIP  346

Query  1166  HWKNFSWQ-DLWCI  1204
             HWK  S Q DLWCI
Sbjct  347   HWKVLSCQEDLWCI  360



>ref|XP_009780713.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X1 [Nicotiana 
sylvestris]
Length=419

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 176/384 (46%), Positives = 249/384 (65%), Gaps = 31/384 (8%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+++ ++D   VEE+E +CEVG  GK  L   LL DPI RVR++P ++M+VAE  + 
Sbjct  9     IVVREFDAKKDCREVEEVERRCEVGPSGKLSLFTHLLGDPICRVRHSPAYLMLVAEIVVH  68

Query  311   ------SKEIVGVIRGSIRSVSRGQKGKND--NSTD-----------YVDVAYILGLRVS  433
                    + IVG+IRG I++V+ G+K   +  NS+D           +  +AYILGLRVS
Sbjct  69    NGENEKKRAIVGMIRGCIKTVTCGKKLSRNAKNSSDSIKPHPQPLPLFTKLAYILGLRVS  128

Query  434   SQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
               HRR+GIG KLV  +E W R NGA+Y Y+AT+  NQASI LFT    Y KFRTPS+LVQ
Sbjct  129   PSHRRMGIGLKLVCEMEEWFRVNGAEYSYIATENDNQASIKLFTHKCGYSKFRTPSILVQ  188

Query  614   PVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK  793
             PV  H+  + S V ++++ P  AE+ YRR F  ++EFFP+DI+ +L NKLNLGTF+AVPK
Sbjct  189   PVFAHRARVSSRVTIIKLSPTDAETLYRRRFS-TTEFFPRDIDSILYNKLNLGTFLAVPK  247

Query  794   --ESLSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLI  955
                S  TW P    F    P + A+LS+W+ K+V+ ++V+G S + Q     TR++DR  
Sbjct  248   GHYSAQTW-PGVDEFLASQPQSWAVLSVWNCKDVFNLEVRGASRMTQILAKTTRLVDRAF  306

Query  956   PWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVS  1135
             PW+++PSVP V + FG +FL+GL  EG    ++ +SL  FAHN+A+  R  C ++  EV+
Sbjct  307   PWLKVPSVPEVFRPFGLHFLYGLGGEGPLAEKLTKSLCDFAHNLAKESR--CSVVATEVA  364

Query  1136  PDDPVRRGIPHWKNFSW-QDLWCI  1204
               +P+R  IPHWK  S  +DLWC+
Sbjct  365   SREPLRLAIPHWKKLSCAEDLWCM  388



>ref|NP_201544.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis 
thaliana]
 dbj|BAB09028.1| N-acetyltransferase hookless1-like protein [Arabidopsis thaliana]
 gb|AAO64922.1| At5g67430 [Arabidopsis thaliana]
 dbj|BAE99418.1| N-acetyltransferase hookless1-like protein [Arabidopsis thaliana]
 gb|AED98343.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis 
thaliana]
 dbj|BAP16476.1| N-acetyltransferase hookless1-like protein [Cloning vector pTACAtg1]
Length=386

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/364 (45%), Positives = 238/364 (65%), Gaps = 20/364 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ +RD  +VEELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VVVREYDPKRDLTSVEELEESCEVGS-----LLVDLMGDPLARIRQSPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRG-----QKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+RG     Q        +   +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  61    NEIVGMIRGTIKMVTRGVNALRQADDVSPEINTTKLAFVSGLRVSPFYRRMGIGLKLVQR  120

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W   N A Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  +   V +
Sbjct  121   LEEWFLRNDAVYSYVQTENDNIASVKLFTEKSGYSKFRTPTFLVNPVFNHRVTVSRRVKI  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVF  832
             +++ P  AES YR  F  ++EFFP DIN +L NKL+LGT++AVP+  +++S   PD    
Sbjct  181   IKLAPSDAESLYRNRFS-TTEFFPSDINSILTNKLSLGTYLAVPRGGDNVSGSLPDQ---  236

Query  833   PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
               + A++SIW++K+VY++QVKG S LK+     TRV D   P++++PS PN+ K+F  +F
Sbjct  237   TGSWAVISIWNSKDVYRLQVKGASRLKRMLAKSTRVFDGAFPFLKIPSFPNLFKSFAMHF  296

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQD  1192
             ++G+  EG   +EM+E+L + AHN+AR  + GC ++ AEV+  +P+R GIPHWK  S +D
Sbjct  297   MYGIGGEGPRAAEMVEALCSHAHNLAR--KSGCAVVAAEVASCEPLRVGIPHWKVLSPED  354

Query  1193  LWCI  1204
             LWC+
Sbjct  355   LWCL  358



>ref|XP_006282234.1| hypothetical protein CARUB_v10028507mg [Capsella rubella]
 gb|EOA15132.1| hypothetical protein CARUB_v10028507mg [Capsella rubella]
Length=382

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 232/362 (64%), Gaps = 23/362 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ +RD   VEELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  9     VVVREYDPKRDLTRVEELEESCEVGS-----LLVDLMGDPLARIRQSPSFHMLVAE--IG  61

Query  314   KEIVGVIRGSIRSVSRG-----QKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+RG     Q+           +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  62    NEIVGMIRGTIKMVTRGGNALRQEDGVSPEISTTKLAFVSGLRVSPFYRRMGIGLKLVQR  121

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W   NGA Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  +   V +
Sbjct  122   LEEWFLRNGAVYSYVQTENDNTASVKLFTEKSGYSKFRTPAFLVNPVFNHRVTVSRRVNI  181

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT  838
             +++ P  AES YR  F  S+EFFP DIN +L NKL LGT+MAVP+             P 
Sbjct  182   IKLAPSEAESLYRDRFS-STEFFPSDINSILTNKLCLGTYMAVPR--------GEDHLPG  232

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             + A++SIW++K+VY++QVKG S LK+     TRV D  +P++++PS PN+ K+F  +F++
Sbjct  233   SWAVISIWNSKDVYRLQVKGASRLKRILAKTTRVFDGALPFLKIPSFPNLFKSFAMHFMY  292

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLW  1198
             G+   G   +EM+E+L + AHN+AR  + GC +L AEV+  +P++ GIPHWK  S +DLW
Sbjct  293   GIGGGGPRAAEMVEALCSHAHNLAR--KSGCSVLAAEVASCEPLKVGIPHWKVLSPEDLW  350

Query  1199  CI  1204
             C+
Sbjct  351   CL  352



>ref|XP_010484497.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=388

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 232/364 (64%), Gaps = 20/364 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ +RD   VEELE  CEVG      L++DL+ DP+ R+R  P   M+VAE  I 
Sbjct  8     VVVREYDPKRDLTRVEELEESCEVGS-----LLVDLMGDPLARIRQCPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRG-----QKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+RG     Q+           +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  61    NEIVGMIRGTIKMVTRGGNALRQEDGVSPEISTTKLAFVSGLRVSPFYRRMGIGLKLVQR  120

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W   NGA Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  +   V +
Sbjct  121   LEEWFLRNGAVYSYVQTENDNTASVKLFTEKSGYSKFRTPAFLVNPVFNHRVTVSRRVKI  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVF  832
             +++ P  AES YR  F  S+EFFP DIN +L NKL LGT+MAVP+    +    PD    
Sbjct  181   IKLTPSDAESLYRNRFS-STEFFPSDINSILTNKLCLGTYMAVPRGEHHVPGSLPDQA--  237

Query  833   PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
               + A++SIW++K+VY++QVKG S LK+     TRV D   P++++PS PN+ K+F  +F
Sbjct  238   -GSWAVISIWNSKDVYRLQVKGTSRLKRILAKTTRVFDGAFPFLKIPSFPNLFKSFAMHF  296

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQD  1192
             ++G+   G   +EM+ESL + AHN+AR  + GC +L AEV+  +P+R GIPHWK  S +D
Sbjct  297   MYGIGGGGPRAAEMVESLCSHAHNLAR--KSGCSVLAAEVASCEPLRVGIPHWKVLSPED  354

Query  1193  LWCI  1204
             LWC+
Sbjct  355   LWCL  358



>ref|XP_010099607.1| hypothetical protein L484_003680 [Morus notabilis]
 gb|EXB80038.1| hypothetical protein L484_003680 [Morus notabilis]
Length=420

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/387 (44%), Positives = 251/387 (65%), Gaps = 33/387 (9%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQE--GKPRLVIDLLDDPIGRVRNAPLHVMMVAE-  301
             ++ VR+++ ++D  AVE+LE +CE      GK  L  DLL DPI R+R++P  +M+VAE 
Sbjct  7     KLTVREFDIDKDIPAVEDLEKRCETTASSGGKMSLFTDLLGDPICRIRHSPSFLMLVAEL  66

Query  302   HGISKEIVGVIRGSIRSVSRGQK-----------GKNDNSTDYV-------DVAYILGLR  427
              G+ KEIVGVIRG I++V+ G+K            ++D+S + V        +AYILGLR
Sbjct  67    GGVEKEIVGVIRGCIKTVTCGKKLSRVNGIITASEQDDHSDNKVIITPVCTKLAYILGLR  126

Query  428   VSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVL  607
             VS  HRR GIG+KL+  +E+W R NGA+Y YMAT+  N+ S++LF    +Y KFRTP++L
Sbjct  127   VSPFHRRKGIGSKLINQMEDWFRKNGAEYSYMATELDNKPSLSLFIKRCHYTKFRTPAIL  186

Query  608   VQPVHRHKKPIGSD-VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA  784
             VQPV  H+    S+ V ++++ P  AE+ YRR F  ++EFFP DI+ +L+NKLNLGT++A
Sbjct  187   VQPVFAHRVKTNSNRVTIIKLTPADAETIYRRRF-SATEFFPHDIDRILHNKLNLGTYVA  245

Query  785   VPKE--SLSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLD  946
             VP E  S+ +W P    F    P + AI+S+W+ KEV+ +Q+KG S  ++     TRV+D
Sbjct  246   VPAESDSVESW-PGLAEFLCDPPESWAIMSVWNCKEVFTLQIKGASFSRRLAAKTTRVVD  304

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIA  1126
               +PW+R+PSVP+V + FG   ++GL  EG     M+++L   AHNVA+  R  C ++  
Sbjct  305   GALPWLRIPSVPDVFRPFGMLVMYGLGGEGPRAERMVKALCGHAHNVAKELR--CGVVAT  362

Query  1127  EVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             EV+  DP+R  IPHW+  S  +D+WC+
Sbjct  363   EVASQDPLRLAIPHWERLSCAEDVWCV  389



>ref|XP_009629747.1| PREDICTED: probable N-acetyltransferase HLS1 [Nicotiana tomentosiformis]
Length=419

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/384 (46%), Positives = 252/384 (66%), Gaps = 31/384 (8%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE----  301
             +VVR+++ ++D   VEE+E +CEVG  GK  L  DLL DPI RVR++P ++M+VAE    
Sbjct  9     IVVREFDAKKDCREVEEVERRCEVGPSGKLSLFTDLLGDPICRVRHSPAYLMLVAEIVVH  68

Query  302   HGISKE---IVGVIRGSIRSVSRGQK----GKNDNSTD---------YVDVAYILGLRVS  433
             +G ++E   IVG+IRG I++V+ G+K     KN + +          +  +AYILGLRVS
Sbjct  69    NGENEEERAIVGMIRGCIKTVTCGKKLSRNAKNSSVSTKPHPQPLPIFTKLAYILGLRVS  128

Query  434   SQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
               HRR+GIG KLV  +E W R NGA+Y Y+AT+  NQASI LFT    Y KFRTPS+LVQ
Sbjct  129   PSHRRMGIGLKLVCEMEEWFRVNGAEYSYIATENDNQASIKLFTNKCGYSKFRTPSILVQ  188

Query  614   PVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK  793
             PV  H+  + S V ++++ P  AE+ YRR F  ++EFFP+DI+ +L NKLNLGTF+AVPK
Sbjct  189   PVFAHRARVSSRVTIIKLSPTDAETLYRRRFS-TTEFFPRDIDSILYNKLNLGTFLAVPK  247

Query  794   --ESLSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLI  955
                S  TW P    F    P + A+LS+W+ K+V+ ++V+G S + +     TR++DR  
Sbjct  248   GLYSAQTW-PGVDEFLASQPESWAVLSVWNCKDVFNLEVRGASRMTKILAKTTRIVDRAF  306

Query  956   PWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVS  1135
             PW+++PSVP V + FG +FL+GL  +G    ++ +SL  FAHN+A+  R  C ++  EV+
Sbjct  307   PWLKVPSVPEVFRPFGLHFLYGLGGKGPLAEKLTKSLCDFAHNLAKESR--CSVVATEVA  364

Query  1136  PDDPVRRGIPHWKNFSW-QDLWCI  1204
               +P+R  IPHWK  S  +DLWC+
Sbjct  365   NREPLRLAIPHWKKLSCAEDLWCM  388



>ref|XP_010444648.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=388

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 231/364 (63%), Gaps = 20/364 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ +RD   VEELE  CEVG      L++DL+ DP+ R+R  P   M+VAE  I 
Sbjct  8     VVVREYDPKRDLTRVEELEESCEVGS-----LLVDLMGDPLARIRQCPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRG-----QKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+R      Q+           +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  61    NEIVGMIRGTIKMVTRSGNALRQEDGVSPEISTTKLAFVSGLRVSPFYRRMGIGLKLVQR  120

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W   NGA Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  I   V +
Sbjct  121   LEEWFLRNGAVYSYVQTENDNTASVKLFTEKSGYSKFRTPAFLVNPVFNHRVTISRRVKI  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVF  832
             +++ P  AES YR  F  S+EFFP DIN +L NKL LGT+MAVP+    +    PD    
Sbjct  181   IKLTPSDAESLYRNRFS-STEFFPSDINSILTNKLCLGTYMAVPRGEHHVPGSLPDQA--  237

Query  833   PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
               + A++SIW++K+VY++QVKG S LK+     TRV D   P++++PS PN+ K+F  +F
Sbjct  238   -GSWAVISIWNSKDVYRLQVKGTSRLKRILAKTTRVFDGAFPFLKIPSFPNLFKSFAMHF  296

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQD  1192
             ++G+   G   +EM+ESL + AHN+AR  + GC +L AEV+  +P+R GIPHWK  S +D
Sbjct  297   MYGIGGGGPRAAEMVESLCSHAHNLAR--KSGCSVLAAEVASCEPLRVGIPHWKVLSPED  354

Query  1193  LWCI  1204
             LWC+
Sbjct  355   LWCL  358



>ref|XP_004231914.1| PREDICTED: probable N-acetyltransferase HLS1 [Solanum lycopersicum]
Length=417

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 244/380 (64%), Gaps = 27/380 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE----  301
             +VVR+++ + D   VEE+E +CEVG  GK  L  DLL DPI RVRN+P ++M+VAE    
Sbjct  11    IVVREFDAKNDSKEVEEVERRCEVGPGGKLSLYTDLLGDPICRVRNSPAYLMLVAEIVVH  70

Query  302   --HGISKEIVGVIRGSIRSVSRGQKGKND---NSTD-------YVDVAYILGLRVSSQHR  445
                   K IVG+IRG I++V+ G K       NS+D       +  +AYILGLRVS  HR
Sbjct  71    NGQNEEKSIVGMIRGCIKTVTCGTKLSRSGVKNSSDSAKPLPIFTKLAYILGLRVSPAHR  130

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
             R+GI  KLV  +E W R NGA+Y Y+AT+  NQASINLF     Y KFRTPS+LVQPV  
Sbjct  131   RMGIALKLVCGMEEWFRGNGAEYSYIATENDNQASINLFNHKCGYSKFRTPSILVQPVFA  190

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ES  799
             H+  + S V ++++ P  AE+ YRR +  ++EFFP+DI+ VLNN LNLGTF+AVPK   S
Sbjct  191   HRVRVSSRVTILKLHPTDAETLYRRRYS-TTEFFPRDIDSVLNNPLNLGTFLAVPKGLYS  249

Query  800   LSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
               TW P    F    P + A+LS+W+ K+V+ ++V+G S + +     TR++DR  PW++
Sbjct  250   AETW-PGVEDFLVHPPESWALLSVWNCKDVFNLEVRGASRMTKFLAKTTRLVDRAFPWLK  308

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             LPSVP V K FG +FL+GL  EG    + M+SL  FAHN+A+     C ++  EV+  +P
Sbjct  309   LPSVPEVFKPFGLHFLYGLGGEGPLSVKFMKSLCDFAHNLAKESE--CSVVATEVASGEP  366

Query  1148  VRRGIPHWKNFSW-QDLWCI  1204
             +R  IPHWK  S  +DLWC+
Sbjct  367   LRLAIPHWKKLSCAEDLWCM  386



>ref|XP_009386825.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=408

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/417 (42%), Positives = 249/417 (60%), Gaps = 31/417 (7%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVG---------QEGKPR---LVIDLLDDPIGRVRNAPLH  283
             VR+++ E+D  AVEE+ES+CEVG         ++ K R   L +DLL DP+ RVR+AP H
Sbjct  4     VREFDVEKDLKAVEEMESRCEVGPTDAGAGSNKKKKKRSMSLYVDLLGDPLCRVRHAPDH  63

Query  284   VMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGT  463
             VM+VAE+G  KE+VGVIR  I+ V+RG+         YV +AYILGLRVS  HRRLGIGT
Sbjct  64    VMLVAEYGEKKEMVGVIRACIKMVTRGRTSSGFLPA-YVRIAYILGLRVSPFHRRLGIGT  122

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
             KLV+ +E W  + GA+Y YMATD +N AS+NLFT  L+Y +FR+P +L  PVH H  P+ 
Sbjct  123   KLVERVELWCAARGAEYAYMATDPANSASLNLFTRRLSYSRFRSPVLLAHPVHSHLLPLS  182

Query  644   SDVAVVRVPPQLAESYYRRNFDGSS-EFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPD  820
               VAV+R+PP  A + Y R    S+ EF P D+  +L++ L L TF+A+P  S ++    
Sbjct  183   PSVAVLRLPPSAAIALYSRLLPPSAVEFLPSDLPTLLSHDLTLSTFLAIPSSSSASSVIT  242

Query  821   SGVF-----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPN  985
             +  F     P++ AI+S+WD+  V +++V G     +A     R +D   PW+R+PS+ +
Sbjct  243   TNAFSLSDLPSSFAIMSLWDSTRVLRLRVAGAPPAARAALALLRTVDARAPWMRVPSIRD  302

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
             + + FG Y ++GL M G  G  +M SL   AHN A  D   C  ++AE+   DPVR  +P
Sbjct  303   IFRPFGVYIMYGLHMAGPEGPRLMRSLCRLAHNAAVAD-ENCAAVVAELGRGDPVRAAVP  361

Query  1166  HWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             HWK FS  +D+WC+             +         +D +    ++ +IFVDPR+ 
Sbjct  362   HWKRFSCEEDVWCM----------KRLRGGGDDAIHGDDWLASPPTTDVIFVDPREF  408



>ref|XP_002866703.1| hypothetical protein ARALYDRAFT_358814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42962.1| hypothetical protein ARALYDRAFT_358814 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 165/364 (45%), Positives = 236/364 (65%), Gaps = 20/364 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ +RD  +V+ELE  CEVG      L++DL+ DP+ R+R +P   M+VAE  I 
Sbjct  8     VVVREYDPKRDLTSVKELEESCEVGS-----LLVDLMGDPLARIRQSPSFHMLVAE--IG  60

Query  314   KEIVGVIRGSIRSVSRG-----QKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              EIVG+IRG+I+ V+RG     Q G          +A++ GLRVS  +RR+GIG KLVQ 
Sbjct  61    NEIVGMIRGTIKMVTRGGNALRQAGGVLPEISTTKLAFVSGLRVSPFYRRMGIGLKLVQR  120

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W   NGA Y Y+ T+  N AS+ LFT    Y KFRTP+ LV PV  H+  +   V +
Sbjct  121   LEEWFLRNGAVYSYVQTENDNTASVKLFTEKSGYSKFRTPTFLVNPVFNHRVTVSRRVKI  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVF  832
             +++ P  AES YR  F   +EFFP DIN +L NKL+LGT++AVP+  + +S   PD    
Sbjct  181   IKLTPYDAESLYRSRFS-FTEFFPSDINSILTNKLSLGTYLAVPRGEDHVSGSLPDQ---  236

Query  833   PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
               + A++SIW++K+VY++QVKG S LK+     TRV D   P++++PS PN+ K+F  +F
Sbjct  237   TGSWAVISIWNSKDVYRLQVKGASRLKRTLAKITRVFDGAFPFLKIPSFPNLFKSFAMHF  296

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQD  1192
             ++G+  EG   +EM+E+L + AHN+AR  + GC ++ AEV+  +P+  GIPHWK  S +D
Sbjct  297   MYGIGGEGPRAAEMVEALCSHAHNLAR--KSGCAVVAAEVASCEPLSVGIPHWKVLSPED  354

Query  1193  LWCI  1204
             LWC+
Sbjct  355   LWCL  358



>ref|XP_004981660.1| PREDICTED: uncharacterized protein LOC101754705 [Setaria italica]
Length=400

 Score =   309 bits (792),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 164/367 (45%), Positives = 223/367 (61%), Gaps = 17/367 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQ--EGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHG  307
             VVVR+Y+  RD+  VE +E  CEVG    GK  L  DLL DP+ R+R++P  +M+VAE  
Sbjct  10    VVVREYDSARDRRGVEAVERACEVGSCGGGKMCLFTDLLGDPLCRIRHSPASLMLVAEIA  69

Query  308   I-----SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLV  472
                   S EI G++RG +++V  G    ND    +  V Y+LGLRVS +HRR G+G KLV
Sbjct  70    TGPNTNSTEIAGLVRGCVKTVVSGTTQAND--PIHTKVGYVLGLRVSPRHRRKGVGKKLV  127

Query  473   QSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDV  652
               +E W R  GA+Y YMAT+  N+AS+ LFTG   Y KFRTPSVLV PV  H        
Sbjct  128   DRMEEWFRQTGAEYSYMATEQDNEASVRLFTGRCGYAKFRTPSVLVHPVFGHALRPSRSA  187

Query  653   AVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF  832
             A+VR+ P+ AE  YR  F G  EFFP DI+ VL+N L+LGTF+AVP  +   WE      
Sbjct  188   AIVRLEPREAELLYRWRFAG-VEFFPADIDAVLSNDLSLGTFLAVP--AGERWEGVEAFL  244

Query  833   ---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFG  1003
                P + A+LS+W+  + ++++V+G   L +A    TR++DR  PW+ +PS+PN+   FG
Sbjct  245   ASPPASWAVLSVWNCMDAFRLEVRGAPRLMRAAAGATRLVDRAAPWLGIPSIPNLFAPFG  304

Query  1004  YYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS  1183
              YFL+GL   G     +  +L   AHN+AR+   GC ++  EVS  +PVR G+PHW    
Sbjct  305   LYFLYGLGGAGADAPRLARALCRHAHNMARDG--GCGVVATEVSACEPVRAGVPHWARLG  362

Query  1184  WQDLWCI  1204
              +DLWCI
Sbjct  363   AEDLWCI  369



>ref|XP_009398287.1| PREDICTED: probable N-acetyltransferase HLS1 [Musa acuminata 
subsp. malaccensis]
Length=431

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 242/383 (63%), Gaps = 30/383 (8%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKP-RLVIDLLDDPIGRVRNAPLHVMMVAE---HG  307
             +R+YE ERD+V VE +E +CEVG  G    L  DLL DP+ RVR++P  +M+VAE     
Sbjct  20    IREYEAERDRVGVEAVERRCEVGPSGGGMSLFTDLLGDPLCRVRHSPPFLMLVAEVICGS  79

Query  308   ISKEIVGVIRGSIRSVSRGQKGKNDNSTD------------------YVDVAYILGLRVS  433
              S+EIVG++RG I++V+ G +  +  S+                   Y  VAY+LGLRVS
Sbjct  80    ESREIVGIVRGCIKTVACGARKPHRGSSTTTAPLTSLAKHHTAPSPIYAKVAYLLGLRVS  139

Query  434   SQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
               HRR GIG KLV+ +E W +  GA+Y YMAT+  N+ASI LF G   Y KFRTP++LVQ
Sbjct  140   PAHRRRGIGLKLVERMEEWFKEKGAEYAYMATEKDNEASIRLFMGRCGYSKFRTPAILVQ  199

Query  614   PVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK  793
             PV  H+  +   +A++R+P   AE+ YRR F  ++EFFP+DI+ VL N L+LGTF+AVP 
Sbjct  200   PVFAHRLTLPRAIAIIRLPAADAEALYRRRF-AATEFFPRDIDAVLANPLSLGTFLAVPA  258

Query  794   ESLST--WEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIP  958
                +   WE         P++ A+ S+W++KEV++++V+G    ++A  L +R +D  +P
Sbjct  259   GCAAAARWEGADAFLADPPSSWAVASVWNSKEVFRLEVRGAGRWRRALALASRAVDWALP  318

Query  959   WIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP  1138
             W+R+PSVP++ + FG Y ++GL  EG + +    ++   AHN+AR D  GC ++ AEV+ 
Sbjct  319   WLRIPSVPDLFRPFGMYLMYGLGGEGPAAAAYARAVCRHAHNMARTD-PGCRVVAAEVAA  377

Query  1139  DDPVRRGIPHWKNFSW-QDLWCI  1204
              +P+R GIPHW   S  +DLWC+
Sbjct  378   CEPLREGIPHWSRLSCAEDLWCV  400



>ref|XP_010550336.1| PREDICTED: probable N-acetyltransferase HLS1 [Tarenaya hassleriana]
Length=396

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 236/371 (64%), Gaps = 23/371 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+  RD   V ELE  C+VG      L++DL+ DP+ R+R +P   M+VAE G  
Sbjct  7     VVVREYDPNRDLEKVGELEKSCQVGS-----LLVDLMGDPLARIRQSPSFHMLVAEIGNE  61

Query  314   -KEIVGVIRGSIRSVSRGQKGKNDNSTDY-------VDVAYILGLRVSSQHRRLGIGTKL  469
              KEIVG+IRG+I+ V+RG    +D   +Y         +A++ GLRVS  +RR+GIG KL
Sbjct  62    HKEIVGMIRGTIKMVTRGNNAPSDRRREYAVDPPENTTLAFVSGLRVSPFYRRMGIGLKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             VQ LE W R N A Y Y+ T+ +N AS+ LFT    Y KFRTP+ LV PV  H+  +   
Sbjct  122   VQRLEEWFRRNDAVYAYLQTESNNDASVKLFTEKCGYSKFRTPTFLVHPVFNHRVAVSHR  181

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP--KESLSTWEPDS  823
             V+++R+ P  AE  Y   F  S+EFFP DI  +LNNKL+LGTF+A+P  K S  +W P S
Sbjct  182   VSIIRLTPSDAELLYLCRFS-STEFFPSDIGSILNNKLSLGTFLALPRGKYSARSW-PGS  239

Query  824   GVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
               F    P + AILS+W++K+VY++QV+G S  K+     +R LD   P++++PS P+V 
Sbjct  240   TEFLSEPPGSWAILSVWNSKDVYRLQVRGTSRFKRTLAKTSRFLDAAFPFLKIPSFPDVF  299

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + F  +F++G+  EG   +EM+E+L   AHN+A   + GC ++ +EV+  +P+R GIPHW
Sbjct  300   RPFAMHFMYGIGGEGPDAAEMVEALCCHAHNLA--GKNGCAVVASEVASCEPLRDGIPHW  357

Query  1172  KNFSWQDLWCI  1204
             K  S +DLWC+
Sbjct  358   KILSPEDLWCL  368



>ref|XP_006339812.1| PREDICTED: probable N-acetyltransferase HLS1-like [Solanum tuberosum]
Length=417

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 246/380 (65%), Gaps = 27/380 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI-  310
             +VVR+++ + D   VEE+E +CEVG  GK  L  DLL DPI RVRN+P ++M+VAE  + 
Sbjct  11    IVVREFDSKNDSKEVEEVERRCEVGPSGKLSLYTDLLGDPICRVRNSPAYLMLVAEIVVH  70

Query  311   -----SKEIVGVIRGSIRSVSRGQKGKND---NSTD-------YVDVAYILGLRVSSQHR  445
                   K IVG+IRG I++V+ G+K       N++D       +  +AYILGLRVS  HR
Sbjct  71    NGKNEEKSIVGMIRGCIKTVTCGKKLSRSGVKNTSDSTKPLPIFTKLAYILGLRVSPTHR  130

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
             R+GI  KLV  +E W R NGA+Y Y+AT+  NQASI LF     Y KFRTPS+LVQPV  
Sbjct  131   RMGIALKLVCGMEEWFRGNGAEYSYIATENDNQASIKLFNHKCGYSKFRTPSILVQPVFA  190

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ES  799
             H+  + + V ++++ P  AE+ YRR +  ++EFFP+DI+ VLNN LNLGTF+AVPK   S
Sbjct  191   HRVRVSTRVTIIKLNPTDAETLYRRRYS-TTEFFPRDIDSVLNNNLNLGTFLAVPKGLYS  249

Query  800   LSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
               TW P    F    P + A+LS+W+ K+V+ ++V+G S + +     TR++DR  PW++
Sbjct  250   AETW-PGVEDFLANPPESWALLSVWNCKDVFNLEVRGASRMTKFLAKTTRLVDRAFPWLK  308

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             +PSVP V K FG +FL+GL  EG    ++M+SL  FAHN+A+     C ++  EV+  +P
Sbjct  309   VPSVPEVFKPFGLHFLYGLGGEGPLSVKLMKSLCDFAHNLAKESE--CSVVATEVASGEP  366

Query  1148  VRRGIPHWKNFSW-QDLWCI  1204
             +R  IPHWK  S  +DLWC+
Sbjct  367   LRLAIPHWKKLSCAEDLWCM  386



>gb|EYU29636.1| hypothetical protein MIMGU_mgv1a019093mg, partial [Erythranthe 
guttata]
Length=387

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/360 (47%), Positives = 237/360 (66%), Gaps = 31/360 (9%)
 Frame = +2

Query  206   GQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI------------SKEIVGVIRGSIR  349
             G  GK  L  DLL DPI RVR++P ++M+VAE  +             +EIVG+IRG I+
Sbjct  1     GPSGKLSLYTDLLGDPICRVRHSPAYLMLVAETVVVDGGGGGAGENERREIVGMIRGCIK  60

Query  350   SVSRGQK-GKNDNSTD-------YVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNG  505
             +V+ G K  +N+N+            +AYILGLRVS  HRR+GIG KLV+ +E W   NG
Sbjct  61    TVTCGTKLTRNNNNCGNAKPLPLSTKLAYILGLRVSPLHRRMGIGVKLVRRMEAWFSENG  120

Query  506   ADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAE  685
             A+Y YMAT+  N AS+NLFT    Y KFRTPS+LV PV  H+  +   VAVV + P  AE
Sbjct  121   AEYSYMATENDNVASVNLFTHKCGYSKFRTPSILVHPVFAHRVRVDKRVAVVELGPADAE  180

Query  686   SYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE--SLSTWEPDSGVF----PTNHA  847
               YRR F  ++EFFP+DI+ VLNN+L+LGTF+AVP+   S ++W P +  F    P + A
Sbjct  181   VLYRRRFS-TTEFFPRDIDSVLNNRLSLGTFLAVPRRWCSAASW-PGAEEFLASPPESWA  238

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLR  1027
             ++SIW+ KEV++++V+G S +++A    TRV+DR+ PW+R+PSVP V + FG++FL+GL 
Sbjct  239   VISIWNCKEVFRLEVRGASRVRKAVAKTTRVVDRVFPWLRVPSVPEVFRPFGFHFLYGLG  298

Query  1028  MEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              EG +    +++L   AHN+A+   RGC ++  EV+  +P+R GIPHWK+ S  +DLWCI
Sbjct  299   GEGPNAVSYVKALCGVAHNLAKA--RGCGVVATEVAGREPLRLGIPHWKSLSCAEDLWCI  356



>ref|XP_010942830.1| PREDICTED: probable N-acetyltransferase HLS1 [Elaeis guineensis]
Length=412

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/379 (43%), Positives = 238/379 (63%), Gaps = 27/379 (7%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-HGI  310
             ++VR+Y+EERD++  E +E  CEVG  G+  L  D   DP+ RVR +P  +M+VAE  G 
Sbjct  5     IMVREYDEERDRLRAEAMERMCEVGPSGEMSLFTDHFGDPVSRVRRSPAFLMLVAETSGP  64

Query  311   SKEIVGVIRGSIRSVSRGQK----------GKNDN---STDYVDVAYILGLRVSSQHRRL  451
              KEIVG+IRGS++SV+ G+           GK++N   S  Y  VAYILGLRVS  +RR+
Sbjct  65    VKEIVGLIRGSVKSVTCGKAIPRNIGAVTAGKHENPLPSPIYTKVAYILGLRVSPFYRRM  124

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             GIG +LV+ LE W +  GA+Y YMATD  N+ASI LFTG   Y KFRTP++LV PV  H+
Sbjct  125   GIGLRLVRRLEEWFKVQGAEYAYMATDKDNEASIRLFTGRCGYSKFRTPAILVNPVFAHR  184

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--  805
              PI   + ++R+P   AES YR +F  ++EFFP+DI+ +L+N L+LGTF+AVP  +    
Sbjct  185   LPIPRRIRILRLPVADAESLYRCHFS-TTEFFPRDIDAILSNPLSLGTFLAVPVAATCGG  243

Query  806   ---TWEPDSGVFPT---NHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
                 W    G       + A++S+W+   V++++V+G S +++     TR  DR +PW+R
Sbjct  244   GEWKWPGTEGFLAAPLESWAVVSVWNCGGVFRLEVRGASRVRRGLAWATRAADRALPWLR  303

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             +PSVP++ + FG  FL+G+  EG   + M+ +L   +HN+ +         +A     +P
Sbjct  304   IPSVPDIFRPFGALFLYGIGGEGPEAAAMVAALCRHSHNMGKGTAGVVAAEVAVC---EP  360

Query  1148  VRRGIPHWKNFSW-QDLWC  1201
             +RRGIPHW+  S+ +DLWC
Sbjct  361   LRRGIPHWRRLSFAEDLWC  379



>ref|XP_004289797.1| PREDICTED: uncharacterized protein LOC101314232 [Fragaria vesca 
subsp. vesca]
Length=397

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 236/373 (63%), Gaps = 24/373 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +V+R+ ++  D   VEELE +CE G  G+  L  DLL DPI R+RN+P  +M+VAE G  
Sbjct  2     LVIRELDKNEDTQKVEELERRCEAGSCGEMSLFTDLLGDPICRIRNSPSFLMLVAEIGPG  61

Query  314   KEIVGVIRGSIRSVSRGQKGKNDNSTD--------YVDVAYILGLRVSSQHRRLGIGTKL  469
             KEIVG+IRG I+ VS GQ  +  ++ D           +AYILGLRVS  HRR GI  KL
Sbjct  62    KEIVGIIRGCIKVVSCGQHLRRPSNEDSDLKIEPICTKLAYILGLRVSPSHRRKGIALKL  121

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK-KPIGS  646
             V  +E W R NGA+Y YMAT+  N+ S+NLFT   NY KFRTPS+LVQPV  H+ K    
Sbjct  122   VNRMEEWFRRNGAEYSYMATELDNKPSLNLFTKKCNYTKFRTPSILVQPVFAHRVKTHRR  181

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTW-----  811
              + ++ + P  AE+ YRR    ++EFFP+DI+ ++ NK N GTF+AVP E L T      
Sbjct  182   QITIIELTPPEAETLYRRQL-SATEFFPQDIDRIVQNKHNAGTFLAVPTEYLWTGLDRFL  240

Query  812   -EPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
              +P     P + A++S W+ KEV+K+++KG S  ++     TR++D+ +PW+R+PSVP+V
Sbjct  241   SDP-----PESWAVMSAWNCKEVFKLEIKGASLARRLAAKATRMVDKALPWLRIPSVPDV  295

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
                FG  FL+GL  +GQ   +M + L   AHN+A+    GC +++ EV+  +P+R  IPH
Sbjct  296   FTPFGLLFLYGLGGQGQQADKMAKVLCGHAHNIAKE--LGCGVVVTEVASQEPLRSAIPH  353

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +D+WC+
Sbjct  354   WKRLSCAEDVWCM  366



>gb|EPS58026.1| hypothetical protein M569_16789 [Genlisea aurea]
Length=408

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 240/370 (65%), Gaps = 26/370 (7%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEV-GQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI---  310
             R+Y++E+D VAV + ES+ E  G  GK  L  D L DPI RVR++P  +M+VAE  +   
Sbjct  16    REYDDEKDSVAVGKAESRWESSGPCGKLSLQTDHLGDPICRVRHSPSRLMLVAEMVVVGG  75

Query  311   -----SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQ  475
                   +EIVG+IRG +++VS G  G        V VAY+LGLRVS  HRR+GIG  LV+
Sbjct  76    GEKEEKREIVGMIRGCVKNVSSGASG------SLVRVAYVLGLRVSPSHRRMGIGLNLVR  129

Query  476   SLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVA  655
              +E W   NGA++ YMAT+  N+ S++LFT    Y +FRTP++LVQPV  H+  I   VA
Sbjct  130   RMEKWFVENGAEFSYMATEKDNKPSMDLFTRRCGYEEFRTPALLVQPVFAHRLRIDRRVA  189

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEPDSGV  829
             V+ + P  AE  YRR F G  EFFP DI+ VLNN+LNLGTF+AVP+ S +  TW P +G 
Sbjct  190   VIELSPADAEVLYRRRFSG-VEFFPMDIDAVLNNRLNLGTFLAVPRGSYAAGTW-PGAGE  247

Query  830   F----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
             F      + A++S+W+ K+V++++V+G S +++A    TRV+DR  P +R+PSVP   + 
Sbjct  248   FLRRPAESWAVVSVWNCKDVFRLRVRGASRVRKALARTTRVVDRAFPCLRIPSVPEFFRP  307

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG +FL+GL   G + +++ ++L   AHN+A +   GC+++  E++  DP+R GIPHWK 
Sbjct  308   FGAHFLYGLGGCGPNAAKLTKALCCVAHNLAMDS--GCQVIATEIAAGDPLRAGIPHWKR  365

Query  1178  FSW-QDLWCI  1204
              S  +D WCI
Sbjct  366   LSCAEDQWCI  375



>gb|ACR61548.1| putative N-acetyltransferase, partial [Turnera subulata]
Length=339

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 226/342 (66%), Gaps = 25/342 (7%)
 Frame = +2

Query  227   LVIDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKND--NSTD--  394
             L  DLL DPI RVR++P  +M+VAE  I +EIVG+IRG I++V+ G+K   +  NST+  
Sbjct  1     LFTDLLGDPICRVRHSPAFLMLVAE--IGEEIVGMIRGCIKTVACGKKLSRNFRNSTNNN  58

Query  395   -----------YVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSN  541
                        Y   AYILGLRVS  HRR+GIG KLV  +E+W R NGA+Y YMAT+  N
Sbjct  59    KDSDPLKPLPIYTKAAYILGLRVSPSHRRMGIGLKLVHQMEDWFRQNGAEYSYMATENDN  118

Query  542   QASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSE  721
              AS+ LFT    Y KFRTPS+LV PV  H+  +   V V R+ P  AE  YRR F  ++E
Sbjct  119   DASVRLFTDKCGYSKFRTPSILVNPVFAHRVAVSHRVTVFRLSPHDAEHLYRRRF-ATTE  177

Query  722   FFPKDINLVLNNKLNLGTFMAVPKESLSTWE-PDSGVF----PTNHAILSIWDAKEVYKV  886
             FFP+DI+ VL+NKL+LGTF+AVP+ SL + E P SG F    P + A+LS+W+ K+V+++
Sbjct  178   FFPRDIDSVLSNKLSLGTFVAVPRGSLKSEEWPGSGKFLADPPESWAVLSVWNCKDVFRL  237

Query  887   QVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESL  1066
             +V+G S +K+     TR+LDR +P++RLPSVP + + FG +FL+GL  EG   ++M+ +L
Sbjct  238   EVRGASRVKRTFAKTTRLLDRALPFLRLPSVPELFRPFGLHFLYGLGGEGPRAAKMVRAL  297

Query  1067  WAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQD  1192
                AHN+A+    GC ++  EV+  +P++ GIPHWK  S  +
Sbjct  298   CDHAHNLAKEG--GCGVVATEVASREPLKLGIPHWKMLSCDE  337



>ref|XP_010028104.1| PREDICTED: probable N-acetyltransferase HLS1 [Eucalyptus grandis]
 ref|XP_010028105.1| PREDICTED: probable N-acetyltransferase HLS1 [Eucalyptus grandis]
 gb|KCW54767.1| hypothetical protein EUGRSUZ_I00714 [Eucalyptus grandis]
Length=419

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 234/388 (60%), Gaps = 35/388 (9%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VVVR+Y+ E+D+  V+ +E +CEVG   +  L  D + DPI RVRN P  +M+VAE G  
Sbjct  5     VVVREYDPEKDREKVDAVERECEVGPSEELSLYTDHMGDPICRVRNCPAFLMLVAEMGEE  64

Query  314   KEIVGVIRGSIRSVSRGQK--------------GKNDNSTD----------YVDVAYILG  421
             KEIVG+IRG I++V+ G++                   S D          Y  V YILG
Sbjct  65    KEIVGMIRGCIKTVTCGKRLCRNSKNINSNNNNNNTMASLDSCIPTKQVPVYTKVGYILG  124

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRV   +RR+GI +KLV+ +E W R +G +Y YMAT+  N AS+ LFT    Y KFRTP+
Sbjct  125   LRVPPPYRRMGIASKLVEKMEEWVRESGGEYCYMATENDNIASVKLFTTKCGYSKFRTPA  184

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LV PV  H+  +     ++++ P+ AE  YR  F  +SEFFP+DI+ VLNNKL LGTF+
Sbjct  185   ILVNPVFAHRVRVPRRATILKLCPRDAELLYRLRFS-TSEFFPRDIDAVLNNKLTLGTFL  243

Query  782   AVPKESLSTWEPDSGVF------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVL  943
             AVP+       P  G        P + A++S+W+ ++VYK++V+G+ A ++A    TR +
Sbjct  244   AVPRGGAGE-RPWGGAAEFLADPPESWAVVSVWNLQDVYKLEVRGVPAAQRALARATRAV  302

Query  944   DRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLI  1123
             DR +PW+ LPS P + + FG +FL+G+  EG    EM+ +L   AHN+A+    GC ++ 
Sbjct  303   DRALPWLGLPSFPELFRPFGAHFLYGVGGEGPRAGEMVRALCLHAHNLAKE--HGCAVVA  360

Query  1124  AEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              EV+  +P+R  IPHWK  S  +DLWCI
Sbjct  361   TEVASREPLRLAIPHWKRLSCDEDLWCI  388



>ref|NP_001170084.1| uncharacterized protein LOC100384002 [Zea mays]
 gb|ACN35754.1| unknown [Zea mays]
 tpg|DAA51552.1| TPA: hypothetical protein ZEAMMB73_436841 [Zea mays]
 gb|AIB05219.1| GNAT transcription factor, partial [Zea mays]
Length=404

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 219/360 (61%), Gaps = 16/360 (4%)
 Frame = +2

Query  161   RDKVAVEELESQCEVGQEGKPRLVI--DLLDDPIGRVRNAPLHVMMVAEHGI---SKEIV  325
             RD+V VEE+E  CEVG  G  ++ +  DLL DP+ R+R++P  +M+VAE      S EI 
Sbjct  18    RDRVGVEEVERACEVGCSGGGKMCLFTDLLGDPLCRIRHSPDSLMLVAETATGPNSTEIA  77

Query  326   GVIRGSIRSV----SRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWG  493
             GV+RG +++V    +   +  N +   Y  V YILGLRVS  HRR G+G KLV  +E W 
Sbjct  78    GVVRGCVKTVVSAGTTTTQQANKDDPIYTKVGYILGLRVSPSHRRKGVGKKLVDRMEEWF  137

Query  494   RSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPP  673
             R  GA+Y YMAT+  N+AS+ LFTG   Y KFRTPSVLV PV RH        A+V + P
Sbjct  138   RQRGAEYSYMATEQDNEASVRLFTGRCGYAKFRTPSVLVHPVFRHALRPSRSAAIVALEP  197

Query  674   QLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF---PTNH  844
             + AE  YR +F G  EFFP DI  VL+N L+LGTF+A+P  S + WE         P + 
Sbjct  198   REAELLYRWHFAG-VEFFPADIGAVLSNALSLGTFLALPS-SPARWEGAEAFVAAPPASW  255

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A+LS+W+  + ++++V+G   L +A    TR++DR  PW+ +PS+PN+   FG YFL+GL
Sbjct  256   AVLSVWNCMDAFRLEVRGAPRLMRAAAGATRLVDRAAPWLGIPSIPNLFAPFGLYFLYGL  315

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCI  1204
                G     +  +L   AHN+AR+   GC ++  EV   +PVR G+PHW     +DLWCI
Sbjct  316   GGAGPDAPRLARALCRSAHNMARDG--GCGVVATEVGACEPVRAGVPHWARLGAEDLWCI  373



>ref|XP_010028370.1| PREDICTED: probable N-acetyltransferase HLS1 [Eucalyptus grandis]
 gb|KCW55114.1| hypothetical protein EUGRSUZ_I01074 [Eucalyptus grandis]
Length=400

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 241/372 (65%), Gaps = 23/372 (6%)
 Frame = +2

Query  137   VVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISK  316
             VVR+++  +D   VEE+E +CEVG  GK  L  DLL DPI R+R++P ++M+VAE  +  
Sbjct  5     VVREFDSNKDCKEVEEVERRCEVGPAGKTSLFTDLLGDPICRIRHSPPYLMLVAEMEVEG  64

Query  317   E--IVGVIRGSIRSVSRGQKGKNDNSTD---------YVDVAYILGLRVSSQHRRLGIGT  463
             E  IVG++RG I++VS G+   ND+  D         Y  +A ILGLRV   HRR+GIG 
Sbjct  65    ERKIVGMVRGCIKTVSCGRGSSNDDGEDDSTKIVTPIYAKLASILGLRVCPSHRRIGIGL  124

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
              LV+ +E W   +GA+Y Y+AT+  NQAS+NLF     Y KFRTPS+LV+PV+ H+  I 
Sbjct  125   ALVKKMEAWFTHSGAEYSYIATENDNQASLNLFLSKCKYTKFRTPSMLVRPVYAHRVKIP  184

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS  823
               VA+ ++    AE  YR  F  ++EFFP+DI+ VL+NKLNLGT++A+P  S   W P+S
Sbjct  185   DRVAIFKLDHLEAELLYRARFS-TTEFFPRDIDRVLSNKLNLGTYVAMPSGS---W-PNS  239

Query  824   GVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
             G F    P + A+LSIW+ KE + ++VKG S   Q   + TR  DRL+P++ +PSVP + 
Sbjct  240   GRFLASPPESWAVLSIWNCKESFTLEVKGASRTLQWIAMATRTADRLLPFLGIPSVPQLF  299

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + FG++FL+GL  EG     MME+L A AHN+A+    GC ++  EV+  +P+R  IPHW
Sbjct  300   QPFGFHFLYGLGGEGPQAGRMMEALCAHAHNLAKE--MGCAVVATEVARHEPLRPAIPHW  357

Query  1172  KNFSW-QDLWCI  1204
             K  S  +D+WC+
Sbjct  358   KRLSCEEDVWCM  369



>ref|XP_010679620.1| PREDICTED: probable N-acetyltransferase HLS1 [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 247/380 (65%), Gaps = 29/380 (8%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI---  310
             +R+YE+ERD   VEE+E +CEVG   K  L  DLL DP+ R+R++P  +M+VAE      
Sbjct  12    IREYEKERDSKEVEEVERRCEVGPSSKVSLFTDLLGDPLCRIRHSPAFLMLVAEVVEEDE  71

Query  311   -----SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVD----------VAYILGLRVSSQHR  445
                   +EIVG+IRG I++V+  +K    + +   D          +AYILGLRVS  HR
Sbjct  72    ETGKEKREIVGMIRGCIKTVTCDKKFPRPSKSTLYDATKPLPIFTKLAYILGLRVSPSHR  131

Query  446   RLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHR  625
             R+GI +KLV  LE W R +GA+Y Y+AT+  N+ASI+LFT    Y KFRTPS+LVQPV  
Sbjct  132   RMGIASKLVNKLEEWFRQSGAEYSYLATESKNEASISLFTQKSGYSKFRTPSILVQPVFE  191

Query  626   HKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS  805
             H+  +   V ++RV P  AE  YR+ +  ++EFFP+DI+ VL+N+L LGTF+AVP+ES +
Sbjct  192   HRAKVSGRVTIIRVRPSDAEILYRKKYS-TTEFFPRDIDAVLHNRLTLGTFVAVPRESYA  250

Query  806   --TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
               +W P +  F    P + A+LS+W+  EV++++V+G S + +     +RV+DR +P+++
Sbjct  251   PGSW-PGAEKFLSNTPESWALLSVWNCSEVWRLEVRGASRVGKGLAKTSRVMDRALPFLK  309

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             +PS P V K FG +FL+GL  EG    + +++L  FAHN+A+   +GC ++  EV+  DP
Sbjct  310   IPSFPEVFKPFGLHFLYGLGGEGPQSVKYIKALCGFAHNLAQE--KGCSVVATEVASRDP  367

Query  1148  VRRGIPHWKNFSW-QDLWCI  1204
             ++ GIPHWK  S  +DLWCI
Sbjct  368   LKLGIPHWKKLSCAEDLWCI  387



>dbj|BAJ86600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 235/375 (63%), Gaps = 17/375 (5%)
 Frame = +2

Query  110   AVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPR---LVIDLLDDPIGRVRNAPL  280
             A  E+ P V+VR+Y++ RD+  VEE+E +CEVG  G      L  DLL DP+ R+RN+P 
Sbjct  4     AAVEEEPVVMVREYDDVRDRGGVEEVERECEVGSSGGGGEMCLFTDLLGDPLCRIRNSPD  63

Query  281   HVMMVAEHGIS---KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRL  451
              +M+VAE        E++G++RG ++SV  G  G +     Y  VAYILGLRVS  HRR 
Sbjct  64    FLMLVAETATGDGGAEVIGLVRGCVKSVVSG--GSHSKDPIYTKVAYILGLRVSPNHRRK  121

Query  452   GIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHK  631
             G+G  LV+ +E W R  GA+Y YMAT+  N+AS+ LFT    Y KFRTPS+LV PV RH 
Sbjct  122   GVGRMLVERMEQWFRQKGAEYSYMATEQDNEASVRLFTSRCGYTKFRTPSLLVHPVFRHA  181

Query  632   KPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTW  811
                    ++VR+ P+ AE  YR +F  + EFFP DI+ VL N L+LGTF+A+P  + S W
Sbjct  182   LKPSRRASIVRLEPRDAERLYRWHF-AAVEFFPADIDAVLTNALSLGTFLAIP--AGSRW  238

Query  812   EPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSV  979
             + D   F    P + A+LS+W+  E ++++V+G   L +A    TR++DR  PW+R+PS+
Sbjct  239   DGDVEAFLAAPPASWAVLSVWNCMEAFRLEVRGAPRLMRAAAGATRLVDRAAPWLRIPSI  298

Query  980   PNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRG  1159
             PN+   FG YFL+GL   G     ++ +L   AHN+AR+   GC ++  EV+  +PVR G
Sbjct  299   PNLFAPFGLYFLYGLGGAGTDAPRLVRALCRHAHNMARHG--GCGVVATEVAALEPVRAG  356

Query  1160  IPHWKNFSWQDLWCI  1204
             +PHW+    +DLWCI
Sbjct  357   VPHWERLGAEDLWCI  371



>ref|XP_002466403.1| hypothetical protein SORBIDRAFT_01g007180 [Sorghum bicolor]
 gb|EER93401.1| hypothetical protein SORBIDRAFT_01g007180 [Sorghum bicolor]
Length=410

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 160/372 (43%), Positives = 225/372 (60%), Gaps = 24/372 (6%)
 Frame = +2

Query  143   RQYEEERDKVAVEELESQCEVGQEGKPR----LVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             R Y++ RD+V VEE+E  CEVG          L  DLL DP+ R+R++P  +M+VAE   
Sbjct  13    RAYDDARDRVGVEEVERACEVGSMSGGGGKMCLFTDLLGDPLCRIRHSPDSLMLVAETAT  72

Query  311   ----SKEIVGVIRGSIRSV-------SRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGI  457
                 S EI G++RG +++V       ++GQ+ K+D+   Y  V YILGLRVS  HRR G+
Sbjct  73    GPNSSTEIAGLVRGCVKTVVSGTAGTTQGQQSKDDDPI-YTKVGYILGLRVSPSHRRKGV  131

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV  +E W R  GA+Y YMAT+  N+ S+ LFTG   Y KFRTPSVLV PV RH   
Sbjct  132   GKKLVDRMEEWFRQRGAEYSYMATEQDNEPSVRLFTGRCGYAKFRTPSVLVHPVFRHALK  191

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEP  817
                 V++V +  + AE  YR +F  + EFFP DI+ VL+N L+LGTF+A+P  S + WE 
Sbjct  192   PSRRVSIVELDAREAELLYRWHF-ANVEFFPADIDAVLSNDLSLGTFLALP--SGAQWES  248

Query  818   DSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
                     P + A+LS+W+  + ++++V+G   L +A    TR++DR  PW+ +PS+PN+
Sbjct  249   VEAFLASPPPSWAVLSVWNCMDAFRLEVRGAPRLMRAAAGATRLVDRAAPWLGIPSIPNL  308

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
                FG YFL+GL   G     +  +L   AHN+AR+   GC ++  EV   +PVR G+PH
Sbjct  309   FAPFGLYFLYGLGGAGPDAPRLARALCREAHNMARDG--GCGVVATEVGACEPVRAGVPH  366

Query  1169  WKNFSWQDLWCI  1204
             W     +DLWCI
Sbjct  367   WARLGAEDLWCI  378



>ref|NP_001051365.1| Os03g0764000 [Oryza sativa Japonica Group]
 gb|AAL34132.1|AC090713_19 putative acetyl transferase [Oryza sativa Japonica Group]
 gb|ABF99027.1| N-acetyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13279.1| Os03g0764000 [Oryza sativa Japonica Group]
 gb|EAY91955.1| hypothetical protein OsI_13643 [Oryza sativa Indica Group]
 gb|EAZ28679.1| hypothetical protein OsJ_12691 [Oryza sativa Japonica Group]
Length=399

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 234/370 (63%), Gaps = 18/370 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEG----KPRLVIDLLDDPIGRVRNAPLHVMMVAE  301
             V VR+Y E+RD+ AVEE+E +CEVG  G    K  L  DLL DP+ R+RN+P ++M+VAE
Sbjct  4     VEVREYREDRDRAAVEEVERECEVGSSGGGEAKMCLFTDLLGDPLCRIRNSPAYLMLVAE  63

Query  302   HGIS------KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGT  463
                       +EI+G+IRG +++V  G   +      Y  VAYILGLRVS ++RR G+G 
Sbjct  64    TANGGGGGNGREIIGLIRGCVKTVVSGGSVQAGKDPIYSKVAYILGLRVSPRYRRKGVGK  123

Query  464   KLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIG  643
             KLV  +E W R +GA+Y YMAT+  N+AS+ LFTG   Y KFRTPSVLV PV  H     
Sbjct  124   KLVGRMEEWFRQSGAEYSYMATEQDNEASVRLFTGRCGYSKFRTPSVLVHPVFGHALQPS  183

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS  823
              + A+ ++ P+ AE  YR +F  + EFFP DI+ VL+ +L+LGTF+AVP  + + WE   
Sbjct  184   RNAAIRKLEPREAELLYRWHF-AAVEFFPADIDAVLSKELSLGTFLAVP--AGTRWESVE  240

Query  824   GVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSK  994
                   P + A++S+W+  + ++++V+G   L +A  + TR++DR  PW+++PS+PN+  
Sbjct  241   AFMDAPPASWAVMSVWNCMDAFRLEVRGAPRLMRAAAVATRLVDRAAPWLKIPSIPNLFA  300

Query  995   NFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWK  1174
              FG YFL+G+   G +   ++ +L   AHN+AR    GC ++  EVS  +PVR G+PHW 
Sbjct  301   PFGLYFLYGVGGAGPASPRLVRALCRHAHNMARKG--GCGVVATEVSACEPVRAGVPHWA  358

Query  1175  NFSWQDLWCI  1204
                 +DLWCI
Sbjct  359   RLGAEDLWCI  368



>ref|XP_008787222.1| PREDICTED: probable N-acetyltransferase HLS1 [Phoenix dactylifera]
Length=422

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 228/369 (62%), Gaps = 26/369 (7%)
 Frame = +2

Query  161   RDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS-KEIVGVIR  337
             RD++  E +E  CEVG  G+  L  D L DP+ RVR++P  +M+VAE     KEIVG+IR
Sbjct  25    RDRLRAEAMERMCEVGPSGEMTLFTDHLGDPVSRVRHSPAFLMLVAETSEPVKEIVGIIR  84

Query  338   GSIRSVSRGQK----------GKNDN---STDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
             GS+++V+ G+            K+ N   +  Y  VAYILGLRVS  +RR+GIG +LV+ 
Sbjct  85    GSVKTVTCGKSIPRNAGAVTAMKHQNPLPAPMYTKVAYILGLRVSPFYRRMGIGLRLVRR  144

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             LE W +  GA+Y YMATD  N+AS+ LFTG   Y KFRTP++LV PV  H+ PI   V +
Sbjct  145   LEEWFKEQGAEYAYMATDKDNEASVRLFTGRCGYSKFRTPAILVHPVFAHRLPIPRLVRI  204

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS----TWEPDSG  826
             +R+P   AES YR +F  ++E FP+DI+ VL+N L+LGTF+AVP  S       W    G
Sbjct  205   LRLPVADAESLYRLHFS-TTELFPRDIDAVLSNHLSLGTFLAVPAGSCGGGEWKWPGTEG  263

Query  827   VF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKN  997
                  P + A++S+W+   V++++V+G S +++     TR  DR +PW+R+PSVP++ + 
Sbjct  264   FLSAPPESWAVVSVWNCGGVFRLEVRGASRVRRGLAWATRAADRALPWLRIPSVPDIFRP  323

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG  FL+G+  EG   + M+ +L   AHN+ +         +A     +P+RRGIPHW+ 
Sbjct  324   FGALFLYGIGGEGPGAAAMVAALCRHAHNMGKGTAGVVAAEVAAC---EPLRRGIPHWRR  380

Query  1178  FSW-QDLWC  1201
              S+ +DLWC
Sbjct  381   LSFAEDLWC  389



>ref|XP_008238090.1| PREDICTED: probable N-acetyltransferase HLS1 [Prunus mume]
Length=422

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/387 (44%), Positives = 239/387 (62%), Gaps = 38/387 (10%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             VV+R+++   D   VEE+E +CEVG  G+  L  DLL DPI RVR++P ++M+VAE    
Sbjct  13    VVLREFDPSTDCEGVEEVERRCEVGPGGELSLFTDLLGDPICRVRHSPAYLMLVAELVGE  72

Query  314   KEIV----GVIRGSIRSVSRGQK-----------GKNDNSTD--------YVDVAYILGL  424
             +E      G+IRG I++V+ G+K            KND+  D        Y  +AYILGL
Sbjct  73    EEEEKEVVGMIRGCIKTVTCGKKLSRNGKNVTHHNKNDDVLDDTLKPLPVYTKLAYILGL  132

Query  425   RVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSV  604
             RVS  +RR+GIG KLV  +E W R NGA+Y YMATD  N+ SINLFT    Y KFRTP++
Sbjct  133   RVSPSYRRMGIGLKLVHRVEEWFRENGAEYSYMATDNDNKPSINLFTDKCGYSKFRTPAI  192

Query  605   LVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA  784
             LV PV  H+  + S V V+ + P  AES YRR F  ++EFFP+D+  VLN   +L  F+A
Sbjct  193   LVNPVFAHRVKLSSRVHVITLSPSDAESLYRRRFS-TTEFFPRDLGAVLNQPPSLA-FLA  250

Query  785   VPKESLS--TWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLD  946
             VP+ + +  TW P S  F    P + A+LS+W+ K+ Y ++V+G S +K+     TR++D
Sbjct  251   VPRGTFTAGTW-PGSDQFLADPPESWAVLSVWNCKDAYTLEVRGASRVKRTLAKTTRIVD  309

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIA  1126
             R +PW+RLP+   V ++F   FL+GL   G    + +++L   AHN+A+   RGC ++  
Sbjct  310   RALPWLRLPARVGVFRSF---FLYGLGGSGPRAEKFVKALCGHAHNLAKE--RGCGVVAT  364

Query  1127  EVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             EVS  +P+R GIPHWK  S  +DLWCI
Sbjct  365   EVSRREPLRLGIPHWKRLSCDEDLWCI  391



>gb|KEH34353.1| acyl-CoA N-acyltransferase (NAT) superfamily protein, putative 
[Medicago truncatula]
Length=388

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/362 (43%), Positives = 232/362 (64%), Gaps = 20/362 (6%)
 Frame = +2

Query  140   VRQYE-EERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISK  316
             +R YE +  D+  VE LE +CEVG      L  D L DPI R+RN+P+++M+VAE     
Sbjct  8     IRSYEGQSADRAQVENLERKCEVGPSESVFLFTDTLGDPICRIRNSPMYIMLVAE--FDN  65

Query  317   EIVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWG  493
             E++GVI+GSI+ V+ +G   K     D   V Y+LGLRVS  HRR GIG+ LV++LE W 
Sbjct  66    ELIGVIQGSIKVVTVQGHPPK-----DLAKVGYVLGLRVSPHHRRKGIGSSLVRTLEEWF  120

Query  494   RSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPP  673
              SN  DY YMAT+  N AS+NLF    NY+KFRTPS+LV PV+ H   I +++ + R+  
Sbjct  121   ISNDVDYAYMATEKDNHASVNLFMNKFNYIKFRTPSILVNPVNHHSLKISNNIEISRLKI  180

Query  674   QLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAIL  853
             + AES YRR F GS+EFFP DI  +L NKL+LGT+MA  K+ ++     +G  P + A+L
Sbjct  181   EQAESLYRR-FMGSTEFFPNDIGNILRNKLSLGTWMACFKDDINI--GPNGQVPNSWAML  237

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             S+W++ E++K+++ G +     C L T+   ++D++ P ++LP++P+    FG+YF++G+
Sbjct  238   SVWNSGEIFKLKI-GKAPF--CCLLYTKSWCLIDKIFPCLKLPTLPDFFNPFGFYFMYGV  294

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDR-RGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLW  1198
               EG    +++++L  F HN+A+  +   C++++ EV   D +   IPHWK  S  +DLW
Sbjct  295   YHEGPFSGKLVKALCQFVHNMAKERKDEKCKIIVTEVGGRDELNHHIPHWKLLSCPEDLW  354

Query  1199  CI  1204
             CI
Sbjct  355   CI  356



>ref|XP_004500285.1| PREDICTED: uncharacterized protein LOC101506528 [Cicer arietinum]
Length=390

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 224/361 (62%), Gaps = 19/361 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYEGQFDRAQVENLERKCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LENE  65

Query  320   IVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRS  499
             +VGVI+GSI+ V+     ++    D   V Y+LGLRVS  HRR GIG+ LV+ LE W  S
Sbjct  66    LVGVIQGSIKLVTI----QHHPPKDLAKVGYVLGLRVSPHHRRKGIGSNLVRRLEEWFIS  121

Query  500   NGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQL  679
             N  DY YMAT+  N AS+NLF     Y KFRTPS+LV PV+ H   I S++ + R+  + 
Sbjct  122   NDVDYAYMATEKENNASVNLFMKKFGYTKFRTPSILVNPVNHHSLQISSNIEISRLKIEE  181

Query  680   AESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSI  859
             AES Y+R F GS+EFFP DI  +L NKL+LGT+MA  K  + +   +    P + A+LS+
Sbjct  182   AESLYKR-FMGSTEFFPNDIGNILRNKLSLGTWMAYFKGDVGS---NGSQVPNSWAMLSV  237

Query  860   WDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFGLRM  1030
             W++ E++K++   L      C L T+   ++D++ P ++LP++P+    FG+YF++GL  
Sbjct  238   WNSGEIFKLR---LGKAPFCCLLYTKSWCLIDKIFPCLKLPTLPDFFNPFGFYFMYGLYH  294

Query  1031  EGQSGSEMMESLWAFAHNVA--RNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWC  1201
             EG    +++  L  F HN+A   ND   C++++ EV   D + + IPHWK  S  +DLWC
Sbjct  295   EGPLSGKLVRGLCQFVHNMAVESNDDEKCKIIVTEVGGRDQLNQHIPHWKLLSCPEDLWC  354

Query  1202  I  1204
             I
Sbjct  355   I  355



>gb|ACU19465.1| unknown [Glycine max]
Length=393

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 225/364 (62%), Gaps = 20/364 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE+LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYEGQSDRAQVEDLERRCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LENE  65

Query  320   IVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             +VGVI GSI+ V+  G   K     D   V Y+LGLRVS  HRR GIG+ LV++LE W  
Sbjct  66    LVGVIHGSIKVVTVHGHPPK-----DLAKVGYVLGLRVSPHHRRKGIGSSLVKTLEEWFT  120

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
             S  ADY YMAT+  N AS++LF     Y+KFRTP++LV PV+ H   I  ++ + R+   
Sbjct  121   SKDADYAYMATEKDNHASVSLFMDKFGYIKFRTPAILVNPVNHHCFQISPNIEITRLKVD  180

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEPDSGVFPTNHAI  850
              AE +YRR F GS+EFFP D+  +L NKLNLGT++A  K  ++   +  D G  P + A+
Sbjct  181   QAEYFYRR-FMGSTEFFPNDVGNILRNKLNLGTWVAYFKGDIAWGDFGSDIGQVPNSWAM  239

Query  851   LSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFG  1021
             LS+W++ E++K++   L     +C + T+   ++D++ P ++LP++P+    FG+YF++G
Sbjct  240   LSVWNSGEIFKLR---LGKAPFSCLVCTKSWWLIDKIFPCLKLPTIPDFFNPFGFYFMYG  296

Query  1022  LRMEGQSGSEMMESLWAFAHN--VARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQ-D  1192
             +  EG    +++ +L  F HN  V   D   C++++ EV   D +   IPHWK  S Q D
Sbjct  297   VHREGPFSGKLVRALCQFVHNMGVESKDESNCKIIVTEVEGRDELNHHIPHWKLLSCQED  356

Query  1193  LWCI  1204
             LWCI
Sbjct  357   LWCI  360



>ref|XP_006826701.1| hypothetical protein AMTR_s00137p00096410 [Amborella trichopoda]
 gb|ERM93938.1| hypothetical protein AMTR_s00137p00096410 [Amborella trichopoda]
Length=420

 Score =   286 bits (733),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 225/373 (60%), Gaps = 51/373 (14%)
 Frame = +2

Query  293   VAEHGISKEIVGVIRGSIRSVSRGQKGKND--NSTD-----------YVDVAYILGLRVS  433
             VAE G  +EIVGVIRG I++V+ G+K      N+TD           Y   AYILGLRVS
Sbjct  73    VAELGEEREIVGVIRGCIKTVTCGKKLPRSARNATDDPTTTKAAVPVYTKAAYILGLRVS  132

Query  434   SQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQ  613
               HRR+GIG +LV+ LE+W  S GA+Y YMATD  N  S++LFT  L+Y  FRTPS+LV 
Sbjct  133   LPHRRMGIGLRLVRRLESWFASMGAEYAYMATDSDNSPSLSLFTRRLSYQNFRTPSILVH  192

Query  614   PVH-RHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP  790
             PVH  H   +  +V ++ +PP  AES YRR    ++EFFP+DI+ VL NKLNLGTF+A+P
Sbjct  193   PVHPHHDLSLSKNVQILSLPPLEAESLYRRLLS-TTEFFPRDIDSVLQNKLNLGTFLALP  251

Query  791   KES-LSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIR  967
              ++  +  E    + P + A+LS+W++K+V+++QV+G S LK+ C   +RV DRL PW+ 
Sbjct  252   SDTNFANMESFLSLPPESWAVLSVWNSKDVFRLQVRGASKLKKMCAKMSRVFDRLFPWLM  311

Query  968   LPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDP  1147
             +PSVP V + FG YFL+GL  EG +   ++ +L   AHN+AR    GC ++  EV   +P
Sbjct  312   IPSVPEVFRPFGLYFLYGLGGEGTAKVRLIRALCKMAHNMARKG--GCGVVATEVGVLEP  369

Query  1148  VRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSS-------  1303
             +R G+PHW  FS  +DLWC+K L                    ED   Y D S       
Sbjct  370   LRAGVPHWARFSCEEDLWCVKRL-------------------GED---YSDGSVGDWTKS  407

Query  1304  ---ALIFVDPRDI  1333
                A IFVDPRD 
Sbjct  408   APGASIFVDPRDF  420



>ref|XP_010257097.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X2 
[Nelumbo nucifera]
Length=389

 Score =   283 bits (725),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 154/362 (43%), Positives = 230/362 (64%), Gaps = 15/362 (4%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +V +R Y    D+  VE+LE +CEVG      L  D + DPI R+RN+PL+ M+VAE  +
Sbjct  6     KVKIRSYNSRIDRGRVEDLERRCEVGPAQSVLLFTDTMGDPICRIRNSPLYKMLVAE--L  63

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
             + E+VGVI+GSI+ V+     +N        V YILGLRVS  HRR GIG  LV+ LE W
Sbjct  64    NNELVGVIQGSIKLVTFSTPTRNRAV-----VGYILGLRVSPHHRRKGIGLSLVRRLEEW  118

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  D+ YMAT+  N+AS+ LFT  L +VKFRTPS+LV PV  H   I  +V VV++ 
Sbjct  119   FIANHVDFAYMATEKDNEASVKLFTEKLGFVKFRTPSILVNPVQYHAMRISREVKVVKLK  178

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEP--DSGVFPTNH  844
              + AE  YRR F GS+EFFP DI+ +L NKL+LGT++A P+    +W+    +G+ P++ 
Sbjct  179   VEEAEYLYRR-FMGSTEFFPHDIDRILRNKLSLGTWVAYPRG--ESWDELRSAGLVPSSW  235

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A++S+W++  ++K++V             +R++DR+ P +R+P++P+V   FG+YF++G+
Sbjct  236   AMVSVWNSGGIFKLRVGKAPLSCHIYSKSSRMMDRIFPCLRIPALPDVFHPFGFYFMYGM  295

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR-RGIPHWKNFSW-QDLW  1198
               EG+   E++ +L  F HN+A  + + C++++ EV   D VR   IPHWK  S  +DLW
Sbjct  296   HGEGRRSGELVRALCRFVHNMA-TECKDCKVIVTEVGGCDAVRLEEIPHWKLLSCPEDLW  354

Query  1199  CI  1204
             CI
Sbjct  355   CI  356



>ref|XP_010089518.1| hypothetical protein L484_011679 [Morus notabilis]
 gb|EXB37957.1| hypothetical protein L484_011679 [Morus notabilis]
Length=384

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 221/358 (62%), Gaps = 11/358 (3%)
 Frame = +2

Query  137   VVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISK  316
             ++R Y+   D+  VE+LE +CEVG   +  L  D L DPI R+RN+P++ M+VAE  +  
Sbjct  1     MIRSYDRRIDRARVEDLERRCEVGPTERVFLFTDTLGDPICRIRNSPMYKMLVAE--LDN  58

Query  317   EIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             E+VGVI+GSI+ V+      N    D   V YILGLRV+ + RR GIG+ LV+ LE W  
Sbjct  59    ELVGVIQGSIKVVTM----MNKPPKDMAKVGYILGLRVAPRQRRKGIGSSLVRELEKWFV  114

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
             +N  D+ YMAT+  N+AS+ LF     Y KFRTP++LV PV      I S+V + ++  +
Sbjct  115   ANEIDFSYMATEKENEASVRLFVDKFGYNKFRTPAILVNPVQNRPSHISSNVEIAKLRIE  174

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILS  856
              AES YR+ F  S EFFP DI+ +L NKL+LGT++A  K   S+W+    V PT+ A+LS
Sbjct  175   DAESLYRK-FMASIEFFPHDIDKILGNKLSLGTWIAYSKGDQSSWDSTGKVLPTSWAMLS  233

Query  857   IWDAKEVYKVQVKGLSALKQACFL-GTRVLDRLIPWIR-LPSVPNVSKNFGYYFLFGLRM  1030
             +W+  EV+K+ + G + L    F  G+RV+ R  P  + LPS+P+    FG+YF++G+  
Sbjct  234   VWNTGEVFKLWL-GKAPLSCLIFTKGSRVISRFFPCFKLLPSLPDFFDPFGFYFMYGVHG  292

Query  1031  EGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCI  1204
             +G    +M+ +L  F HN+A    + C++++ EV   D VR  IPHWK    +DLWCI
Sbjct  293   QGPLAGKMVRTLCQFVHNMAMAS-KDCKVIVTEVGDQDEVRHHIPHWKLLCPEDLWCI  349



>ref|XP_006488558.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X1 
[Citrus sinensis]
Length=386

 Score =   283 bits (724),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 228/363 (63%), Gaps = 16/363 (4%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EV+ R Y+ + D+  VE+LE +CEVG   +  L  D L DPI R+RN+P++ M+VAE  +
Sbjct  5     EVITRSYDRQIDRARVEDLERRCEVGPAERVFLFTDTLGDPICRIRNSPMYKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
              +E+VGVI+GSI+ V+  +  +     D   V Y+LGLRV+  HRR GIG+ LV  LE W
Sbjct  63    DRELVGVIQGSIKQVTVQKPHE-----DLAKVGYVLGLRVAPLHRRKGIGSSLVCKLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               SN  DY YMAT+  N+AS+ LF   L YV FRTP++LV PV+       S+V + ++ 
Sbjct  118   FTSNDVDYAYMATEKDNEASVKLFVNKLGYVNFRTPAILVHPVNNRMFHTPSNVQIRKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE+ Y + F  S+EFFP DI  +L NKL+LGT++A P+ E +  +  +  +FP + A
Sbjct  178   IEEAENLYYK-FMASTEFFPYDIGNILRNKLSLGTWVAYPRGEIVGEFGSNGQIFPKSWA  236

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             ++S+W++ E++K++   L     +C L T   +++D+ +P  +LP++P+    FG+YF++
Sbjct  237   MVSVWNSGELFKLR---LGKAPLSCLLYTKSSKLIDKFLPCFKLPAIPDFYHPFGFYFMY  293

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    +M+ +L  F HN+A    + C++++ EV   D +R  IPHWK  S  +DL
Sbjct  294   GMHREGPLSGKMVRTLCQFVHNMASTKSKDCKVIVTEVGGSDALRLHIPHWKLLSCPEDL  353

Query  1196  WCI  1204
             WCI
Sbjct  354   WCI  356



>ref|XP_010257096.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X1 
[Nelumbo nucifera]
Length=407

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 154/362 (43%), Positives = 230/362 (64%), Gaps = 15/362 (4%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +V +R Y    D+  VE+LE +CEVG      L  D + DPI R+RN+PL+ M+VAE  +
Sbjct  24    KVKIRSYNSRIDRGRVEDLERRCEVGPAQSVLLFTDTMGDPICRIRNSPLYKMLVAE--L  81

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
             + E+VGVI+GSI+ V+     +N        V YILGLRVS  HRR GIG  LV+ LE W
Sbjct  82    NNELVGVIQGSIKLVTFSTPTRNRAV-----VGYILGLRVSPHHRRKGIGLSLVRRLEEW  136

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  D+ YMAT+  N+AS+ LFT  L +VKFRTPS+LV PV  H   I  +V VV++ 
Sbjct  137   FIANHVDFAYMATEKDNEASVKLFTEKLGFVKFRTPSILVNPVQYHAMRISREVKVVKLK  196

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEP--DSGVFPTNH  844
              + AE  YRR F GS+EFFP DI+ +L NKL+LGT++A P+    +W+    +G+ P++ 
Sbjct  197   VEEAEYLYRR-FMGSTEFFPHDIDRILRNKLSLGTWVAYPRG--ESWDELRSAGLVPSSW  253

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A++S+W++  ++K++V             +R++DR+ P +R+P++P+V   FG+YF++G+
Sbjct  254   AMVSVWNSGGIFKLRVGKAPLSCHIYSKSSRMMDRIFPCLRIPALPDVFHPFGFYFMYGM  313

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR-RGIPHWKNFSW-QDLW  1198
               EG+   E++ +L  F HN+A  + + C++++ EV   D VR   IPHWK  S  +DLW
Sbjct  314   HGEGRRSGELVRALCRFVHNMA-TECKDCKVIVTEVGGCDAVRLEEIPHWKLLSCPEDLW  372

Query  1199  CI  1204
             CI
Sbjct  373   CI  374



>ref|XP_003538308.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
Length=393

 Score =   283 bits (723),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 225/364 (62%), Gaps = 20/364 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE+LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYEGQSDRAQVEDLERRCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LENE  65

Query  320   IVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             +VGVI+GSI+ V+  G   K     D   V Y+LGLRVS  HRR GIG+ LV++LE W  
Sbjct  66    LVGVIQGSIKVVTVHGHPPK-----DLAKVGYVLGLRVSPHHRRKGIGSSLVKTLEEWFT  120

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
             S   DY YMAT+  N AS++LF     Y+KFRTP++LV PV+ H   I  ++ + R+   
Sbjct  121   SKDVDYAYMATEKDNHASVSLFMDKFGYIKFRTPAILVNPVNHHCFQISPNIEITRLKVD  180

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEPDSGVFPTNHAI  850
              AE +YRR F GS+EFFP DI  +L NKL+LGT++A  K  ++   +  D G  P + A+
Sbjct  181   QAEYFYRR-FMGSTEFFPNDIGNILRNKLSLGTWVAYFKGDIAWGDFGSDIGQVPNSWAM  239

Query  851   LSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFG  1021
             LS+W++ E++K++   L     +C + T+   ++D++ P ++LP++P+    FG+YF++G
Sbjct  240   LSVWNSGEIFKLR---LGKAPFSCLVCTKSWWLIDKIFPCLKLPTIPDFFNPFGFYFMYG  296

Query  1022  LRMEGQSGSEMMESLWAFAHNVA--RNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQ-D  1192
             +  EG    +++ +L  F HN+     D   C++++ EV   D +   IPHWK  S Q D
Sbjct  297   VHREGPFSGKLVRALCQFVHNMGAESKDESNCKIIVTEVEGRDELNHHIPHWKLLSCQED  356

Query  1193  LWCI  1204
             LWCI
Sbjct  357   LWCI  360



>ref|XP_003519260.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
 gb|KHN46133.1| hypothetical protein glysoja_022775 [Glycine soja]
Length=383

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 222/364 (61%), Gaps = 17/364 (5%)
 Frame = +2

Query  125   LPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH  304
             L E  +R YE + D+  VE+LE +C+VG       V+D + DP+ R+RN P+++M+VAE 
Sbjct  3     LKEFKIRSYECQFDRAQVEDLERRCKVGPSES---VLDTMGDPMCRIRNCPMYIMLVAE-  58

Query  305   GISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
              +  E+VGVI+GSI++V+      N    D   V Y+LGLRVS  +R+ GIG+ LVQ LE
Sbjct  59    -MDNELVGVIQGSIKTVTLHNHHPNK---DMAKVGYVLGLRVSPHNRKKGIGSSLVQKLE  114

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
              W  SN  DY YMAT+  N ASINLF     Y+KFRTPS+L+ PV+ H   I S++ + R
Sbjct  115   EWFTSNDVDYAYMATEKENHASINLFMNKFGYIKFRTPSILINPVNHHPFGISSNIEIAR  174

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNH  844
             +  + AES YR     S+EFFP DI  +L N L+LGT++A  K   S +    G  P + 
Sbjct  175   IKVEKAESLYRGFMGASTEFFPSDIENILTNNLSLGTWVAYFKGD-SGFGNLEGKVPNSW  233

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFL  1015
             A+LS+W+  E++K++   L     +C L T+   +++R+ P ++LP++PN    FG+YF+
Sbjct  234   AMLSVWNCGEIFKLR---LGKTPLSCMLFTKSLSLMNRIFPCLKLPTLPNFFSPFGFYFI  290

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP-DDPVRRGIPHWKNFSWQD  1192
             +G+  EG    +++ +L  F HN+A      C++++ EV   D  +   +PHWK FS  D
Sbjct  291   YGVYQEGPFSGKLVRALCKFVHNMASKTEH-CKIIVTEVGERDHELIHHVPHWKLFSCPD  349

Query  1193  LWCI  1204
             LWCI
Sbjct  350   LWCI  353



>ref|XP_002278620.1| PREDICTED: probable N-acetyltransferase HLS1-like [Vitis vinifera]
 emb|CBI15920.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 232/362 (64%), Gaps = 16/362 (4%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E  +R YEE RD+  VE+LE +CEVG   +  L  D + D I R+RN+P++ M+VAE  +
Sbjct  5     ETKIRNYEERRDRAQVEDLERRCEVGPAERVFLFTDTMGDAICRIRNSPMYKMLVAE--V  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVIRGSI+ V+  +  K     D   V Y+LGLRV S +RR GIG KLV+ LE W
Sbjct  63    DNQLVGVIRGSIKVVTVRKPPK-----DLAKVGYVLGLRVLSLYRRRGIGLKLVRRLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N  DY YMAT+  N+AS+ LF   L YVKFRTP++LV PV R +  + S++ + ++ 
Sbjct  118   FVDNQVDYAYMATEKDNEASVKLFVDKLGYVKFRTPAILVNPV-RRRVHLSSNIEIAKLK  176

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YR+ F  S+EFF +DI+ +L NKL+LGT++A P+ E       D  V  +N A
Sbjct  177   VEEAELLYRK-FMASTEFFSQDIDRILRNKLSLGTWVAYPRGERWGEVGADGRVENSNWA  235

Query  848   ILSIWDAKEVYKVQVKG--LSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFG  1021
             +LS+W++ E++K+++    LS L  A   G+RV+DRL+P I++P++P+    FG+YF++G
Sbjct  236   MLSVWNSGELFKLRLGKAPLSCLVYA--KGSRVVDRLLPCIKVPTIPDFFNPFGFYFMYG  293

Query  1022  LRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLW  1198
             +  EG    +M+ +L  + HN+AR   + C++++ EV   D +R  IPHWK  S  +DLW
Sbjct  294   VHREGPLSGKMVRTLCNYVHNMARKT-KDCKVIVTEVGGCDTLRLHIPHWKLLSCPEDLW  352

Query  1199  CI  1204
             CI
Sbjct  353   CI  354



>ref|XP_009780719.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X2 [Nicotiana 
sylvestris]
Length=378

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 211/327 (65%), Gaps = 24/327 (7%)
 Frame = +2

Query  284   VMMVAEHGISKEIVGVIRGSIRSVSRGQKGKND--NSTD-----------YVDVAYILGL  424
             V+   E+   + IVG+IRG I++V+ G+K   +  NS+D           +  +AYILGL
Sbjct  25    VVHNGENEKKRAIVGMIRGCIKTVTCGKKLSRNAKNSSDSIKPHPQPLPLFTKLAYILGL  84

Query  425   RVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSV  604
             RVS  HRR+GIG KLV  +E W R NGA+Y Y+AT+  NQASI LFT    Y KFRTPS+
Sbjct  85    RVSPSHRRMGIGLKLVCEMEEWFRVNGAEYSYIATENDNQASIKLFTHKCGYSKFRTPSI  144

Query  605   LVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA  784
             LVQPV  H+  + S V ++++ P  AE+ YRR F  ++EFFP+DI+ +L NKLNLGTF+A
Sbjct  145   LVQPVFAHRARVSSRVTIIKLSPTDAETLYRRRFS-TTEFFPRDIDSILYNKLNLGTFLA  203

Query  785   VPK--ESLSTWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLD  946
             VPK   S  TW P    F    P + A+LS+W+ K+V+ ++V+G S + Q     TR++D
Sbjct  204   VPKGHYSAQTW-PGVDEFLASQPQSWAVLSVWNCKDVFNLEVRGASRMTQILAKTTRLVD  262

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIA  1126
             R  PW+++PSVP V + FG +FL+GL  EG    ++ +SL  FAHN+A+  R  C ++  
Sbjct  263   RAFPWLKVPSVPEVFRPFGLHFLYGLGGEGPLAEKLTKSLCDFAHNLAKESR--CSVVAT  320

Query  1127  EVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             EV+  +P+R  IPHWK  S  +DLWC+
Sbjct  321   EVASREPLRLAIPHWKKLSCAEDLWCM  347



>ref|XP_006425110.1| hypothetical protein CICLE_v10028636mg [Citrus clementina]
 gb|ESR38350.1| hypothetical protein CICLE_v10028636mg [Citrus clementina]
Length=386

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 228/363 (63%), Gaps = 16/363 (4%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EV+ R Y+ + D+  VE+LE +CEVG   +  L  D L DPI R+RN+P++ M+VAE  +
Sbjct  5     EVITRSYDRQIDRARVEDLERRCEVGPAERVFLFTDTLGDPICRIRNSPMYKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
              +E+VGVI+GSI+ V+  +  +     D   V Y+LGLRV+  HRR GIG+ LV  LE W
Sbjct  63    DRELVGVIQGSIKQVTVQKPHE-----DLAKVGYVLGLRVAPLHRRKGIGSSLVCKLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  DY YMAT+  N+AS+ LF   L YV FRTP++LV PV+       S+V + ++ 
Sbjct  118   FTANDVDYAYMATEKDNEASVKLFVNKLGYVNFRTPAILVHPVNNRMFHTPSNVQIRKLK  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE+ Y + F  S+EFFP DI  +L NKL+LGT++A P+ E +  +  +  +FP + A
Sbjct  178   IEEAENLYYK-FMASTEFFPYDIGNILRNKLSLGTWVAYPRGEIVGEFGSNGQIFPKSWA  236

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             ++S+W++ E++K++   L     +C L T   +++D+ +P  +LP++P+    FG+YF++
Sbjct  237   MVSVWNSGELFKLR---LGKAPLSCLLYTKSSKLIDKFLPCFKLPAIPDFYHPFGFYFMY  293

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    +M+ +L  F HN+A    + C++++ EV   D +R  IPHWK  S  +DL
Sbjct  294   GMHREGPLSGKMVRTLCQFVHNMASTKSKDCKVIVTEVGGSDALRLHIPHWKLLSCPEDL  353

Query  1196  WCI  1204
             WC+
Sbjct  354   WCM  356



>gb|KHN42226.1| hypothetical protein glysoja_046964 [Glycine soja]
Length=393

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 224/364 (62%), Gaps = 20/364 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE+LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYEGQSDRAQVEDLERRCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LENE  65

Query  320   IVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             +VGVI+GSI+ V+  G   K     D   V Y+LGLRVS  HRR GIG+ LV++LE W  
Sbjct  66    LVGVIQGSIKVVTVHGHPPK-----DLAKVGYVLGLRVSPHHRRKGIGSSLVKTLEEWFT  120

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
             S   DY YMAT+  N AS++LF     Y+KFRTP++LV PV+ H   I  ++ + R+   
Sbjct  121   SKDVDYAYMATEKDNHASVSLFMDKFGYIKFRTPAILVNPVNHHCFQISPNIEITRLKVD  180

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWEPDSGVFPTNHAI  850
              AE +YRR F GS+EFFP DI  +L NKL+LGT++A  K  ++   +  D G  P + A+
Sbjct  181   QAEYFYRR-FMGSTEFFPNDIGNILRNKLSLGTWVAYFKGDIAWGDFGSDIGQVPNSWAM  239

Query  851   LSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFG  1021
             LS+W++ E +K++   L     +C + T+   ++D++ P ++LP++P+    FG+YF++G
Sbjct  240   LSVWNSGETFKLR---LGKAPFSCLVCTKSWWLIDKIFPCLKLPTIPDFFNPFGFYFMYG  296

Query  1022  LRMEGQSGSEMMESLWAFAHNVA--RNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQ-D  1192
             +  EG    +++ +L  F HN+     D   C++++ EV   D +   IPHWK  S Q D
Sbjct  297   VHREGPFSGKLVRALCQFVHNMGAESKDESNCKIIVTEVEGRDELNHHIPHWKLLSCQED  356

Query  1193  LWCI  1204
             LWCI
Sbjct  357   LWCI  360



>gb|KDO66958.1| hypothetical protein CISIN_1g016609mg [Citrus sinensis]
Length=386

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 228/363 (63%), Gaps = 16/363 (4%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EV+ R Y+ + D+  VE+LE +CEVG   +  L  D L DPI R+RN+P++ M+VAE  +
Sbjct  5     EVITRSYDRQIDRARVEDLERRCEVGPAERVFLFTDTLGDPICRIRNSPMYKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
              +E+VGVI+GSI+ V+  +  +     D   V Y+LGLRV+  HRR GIG+ LV  LE W
Sbjct  63    DRELVGVIQGSIKQVTVQKPHE-----DLAKVGYVLGLRVAPLHRRKGIGSSLVCKLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               SN  DY YMAT+  N+AS+ LF   L YV FRTP++LV PV+       S+V + ++ 
Sbjct  118   FTSNDVDYAYMATEKDNEASVKLFVNKLGYVNFRTPAILVHPVNNRMFHTPSNVQIRKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE+ Y + F  S+EFFP DI  +L NKL+LGT++A P+ E +  +  +  +FP + A
Sbjct  178   IEEAENLYYK-FMASTEFFPYDIGNILRNKLSLGTWVAYPRGEIVGEFGSNGQIFPKSWA  236

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             ++S+W++ E++K++   L     +C L T   +++D+ +P  +LP++P+    FG+YF++
Sbjct  237   MVSVWNSGELFKLR---LGKAPLSCLLYTKSSKLIDKFLPCFKLPAIPDFYHPFGFYFMY  293

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    +M+ +L  F HN+A    + C++++ EV   D +R  IPHWK  S  +DL
Sbjct  294   GMHREGPLSGKMVRTLCQFVHNMAGTKSKDCKVIVTEVGGSDALRLHIPHWKLLSCPEDL  353

Query  1196  WCI  1204
             WC+
Sbjct  354   WCM  356



>gb|KHN36291.1| hypothetical protein glysoja_003414 [Glycine soja]
Length=375

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 226/371 (61%), Gaps = 49/371 (13%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             +VVR+++  +D+  VE +E  CEVG  GK  L  D+L DPI RVR++P  +M+VAE  I 
Sbjct  9     LVVREFDLNKDRERVEAVERSCEVGPSGKLSLFTDMLGDPICRVRHSPAFLMLVAE--IG  66

Query  314   KEIVGVIRGSIRSVSRGQK----GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIGTK  466
              E+VG+IRG I++V+ G++    GK++N+       Y  VAYILGLRVS   RR+GIG K
Sbjct  67    GELVGMIRGCIKTVTCGKRLSRNGKHNNTNAKHVPVYTKVAYILGLRVSPNRRRMGIGLK  126

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E W R NG +Y YM T+ +N AS+ LFT    Y KFR PS+LV PV  H   +  
Sbjct  127   LVRKMETWFRDNGTEYSYMTTEKNNLASVKLFTDKCGYSKFRNPSILVNPVFAHPARVSP  186

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLST--W-EP  817
              V ++ + P  AE  YR +F  ++EFFP+D++ VLNNKLNLGTF+AVP ES  +  W  P
Sbjct  187   KVRIISLSPSEAEVLYRHHF-ATTEFFPRDVDSVLNNKLNLGTFLAVPNESYKSDIWLGP  245

Query  818   DSGVF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
             D  +   P + A++S+W++KEV+  +++G S          RV                 
Sbjct  246   DLFLSDPPHSWAMVSVWNSKEVFTFELRGASR-------AVRV-----------------  281

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
                  +FL G   EG  G +M+++L  FAHN+A    +GC +L  EVSP++P+R GIPHW
Sbjct  282   ---SLHFLGG---EGPEGVKMVKALCGFAHNLAM--EKGCRVLATEVSPNEPLRFGIPHW  333

Query  1172  KNFSWQDLWCI  1204
             K  S +DLWC+
Sbjct  334   KMLSGEDLWCM  344



>ref|XP_010264579.1| PREDICTED: probable N-acetyltransferase HLS1-like [Nelumbo nucifera]
Length=384

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 226/360 (63%), Gaps = 12/360 (3%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +V +R Y+   D+  VE+LE +CEVG      L  D + DPI R+RN+PL  M+VAE  +
Sbjct  6     KVKIRSYDGRTDRGRVEDLERRCEVGPAQSVLLFTDTMGDPICRIRNSPLFKMLVAE--L  63

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
             + E+VGVI+GSI+ V+     +     D   V Y+LGLRVS  HRR GIG+ LV+ LE W
Sbjct  64    NNELVGVIQGSIKMVTLATPTR-----DPAVVGYVLGLRVSPFHRRKGIGSSLVRRLEEW  118

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               SN   + YMAT+  N+AS+ LFT  L +VKFRTPS+LV PVH H   I   V + ++ 
Sbjct  119   FLSNHVHFAYMATEKDNEASVKLFTEKLGFVKFRTPSILVNPVHYHSLRISRGVEIAKLK  178

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YRR F GS++FFP DI+ +L NKL+LGT++A P+ ES S    D G  PT+ A
Sbjct  179   MEEAEYLYRR-FMGSTDFFPHDIDRILKNKLSLGTWVAYPRGESWSELRCD-GRLPTSWA  236

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLR  1027
             ++S+W++ +++K++V             +R++DR+ P + +P++P+V   FG+YF++GL 
Sbjct  237   MMSVWNSGDLFKLRVAKAPLSCHIYSKSSRLIDRIFPCLSIPALPDVFHPFGFYFMYGLH  296

Query  1028  MEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              EG     ++ SL  F HN+A  + + C++++ EV   D +R  IPHWK  S  +DLWCI
Sbjct  297   GEGPRSGALVRSLCRFVHNMA-TECKDCKVIVTEVGGCDGLRPEIPHWKLLSCPEDLWCI  355



>ref|XP_007146796.1| hypothetical protein PHAVU_006G070600g [Phaseolus vulgaris]
 gb|ESW18790.1| hypothetical protein PHAVU_006G070600g [Phaseolus vulgaris]
Length=389

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 225/361 (62%), Gaps = 16/361 (4%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE+LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYERQYDRAQVEDLERRCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LENE  65

Query  320   IVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRS  499
             +VGVI+GSI+ V+      ND       V Y+LGLRVS  HRR GIG+ LV+ LE W  S
Sbjct  66    LVGVIQGSIKLVTVHGHPPND----LAKVGYVLGLRVSPHHRRKGIGSSLVRRLEEWFTS  121

Query  500   NGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQL  679
                DY YMAT+  NQAS++LF     Y KFRTP++LV PV+ H   + S++ + R+    
Sbjct  122   KDVDYAYMATEKDNQASVSLFMDKFGYTKFRTPAILVNPVNHHCFQVSSNIEIARLKVDQ  181

Query  680   AESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS-GVFPTNHAILS  856
             AE  YRR F GS+EFFP DI  +L NKL+LGT++A  K  ++  +  S G  P + A+LS
Sbjct  182   AEYLYRR-FMGSTEFFPNDIGNILRNKLSLGTWVAYFKGDIAWGDFGSDGQVPNSWAMLS  240

Query  857   IWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFGLR  1027
             +W++ E++K++   L     +C L T+   ++D++ P ++LP++P+    FG+YF++G+ 
Sbjct  241   VWNSGEIFKLR---LGKAPFSCLLCTKSWWLIDKVFPCLKLPTIPDFFNPFGFYFMYGVH  297

Query  1028  MEGQSGSEMMESLWAFAHNVARNDR-RGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWC  1201
              EG    +++ +L  F HN+A   +   C+++++EV   D +   IPHWK  S  +DLWC
Sbjct  298   HEGPFSGKLVRALCQFVHNMAAESKDDNCKIIVSEVGGRDELNHHIPHWKLLSCPEDLWC  357

Query  1202  I  1204
             I
Sbjct  358   I  358



>ref|XP_007016925.1| Acyl-CoA N-acyltransferases superfamily protein [Theobroma cacao]
 gb|EOY34544.1| Acyl-CoA N-acyltransferases superfamily protein [Theobroma cacao]
Length=385

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 231/363 (64%), Gaps = 17/363 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+++R Y+ + D+  VE+LE +CEVG   K  L  D L DPI R+RN+P++ M+VAE  +
Sbjct  5     ELIIRSYDAQNDRARVEDLERRCEVGPAEKVFLFTDTLGDPICRIRNSPIYKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+      +    D   V YILGLRV+  +RR GIG+ LV  LE W
Sbjct  63    DSQLVGVIQGSIKLVT-----VHKPPNDLARVGYILGLRVAPLYRRRGIGSSLVIKLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               ++  DY YMAT+  N+AS  LF   L+YVKFRT ++LV PV      I S+V + ++ 
Sbjct  118   FIASDVDYAYMATEKDNEASFKLFVDKLSYVKFRTLAILVNPVSHRMSRISSNVELAKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + A+S Y + F  S+EFFP DI  +L NKL+LGT++A PK ES     P+ GVFP++ A
Sbjct  178   VEEAKSLYHK-FMSSTEFFPNDIGNILRNKLSLGTWVAYPKGESWGYSGPNGGVFPSSWA  236

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++K++   L     +C + T   R++++L+P  +LP++P+    FG+YFL+
Sbjct  237   MLSVWNSGELFKLR---LGNAPLSCLMYTKSSRLIEKLLPCFKLPAIPDFFHPFGFYFLY  293

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    +++ +L  F HN+A +  + C++++ EV   D +R  IPHWK  S  +DL
Sbjct  294   GVYREGPLSGKLVRTLCRFVHNMA-SKSKDCKVIVTEVGGSDTLRLHIPHWKLLSCPEDL  352

Query  1196  WCI  1204
             WCI
Sbjct  353   WCI  355



>ref|XP_010922585.1| PREDICTED: probable N-acetyltransferase HLS1-like [Elaeis guineensis]
Length=391

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 158/365 (43%), Positives = 223/365 (61%), Gaps = 20/365 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +VV+R Y+ ERD+   E+LE  CEV  +  P    D+L DP+ R+RN+P + M+VAE G 
Sbjct  10    KVVIRSYDRERDRERFEKLERNCEVEPKKSPFFKTDVLGDPLCRIRNSPTYEMLVAELG-  68

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGV+ GSI+ V  G   +         V YILGLRVSS HRR GIG+ LV  +E W
Sbjct  69    -NELVGVVCGSIKVVRAGGSPEGR-----AKVGYILGLRVSSLHRRRGIGSSLVFRMEQW  122

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  DY+YMATD  N+AS+ LFT  L ++KFRTP++LV PV      I S V + ++ 
Sbjct  123   FAANLVDYVYMATDKDNEASVKLFTDKLGFIKFRTPTILVNPVGNRMIHISSGVEIKKLD  182

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEP--DSG-VFPTN  841
              + AE  YR+     +EFFP+DI+ +L NKL+LGTF+A P     TWE   D G   P +
Sbjct  183   VEQAEVLYRKVMS-LTEFFPQDIDSILANKLSLGTFIAYPLG--ETWEGLLDGGPSTPKS  239

Query  842   HAILSIWDAKEVYKVQVKGLSALKQACFL---GTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
              A+LS+W++   +K++V    A  QAC L    +R +DRL+P +R+P +PN+   FG+YF
Sbjct  240   WAMLSVWNSAAAFKLKVG--RAHHQACVLMSKASRWMDRLLPLLRIPVLPNIFSWFGFYF  297

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-Q  1189
             ++GL  +G     +M SL    HN+A    + C++++ EV   D V   IPHWK  S+ +
Sbjct  298   MYGLHAQGPESDSLMRSLCHHVHNMA-TRCKDCKVIVTEVGSQDLVGTYIPHWKMLSYSE  356

Query  1190  DLWCI  1204
             DLWCI
Sbjct  357   DLWCI  361



>ref|XP_007142182.1| hypothetical protein PHAVU_008G259100g [Phaseolus vulgaris]
 gb|ESW14176.1| hypothetical protein PHAVU_008G259100g [Phaseolus vulgaris]
Length=379

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 159/411 (39%), Positives = 239/411 (58%), Gaps = 42/411 (10%)
 Frame = +2

Query  125   LPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH  304
             L + ++R+YE   D+  VE+LE +C+VG       V+D + DP+ R+RN+P+++M+VAE 
Sbjct  3     LKKFIIRRYEGHSDRAQVEDLERRCKVGPSES---VLDTMGDPMCRIRNSPMYIMLVAE-  58

Query  305   GISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
              +  E+VGVI+G I+ V    K       D   V Y+LGLRVS   RR GIG+ LVQ LE
Sbjct  59    -MENELVGVIQGLIKMV----KVHTHPPKDMAKVGYVLGLRVSPHSRRKGIGSSLVQRLE  113

Query  485   NWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR  664
              W  SN  +Y YMAT+  N ASINLF     Y KFRTP++L+ PV+ H   I S++ +  
Sbjct  114   EWFTSNDVEYAYMATEKENHASINLFMEKYCYTKFRTPTILINPVNHHLFQISSNIEIAM  173

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNH  844
             V  + AES YRR F GS+EFFP DI  +L NKL+LGT++A  K   S +  D G  P + 
Sbjct  174   VKVEKAESLYRR-FMGSTEFFPSDIENILRNKLSLGTWVAYFKGD-SDFGLD-GEVPDSW  230

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFL  1015
             A+LS+W+  E++K++   L     +C L T+   ++ R+ P ++LP++PN    FG+YF+
Sbjct  231   AMLSVWNCGEIFKLR---LGKAPLSCMLFTKSWSLIGRMFPCMKLPTLPNFFSPFGFYFM  287

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDL  1195
             +G+  EG    +++ +L  F HN+A    +  ++++ E+   D +   IPHWK  S QDL
Sbjct  288   YGVYQEGPFSGKLVRALCQFVHNMASRSEQS-KIIVTEIGGRDDLIHHIPHWKLLSCQDL  346

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHD-----SSALIFVDPRDI  1333
             WCI                     ++E +  +H+     SS  +FVDPR++
Sbjct  347   WCI------------------KALNNEGTNKFHELSNTQSSITLFVDPREV  379



>ref|XP_011024921.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=384

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 226/363 (62%), Gaps = 18/363 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ VR Y+ +  +  VE+LE +CEVG   +  L ID + DPI R+RN+P++ M+VAE G 
Sbjct  5     ELKVRSYDVQVHRAGVEDLERRCEVGPTER-VLFIDTMGDPICRIRNSPMYKMLVAELG-  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGVIRGSI+  +  +  KN        + Y+LGLR++  HRR GIG++LV  LE W
Sbjct  63    -SELVGVIRGSIKLATVHKPPKN-----IAKLGYVLGLRIAPLHRRKGIGSRLVLELEKW  116

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N  DY YMAT+  N+AS+NLF   L Y KFRTP++LV PV      + S   V ++ 
Sbjct  117   FIENDVDYAYMATEKDNEASVNLFINKLGYAKFRTPAILVNPVDHRALRLSSKTEVAKLK  176

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YR+ F  S+EFFP DI  +L NKL+LGT++A P+ ES   +  D  V P + A
Sbjct  177   VEEAEFLYRK-FMTSTEFFPDDIGNILRNKLSLGTWVAYPRGESWDDFGSDGKVLPRSWA  235

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++K++   L     +CFL T+   ++D++ P  +LP++P+    FG+YFL+
Sbjct  236   MLSVWNSGELFKLR---LGKAPFSCFLYTKSSILIDKIFPCFKLPAIPDFFSPFGFYFLY  292

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    ++++ L  F HN+A    + C++++ EV   D +R  IP+WK+ S  +DL
Sbjct  293   GVHHEGSLSGKLVQHLCQFVHNMA-TKSKDCKVIVTEVDGKDILRLHIPYWKSLSCPEDL  351

Query  1196  WCI  1204
             WCI
Sbjct  352   WCI  354



>ref|NP_001031403.1| acyl-CoA N-acyltransferase-like protein [Arabidopsis thaliana]
 gb|AEC07402.1| acyl-CoA N-acyltransferase-like protein [Arabidopsis thaliana]
Length=358

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 217/331 (66%), Gaps = 29/331 (9%)
 Frame = +2

Query  287   MMVAEHGIS--KEIVGVIRGSIRSVSRG----------QKGKND---NSTDYVDVAYILG  421
             M+VAE G    KE+VG+IRG I++V+ G           K +ND       Y  +AYILG
Sbjct  1     MLVAEIGPKEKKELVGMIRGCIKTVTCGITTKRLDLTHNKSQNDVVITKPLYTKLAYILG  60

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRR GIG KLV+++E+W   NGA+Y Y AT+  N AS+NLFTG   Y +FRTPS
Sbjct  61    LRVSPTHRRQGIGFKLVKAMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGYAEFRTPS  120

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFM  781
             +LV PV+ H+  I   V V+++ P  AE  YR  F  ++EFFP+DI+ VLNNKL+LGTF+
Sbjct  121   ILVNPVYAHRVNISRRVTVIKLEPSDAELLYRLRFS-TTEFFPRDIDSVLNNKLSLGTFV  179

Query  782   AVPKESL-----STWEPDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGT  934
             AVP+ S       +W P S  F    P + A+LS+W+ K+ ++++V+G S L++     T
Sbjct  180   AVPRGSCYGSGSRSW-PGSAKFLEYPPDSWAVLSVWNCKDSFRLEVRGASRLRRVVSKAT  238

Query  935   RVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCE  1114
             R++D+ +P++++PS+P V + FG +F++G+  EG    +M+++L   AHN+A+    GC 
Sbjct  239   RMVDKTLPFLKIPSIPAVFRPFGLHFMYGIGGEGPRAEKMVKALCDHAHNLAKEG--GCG  296

Query  1115  LLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             ++ AEV+ ++P+RRGIPHWK  S  +DLWCI
Sbjct  297   VVAAEVAGEEPLRRGIPHWKVLSCAEDLWCI  327



>ref|XP_011024922.1| PREDICTED: probable N-acetyltransferase HLS1 [Populus euphratica]
Length=384

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 226/363 (62%), Gaps = 18/363 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ +R Y+ +  +  VE+LE +CEVG   +  L ID + DPI R+RN+P++ M+VAE G 
Sbjct  5     ELKIRSYDVQVHRAGVEDLERRCEVGPTER-VLFIDTMGDPICRIRNSPMYKMLVAELG-  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGVIRGSI+  +  +  KN        + Y+LGLR++  HRR GIG++LV  LE W
Sbjct  63    -SELVGVIRGSIKLATVHKPPKN-----IAKLGYVLGLRIAPLHRRKGIGSRLVLELEKW  116

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N  DY YMAT+  N+AS+NLF   L Y KFRTP++LV PV      + S   V ++ 
Sbjct  117   FIENDVDYAYMATEKDNEASVNLFINKLGYAKFRTPAILVNPVDHRALRLSSKTEVAKLK  176

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YR+ F  S+EFFP DI  +L NKL+LGT++A P+ ES   +  D  V P + A
Sbjct  177   VEEAEFLYRK-FMTSTEFFPDDIGNILRNKLSLGTWVAYPRGESWDDFGSDGKVLPRSWA  235

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++K++   L     +CFL T+   ++D++ P  +LP++P+    FG+YFL+
Sbjct  236   MLSVWNSGELFKLR---LGKAPFSCFLYTKSSILIDKIFPCFKLPAIPDFFSPFGFYFLY  292

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    ++++ L  F HN+A    + C++++ EV   D +R  IP+WK+ S  +DL
Sbjct  293   GVHHEGSLSGKLVQHLCQFVHNMA-TKSKDCKVIVTEVDGKDILRLHIPYWKSLSCPEDL  351

Query  1196  WCI  1204
             WCI
Sbjct  352   WCI  354



>ref|XP_009386512.1| PREDICTED: probable N-acetyltransferase HLS1 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/375 (43%), Positives = 229/375 (61%), Gaps = 23/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH-GI  310
             VVVR+Y    D+ A EE+E  CE+G  GK  L  DLL DP  R+R++P ++M+VAE  G 
Sbjct  8     VVVREYNAANDRAAAEEVERTCELGSSGKMSLHTDLLGDPASRIRHSPTYLMLVAETCGG  67

Query  311   SKEIVGVIRGSIRSVSRGQK-----GKNDNSTD-----YVDVAYILGLRVSSQHRRLGIG  460
              KEIVG++RG ++ V+ G+K     G   N+       Y  V Y+LGLRVS  HRR GIG
Sbjct  68    VKEIVGLVRGCVKVVTCGKKLPRQGGSTKNTCQVATPTYTKVGYLLGLRVSPSHRRKGIG  127

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI  640
              +LV+ +E W R  GA+Y YMAT   N+AS+ LFT   +Y KFR P++LV PV  H+ P+
Sbjct  128   LRLVRQMEGWFREKGAEYAYMATGNDNEASMRLFTERCDYTKFRAPTILVHPVFAHRLPV  187

Query  641   GSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWE  814
                V V+R+    AE+ YRR F  ++EFFP+DI+ VL N L + TF+AVP    +   W 
Sbjct  188   PRSVTVLRLGHADAEAIYRRCF-ATTEFFPRDIDAVLRNPLTVATFLAVPAGCNTARQW-  245

Query  815   PDSGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
             P +  F    P + A+ S WD   V +++V+G S L++     TR  DR +PW+R+P+VP
Sbjct  246   PGAEAFLAAPPGSWAVTSAWDCGGVLRMEVRGASRLRRGAAAATRAADRAMPWLRIPAVP  305

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
             ++ + F  +FL+G+  EG   +EM  + W  AHNVAR       +L AEV+  DPV RGI
Sbjct  306   DLFRPFVAWFLYGVGGEGPGAAEMAAAAWREAHNVARGS---ATVLAAEVAAGDPVLRGI  362

Query  1163  PHWKNFSW-QDLWCI  1204
             P W+  S  +D+WC+
Sbjct  363   PRWRWLSCAEDVWCV  377



>ref|XP_009780724.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X3 [Nicotiana 
sylvestris]
Length=339

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 203/312 (65%), Gaps = 24/312 (8%)
 Frame = +2

Query  329   VIRGSIRSVSRGQKGKND--NSTD-----------YVDVAYILGLRVSSQHRRLGIGTKL  469
             +IRG I++V+ G+K   +  NS+D           +  +AYILGLRVS  HRR+GIG KL
Sbjct  1     MIRGCIKTVTCGKKLSRNAKNSSDSIKPHPQPLPLFTKLAYILGLRVSPSHRRMGIGLKL  60

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V  +E W R NGA+Y Y+AT+  NQASI LFT    Y KFRTPS+LVQPV  H+  + S 
Sbjct  61    VCEMEEWFRVNGAEYSYIATENDNQASIKLFTHKCGYSKFRTPSILVQPVFAHRARVSSR  120

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDS  823
             V ++++ P  AE+ YRR F  ++EFFP+DI+ +L NKLNLGTF+AVPK   S  TW P  
Sbjct  121   VTIIKLSPTDAETLYRRRFS-TTEFFPRDIDSILYNKLNLGTFLAVPKGHYSAQTW-PGV  178

Query  824   GVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
               F    P + A+LS+W+ K+V+ ++V+G S + Q     TR++DR  PW+++PSVP V 
Sbjct  179   DEFLASQPQSWAVLSVWNCKDVFNLEVRGASRMTQILAKTTRLVDRAFPWLKVPSVPEVF  238

Query  992   KNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHW  1171
             + FG +FL+GL  EG    ++ +SL  FAHN+A+  R  C ++  EV+  +P+R  IPHW
Sbjct  239   RPFGLHFLYGLGGEGPLAEKLTKSLCDFAHNLAKESR--CSVVATEVASREPLRLAIPHW  296

Query  1172  KNFSW-QDLWCI  1204
             K  S  +DLWC+
Sbjct  297   KKLSCAEDLWCM  308



>gb|ACU18403.1| unknown [Glycine max]
Length=380

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 222/363 (61%), Gaps = 19/363 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE+LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYEGQSDRAQVEDLERRCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LDNE  65

Query  320   IVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             +VGVI+GSI+ V+  G   K     D   V Y+LGLRVS QHRR GIG+ LV++LE W  
Sbjct  66    LVGVIQGSIKVVTVHGHPPK-----DLAKVGYVLGLRVSPQHRRKGIGSSLVRTLEEWFT  120

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
             S   DY YMAT+  N AS++LF     Y KFRTP++LV PV+ H   I  ++ + R+   
Sbjct  121   SKDVDYAYMATEKDNHASVSLFMDKFGYTKFRTPAILVNPVNHHCFQISPNIEIARLKID  180

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS-GVFPTNHAIL  853
              AE  YRR F GS+EFFP DI  +L NKL+LGT++A  K  ++  +  S G  P + A+L
Sbjct  181   QAEYLYRR-FMGSTEFFPNDIGNILRNKLSLGTWVAYFKGDIAWGDFGSDGQVPNSWAML  239

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             S+W++ E++K++   L     +C + T+   ++ ++ P ++LP++P+    FG+YF++G+
Sbjct  240   SVWNSGEIFKLR---LGKAPFSCLVCTKSWWLIHKIFPCLKLPTIPDFFNPFGFYFMYGV  296

Query  1025  RMEGQSGSEMMESLWAFAHNVA--RNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
               EG    +++ +L  F HN+     D   C +++ EV   D +   IPHWK  S  +DL
Sbjct  297   HHEGPFSGKLVRALCQFVHNMGAESKDESNCRIIVTEVGGRDELNHHIPHWKLLSCPEDL  356

Query  1196  WCI  1204
             WCI
Sbjct  357   WCI  359



>ref|XP_003551239.1| PREDICTED: probable N-acetyltransferase HLS1-like [Glycine max]
Length=391

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 222/363 (61%), Gaps = 19/363 (5%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R YE + D+  VE+LE +CEVG      L  D + DPI R+RN+P+++M+VAE  +  E
Sbjct  8     IRSYEGQSDRAQVEDLERRCEVGPSESVFLFTDTMGDPICRIRNSPMYMMLVAE--LDNE  65

Query  320   IVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGR  496
             +VGVI+GSI+ V+  G   K     D   V Y+LGLRVS QHRR GIG+ LV++LE W  
Sbjct  66    LVGVIQGSIKVVTVHGHPPK-----DLAKVGYVLGLRVSPQHRRKGIGSSLVRTLEEWFT  120

Query  497   SNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQ  676
             S   DY YMAT+  N AS++LF     Y KFRTP++LV PV+ H   I  ++ + R+   
Sbjct  121   SKDVDYAYMATEKDNHASVSLFMDKFGYTKFRTPAILVNPVNHHCFQISPNIEIARLKID  180

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS-GVFPTNHAIL  853
              AE  YRR F GS+EFFP DI  +L NKL+LGT++A  K  ++  +  S G  P + A+L
Sbjct  181   QAEYLYRR-FMGSTEFFPNDIGNILRNKLSLGTWVAYFKGDIAWGDFGSDGQVPNSWAML  239

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             S+W++ E++K++   L     +C + T+   ++ ++ P ++LP++P+    FG+YF++G+
Sbjct  240   SVWNSGEIFKLR---LGKAPFSCLVCTKSWWLIHKIFPCLKLPTIPDFFNPFGFYFMYGV  296

Query  1025  RMEGQSGSEMMESLWAFAHNVA--RNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
               EG    +++ +L  F HN+     D   C +++ EV   D +   IPHWK  S  +DL
Sbjct  297   HHEGPFSGKLVRALCQFVHNMGAESKDESNCRIIVTEVGGRDELNHHIPHWKLLSCPEDL  356

Query  1196  WCI  1204
             WCI
Sbjct  357   WCI  359



>ref|XP_009421102.1| PREDICTED: probable N-acetyltransferase HLS1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 233/375 (62%), Gaps = 23/375 (6%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-HGI  310
             +VVR+Y+ E D+ A E ++  CEVG  GK  L +DLL DP+ R+R++P ++M+VAE  G 
Sbjct  8     IVVREYDAETDRSAAEAVDRICEVGTSGKVSLCMDLLGDPVSRIRHSPAYLMLVAETSGP  67

Query  311   SKEIVGVIRGSIRSVSRGQK----GKNDNSTD-------YVDVAYILGLRVSSQHRRLGI  457
              +EIVGVIRGS++ V+ G+K    G     T        Y  V YILGLRV   HRR+GI
Sbjct  68    VREIVGVIRGSVKIVACGRKMPRQGGGGTRTHGPAAAPIYTKVGYILGLRVLPSHRRMGI  127

Query  458   GTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP  637
             G KLV+ +E W    GA+Y YMAT   N AS+ LFTG   Y KFRTPS+LV PV  H+ P
Sbjct  128   GLKLVKRMEEWFGEKGAEYAYMATTKGNDASLGLFTGC-GYSKFRTPSILVHPVFVHRLP  186

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVP-----KESL  802
             +    AV+R+PP  AE  YRR    ++EFFP+DI+ VL N L++ T +AVP      E  
Sbjct  187   VPRSAAVLRIPPADAEVIYRRRL-AATEFFPRDIDAVLANPLSVVTLLAVPAGCAASERW  245

Query  803   STWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVP  982
             S  E      P + AI S+WD   V++++++G S L++A    TR  DR +PW+R+PSVP
Sbjct  246   SGAEAFLAAPPESWAIASVWDCGGVFRLEIRGASRLRRAAAAATRAADRAMPWLRIPSVP  305

Query  983   NVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGI  1162
             ++ + FG +FL+G+  EG + + M  ++W  AHN AR       ++ AEV+  +P+RRGI
Sbjct  306   DLFRPFGAWFLYGIGGEGPAAATMAAAVWREAHNTARGAA---AVVAAEVAETEPLRRGI  362

Query  1163  PHWKNFSW-QDLWCI  1204
             P W+  S   D+WC+
Sbjct  363   PRWRLLSGADDVWCV  377



>ref|XP_009338961.1| PREDICTED: probable N-acetyltransferase HLS1-like [Pyrus x bretschneideri]
Length=392

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/406 (39%), Positives = 237/406 (58%), Gaps = 23/406 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E ++R Y+   D+  VE+LE +CEVG   +  L  D L DPI R+RN+P+H M+VAE  +
Sbjct  5     EAIIRSYDGMADRGRVEDLERRCEVGPSERVFLFTDTLGDPICRIRNSPMHKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI++V+        N  D   V YILGLRVS  +RR GIG+ LV  LE W
Sbjct  63    DNQLVGVIQGSIKAVTLHNSKSPPN--DQAKVGYILGLRVSPLYRRKGIGSSLVSKLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N ADY YMAT+  N AS+ LF     YVKFRTP++LV PV    + + S V + ++ 
Sbjct  121   FTDNDADYAYMATEKDNHASVRLFMTKFGYVKFRTPAILVNPVCYSPRHVSSGVEIAKLK  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPD-SGVFPTNHA  847
              + AE  YR+  + ++EFFP DI+ VL N L+LGT++A P+  L   +   +G  P + A
Sbjct  181   VEEAEYLYRKCME-NTEFFPHDIDKVLGNNLSLGTWVAYPRGELKVGDFGVNGHLPDSWA  239

Query  848   ILSIWDAKEVYKVQVKG--LSALKQACFLGTRVLDRLIPWIR-LPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++ +++    LS L  A     + + R+ P  + LPS+P+    FG+YF++
Sbjct  240   MLSVWNSGELFNLRLGNAPLSCLMYA--KSWKWMARVFPCFKLLPSMPDFFTPFGFYFMY  297

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS-WQDL  1195
             GL  EG    +++ +L  F HNVA      C++++ EV   DPVR  IPHWK  S ++DL
Sbjct  298   GLHHEGPLSGKLVRALCQFVHNVAATTSENCKVIVTEVGGCDPVRHHIPHWKLLSCYEDL  357

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WCI             K  +   +S  +    H + +L FVDPR++
Sbjct  358   WCI----------KALKNEDRRTNSLHELTKTHPTKSL-FVDPREV  392



>ref|XP_006843651.1| hypothetical protein AMTR_s00007p00176580 [Amborella trichopoda]
 gb|ERN05326.1| hypothetical protein AMTR_s00007p00176580 [Amborella trichopoda]
Length=380

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/363 (42%), Positives = 217/363 (60%), Gaps = 17/363 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ +R +E+ +D   VE LE  CEVG      L  D++ DPI RVRN P + M+VAE  +
Sbjct  4     EIRIRPFEKLKDSGMVETLERSCEVGPSTT--LFTDMMGDPISRVRNCPHYTMLVAE--L  59

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
                IVGVIRGSI++V     G          V Y+LGLRVS  HRR GIG +LVQ LE W
Sbjct  60    QGLIVGVIRGSIKTVL--CTGGGGRGPVQAKVGYVLGLRVSRMHRRRGIGLRLVQCLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                NGA+Y YMATD  N AS+ LFT    Y KFRTP+VLV PV  + K I S V V ++ 
Sbjct  118   LVENGAEYAYMATDKDNVASVKLFTERCGYAKFRTPTVLVNPVCPYPKRIPSWVRVQKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF-----P  835
             P  AE+ YR+     SEFFP DI+ VL N+L+LGT++A  ++   TW    GV      P
Sbjct  178   PDQAETLYRQYMGSQSEFFPDDIDRVLRNELSLGTWIAYLRD--ETWH---GVLTGESPP  232

Query  836   TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
             ++ A++S+W++  ++K++V         C  G+ +L R + ++RLP  P+V + FG+ F+
Sbjct  233   SSWAVVSVWNSAGMFKLRVGNAPTGYALCARGSAILARALSFLRLPFFPDVFRWFGFLFM  292

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSWQDL  1195
             +GL M+G SG ++  +L  + HN     R+ C +++ E+   D +R  +PH K+ S QDL
Sbjct  293   YGLYMQGPSGGDLTRALCHWVHNFT-AKRKDCRVVVTELGALDSLRSHVPHKKSLSCQDL  351

Query  1196  WCI  1204
             WC+
Sbjct  352   WCV  354



>gb|KEH27507.1| acyl-CoA N-acyltransferase (NAT) superfamily protein [Medicago 
truncatula]
Length=332

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 201/304 (66%), Gaps = 15/304 (5%)
 Frame = +2

Query  329   VIRGSIRSVSRGQKGKNDNST------DYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
             +IRG I++V+ G+      ++       Y  +AYILGLRVS   RR+GIG KLV+ +E W
Sbjct  1     MIRGCIKTVTCGKNLSRSKTSVTKHIPIYTKLAYILGLRVSPNQRRMGIGLKLVKKMEAW  60

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
              + NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV+ H+  I   V ++ + 
Sbjct  61    FKDNGAEYSYMATETENLASVKLFTEKCGYTKFRTPSILVNPVYAHRTKISRKVTIIPLT  120

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS--TWE-PDSGVF--P  835
             P  A  +YR  F  ++EFFP DI+ V+NNKL+LGTF+AVP  S S  TW  PD  +   P
Sbjct  121   PSDAVIFYRNRFS-TTEFFPNDIDAVVNNKLSLGTFLAVPSGSYSVKTWPGPDRFLLGPP  179

Query  836   TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
              + AILS+W++KEV+K++V+G S +K+     TR+LDR +PW+++PSVP++ + FG++FL
Sbjct  180   CSWAILSVWNSKEVFKLEVRGASRVKRGLAKTTRILDRALPWLKVPSVPDLFRPFGFHFL  239

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QD  1192
             +GL  EG    +M+++L  FAHN+A     GC ++  EV+  +P+R GIPHWK  S   D
Sbjct  240   YGLGGEGPKKLKMVKALCEFAHNLAMEC--GCGVVATEVASCEPLRFGIPHWKMLSCAND  297

Query  1193  LWCI  1204
             LWCI
Sbjct  298   LWCI  301



>ref|XP_010043411.1| PREDICTED: probable N-acetyltransferase HLS1-like [Eucalyptus 
grandis]
 gb|KCW85413.1| hypothetical protein EUGRSUZ_B02233 [Eucalyptus grandis]
Length=397

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 246/416 (59%), Gaps = 41/416 (10%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCE-VGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHG  307
             E+ +R Y+ E+D+  VEELE  CE VG   +  L  D L DPI R+RN+P   M+VAE  
Sbjct  8     ELKIRSYDGEKDRARVEELERGCEIVGPADRVFLFTDTLGDPICRIRNSPSFYMLVAES-  66

Query  308   ISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLEN  487
                E+VGVI+GSI+ V+     +    +    V YILGLRVS  HRR GIG++LV+SLE 
Sbjct  67    -DNELVGVIQGSIKLVT---MARPHGKSGLARVGYILGLRVSPLHRRQGIGSRLVRSLEQ  122

Query  488   WGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK-PIGSDVAVVR  664
             W  SN  ++ YMATD  N+AS+ LF  +L YVKFRTP++LV PV  ++   + S V + +
Sbjct  123   WFASNHVEFAYMATDKENKASVKLFVDSLGYVKFRTPAILVNPVSPYRALHLPSHVEIKK  182

Query  665   VPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWE----------  814
             +  + AE  YR+ F  S+EFFPKDI+ +L N+L+LGT++A  K     WE          
Sbjct  183   LGTKEAELLYRK-FMSSAEFFPKDIDNILENRLSLGTWVAYYKG--EAWEDIRYDGASTG  239

Query  815   PDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPN  985
              +    P N A++S+W++ EV+K++V+G + L  +C++ T   +++DR  P  ++P++P+
Sbjct  240   SEYWRGPRNWAMVSVWNSAEVFKLRVQGRAPL--SCWIYTKSCKLMDRFFPCFKIPAIPD  297

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIP  1165
                 FG+YF++G+  EG+S ++++ +L  F  N+AR     C+L++ E+   D VR  IP
Sbjct  298   FVDPFGFYFMYGVHCEGKSSAQLVRTLCQFVRNMARKS-EDCKLVVTEIGARDEVRLDIP  356

Query  1166  HWKNFSWQDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
              WK    +DLWCI             KA N    SS   I     +  +FVDPR++
Sbjct  357   QWKCL--EDLWCI-------------KALNNQEPSSLHEIAMSPPTRALFVDPREV  397



>ref|XP_009369588.1| PREDICTED: probable N-acetyltransferase HLS1-like [Pyrus x bretschneideri]
Length=392

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 236/406 (58%), Gaps = 23/406 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E ++R Y+   D+  VE+LE +CEVG   +  L  D L DPI R+RN+P+H M+VAE  +
Sbjct  5     EAIIRSYDGMADRGRVEDLERRCEVGPSERVFLFTDTLGDPICRIRNSPMHKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI++V+        N  D   V YILGLRVS  +RR GIG+ LV  LE W
Sbjct  63    DNQLVGVIQGSIKAVTLHNSKSPPN--DQAKVGYILGLRVSPLYRRKGIGSSLVSKLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N A Y YMAT+  N AS+ LF     YVKFRTP++LV PV    + + S V + ++ 
Sbjct  121   FTDNDAHYAYMATEKDNHASVRLFMTKFGYVKFRTPAILVNPVCYSPRHVSSGVEIAKLK  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPD-SGVFPTNHA  847
              + AE  YR+  + ++EFFP DI+ VL N L+LGT++A P+  L   +   +G  P + A
Sbjct  181   VEEAEYLYRKCME-NTEFFPHDIDKVLGNNLSLGTWVAYPRGELKVGDFGVNGHLPDSWA  239

Query  848   ILSIWDAKEVYKVQVKG--LSALKQACFLGTRVLDRLIPWIR-LPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++ +++    LS L  A     + + R+ P  + LPS+P+    FG+YF++
Sbjct  240   MLSVWNSGELFNLRLGNAPLSCLMYA--KSWKWMARVFPCFKLLPSMPDFFTPFGFYFMY  297

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS-WQDL  1195
             GL  EG    +++ +L  F HNVA      C++++ EV   DPVR  IPHWK  S ++DL
Sbjct  298   GLHHEGPLSGKLVRALCQFVHNVAATTSENCKVIVTEVGGCDPVRHHIPHWKLLSCYEDL  357

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WCI             K  +   +S  +    H + +L FVDPR++
Sbjct  358   WCI----------KALKNEDRRTNSLHELTKTHPTKSL-FVDPREV  392



>ref|XP_002461340.1| hypothetical protein SORBIDRAFT_02g001200 [Sorghum bicolor]
 gb|EER97861.1| hypothetical protein SORBIDRAFT_02g001200 [Sorghum bicolor]
Length=421

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 229/395 (58%), Gaps = 29/395 (7%)
 Frame = +2

Query  92    MSFKVAAVAE-----KLPEVVVRQYE--EERDKVAVEELESQCEVG-QEGKPRLVIDLLD  247
             M+  VAAV E         V VR+++   +RD+ AV+ LE  CEVG   GK  L  DLL 
Sbjct  1     MAVVVAAVEEDGGGPAEEAVTVREFDGTSDRDRAAVDRLERACEVGPSAGKLCLFTDLLG  60

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVI-----RGSIRSVSRGQKGKNDNSTDYVDVAY  412
             DP+ RVR++P  +M+VAE G      G       RG +++V+ G+    D+   +  VAY
Sbjct  61    DPLCRVRHSPAFLMLVAEAGAGGAAGGGEVVGVVRGCVKTVACGRGRGQDHL--FSKVAY  118

Query  413   ILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFR  592
             +LGLRVS  HRR GIG  LV  +E W R  GADY Y+ATD  N+ S+ LFT    Y KFR
Sbjct  119   LLGLRVSPAHRRRGIGRALVARMEEWFRQAGADYAYVATDRGNEPSVRLFTSRCGYAKFR  178

Query  593   TPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLG  772
             TPSVLV PV RH       VAV+RVPP+ AE  YR  F G  EFFP+DI+ VL+N L+LG
Sbjct  179   TPSVLVHPVFRHDLAPPRRVAVIRVPPRDAELLYRARFAG-VEFFPRDIDAVLSNPLSLG  237

Query  773   TFMAVP----KESLSTWEPDSGVF---PTNHAILSIWDAKEVYKVQVKG----LSALKQA  919
             TF+AVP      +L TW          P + A+ S+W++K+ ++++V+G      A  +A
Sbjct  238   TFLAVPAASSSAALCTWRGAEAFLASPPPSWAVGSVWNSKDAFRLEVRGAPRLWRAAARA  297

Query  920   CFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARND  1099
                  R L R +P +R+PSVPN+ + FG +FL+GL   G     M  +L   AHNVAR  
Sbjct  298   TRAADRALSRWLPLLRVPSVPNLFEPFGMHFLYGLGGAGPDAPRMATALCRHAHNVAR--  355

Query  1100  RRGCELLIAEVSPDDPVRRGIPHWKNFSWQDLWCI  1204
             R G  ++  EV+  DP+R  +PHW     +DLWCI
Sbjct  356   RAGARVVATEVAACDPLRDAVPHWPRLGAEDLWCI  390



>ref|XP_002299994.1| hypothetical protein POPTR_0001s28630g [Populus trichocarpa]
 gb|EEE84799.1| hypothetical protein POPTR_0001s28630g [Populus trichocarpa]
Length=384

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 225/363 (62%), Gaps = 18/363 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ +R Y+ +  +  VE+LE +CEVG   +  L ID + DPI R+RN+P+  M+VAE G 
Sbjct  5     ELKIRSYDVQVHRAGVEDLERRCEVGPTER-VLCIDTMGDPICRIRNSPMCKMLVAELG-  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGVI+GSI+  +  +  KN        + Y+LGLR++  HRR GIG++LV  LE W
Sbjct  63    -SELVGVIQGSIKLATVHKPPKN-----IAKLGYVLGLRIAPLHRRKGIGSRLVLELEKW  116

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  DY YMAT+  N+AS+NLF   L Y  FRTP++LV PV      + S   V ++ 
Sbjct  117   FIANDVDYAYMATEKDNEASVNLFINKLGYANFRTPAILVNPVDHRALRLSSKTEVAKLK  176

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YR+ F  S+EFFP DI  +L NKL+LGT++A P+ ES   +  D  V P + A
Sbjct  177   VEEAEFLYRK-FMTSTEFFPDDIGNILRNKLSLGTWVAYPRGESWDDFGSDGKVLPRSWA  235

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTR---VLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++K++   L     +CFL T+   ++D++ P  +LP++P+    FG+YF++
Sbjct  236   MLSVWNSGELFKLR---LGKAPLSCFLYTKSSILIDKIFPCFKLPAIPDFLSPFGFYFMY  292

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    ++++ L  F HN+A    + C++++ EV   D +R  IP+WK+ S  +DL
Sbjct  293   GVHHEGSLSGKLVQHLCQFVHNMA-TKSKDCKVIVTEVGGKDILRLHIPYWKSLSCPEDL  351

Query  1196  WCI  1204
             WCI
Sbjct  352   WCI  354



>emb|CDP09222.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 230/375 (61%), Gaps = 21/375 (6%)
 Frame = +2

Query  110   AVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVM  289
             A+ EK   + +R Y+ E DKV VE+LE  CEVG      L  D + DPI R+RN+P++ M
Sbjct  2     AIFEK---IKIRSYDWEIDKVRVEDLERGCEVGPAEHVFLFTDTMGDPISRIRNSPMYNM  58

Query  290   MVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKL  469
             +VAE  ++ EIVGVI+GSI+ V+     KN        V Y+LGLRV+ +HRR GI   L
Sbjct  59    LVAE--LNDEIVGVIQGSIKVVTLHTSPKNH----LAKVGYVLGLRVAPRHRRKGIALSL  112

Query  470   VQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSD  649
             V  +E W  ++  +Y YMAT+  NQASINLF   L YV+FRTP++LV PV+     + S 
Sbjct  113   VHHMEEWFVTHQVEYAYMATEKDNQASINLFVNKLGYVEFRTPAILVHPVYNRSFRLSSS  172

Query  650   VAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK------ESLSTW  811
             V ++++    AE  YR+ F  S+EFFP DIN +L NKL+LGT++A  +       S   +
Sbjct  173   VEIMKLKIDQAEFLYRK-FMSSTEFFPHDINRILRNKLSLGTWVAYFRRGDHESSSRGGF  231

Query  812   EPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVS  991
               D G+ P + A++S+W + EV K++V   +         +R+L+ ++P  R+PS+P+ S
Sbjct  232   GLDGGI-PNSWAMMSVWRSTEVIKLRVGKPTLSCMFYAKSSRMLESVLPCFRVPSLPDFS  290

Query  992   KN-FGYYFLFGLRMEGQSGSEMMESLWAFAHNVAR--NDRRGCELLIAEVSPDDPVRRGI  1162
             +N FG+YF++G   EG S  +++ +L  F HN+AR  + +  C++++ EV   D ++  I
Sbjct  291   ENPFGFYFIYGFHREGPSSGKLVRTLCRFVHNLARESDGKEECKVIVTEVGGSDELKLHI  350

Query  1163  PHWKNFSW-QDLWCI  1204
             PHWK  S  +DLWCI
Sbjct  351   PHWKLLSCPEDLWCI  365



>ref|XP_004294308.1| PREDICTED: uncharacterized protein LOC101311451 [Fragaria vesca 
subsp. vesca]
Length=399

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/413 (38%), Positives = 240/413 (58%), Gaps = 26/413 (6%)
 Frame = +2

Query  125   LPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH  304
             L E  +R Y+ E D+  VE+LE +CEVG   +  L  D + DPI R+RN+P+H M+VAE 
Sbjct  3     LKEAEIRCYDGEADRARVEDLERRCEVGPTERVYLFTDTMGDPICRIRNSPMHKMLVAE-  61

Query  305   GISKEIVGVIRGSIRSVSRGQKGK-NDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSL  481
              +  ++VGVI+GSI+ V+   K     +  +   V YILGLRV+  HR+ GIG++LV  L
Sbjct  62    -LDNQLVGVIQGSIKWVTVHNKPPPGQHEANLSRVGYILGLRVAPLHRQKGIGSRLVCCL  120

Query  482   ENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVV  661
             E+W  +N  DY YMAT+  N+AS+ LF     Y+KFRTP++LV PV    + + SDV + 
Sbjct  121   EDWFVANDVDYAYMATEKDNEASVRLFMEKFGYIKFRTPAILVNPVRYRPRHVSSDVEIA  180

Query  662   RVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPT  838
             ++  + AE  Y RN   S++FFP DI+ VL NKL+LGT++A P+ ES   +  +    P 
Sbjct  181   KLKVEEAEFLY-RNCMASTDFFPHDIDKVLGNKLSLGTWVAYPRGESFCKFGSNGEAIPK  239

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIR-LPSVPNVSKNFGY  1006
             + A++S+W++ EV+ ++   L     +C L     R++DR +P  + LPS+P+    FG+
Sbjct  240   SWAMISVWNSGEVFTLR---LGKAPLSCLLYAKSWRLMDRFLPCFKLLPSMPDFFNPFGF  296

Query  1007  YFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRG--CELLIAEVSPDDPV-RRGIPHWKN  1177
             YF++G+  EG    +++ +L  F HN+A+   +   C++++ EV   D V R  IPHWK 
Sbjct  297   YFMYGVYHEGPLSGKLVRNLCHFVHNMAKTTTKNYCCKVVVTEVGGCDSVLRHNIPHWKL  356

Query  1178  FSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
              S  +DLWCI             K       S  +      ++  +FVDPR++
Sbjct  357   LSCSEDLWCI----------KAMKMNEADRTSLHELTKTQQTNKALFVDPREV  399



>ref|XP_009401028.1| PREDICTED: probable N-acetyltransferase HLS1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401029.1| PREDICTED: probable N-acetyltransferase HLS1-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 167/416 (40%), Positives = 247/416 (59%), Gaps = 33/416 (8%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH-GI  310
             +VVR+Y+ + D+ A E ++  CEVG  GK  L +DLL DP+ RVR++P ++M+VAE  G 
Sbjct  3     IVVREYDAKTDRSAAEAVDRMCEVGTSGKASLCMDLLGDPLSRVRHSPAYLMLVAETTGP  62

Query  311   SKEIVGVIRGSIRSVS-------RGQKGKNDNSTD-YVDVAYILGLRVSSQHRRLGIGTK  466
              KEIVGV+RGS++ ++       +G  G   + T  Y  V Y+LGLRV   HRR+G+G +
Sbjct  63    VKEIVGVVRGSVKVIACGRNNPRQGGGGTMKSRTPVYTKVGYVLGLRVLPSHRRIGVGLE  122

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGS  646
             LV+ +E+W R   A+Y YMAT+  N AS+ LFTG   Y KFRTPS+LV PV  H+  +  
Sbjct  123   LVKRMEDWFREKAAEYAYMATEKGNAASLRLFTGRCGYTKFRTPSILVHPVFAHRFALPR  182

Query  647   DVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLST--WEPD  820
               AV+R+PP  AE+ YRR F  ++EFFP+DI+ VL N L++ T +AVP    +   W P 
Sbjct  183   CAAVLRLPPAYAEAIYRRRFS-ATEFFPRDIDAVLANPLSVATLLAVPAGCAAAERW-PG  240

Query  821   SGVF----PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNV  988
                F    P + A+ S+WD+  V++++V+G S L++A    TR  DR  PW+R+PSVP++
Sbjct  241   VEAFLAAPPESWAMASVWDSGGVFQLEVRGASRLRRAAAAATRAADRAAPWLRIPSVPDL  300

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
              + F  +FL+G+  EG   + M  ++W  AHN A        ++  EV+  +P+R+GIP 
Sbjct  301   FRPFRAWFLYGIGGEGPEAAAMAAAVWRVAHNGAMGAA---AVVAVEVAETEPLRQGIPR  357

Query  1169  WKNFS-WQDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             W+  S  +D+WC+K L     +            SS            IFVDPR++
Sbjct  358   WRQLSVAEDVWCVKRLAEEYSDGAVGDWTKSAPGSS------------IFVDPREL  401



>ref|XP_009354026.1| PREDICTED: probable N-acetyltransferase HLS1 [Pyrus x bretschneideri]
Length=390

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 238/405 (59%), Gaps = 23/405 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E ++R Y+   D+  VE+LE +CEVG   +  L  D + DPI R+R++P+H M+VAE  +
Sbjct  5     EAIIRSYDGLVDRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRSSPMHKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+   K    N  D   V YILGLRVS  +RR GIG+ LV  LE W
Sbjct  63    DNQLVGVIQGSIKVVTVHHKKPPPN--DQAKVGYILGLRVSPLYRRKGIGSNLVSKLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N ADY YMAT+  N AS+ LF     YV+FRTP++LV PV    + + S+V + ++ 
Sbjct  121   FIDNDADYAYMATEKDNLASVRLFITKFGYVRFRTPAILVNPVRYRPRHVSSNVEIAKLK  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAI  850
              + AE  YR+    ++EFFP DI+ VL NKL+LGT++A P+  L  +    G  P + A+
Sbjct  181   VEEAEYLYRKCM-ANTEFFPHDIDKVLGNKLSLGTWVAYPRGELKDFGV-HGHLPESWAM  238

Query  851   LSIWDAKEVYKVQVKG--LSALKQACFLGTRVLDRLIPWIR-LPSVPNVSKNFGYYFLFG  1021
             LS+W++ E++ +++    LS L  A     + + R+ P  + LPS+P+    FG+YF++G
Sbjct  239   LSVWNSGELFNLRLGNAPLSCLMYA--KSWKWMARVFPCFKLLPSMPDFFIPFGFYFMYG  296

Query  1022  LRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS-WQDLW  1198
             L  EG    +++ +L  F HN+A      C++++ EV   DPVR  IPHWK  S ++DLW
Sbjct  297   LHHEGPLSGKLVRALCQFVHNMAATTSENCKVIVTEVGGCDPVRHHIPHWKLLSCYEDLW  356

Query  1199  CIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             CI             K+ +   +S  +    H + +L FVDPR++
Sbjct  357   CI----------KALKSEDRRTNSVHEFTRTHPTKSL-FVDPREV  390



>ref|XP_008645325.1| PREDICTED: probable N-acetyltransferase HLS1 [Zea mays]
 gb|AFW70433.1| hypothetical protein ZEAMMB73_003289 [Zea mays]
 gb|AIB04778.1| GNAT transcription factor, partial [Zea mays]
Length=433

 Score =   268 bits (686),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 167/426 (39%), Positives = 233/426 (55%), Gaps = 37/426 (9%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKP------------------------RLVIDLLD  247
             VR ++ ERD  AVEELE  C+VG  G                           L ++ + 
Sbjct  17    VRGFDVERDLRAVEELERLCQVGLSGDQGSDPVADLDGGAKKTRSSKKKKGMSLYVEQIG  76

Query  248   DPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKN--DNSTDYVDVAYILG  421
             DP  RVR+A  +VM+VAE+G   E+VGVI+   R VSRG+K ++   +S  +V VA +LG
Sbjct  77    DPFARVRHATDNVMLVAEYGEKDEVVGVIKACTRMVSRGKKQQSFSGSSKQFVKVACLLG  136

Query  422   LRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPS  601
             LRVS  HRRLGI T+LV+  E+W  + GA Y  MAT  SN AS+ LFTG   Y  FR P 
Sbjct  137   LRVSPSHRRLGIATELVRHAESWCAARGAAYATMATTESNAASLALFTGRFAYAPFRRPV  196

Query  602   VLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSS-EFFPKDINLVLNNKLNLGTF  778
              L  PVHRH+  I     V+R+PP LA + Y      S+ EF P D+  +LN+KL LGT+
Sbjct  197   FLGHPVHRHRVRIPRAHRVLRLPPPLASAAYAALLPPSAAEFLPADLPALLNHKLTLGTY  256

Query  779   MAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIP  958
             +A+ +       P+      + A+LS+WDA    +++V G   L +A     R LDR  P
Sbjct  257   LAIQRGGGGGGGPEDPARTPSFALLSVWDATRSLRLRVGGAPTLLRASLAAARALDRHAP  316

Query  959   WIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSP  1138
             W+++PSVP++ + FG Y L+GLRM G  G  ++ SL   AHNVAR +   C +L A++ P
Sbjct  317   WLQVPSVPDIFRPFGTYLLYGLRMSGPEGPALLRSLCRHAHNVARKN-PACAVLAADLGP  375

Query  1139  DDPVRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIF  1315
             DDP +  +PHW  FS  +D+WCI               A     + +D        +++F
Sbjct  376   DDPTKAVVPHWPKFSCDEDVWCI--------KKLGTSTAGGNAGNGDDDWATSPPPSVLF  427

Query  1316  VDPRDI  1333
             VDPR+ 
Sbjct  428   VDPREF  433



>dbj|BAJ87030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 175/435 (40%), Positives = 243/435 (56%), Gaps = 44/435 (10%)
 Frame = +2

Query  101   KVAAVAEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKP----------------RLV  232
             +VAAV     EV VR+ + ERD  AVEELE +CEVG  G                   L 
Sbjct  9     RVAAV-----EVTVREVDVERDLPAVEELERRCEVGLSGDQADDGGKKKTTTKKKSMSLC  63

Query  233   IDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKND------NSTD  394
             ++ + DP+ RVR+AP HVM+VAE G  +E+VGVI+  I+ VSRG  G +           
Sbjct  64    VEQIGDPLARVRHAPEHVMLVAECG--EEMVGVIKACIKMVSRGSSGSSSSSGSVAKQPA  121

Query  395   YVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTL  574
             YV VA+ILGLRVS  HRR G+ T LVQ+ E W R  GA +  MAT  SN+AS+ LF G  
Sbjct  122   YVKVAFILGLRVSPSHRRQGVATALVQAAEEWSRGRGAAHATMATTASNKASLGLFAGRF  181

Query  575   NYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGS-SEFFPKDINLVL  751
              Y  FR P +L +PVH    P+ S   V+++PP LA + Y R      +EF P D+  +L
Sbjct  182   GYAPFRRPVLLGRPVHARWLPVTSRHRVLQLPPTLAAAAYARLLPPQDTEFLPADLPALL  241

Query  752   NNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLG  931
              +KL LGTF+A+  ES +     S     + A+LS+WD     +++V G  AL +     
Sbjct  242   AHKLTLGTFVAI--ESSNAAGTGSDTASPSFAVLSVWDQTRSLRLRVDGAPALLRHSLAA  299

Query  932   TRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGC  1111
              R LDR+ PW+R+PSVP++ + FG Y ++G+RM G  G  ++ +L + AHN+ARN+   C
Sbjct  300   VRALDRVAPWLRVPSVPDIFRPFGAYLIYGVRMSGPEGPALLRTLCSHAHNMARNN-PAC  358

Query  1112  ELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIM  1288
              ++ A++SPDDP    IP W+ FS  +D+WCI           N    N    SS D   
Sbjct  359   GVVAADLSPDDPAAAAIPSWRRFSCDEDVWCI----------KNLSDNNATPTSSSDWPA  408

Query  1289  YHDSSALIFVDPRDI  1333
                  +++FVDPR+ 
Sbjct  409   SAPPGSVLFVDPREF  423



>ref|XP_004153722.1| PREDICTED: uncharacterized protein LOC101222130 [Cucumis sativus]
Length=389

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/373 (40%), Positives = 228/373 (61%), Gaps = 26/373 (7%)
 Frame = +2

Query  107   AAVAEKLPEV-VVRQYE-EERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPL  280
             AA+A    E+ ++R Y+ +  D+  VE+LE +CEVG   +  L  D + DPI R+RN+PL
Sbjct  4     AAIARVHEEILIIRSYDGQSADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRNSPL  63

Query  281   HVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIG  460
             + M+VAE  +  ++VGVI+GSI+ V+  Q  K     D   V Y+LGLRV+   RR GIG
Sbjct  64    YKMLVAE--VDNQLVGVIQGSIKVVTVHQAPK-----DRAKVGYVLGLRVAPSFRRRGIG  116

Query  461   TKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPV-HRHKKP  637
               LV+ LE W   N  DY YMAT+  N+AS+ LF   L Y  FR P++LV PV H     
Sbjct  117   CSLVRRLEEWFMINDVDYAYMATEKDNEASVKLFINKLGYTNFRVPAILVNPVKHYRSYQ  176

Query  638   IGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEP  817
             + S++ + R+   +AE  YR+ F  S+EFFP DI+ VL +KL+LGT++A  K+       
Sbjct  177   LPSNIQIARLKVDVAEFLYRK-FMASTEFFPHDIDHVLKHKLSLGTWVAYYKD-------  228

Query  818   DSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNV  988
             D    P + A+LS+W++ EV+K++   L     +C + T   +V+D++ P ++LPS+P+ 
Sbjct  229   DDITIPKSWAMLSVWNSGEVFKLR---LGKAPLSCLIYTESSKVIDKIFPCLKLPSIPDF  285

Query  989   SKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPH  1168
              + FG+YF++G+  EG    +++ +L  + HN+A    R C++++ E+  +D +R  IPH
Sbjct  286   YEPFGFYFMYGVHREGTGTGKLVRALCQYVHNMAAA-ARDCKVIVTEIGGEDSLREEIPH  344

Query  1169  WKNFSW-QDLWCI  1204
             WK  S  +DLWCI
Sbjct  345   WKLLSCPEDLWCI  357



>ref|XP_001782216.1| predicted protein [Physcomitrella patens]
 gb|EDQ52967.1| predicted protein [Physcomitrella patens]
Length=416

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/377 (40%), Positives = 216/377 (57%), Gaps = 25/377 (7%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
              +++R+Y E  D   +   + + E+G  G   L  D L DP+ RVR+ P   M+VAE  I
Sbjct  15    HIIIRKYNE-FDVKQLAAFDKRVEMGPAGSESLTFDWLGDPLCRVRHLPAFHMLVAE--I  71

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTD---YVDVAYILGLRVSSQHRRLGIGTKLVQSL  481
               EIVGVIRGS++ V   Q     +      Y  V Y+LGLRV  +HRR+GI  KLVQS+
Sbjct  72    GGEIVGVIRGSVKEVVCSQSAACSDKASIRKYARVGYLLGLRVCPRHRRIGIAFKLVQSM  131

Query  482   ENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVV  661
             E W R    +Y+YMAT+  N+AS+ LFT  L+Y  FRTP + +QPVH H + I S + + 
Sbjct  132   EEWCREQDVEYVYMATEKDNEASLKLFTERLSYRHFRTPGIFIQPVHVHDRRISSRIQLT  191

Query  662   RVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES-----LSTWEPDSG  826
             ++ P  A + Y      ++EFFPKDI+ VL NKL  GT++A  KES     L+ +  + G
Sbjct  192   KIAPDHAVALYSATM-STAEFFPKDIDAVLRNKLCEGTWIASFKESRLDEELNNFACEGG  250

Query  827   ----------VFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPS  976
                           + A+LS+W + ++++ + K  S  K+     +R++D  +P  R+PS
Sbjct  251   RGGKVVDASWAKGASWAMLSVWRSNDLFQCEYKNASWFKKTGAALSRLVDFCLPGCRVPS  310

Query  977   VPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRR  1156
             VPN    FG  F+FGL  EG  G E++ SL   AHN+AR +   C+ +++EV+P DP   
Sbjct  311   VPNFFHPFGVQFMFGLHCEGDGGPELLHSLCWHAHNLARKN--DCKAVMSEVAPTDPAWN  368

Query  1157  GIPHWKNF-SWQDLWCI  1204
              IPHWK   S +D+WCI
Sbjct  369   SIPHWKRLSSTEDIWCI  385



>ref|XP_008354926.1| PREDICTED: probable N-acetyltransferase HLS1 [Malus domestica]
Length=390

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 153/406 (38%), Positives = 235/406 (58%), Gaps = 25/406 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E ++R Y+   D+  VE+LE +CEVG   +  L  D + DPI R+R++P+H M+VAE  +
Sbjct  5     EAIIRSYDGLADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRSSPMHKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+        N  D   V YILGLRVS  +RR GIG+ LV  LE W
Sbjct  63    DNQLVGVIQGSIKVVTVHHNKPPPN--DQAKVGYILGLRVSPLYRRKGIGSNLVSKLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N ADY YMAT+  N AS+ LF     Y++FRTP++LV PV    + + S+V + ++ 
Sbjct  121   FIDNDADYAYMATEKDNLASVRLFXTKFGYIRFRTPAILVNPVRYRPRHVSSNVEIAKLK  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAI  850
              + AE  YR+  + ++EFFP DI  VL NKL+LGT++A P+  L  +  + G  P + A+
Sbjct  181   VEEAEYLYRKCME-NTEFFPHDIEKVLGNKLSLGTWVAYPRGELRDFGVN-GHLPESWAM  238

Query  851   LSIWDAKEVYKVQVKGLSALKQACFLGTRV---LDRLIPWIR-LPSVPNVSKNFGYYFLF  1018
             LS+W++ E++ ++   L     +C +  +    + R+ P  + LPS+P+    FG+YF++
Sbjct  239   LSVWNSGELFNLR---LGNAPLSCLMYAKXWKWMARVFPCFKLLPSMPDFFXPFGFYFMY  295

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             GL   G    +++ +L  F HN+A      C++++ EV   DPVR  IPHWK  S  +DL
Sbjct  296   GLHHXGPLSGKLVRALCQFVHNMAATTSENCKVIVTEVGGCDPVRHHIPHWKLLSCXEDL  355

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WCI             K+ +   +S  +    H + +L FVDPR++
Sbjct  356   WCI----------KALKSEDRRTNSVHEFTRTHPTKSL-FVDPREV  390



>ref|XP_004171982.1| PREDICTED: uncharacterized LOC101222130, partial [Cucumis sativus]
Length=378

 Score =   264 bits (675),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 223/363 (61%), Gaps = 25/363 (7%)
 Frame = +2

Query  134   VVVRQYE-EERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +++R Y+ +  D+  VE+LE +CEVG   +  L  D + DPI R+RN+PL+ M+VAE  +
Sbjct  3     LIIRSYDGQSADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRNSPLYKMLVAE--V  60

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+  Q  K     D   V Y+LGLRV+   RR GIG  LV+ LE W
Sbjct  61    DNQLVGVIQGSIKVVTVHQAPK-----DRAKVGYVLGLRVAPSFRRRGIGCSLVRRLEEW  115

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPV-HRHKKPIGSDVAVVRV  667
                N  DY YMAT+  N+AS+ LF   L Y  FR P++LV PV H     + S++ + R+
Sbjct  116   FMINDVDYAYMATEKDNEASVKLFINKLGYTNFRVPAILVNPVKHYRSYQLPSNIQIARL  175

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHA  847
                +AE  YR+ F  S+EFFP DI+ VL +KL+LGT++A  K+       D    P + A
Sbjct  176   KVDVAEFLYRK-FMASTEFFPHDIDHVLKHKLSLGTWVAYYKD-------DDITIPKSWA  227

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ EV+K++   L     +C + T   +V+D++ P ++LPS+P+  + FG+YF++
Sbjct  228   MLSVWNSGEVFKLR---LGKAPLSCLIYTESSKVIDKIFPCLKLPSIPDFYEPFGFYFMY  284

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             G+  EG    +++ +L  + HN+A    R C++++ E+  +D +R  IPHWK  S  +DL
Sbjct  285   GVHREGTGTGKLVRALCQYVHNMAAA-ARDCKVIVTEIGGEDSLREEIPHWKLLSCPEDL  343

Query  1196  WCI  1204
             WCI
Sbjct  344   WCI  346



>ref|XP_008457342.1| PREDICTED: probable N-acetyltransferase HLS1 [Cucumis melo]
Length=397

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 228/370 (62%), Gaps = 25/370 (7%)
 Frame = +2

Query  134   VVVRQYE-EERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +++R Y+ +  D+  VE+LE +CEVG   +  L  D + DPI R+RN+PL+ M+VAE  +
Sbjct  8     LIIRSYDGQSADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRNSPLYKMLVAE--V  65

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+  Q  K     D   V Y+LGLRV+   RR GIG  LV+ LE W
Sbjct  66    DNQLVGVIQGSIKVVTVHQAPK-----DRAKVGYVLGLRVAPSFRRRGIGCSLVRRLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPV-HRHKKPIGSDVAVVRV  667
                N  DY YMAT+  N+AS+ LF   L Y  FR P++LV PV H     + S++ + R+
Sbjct  121   FVINDVDYAYMATEKDNEASVKLFINKLGYTNFRVPAILVNPVKHYRSYHLPSNIQIARL  180

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE---SLSTWEPDSG----  826
                +AE  YR+ F  S+EFFP DI+ VL +KL+LGT++A  K+   S + +E +S     
Sbjct  181   KVDVAEFLYRK-FMASTEFFPHDIDHVLKHKLSLGTWVAYYKDDDVSSAKFETNSSKSEI  239

Query  827   VFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKN  997
               P + A+LS+W++ EV+K++   L     +C + T   +V+D++ P ++LPS+P+  + 
Sbjct  240   TIPKSWAMLSVWNSGEVFKLR---LGKAPLSCLIYTESSKVIDKIFPCLKLPSIPDFYEP  296

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG+YF++G+  EG    +++ +L  + HN+A    R C++++ E+  +D +R  IPHWK 
Sbjct  297   FGFYFMYGVHREGTGTGKLVRALCQYVHNMAAA-ARDCKVIVTEIGGEDSLREEIPHWKL  355

Query  1178  FSW-QDLWCI  1204
              S  +DLWCI
Sbjct  356   LSCPEDLWCI  365



>ref|XP_011003801.1| PREDICTED: probable N-acetyltransferase HLS1-like [Populus euphratica]
 ref|XP_011003809.1| PREDICTED: probable N-acetyltransferase HLS1-like [Populus euphratica]
Length=384

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 238/411 (58%), Gaps = 41/411 (10%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ +R Y+ +  +  VE+LE +CEVG   +  L  D + DPI R++N+P++ M++AE G 
Sbjct  5     ELKIRSYDVQIHRARVEDLERRCEVGPTKRVVLFTDTMGDPICRIKNSPMYKMLIAELG-  63

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGVI+GSI+  +  +  KN        + Y+LGLR++  HRR GIG +LV  LE W
Sbjct  64    -SELVGVIQGSIKLATVHKPPKN-----LAKLGYVLGLRIAPLHRRKGIGLRLVLELEKW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N  DY YMAT+  N+AS+NLF   L Y KFRTP++LV PV R    + S   V ++ 
Sbjct  118   FVENDVDYAYMATEKDNEASVNLFIKKLGYAKFRTPAILVNPVDRRALRLSSKTEVAKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YR+    S+EFFP DI  +L N+L++GT++A  + ES   +  D G FP++ A
Sbjct  178   IEEAEFLYRK-LMTSTEFFPDDIGNILRNRLSMGTWVAYQRGESWDGFGSD-GKFPSSWA  235

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++K++   L     +C + T   R++D++ P  +LP++P+    FG+YF++
Sbjct  236   MLSVWNSGELFKLR---LGKAPLSCLIYTKISRLMDKIFPCFKLPAIPDFFSPFGFYFMY  292

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             GL +EG    +++  L  F HN+A    + C++ + EV   + +R  IP+WK+ S  +DL
Sbjct  293   GLHLEGPLSGKLVGDLCQFVHNMA-TKTKDCKVTVTEVGCKEMLRPHIPYWKSLSCPEDL  351

Query  1196  WCIkhlnlvgdnnnnnkaanivhdSSEDSIMYH-----DSSALIFVDPRDI  1333
             WCI                      +E+S +        ++  +FVDPR++
Sbjct  352   WCI------------------KAMKNEESTILQLPKTPPTTTCLFVDPREV  384



>ref|XP_010233910.1| PREDICTED: probable N-acetyltransferase HLS1 [Brachypodium distachyon]
Length=441

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 155/395 (39%), Positives = 223/395 (56%), Gaps = 45/395 (11%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKP------------------------------  223
             + VR++E ERD  AVEELE +C+VG  G                                
Sbjct  12    IRVREFEMERDLPAVEELERRCQVGLSGDQADDVASTGTAEEDGGGAANKKCRRRKKKTK  71

Query  224   -----RLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE--IVGVIRGSIRSVSRGQKGKND  382
                   L ++ + DP  RVR++P HV++VAE+G  +   +VGVI+  +R+VSRG+K K  
Sbjct  72    KKRGMSLYVEQIGDPFARVRHSPDHVILVAEYGEEEAGEVVGVIKACVRAVSRGKKKKQH  131

Query  383   NSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLF  562
                ++   A +LGLRVS  HRRLGI T LV   E W  + GA +  MAT  SN AS+ LF
Sbjct  132   ---EFAKTACLLGLRVSPSHRRLGIATALVSRAEAWCAARGAAHATMATTSSNAASLALF  188

Query  563   TGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDIN  742
             TG   Y  FR P  L  PVHRH+  + +   V+++PPQLA + Y       +EF P D+ 
Sbjct  189   TGRFGYAPFRRPVFLGHPVHRHRARVPAAHRVLQLPPQLAAAAYAATTLQEAEFVPADLP  248

Query  743   LVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQAC  922
              +L +KL LGT++A+ + +    + D+G  P ++A+LS+WDA    +++V G + L +A 
Sbjct  249   ALLAHKLTLGTYLALNRGAPP--DADAGT-PASYAMLSVWDATRSLRLRVSGAAPLLRAS  305

Query  923   FLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDR  1102
                 R LDR  PW+R+PS+P+V + FG Y L+GLRM G  G  ++ SL   AHNVAR + 
Sbjct  306   LAAARALDRHAPWLRVPSLPDVFRPFGTYLLYGLRMSGPDGPALLRSLCRHAHNVARRN-  364

Query  1103  RGCELLIAEVSPDDPVRRGIPHWKNFSWQ-DLWCI  1204
               C ++ A++ PDDP    +PHW  FS   D+WC+
Sbjct  365   PACAVVAADLGPDDPAAAAVPHWARFSCHDDVWCV  399



>gb|KGN65831.1| hypothetical protein Csa_1G533380 [Cucumis sativus]
Length=397

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 227/370 (61%), Gaps = 25/370 (7%)
 Frame = +2

Query  134   VVVRQYE-EERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +++R Y+ +  D+  VE+LE +CEVG   +  L  D + DPI R+RN+PL+ M+VAE  +
Sbjct  8     LIIRSYDGQSADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRNSPLYKMLVAE--V  65

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+  Q  K     D   V Y+LGLRV+   RR GIG  LV+ LE W
Sbjct  66    DNQLVGVIQGSIKVVTVHQAPK-----DRAKVGYVLGLRVAPSFRRRGIGCSLVRRLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPV-HRHKKPIGSDVAVVRV  667
                N  DY YMAT+  N+AS+ LF   L Y  FR P++LV PV H     + S++ + R+
Sbjct  121   FMINDVDYAYMATEKDNEASVKLFINKLGYTNFRVPAILVNPVKHYRSYQLPSNIQIARL  180

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE---SLSTWEPDSG----  826
                +AE  YR+ F  S+EFFP DI+ VL +KL+LGT++A  K+   S + +E +      
Sbjct  181   KVDVAEFLYRK-FMASTEFFPHDIDHVLKHKLSLGTWVAYYKDDDVSSTKFETNGSKSEI  239

Query  827   VFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKN  997
               P + A+LS+W++ EV+K++   L     +C + T   +V+D++ P ++LPS+P+  + 
Sbjct  240   TIPKSWAMLSVWNSGEVFKLR---LGKAPLSCLIYTESSKVIDKIFPCLKLPSIPDFYEP  296

Query  998   FGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             FG+YF++G+  EG    +++ +L  + HN+A    R C++++ E+  +D +R  IPHWK 
Sbjct  297   FGFYFMYGVHREGTGTGKLVRALCQYVHNMAAA-ARDCKVIVTEIGGEDSLREEIPHWKL  355

Query  1178  FSW-QDLWCI  1204
              S  +DLWCI
Sbjct  356   LSCPEDLWCI  365



>ref|XP_008221351.1| PREDICTED: probable N-acetyltransferase HLS1 [Prunus mume]
Length=395

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 222/372 (60%), Gaps = 22/372 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E ++R Y+   D+  VE+LE +CEVG   +  L  D + DPI R+RN+P+H M+VAE  +
Sbjct  5     EPIIRSYDGVADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRNSPMHKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+           D   V Y+LGLRVS Q+RR GIG+ LV+ LE W
Sbjct  63    DNQLVGVIQGSIKLVTF--HPNKPPPKDQAKVGYLLGLRVSPQYRRKGIGSSLVRRLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N  DY YMAT+  NQAS  LF     Y+KFRTP++LV PV      + S V + ++ 
Sbjct  121   FVCNDVDYAYMATEKDNQASAGLFMNKFGYIKFRTPAILVNPVRYRPCRVSSGVEIAKLR  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSG---VFPT  838
              + AE  YR+    S+EFF  DI+ VL NKL+LGT++A P+ + L   +  S    V P+
Sbjct  181   IEEAEYLYRKCM-ASTEFFSHDIDKVLGNKLSLGTWVAYPRGDGLRVGDFGSNGDEVVPS  239

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIR-LPSVPNVSKNFGY  1006
             N A+LS+W++ E++ ++   L     +C +     +++DR +P  + LPS+P+    FG+
Sbjct  240   NWAMLSVWNSGELFNLR---LGKAPLSCLMYAKSWKLMDRFLPCFKLLPSMPDFFTPFGF  296

Query  1007  YFLFGLRMEGQSGSEMMESLWAFAHNVARN-----DRRGCELLIAEVSPDDPVRRGIPHW  1171
             YF++GL  EG    +++ +L  F HN+A N       + C++++ EV   DPV+  IPHW
Sbjct  297   YFMYGLHHEGPLSGKLVRNLCRFVHNMAANSSSEYSSKNCKVVVTEVGGGDPVKHYIPHW  356

Query  1172  KNFSW-QDLWCI  1204
             K  S  +DLWCI
Sbjct  357   KLLSCSEDLWCI  368



>dbj|BAC16204.1| acetyltransferase-like protein [Oryza sativa Japonica Group]
 dbj|BAD30273.1| acetyltransferase-like protein [Oryza sativa Japonica Group]
Length=397

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 167/375 (45%), Positives = 233/375 (62%), Gaps = 19/375 (5%)
 Frame = +2

Query  104   VAAVAEKLPEVV-VRQYEEERDKVAVEELESQCEVGQEG-KPRLVIDLLDDPIGRVRNAP  277
             VA + E   EVV VR+++  RD+  VE +E  CEVG  G K  L  DLL DP+ RVR++P
Sbjct  3     VACLPEDGGEVVLVREFDGGRDRPGVELVERACEVGPSGGKLCLFTDLLGDPLCRVRHSP  62

Query  278   LHVMMVAEH---GISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRR  448
              ++M+VAE     +  EIVGV+RG +++V+ G+      S  +  VAY+LGLRVS +HRR
Sbjct  63    AYLMLVAEAVGGPLGTEIVGVVRGCVKTVACGR------SQLFSKVAYLLGLRVSPRHRR  116

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
              GIG +LV+ +E W R  GA+Y Y+ATD  N+ S+ LFTG   Y KFRTPSVLV PV  H
Sbjct  117   RGIGRRLVERMEEWFREMGAEYAYVATDRDNEPSVRLFTGACGYAKFRTPSVLVHPVFGH  176

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLST  808
                     AVVR+  + AE  YRR   GS EFFP+DI+ VL+N L+LGTF+AVP+   + 
Sbjct  177   DLAPSRRAAVVRLDAREAELLYRRRL-GSVEFFPRDIDAVLSNALSLGTFLAVPRG--TR  233

Query  809   WEPDSGVF---PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSV  979
             W    G     P + A+ S+W+ K+ ++++V+G   L +A    TR  DR  PW+ +PS+
Sbjct  234   WRGVEGFLASPPASWAVASLWNCKDAFRLEVRGAPRLWRAAARATRAADRAAPWLGIPSI  293

Query  980   PNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRG  1159
             PN+ + FG +F++GL   G + + M  +L+  AHNVAR  R G  ++  EV   +P+R G
Sbjct  294   PNLFEPFGLHFVYGLGGGGPAAARMARALFRHAHNVAR--RGGARVVATEVGACEPLRAG  351

Query  1160  IPHWKNFSWQDLWCI  1204
             +PHW      DLWCI
Sbjct  352   VPHWPRLGADDLWCI  366



>ref|XP_007205302.1| hypothetical protein PRUPE_ppa006777mg [Prunus persica]
 gb|EMJ06501.1| hypothetical protein PRUPE_ppa006777mg [Prunus persica]
Length=395

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 222/372 (60%), Gaps = 22/372 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E ++R Y+   D+  VE+LE +CEVG   +  L  D + DPI R+RN+P+H M+VAE  +
Sbjct  5     EPIIRSYDGVADRGRVEDLERRCEVGPSERVFLFTDTMGDPICRIRNSPMHKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VGVI+GSI+ V+           D   V Y+LGLRVS  +RR GIG+ LV+ LE W
Sbjct  63    DNQLVGVIQGSIKLVTF--HPNKPPPKDQAKVGYLLGLRVSPLYRRKGIGSSLVRRLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                N  DY YMAT+  NQAS  LF     Y+KFRTP++LV PV      + S V + ++ 
Sbjct  121   FVCNDVDYAYMATEKDNQASAGLFMNKFGYIKFRTPAILVNPVRYRPCRVSSGVEIAKLR  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSG---VFPT  838
              + AE  YR+    S+EFF  DI+ VL NKL+LGT++A P+ + L   +  S    V P+
Sbjct  181   IEEAEYLYRKCM-ASTEFFSHDIDKVLGNKLSLGTWVAYPRGDGLRVGDFGSNGDEVVPS  239

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIR-LPSVPNVSKNFGY  1006
             N A+LS+W++ E++ ++   L     +CF+     +++DR +P  + LPS+P+    FG+
Sbjct  240   NWAMLSVWNSGELFNLR---LGKAPLSCFMYAKSWKLMDRFLPCFKLLPSMPDFFAPFGF  296

Query  1007  YFLFGLRMEGQSGSEMMESLWAFAHNVARN-----DRRGCELLIAEVSPDDPVRRGIPHW  1171
             YF++GL  EG    +++ +L  F HN+A N       + C++++ EV   DPV+  IPHW
Sbjct  297   YFMYGLHHEGPLSGKLVRNLCQFVHNMAANSSSEYSSKNCKVVVTEVGGCDPVKHYIPHW  356

Query  1172  KNFSW-QDLWCI  1204
             K  S  +DLWCI
Sbjct  357   KLLSCSEDLWCI  368



>ref|XP_002313243.1| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|EEE87198.1| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=384

 Score =   259 bits (662),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 223/363 (61%), Gaps = 18/363 (5%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ +R Y+ +  +  VE+LE +CEVG   +  L  D + DPI R++N+P++ M++AE G 
Sbjct  5     ELKIRSYDVQIHRARVEDLERRCEVGPTKRVVLFTDTMGDPICRIKNSPMYKMLIAELG-  63

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGVI+GSI+  +  +  KN        + Y+LGLR++  HRR GIG +LV  LE W
Sbjct  64    -SELVGVIQGSIKLATVHKPPKN-----LAKLGYVLGLRIAPLHRRNGIGLRLVLELEKW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  DY YMAT+  N+AS+NLF   L Y KFRTP++LV PV R    + S   V ++ 
Sbjct  118   FVANDVDYAYMATEKDNEASVNLFIKKLGYAKFRTPAILVNPVDRRALRLSSKTEVAKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE  YR+    S+EFFP DI  +L N+L+LGT++A  + ES   +  D G FP++ A
Sbjct  178   IEEAEFLYRK-LMTSTEFFPDDIGNILRNRLSLGTWVAYQRGESWDGFGSD-GKFPSSWA  235

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGT---RVLDRLIPWIRLPSVPNVSKNFGYYFLF  1018
             +LS+W++ E++K++   L     +C + T   R++D++ P  +L ++P+    FG+YF++
Sbjct  236   MLSVWNSGELFKLR---LGKAPLSCLIYTKISRLIDKIFPCFKLSAIPDFFSPFGFYFMY  292

Query  1019  GLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDL  1195
             GL +EG    +++  L  F HN+A    + C++ + EV   + +R  IP+WK+ S  +DL
Sbjct  293   GLHLEGPLSGKLVGDLCQFVHNMA-TKTKDCKVTVTEVGGKEMLRPHIPYWKSLSCPEDL  351

Query  1196  WCI  1204
             WCI
Sbjct  352   WCI  354



>ref|XP_001755999.1| predicted protein [Physcomitrella patens]
 gb|EDQ79284.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 205/351 (58%), Gaps = 21/351 (6%)
 Frame = +2

Query  200   EVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKN  379
             E+   G   L  DLL DP+ RVR+ P   M+VAE  I  EIVGVIRGS++ V        
Sbjct  4     EICPAGSESLGFDLLGDPLCRVRHLPSFHMLVAE--IGGEIVGVIRGSVKDVVCSSDKAL  61

Query  380   DNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINL  559
               +  Y  V Y+LGLRV  +HRR+GI  KL Q++E W +  GA Y+YMAT   N+AS+ L
Sbjct  62    VRNPPYERVGYLLGLRVCPRHRRMGIALKLAQAMEEWCQEQGAKYVYMATTKDNEASLKL  121

Query  560   FTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDI  739
             FT  LNY  FRTP++ VQPVH H++ I S + + ++    A + YR    G++EFFPKDI
Sbjct  122   FTERLNYSHFRTPAIFVQPVHVHERRISSRIQLTKISSDHAAALYRATM-GTAEFFPKDI  180

Query  740   NLVLNNKLNLGTFMAVPKE-----SLSTWEPDSG----------VFPTNHAILSIWDAKE  874
             + VL NKL  GT++A  K+      L+    +SG                A+LS+W + +
Sbjct  181   DAVLRNKLCEGTWIATFKKDRLDHELNNLACESGRGGRMVDGGWAKGAPWAVLSVWRSND  240

Query  875   VYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEM  1054
             +++ + +  S +K+     +R++D  +P  R+PSVPN    FG  F+FGL  EG  G E+
Sbjct  241   LFRCEYRNASWMKKTGAALSRLVDFCLPGCRVPSVPNFFDPFGVQFMFGLHSEGDRGPEL  300

Query  1055  MESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNF-SWQDLWCI  1204
             + SL   AHN+AR +   C+ +++EV+P DP    IPHWK   S +D+WCI
Sbjct  301   LHSLCWHAHNLARKN--DCKAVMSEVAPTDPAWSSIPHWKKLSSTEDMWCI  349



>dbj|BAQ15252.1| acetyl transferase [Oryza sativa Indica Group]
 dbj|BAQ15253.1| acetyl transferase [Oryza sativa Indica Group]
Length=419

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 156/394 (40%), Positives = 215/394 (55%), Gaps = 54/394 (14%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD---------------------  250
             V VR+++ E+D  AVEELE +C+VG  G    V D  DD                     
Sbjct  12    VRVREFDVEKDLPAVEELERRCQVGLSGDMAAVHDHADDGDGAAAKEKKKTKTKTKKKKA  71

Query  251   -----------PIGRVRNAPLHVMMVAEHGISKEIVGV---IRGSIRSVSRGQKGKNDNS  388
                        P+ RVR+AP HVM+VAE+G  +E   V   I+  +++VSRG K      
Sbjct  72    GMSLCVEQIGDPLARVRHAPEHVMLVAEYGEEEEKKKVVGVIKACVKTVSRGGK----QE  127

Query  389   TDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTG  568
               +V VA +LGLRVS  HRRLGIGT LV+  E W  + GA++  MAT  SN AS+ LFTG
Sbjct  128   KPFVKVANLLGLRVSPSHRRLGIGTALVRRAEEWCVARGAEHATMATTESNAASLALFTG  187

Query  569   TLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGS-SEFFPKDINL  745
                Y  FR P  +  PVH H+ P+     V ++PP++A + Y R      +EF P D+  
Sbjct  188   RFGYAPFRRPEFIGHPVHAHRLPVARGHRVFQLPPEVAAAAYARLLPPQDAEFLPADMPA  247

Query  746   VLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACF  925
             +L +KL LGTF+AV  +  S             A+LS+WD+     ++V G  AL +A  
Sbjct  248   LLAHKLTLGTFVAVAADGAS------------FAMLSVWDSTRSLSLRVSGAPALLRASL  295

Query  926   LGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRR  1105
                R LDR  PW+ LPS+P++ + FG Y L+GLRM G  G E++ SL   AHNVAR +  
Sbjct  296   AALRALDRCAPWLHLPSIPDIFRPFGAYLLYGLRMSGPDGPELLRSLCHHAHNVARKN-P  354

Query  1106  GCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              C ++ A++SPDDP    +P W+ F   +D+WCI
Sbjct  355   ACAVVAADISPDDPAAAAVPRWRRFCCDEDVWCI  388



>ref|XP_010229419.1| PREDICTED: probable N-acetyltransferase HLS1 [Brachypodium distachyon]
Length=408

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 151/367 (41%), Positives = 219/367 (60%), Gaps = 16/367 (4%)
 Frame = +2

Query  143   RQYEEERDK------VAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEH  304
             R+Y+ ERD+          E+ S    G+ GK RL  DLL DP+ R+RN+P ++M+VAE 
Sbjct  12    REYDGERDRRGVEEVERECEVGSSGSGGRSGKMRLFTDLLGDPLARIRNSPAYLMLVAET  71

Query  305   GISKEIVG----VIRGSIRSVSRGQKGKNDNSTD--YVDVAYILGLRVSSQHRRLGIGTK  466
               +         ++RG ++SV  G      ++ D  Y  VAYILGLRVS  HRR G+G K
Sbjct  72    TATGGGGTEIIGLVRGCVKSVVSGACSTQPSNQDPIYTKVAYILGLRVSPNHRRRGVGKK  131

Query  467   LVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVH-RHKKPIG  643
             LV+ +E W R  GA+Y YMAT+  N+AS+ LFTG   Y KFRTPSVLV PV   H  P  
Sbjct  132   LVERMEEWFREKGAEYSYMATEQDNEASVRLFTGRCGYAKFRTPSVLVHPVFPGHALPPS  191

Query  644   SDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS  823
                ++ R+  + AE  YRR+F  S EFFP DI+ VL+N L+LGTF+A+P  +   W+   
Sbjct  192   RRASISRLDTRDAERLYRRHF-ASVEFFPADIDAVLSNALSLGTFLALPAGT-RPWDGIE  249

Query  824   GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFG  1003
                 ++ A++S+W+  + ++++V+G + L +A    TR++DR  PW+ +PSVP++ + FG
Sbjct  250   SPPASSWAVVSVWNCADAFRLEVRGATRLMRAAAGATRLVDRTAPWLGIPSVPDLFRPFG  309

Query  1004  YYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS  1183
               F++G+   G     ++ +L   AHNVAR  R G  ++  EV   DPVR G+P W    
Sbjct  310   VCFMYGVGGAGPGAPGLVRALCRHAHNVARR-RGGFGVVATEVGARDPVRAGVPRWARLG  368

Query  1184  WQDLWCI  1204
              +DLWCI
Sbjct  369   AEDLWCI  375



>ref|XP_008805049.1| PREDICTED: probable N-acetyltransferase HLS1-like [Phoenix dactylifera]
Length=390

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/366 (43%), Positives = 221/366 (60%), Gaps = 23/366 (6%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVV+R Y+ ERD+   EELE   +VG E  P   ID+L DP+ R+RN+P + M+VAE G 
Sbjct  10    EVVIRSYDRERDRERFEELERNWDVGPEESPFFKIDVLSDPLCRIRNSPTYEMLVAELG-  68

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               E+VGV+ GSI+ V  G   +         V YILGLRV   HRR GIG+ LV  +E W
Sbjct  69    -NELVGVVCGSIKVVRVGGSPEG-----LAKVGYILGLRVPPLHRRRGIGSSLVFGMERW  122

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               +N  DY YMAT+  N+AS+ LFT  L ++KFRTPS+LV PV      I S V + ++ 
Sbjct  123   FVANLVDYAYMATEKDNEASVKLFTDKLGFIKFRTPSILVNPVGNRMIHISSSVEIKKLD  182

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWE----PDSGVFPT  838
              + AE  YR+      EFFP+DI+ +L NKL+LGTF+A P     TWE     D+   PT
Sbjct  183   IEQAEVLYRKVMS-FCEFFPQDIDSILANKLSLGTFVAYPLG--ETWEGLLDGDTSA-PT  238

Query  839   NHAILSIWDAKEVYKVQVKGLSALKQACFL---GTRVLDRLIPWIRLPSVPNVSKNFGYY  1009
             + A+LS+W++  ++K++V       QAC L    +R +D+L+P + +P +PN+   FG+Y
Sbjct  239   SWAMLSVWNSAALFKLKV---GRAHQACVLMSKASRWMDQLLPSLGIPVLPNIFSWFGFY  295

Query  1010  FLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-  1186
             F++GL  +G     +M SL    HN+A    + C++++ EV   D +R  IPHWK  S+ 
Sbjct  296   FMYGLHAQGPESESLMRSLCHHVHNMA-TKCKDCKVIVTEVGRRDAIRPYIPHWKLLSYS  354

Query  1187  QDLWCI  1204
             +DLWCI
Sbjct  355   EDLWCI  360



>dbj|BAD38107.1| GCN5-related N-acetyltransferase-like [Oryza sativa Japonica 
Group]
 dbj|BAQ15250.1| acetyl transferase [Oryza sativa Japonica Group]
 dbj|BAQ15251.1| acetyl transferase [Oryza sativa Japonica Group]
Length=419

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 155/394 (39%), Positives = 214/394 (54%), Gaps = 54/394 (14%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD---------------------  250
             V VR+++ E+D  AVEELE +C+VG  G    V D  DD                     
Sbjct  12    VRVREFDVEKDLPAVEELERRCQVGLSGDMAAVHDHADDGDGAAAKEKKKTKTKTKKKKA  71

Query  251   -----------PIGRVRNAPLHVMMVAEHGISKEIVGV---IRGSIRSVSRGQKGKNDNS  388
                        P+ RVR+AP HVM+VAE+G  +E   V   I+  +++VSRG K      
Sbjct  72    SMSLCVEQIGDPLARVRHAPEHVMLVAEYGEEEEKKKVVGVIKACVKTVSRGGK----QE  127

Query  389   TDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTG  568
               +V VA +LGLRVS  HRRLGIGT LV+  E W  + GA++  MAT  SN AS+ LFTG
Sbjct  128   KPFVKVANLLGLRVSPSHRRLGIGTALVRRAEEWCVARGAEHATMATTESNAASLALFTG  187

Query  569   TLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGS-SEFFPKDINL  745
                Y  FR P  +  PVH H+ P+     V ++PP++A + Y R      +EF P D+  
Sbjct  188   RFGYAPFRRPEFIGHPVHAHRLPVARGHRVFQLPPEVAAAAYARLLPPQDAEFLPADMPA  247

Query  746   VLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACF  925
             +L +KL LGTF+AV  +  S             A+LS+WD+     ++V G  AL +A  
Sbjct  248   LLAHKLTLGTFVAVAADGAS------------FAVLSVWDSTRSLSLRVSGAPALLRASL  295

Query  926   LGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRR  1105
                R LDR  PW+ LPS+P++ + FG Y L+GLRM G  G  ++ SL   AHNVAR +  
Sbjct  296   AALRALDRGAPWLHLPSIPDIFRPFGAYLLYGLRMSGPDGPALLRSLCHHAHNVARKN-P  354

Query  1106  GCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              C ++ A++SPDDP    +P W+ F   +D+WCI
Sbjct  355   ACAVVAADISPDDPAAAAVPRWRRFCCDEDVWCI  388



>gb|EAY82038.1| hypothetical protein OsI_37224 [Oryza sativa Indica Group]
Length=421

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 155/396 (39%), Positives = 214/396 (54%), Gaps = 56/396 (14%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDD---------------------  250
             V VR+++ E+D  AVEELE +C+VG  G    V D  DD                     
Sbjct  12    VRVREFDVEKDLPAVEELERRCQVGLSGDMAAVHDHADDGDGAAAKEKKKTKTKTKTKKK  71

Query  251   -------------PIGRVRNAPLHVMMVAEHGISKEIVGV---IRGSIRSVSRGQKGKND  382
                          P+ RVR+AP HVM+VAE+G  +E   V   I+  +++VSRG K    
Sbjct  72    KAGMSLCVEQIGDPLARVRHAPEHVMLVAEYGEEEEKKKVVGVIKACVKTVSRGGK----  127

Query  383   NSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLF  562
                 +V VA +LGLRVS  HRRLGIGT LV+  E W  + GA++  MAT  SN AS+ LF
Sbjct  128   QEKPFVKVANLLGLRVSPSHRRLGIGTALVRRAEEWCVARGAEHATMATTESNAASLALF  187

Query  563   TGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGS-SEFFPKDI  739
             TG   Y  FR P  +  PVH H+ P+     V ++PP++A + Y R      +EF P D+
Sbjct  188   TGRFGYAPFRRPEFIGHPVHAHRLPVARGHRVFQLPPEVAAAAYARLLPPQDAEFLPADM  247

Query  740   NLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQA  919
               +L +KL LGTF+AV  +  S             A+LS+WD+     ++V G  AL +A
Sbjct  248   PALLAHKLTLGTFVAVAADGAS------------FAVLSVWDSTRSLSLRVSGAPALLRA  295

Query  920   CFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARND  1099
                  R LDR  PW+ LPS+P++ + FG Y L+GLRM G  G  ++ SL   AHNVAR +
Sbjct  296   SLAALRALDRGAPWLHLPSIPDIFRPFGAYLLYGLRMSGPDGPALLRSLCHHAHNVARKN  355

Query  1100  RRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
                C ++ A++SPDDP    +P W+ F   +D+WCI
Sbjct  356   -PACAVVAADISPDDPAAAAVPRWRRFCCDEDVWCI  390



>dbj|BAJ91125.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08106.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 217/371 (58%), Gaps = 14/371 (4%)
 Frame = +2

Query  116   AEKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMV  295
             AE  PE+ +R Y    D+   E ++ +CEVGQ G   L  DLL DP+ R+R++P H+M+V
Sbjct  20    AEGKPEITIRVYNPSTDRAGTETVDRECEVGQPGGMSLHADLLGDPVARIRHSPAHLMLV  79

Query  296   AEHGIS-KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLV  472
             AE     + IVGVIRG+++SV+ G+      +  +  V YILGLRVS  HRR+G+  +LV
Sbjct  80    AETSAPPRRIVGVIRGTVKSVATGKS--CPGAPAFASVGYILGLRVSPSHRRMGVALRLV  137

Query  473   QSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDV  652
               LE W    GA+Y YMATD SN+AS+ LFTG   Y KFRTPS+LV PVH H+       
Sbjct  138   GHLERWFTLMGAEYAYMATDKSNEASVQLFTGRCGYSKFRTPSLLVHPVHAHRLRAPRRA  197

Query  653   AV-VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDS--  823
             AV + +  + AE  YRR F G  E FP DI  VL N+L+LGTF+AV       +E     
Sbjct  198   AVLLSLDARDAEQLYRRRF-GHVELFPADIGAVLGNRLSLGTFLAVVVRDDDGYEWRGVE  256

Query  824   ---GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSK  994
                   P + A+ S+WD   V++++++G S L++A    +R LDR   W+R+PSVPN  +
Sbjct  257   HFLASPPASWAVASLWDCGGVFRLEMRGASRLRRAAAAASRALDRAAKWMRVPSVPNFFR  316

Query  995   NFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWK  1174
              F  +F +GL  EG       ++L+    +     R     +  EV+  DP+RR +PHW+
Sbjct  317   PFAGWFAYGLGGEGDDAPLAAKALYV---SFVNRARGRAAAVAVEVAALDPLRRRLPHWR  373

Query  1175  NFSW-QDLWCI  1204
             + S  +DLWC+
Sbjct  374   SLSCAEDLWCM  384



>ref|XP_006296397.1| hypothetical protein CARUB_v10025573mg [Capsella rubella]
 gb|EOA29295.1| hypothetical protein CARUB_v10025573mg [Capsella rubella]
Length=392

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 152/410 (37%), Positives = 240/410 (59%), Gaps = 38/410 (9%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EV++R Y+E RD++ +E +E  CE+G + +  L  D L DPI R+RN+PL  M+VAE G 
Sbjct  12    EVMIRCYDERRDRIQMERVEKSCEIGHDDQTLLSTDSLGDPICRIRNSPLFTMLVAEVG-  70

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VG I+GS++ V    K         V V Y+LGLRV S++RR GIG+ LV+ LE W
Sbjct  71    -NKLVGSIQGSVKPVEYHGKS--------VRVGYVLGLRVVSRYRRRGIGSILVRKLEEW  121

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKP-IGSDVAVVRV  667
               S+ ADY YMAT+  N+AS+ LF G L+YV FR P++LV PV+  +   + SD+ +  +
Sbjct  122   FVSHNADYAYMATEKDNEASLGLFVGKLSYVVFRNPTILVNPVNPGRSSKLPSDIGIRML  181

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNH  844
               + AES YRR+   ++EFFP DI+ +L NKL++GT+ A  K +++ +W           
Sbjct  182   KVKEAESLYRRHVVATTEFFPDDIDRILRNKLSVGTWAAYYKDDNIGSW-----------  230

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A+LS+WD+ +V+K+ +K            + +  +L+  + + S+P++   FG+YFL+G+
Sbjct  231   AMLSVWDSSKVFKLTIKKAPLSYLLLTKVSNLFGKLLSLLGITSLPDLFTPFGFYFLYGV  290

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGC-ELLIAEV-----SPDDPVRRGIPHWKNFSW  1186
               EG    +++ +L    HN++ +D  G  ++++ EV       DD + R IPHWK  S 
Sbjct  291   YAEGPLSGKLVRALCEHVHNMSASDDDGARKVVVVEVDGGSNGDDDALSRCIPHWKMLSC  350

Query  1187  Q-DLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             + D+WCIK L      N  ++ +N+   S   S +        FVDPRD+
Sbjct  351   EDDMWCIKPLQCEEKMNGFSEFSNMCLRSKPRSSL--------FVDPRDV  392



>ref|XP_004954689.1| PREDICTED: uncharacterized protein LOC101782471 [Setaria italica]
Length=435

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 166/432 (38%), Positives = 231/432 (53%), Gaps = 44/432 (10%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPR---------------------------LV  232
             + VR+++  RD  AVEELE +C+VG  G                              L 
Sbjct  16    IRVREFDVARDLRAVEELELRCQVGLSGDQSSDDPAADHDGGAERKKRSGKKKKRGMSLY  75

Query  233   IDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDY---VD  403
             ++ + DP  RVR+AP HVM+VAE+G  +E+VGVI+   R VSRG+K     S+     V 
Sbjct  76    VEQIGDPFARVRHAPDHVMLVAEYGDEEEVVGVIKACTRMVSRGKKTTQSFSSSSKQFVK  135

Query  404   VAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYV  583
             VA +LGLRVS  HRRLGI T+LV+  E+W  + GA Y  MAT  SN AS+ LF G   Y 
Sbjct  136   VACLLGLRVSPSHRRLGIATELVRRAESWCAARGAAYATMATTESNAASLALFAGRFAYA  195

Query  584   KFRTPSVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDG-SSEFFPKDINLVLNNK  760
              FR P  L  PVHRH+  +     V+R+PP LA + Y       ++EF P D+  +L +K
Sbjct  196   PFRRPVFLGHPVHRHRARVPRAHRVLRLPPPLAAAAYAALLPPHAAEFLPADLPALLAHK  255

Query  761   LNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRV  940
             L LGT++A+ +       P+    P + A++S+WDA    +++V G  AL +A     R 
Sbjct  256   LTLGTYLAIERGG----GPEDAARPPSFALVSVWDATRSLRLRVGGAPALLRASLAAARA  311

Query  941   LDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELL  1120
             LD   PW+R+PSVP++ + FG Y L+GLRM G  G  ++ SL   AHNVAR +   C +L
Sbjct  312   LDSHAPWLRVPSVPDIFRPFGTYLLYGLRMSGPEGPALLRSLCRHAHNVARKN-PACAVL  370

Query  1121  IAEVSPDDPVRRGIPHWKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHD  1297
              A++ P+DP    +PHW  FS  +D+WCI                N   D  ED      
Sbjct  371   AADLGPEDPAAAVVPHWAKFSCDEDVWCI-------KKLGAATGGNAAGDEDEDDWTTSP  423

Query  1298  SSALIFVDPRDI  1333
                ++FVDPR+ 
Sbjct  424   PPGVLFVDPREF  435



>ref|XP_004143219.1| PREDICTED: uncharacterized protein LOC101206936 [Cucumis sativus]
Length=402

 Score =   249 bits (637),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 222/369 (60%), Gaps = 27/369 (7%)
 Frame = +2

Query  137   VVRQYEEERD------KVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             V+R YE+  D      K  V +LE +CE+GQ  +  L  D L DPI R+RN+P++ M+VA
Sbjct  7     VIRSYEDHNDEGQFSDKAQVLDLERRCEIGQSKRVFLFTDNLGDPICRIRNSPMYKMLVA  66

Query  299   EHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
             E    KE+VGVI+GSI++V      K       V V Y+LGLRV+  +RR GIG  LV+ 
Sbjct  67    E--CDKEVVGVIQGSIKAVF-FTPHKPPPPGLVVKVGYVLGLRVAPPYRRRGIGAALVRR  123

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI-GSDVA  655
             LE+W  SN  DY  MA +  N AS+NLF   L Y+KFRT  +LV PV  H   I  S++ 
Sbjct  124   LEDWFVSNDVDYCCMAAEKDNHASLNLFINNLRYIKFRTGRILVNPVRNHPYNINSSEIK  183

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFP  835
             + ++  + AE+ Y+++   S+E FPKDI  +L NKL+LGT+MA  K+           +P
Sbjct  184   IQKLKIEDAEAIYKKHM-ASTELFPKDIKNILKNKLSLGTWMANFKQQH---------YP  233

Query  836   TNHAILSIWDAKEVYKVQVKGLSALKQACFLGT-RVLDRLIPWIRLPSVPNVSKNFGYYF  1012
              + AI+S+W++ EV+++++ G +      +  + +++D+++P  +L  VPN  K FG+YF
Sbjct  234   LSWAIVSLWNSGEVFRLRL-GKAPFAWVIYTKSLKIMDKILPCFKLVLVPNFFKPFGFYF  292

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVARNDRR--GCELLIAEVS--PDDPVRRGIPHWKNF  1180
             ++GL  EG     ++ +L  F HN+A N+ +   C+ ++ E+S   DD ++  IPHWK  
Sbjct  293   VYGLHHEGPFSERLVGALCKFVHNMAMNNSKDHNCKAIVTEISGDEDDDLKMEIPHWKLL  352

Query  1181  S-WQDLWCI  1204
             S ++D WCI
Sbjct  353   SCYEDFWCI  361



>ref|XP_006410062.1| hypothetical protein EUTSA_v10016773mg [Eutrema salsugineum]
 gb|ESQ51515.1| hypothetical protein EUTSA_v10016773mg [Eutrema salsugineum]
Length=391

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 149/413 (36%), Positives = 234/413 (57%), Gaps = 45/413 (11%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVV+R Y++ RD++ +E +E  CE+G + +  L  D L DPI R+RN PL  M+VA+ G 
Sbjct  12    EVVIRCYDDRRDRIEMECVERSCEIGHD-QTFLFTDSLGDPICRIRNTPLFTMLVAQVG-  69

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VG I+GS++ V    K         V V Y+LGLRV  Q+RR GIG+ LV+ LE W
Sbjct  70    -NKLVGSIQGSVKPVEFHDKS--------VKVGYVLGLRVVPQYRRSGIGSTLVRKLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK-PIGSDVAVVRV  667
               ++ ADY YMAT   N+AS+ LF G L YV FR P++LV PV+  +   + SD+ + ++
Sbjct  121   FVAHNADYAYMATQKDNEASLGLFVGRLGYVVFRNPAILVNPVNPGRGLKLPSDIEIKKL  180

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHA  847
               + A S+Y+R+   ++EFFPKDI  +L NKL++GT++A    + +T          + A
Sbjct  181   KVKEAASWYQRHVASTTEFFPKDIEKILRNKLSIGTWVAYYNNNDNT---------GSWA  231

Query  848   ILSIWDAKEVYKVQVK----GLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
             +LS+WD+ +V+K++++        L + C      L R  P++ L ++P++  +FG+YFL
Sbjct  232   MLSVWDSSKVFKLRIEKAPLSYLLLTKVC----NYLGRFFPFLGLTALPDLFNSFGFYFL  287

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRG-CELLIAEV-----SPDDPVRRGIPHWKN  1177
             +G+  EG    +++ +L    HN+A  D  G C++++ EV       DD +RR +PHWK 
Sbjct  288   YGVHAEGPLRGKLVRALCEHVHNMAALDDGGACKVVVVEVDGERDGDDDSLRRCVPHWKM  347

Query  1178  FSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
              S   D WCI                 +   S    ++    S  +FVDPRD+
Sbjct  348   LSCDDDTWCI---------KPLRCDEKMSGLSEVTKMLLSSKSRSLFVDPRDV  391



>gb|KHN02087.1| hypothetical protein glysoja_028290 [Glycine soja]
Length=350

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 203/329 (62%), Gaps = 19/329 (6%)
 Frame = +2

Query  242   LDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVS-RGQKGKNDNSTDYVDVAYIL  418
             + DPI R+RN+P+++M+VAE  +  E+VGVI+GSI+ V+  G   K     D   V Y+L
Sbjct  1     MGDPICRIRNSPMYMMLVAE--LDNELVGVIQGSIKVVTVHGHPPK-----DLAKVGYVL  53

Query  419   GLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTP  598
             GLRVS QHRR GIG+ LV++LE W  S   DY YMAT+  N AS++LF     Y KFRTP
Sbjct  54    GLRVSPQHRRKGIGSSLVRTLEEWFTSKDVDYAYMATEKDNHASVSLFMDKFGYTKFRTP  113

Query  599   SVLVQPVHRHKKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTF  778
             ++LV PV+ H   I  ++ + R+    AE  YRR F GS+EFFP DI  +L NKL+LGT+
Sbjct  114   AILVNPVNHHCFQISPNIEIARLKIDQAEYLYRR-FMGSTEFFPNDIGNILRNKLSLGTW  172

Query  779   MAVPKESLSTWEPDS-GVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTR---VLD  946
             +A  K  ++  +  S G  P + A+LS+W++ E++K++   L     +C + T+   ++ 
Sbjct  173   VAYFKGDIAWGDFGSDGQVPNSWAMLSVWNSGEIFKLR---LGKAPFSCLVCTKSWWLIH  229

Query  947   RLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVA--RNDRRGCELL  1120
             ++ P ++LP++P+    FG+YF++G+  EG    +++ +L  F HN+     D   C ++
Sbjct  230   KIFPCLKLPTIPDFFNPFGFYFMYGVHHEGPFSGKLVRALCQFVHNMGAESKDESNCRII  289

Query  1121  IAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             + EV   D +   IPHWK  S  +DLWCI
Sbjct  290   VTEVGGRDELNHHIPHWKLLSCPEDLWCI  318



>gb|KGN47059.1| hypothetical protein Csa_6G182130 [Cucumis sativus]
Length=415

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/373 (39%), Positives = 221/373 (59%), Gaps = 22/373 (6%)
 Frame = +2

Query  137   VVRQYEEERD------KVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVA  298
             V+R YE+  D      K  V +LE +CE+GQ  +  L  D L DPI R+RN+P++ M+VA
Sbjct  7     VIRSYEDHNDEGQFSDKAQVLDLERRCEIGQSKRVFLFTDNLGDPICRIRNSPMYKMLVA  66

Query  299   EHGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
             E    KE+VGVI+GSI++V      K       V V Y+LGLRV+  +RR G+G  LV+ 
Sbjct  67    E--CDKEVVGVIQGSIKAVFFTPH-KPPPPGLVVKVGYVLGLRVAPPYRRRGVGAALVRR  123

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI-GSDVA  655
             LE+W  SN  DY  MA +  N AS+NLF   L Y+KFRT  +LV PV  H   I  S++ 
Sbjct  124   LEDWFVSNDVDYCCMAAEKDNHASLNLFINNLRYIKFRTGRILVNPVRNHPYNINSSEIK  183

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFP  835
             + ++  + AE+ Y+++   S+E FPKDI  +L NKL+LGT+MA  K+        S    
Sbjct  184   IQKLKIEDAEAIYKKHM-ASTELFPKDIKNILKNKLSLGTWMANFKQQHYPLRSSSSTTG  242

Query  836   TNH----AILSIWDAKEVYKVQVKGLSALKQACFLGT-RVLDRLIPWIRLPSVPNVSKNF  1000
              N     AI+S+W++ EV+++++ G +      +  + +++D+++P  +L  VPN  K F
Sbjct  243   GNEQSSWAIVSLWNSGEVFRLRL-GKAPFAWVIYTKSLKIMDKILPCFKLVLVPNFFKPF  301

Query  1001  GYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRR--GCELLIAEVS--PDDPVRRGIPH  1168
             G+YF++GL  EG     ++ +L  F HN+A N+ +   C+ ++ E+S   DD ++  IPH
Sbjct  302   GFYFVYGLHHEGPFSERLVGALCKFVHNMAMNNSKDHNCKAIVTEISGDEDDDLKMEIPH  361

Query  1169  WKNFS-WQDLWCI  1204
             WK  S ++D WCI
Sbjct  362   WKLLSCYEDFWCI  374



>ref|XP_002881084.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57343.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/363 (37%), Positives = 217/363 (60%), Gaps = 29/363 (8%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R Y++ RD++ +  +E  CE+G + +  L  D L DPI R+RN+P  +M+VAE G   +
Sbjct  15    IRCYDDSRDRIQMGRVEKSCEIGHDQQTLLFTDTLGDPICRIRNSPFFIMLVAEVG--NK  72

Query  320   IVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRS  499
             +VG I+GS++ V    K         V V Y+LGLRV   +RR GIG+ LV+ LE W  S
Sbjct  73    LVGSIQGSVKPVEFHDKS--------VRVGYVLGLRVVPPYRRRGIGSILVRKLEEWFES  124

Query  500   NGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK-PIGSDVAVVRVPPQ  676
             + ADY YMAT   N+AS+ LF G L YV FR P++LV PV+  +   + S++ + ++  +
Sbjct  125   HNADYAYMATQKDNEASLGLFVGKLGYVVFRNPAILVNPVNPGRGLKLPSNIGIRKLKVK  184

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA-VPKESLSTWEPDSGVFPTNHAIL  853
              AES YRR    ++EFFP+DIN +L NKL++GT++A    ++  +W           A+L
Sbjct  185   EAESLYRRYVAATTEFFPEDINKILRNKLSIGTWLAYYNDDNTRSW-----------AML  233

Query  854   SIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRME  1033
             S+WD+ +V+K++++            +++  + +  + L ++P++  +FG+YFL+G+  E
Sbjct  234   SVWDSSKVFKLRIERAPLSYLLLTKVSKIFGKFLSLLGLTAMPDLFTSFGFYFLYGVHSE  293

Query  1034  GQSGSEMMESLWAFAHNVARNDRRG-CELLIAEVSP----DDPVRRGIPHWKNFSW-QDL  1195
             G    +++ +L    HN+A +D  G C++++ EV      DD ++R IPHWK  S   D+
Sbjct  294   GPLCGKLVRALCEHVHNMAASDDSGACKVVVVEVDKGSNGDDSLQRCIPHWKMLSCDDDM  353

Query  1196  WCI  1204
             WCI
Sbjct  354   WCI  356



>gb|KEH27508.1| acyl-CoA N-acyltransferase (NAT) superfamily protein [Medicago 
truncatula]
Length=286

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 175/258 (68%), Gaps = 9/258 (3%)
 Frame = +2

Query  449   LGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH  628
             +GIG KLV+ +E W + NGA+Y YMAT+  N AS+ LFT    Y KFRTPS+LV PV+ H
Sbjct  1     MGIGLKLVKKMEAWFKDNGAEYSYMATETENLASVKLFTEKCGYTKFRTPSILVNPVYAH  60

Query  629   KKPIGSDVAVVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLS-  805
             +  I   V ++ + P  A  +YR  F  ++EFFP DI+ V+NNKL+LGTF+AVP  S S 
Sbjct  61    RTKISRKVTIIPLTPSDAVIFYRNRFS-TTEFFPNDIDAVVNNKLSLGTFLAVPSGSYSV  119

Query  806   -TWE-PDSGVF--PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLP  973
              TW  PD  +   P + AILS+W++KEV+K++V+G S +K+     TR+LDR +PW+++P
Sbjct  120   KTWPGPDRFLLGPPCSWAILSVWNSKEVFKLEVRGASRVKRGLAKTTRILDRALPWLKVP  179

Query  974   SVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVR  1153
             SVP++ + FG++FL+GL  EG    +M+++L  FAHN+A     GC ++  EV+  +P+R
Sbjct  180   SVPDLFRPFGFHFLYGLGGEGPKKLKMVKALCEFAHNLAMEC--GCGVVATEVASCEPLR  237

Query  1154  RGIPHWKNFSW-QDLWCI  1204
              GIPHWK  S   DLWCI
Sbjct  238   FGIPHWKMLSCANDLWCI  255



>ref|XP_002975895.1| hypothetical protein SELMODRAFT_104443 [Selaginella moellendorffii]
 gb|EFJ22800.1| hypothetical protein SELMODRAFT_104443 [Selaginella moellendorffii]
Length=418

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 159/427 (37%), Positives = 228/427 (53%), Gaps = 36/427 (8%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ VR+Y+   D   VEELE  C+ G  G   L  D + DP+GRVR+  L+ M+VAE  I
Sbjct  2     ELRVRKYDPSGDARRVEELERLCDAGPSGSMSLFADSMGDPLGRVRHFALYTMLVAE--I  59

Query  311   SKEIVGVIRGSIRSVSRGQK----GKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              +EIVGVIR  I+ +  G+K    G    S      AYILGLRVS  HRR GIG  L + 
Sbjct  60    GEEIVGVIRAGIKEMVCGRKRLSDGSGKESAVRARCAYILGLRVSPLHRRKGIGLALARR  119

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             +E W R  GA Y YM T+ SN AS  LF G L +   R+PS+LV PV +H + I S + +
Sbjct  120   IEQWCRDKGAAYAYMMTEKSNVASSGLFVGKLQFRPVRSPSILVHPVFQHWESIPSHIRL  179

Query  659   VRVPPQLAESYYRRNFDGSSEFFP-KDINLVLNN-KLNLGTFMAV---------------  787
              R+ P  A   Y R + G+++FFP  DI+ ++ N +   GT++A                
Sbjct  180   TRLAPADAAEIY-RCYSGATDFFPAADIDSIVGNARCCAGTWLATLKAESTPSSGMAAPL  238

Query  788   ----PKESLSTWEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLI  955
                 P+  +S  +   GVF ++ A++S+W   E++ ++V G     +A    +R LDR +
Sbjct  239   DRRHPRRQVSVKKLLEGVF-SSWAVVSVWKTNEIFTLEVSGAPWRIRAAAAASRALDRAL  297

Query  956   PWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVS  1135
             PW+R+ S P+V + FG +FLFG+   G    E++ +L   A NVAR  R GC ++ AE+ 
Sbjct  298   PWLRISSFPDVFQPFGIHFLFGIAGGGARSGELVAALCKNARNVAR--RNGCAVVAAEMG  355

Query  1136  PDDPVRRGIPHWKNFS-WQDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALI  1312
               DP+   +PHWK+ S   DLWC+           N  A       S ++ M     + +
Sbjct  356   AADPLLGSVPHWKSLSTMDDLWCV----KDLVGIKNTGATVTATPDSGENWMDLPMGSSV  411

Query  1313  FVDPRDI  1333
             FVDPRD 
Sbjct  412   FVDPRDF  418



>ref|NP_180570.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis 
thaliana]
 gb|AAC16963.1| hookless1-like protein [Arabidopsis thaliana]
 gb|AEC08343.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis 
thaliana]
Length=386

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/364 (37%), Positives = 213/364 (59%), Gaps = 30/364 (8%)
 Frame = +2

Query  140   VRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGISKE  319
             +R Y++ RD++ +  +E  CE+G + +  L  D L DPI R+RN+P  +M+VA  G+  +
Sbjct  15    IRCYDDRRDRIQMGRMEKSCEIGHDHQTLLFTDTLGDPICRIRNSPFFIMLVA--GVGNK  72

Query  320   IVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRS  499
             +VG I+GS++ V    K         V V Y+LGLRV   +RR GIG+ LV+ LE W  S
Sbjct  73    LVGSIQGSVKPVEFHDKS--------VRVGYVLGLRVVPSYRRRGIGSILVRKLEEWFES  124

Query  500   NGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK-PIGSDVAVVRVPPQ  676
             + ADY YMAT+  N+AS  LF G L YV FR P++LV PV+  +   + SD+ + ++  +
Sbjct  125   HNADYAYMATEKDNEASHGLFIGRLGYVVFRNPAILVNPVNPGRGLKLPSDIGIRKLKVK  184

Query  677   LAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVFPTNHAI  850
              AES YRRN   ++EFFP DIN +L NKL++GT++A     ++  +W           A+
Sbjct  185   EAESLYRRNVAATTEFFPDDINKILRNKLSIGTWVAYYNNVDNTRSW-----------AM  233

Query  851   LSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRM  1030
             LS+WD+ +V+K++++            +++    +  + L  +P++   FG+YFL+G+  
Sbjct  234   LSVWDSSKVFKLRIERAPLSYLLLTKVSKLFGNFLSLLGLTVLPDLFTPFGFYFLYGVHS  293

Query  1031  EGQSGSEMMESLWAFAHNVAR-NDRRGCELLIAEVSP----DDPVRRGIPHWKNFSW-QD  1192
             EG    +++ +L    HN+A  ND   C++++ EV      DD ++R IPHWK  S   D
Sbjct  294   EGPHCGKLVRALCEHVHNMAALNDGCACKVVVVEVDKGSNGDDSLQRCIPHWKMLSCDDD  353

Query  1193  LWCI  1204
             +WCI
Sbjct  354   MWCI  357



>gb|KFK23396.1| hypothetical protein AALP_AAs60744U000300 [Arabis alpina]
Length=395

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 155/416 (37%), Positives = 238/416 (57%), Gaps = 47/416 (11%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVV+R Y++ RD++ ++ LE  CE+G + +  L  D L DPI R+RN PL  M+VAE G 
Sbjct  12    EVVIRCYDDRRDRIEMDCLEKSCEIGHDHQTLLFTDTLGDPICRIRNTPLFTMLVAEVG-  70

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
              K +VG I+GS++ V    K         V V Y+LGLRV   +RR GIG+ LV+ +E W
Sbjct  71    -KRLVGSIQGSVKPVKFHDKS--------VKVGYVLGLRVVPPYRRRGIGSILVRKMEEW  121

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRH-KKPIGSDVAVVRV  667
                N A+  YMAT   N+AS+ LF G   YV FR P++LV PV+R     + SD+ + ++
Sbjct  122   FVVNNAELAYMATQKDNEASLCLFVGRHGYVVFRNPTILVNPVNRGWGLKLSSDIGIRKL  181

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHA  847
               + A S+YRR+   ++EFFP DI+ +L NKL++GT++A     +   E        + A
Sbjct  182   KVKEAASWYRRHVASTTEFFPDDIDKILRNKLSMGTWVAYYNNDVDNIE--------SWA  233

Query  848   ILSIWDAKEVYKVQVK----GLSALKQAC-FLGTRVLDRLIPWIRLPSVPNVSKNFGYYF  1012
             ++S+WD+ +++K+++         L + C FLG     RL+P++RL ++P++   FG+YF
Sbjct  234   MVSVWDSSKIFKLRIGKAPFSYLLLTKVCNFLG-----RLLPFLRLKALPDLFTPFGFYF  288

Query  1013  LFGLRMEGQSGSEMMESLWAFAHNVA--RNDRRGCELLIAEVSPDDP------VRRGIPH  1168
             L+G+ MEG    +++ +L    HN+A   +D   C++++ EV  DD       +R+ +PH
Sbjct  289   LYGVHMEGPLCGKLVTALCDHVHNMAASSDDGDACKVVVVEVDGDDDDDDDSLLRKCVPH  348

Query  1169  WKNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             WK  S   D WCIK L        N          SE S M+  S + +FVDPRD+
Sbjct  349   WKMLSCDDDTWCIKPLKCEEKMAGNL---------SEFSNMHLGSRSSLFVDPRDV  395



>ref|XP_008465276.1| PREDICTED: probable N-acetyltransferase HLS1-like [Cucumis melo]
Length=420

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 223/378 (59%), Gaps = 27/378 (7%)
 Frame = +2

Query  137   VVRQYEEE-----RDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE  301
             ++R YE+       DK  V +LE +CE+GQ  +  L  D L DPI R+RN+P++ M+VAE
Sbjct  7     IIRSYEDNDEGQLSDKAQVLDLERRCEIGQSKRVFLFTDHLGDPICRIRNSPMYKMLVAE  66

Query  302   HGISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSL  481
                 KE+VGVI+GSI++V      K       V V YILGLRV+  +RR GIG  LV+ L
Sbjct  67    --CDKEVVGVIQGSIKAVFFAAH-KPPPPGLVVKVGYILGLRVAPPYRRRGIGAALVRRL  123

Query  482   ENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPI-GSDVAV  658
             E+W  SN  DY  MAT+  N AS+NLF   L Y+KFRT  +LV PV  H   I  S++ +
Sbjct  124   EDWFVSNDVDYCCMATEKDNHASLNLFINNLRYIKFRTGRILVNPVRNHPYKINSSEIKI  183

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKES----------LST  808
              ++  + AE+ Y+++   S+E FP+DI  +L NKL+LGT+MA  K+            + 
Sbjct  184   QKLRIEEAEAIYKKHM-ASTELFPEDIKNILKNKLSLGTWMANFKQQRYPLRSSSSSSTA  242

Query  809   WEPDSGVFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGT-RVLDRLIPWIRLPSVPN  985
                +  +  ++ AI+S+W++ EV+K+++ G +      +  + +++D++ P  +L  VPN
Sbjct  243   GGNEQIMSSSSWAIVSLWNSGEVFKLRL-GKAPFPWVIYTKSLKIMDKIFPCFKLVLVPN  301

Query  986   VSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRR--GCELLIAEV--SPDDPVR  1153
               K FG+YF++GL  EG     ++ +L  F HN+A N+ +   C+ ++ E+    DD ++
Sbjct  302   FFKPFGFYFVYGLHHEGPFSERLVGALCKFVHNMAMNNSKDHNCKAIVTEIGGDEDDDLK  361

Query  1154  RGIPHWKNFS-WQDLWCI  1204
               IPHWK  S ++D WCI
Sbjct  362   MEIPHWKLLSCYEDFWCI  379



>ref|XP_002465676.1| hypothetical protein SORBIDRAFT_01g043530 [Sorghum bicolor]
 gb|EER92674.1| hypothetical protein SORBIDRAFT_01g043530 [Sorghum bicolor]
Length=405

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 146/367 (40%), Positives = 217/367 (59%), Gaps = 12/367 (3%)
 Frame = +2

Query  122   KLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE  301
             + P VV+R+Y  + D+   + ++ +CEVG  G   L  DLL DP+ R+R++P ++M+VAE
Sbjct  11    RRPAVVIREYNPKTDRDGTDAVDRECEVGPAGGMSLHADLLGDPVARIRHSPHYLMLVAE  70

Query  302   HG--ISKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQ  475
                     IVG++RG+++SV+ G+      +  +  V YILGLRV+  HRR+GI  +LV+
Sbjct  71    TSGPADARIVGLVRGTVKSVASGKS--RPGAPAFAKVGYILGLRVAPSHRRMGIALQLVR  128

Query  476   SLENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVA  655
              LE W    GA+Y YMATD SN+AS+ LFTG   Y KFRTPS+LV PVH H+        
Sbjct  129   QLEQWFELMGAEYAYMATDKSNEASLRLFTGRCGYSKFRTPSLLVHPVHLHRLKPPRRAT  188

Query  656   VVRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTW---EPDSG  826
             VVR+  + AE  YR       EFFP DI  VL+N L+ GTF+A+  E    W   +    
Sbjct  189   VVRLGARDAERLYRSRC-AHVEFFPADIGDVLDNTLSHGTFLAIVGEDGYEWGGVDRFLA  247

Query  827   VFPTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGY  1006
               P + A+ S WD   V++++V+G S L++     TR LDR+  W+R+PSVP+  + F  
Sbjct  248   TPPASWAVASAWDCGGVFRLEVRGASRLRRGAAAATRALDRVAKWLRVPSVPDFFRPFAG  307

Query  1007  YFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW  1186
             +F++GL   G+  +   E+++A   N+AR       + +A +   DP+R  IPHW+  S 
Sbjct  308   WFVYGLAGTGRDAAVAAEAVFASIVNLARGRAAAVAVEVAAM---DPLRGRIPHWRRLSC  364

Query  1187  -QDLWCI  1204
              +DLWC+
Sbjct  365   TEDLWCM  371



>ref|XP_004985277.1| PREDICTED: uncharacterized protein LOC101770019 [Setaria italica]
Length=405

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 152/362 (42%), Positives = 214/362 (59%), Gaps = 10/362 (3%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAE-HGI  310
             VV+R Y  + D+   E ++ +CEVG  G   L  DLL DP+ R+R++P H+M+VAE  G 
Sbjct  18    VVIRSYNPKTDQAGTEAVDRECEVGPAGGMSLHADLLGDPVARIRHSPHHLMLVAETSGP  77

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
                IVG+IRG+++SV+ G K        + +V YILGLRV+  HRR+GI   LV+ LE W
Sbjct  78    GGRIVGLIRGTVKSVATG-KACPQGEPAFANVGYILGLRVAPSHRRMGIARLLVRQLERW  136

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                 GA+Y YMATD SN+AS+ LFTG   Y KFRTPS+LV PVH H+        VVR+ 
Sbjct  137   FEVMGAEYAYMATDKSNEASLRLFTGRCGYSKFRTPSLLVHPVHSHRLRAPRRATVVRLG  196

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVF---PTN  841
                AE  YR  F  + EFFP DI  VL+N+L+ GTF+A+       W          P +
Sbjct  197   ACDAERLYRSRF-ANVEFFPADIGAVLDNQLSRGTFLAIVDGGGYEWRGVEDFLSSPPAS  255

Query  842   HAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFG  1021
              A+ S WD   V++++V+G S L++     TR LDR+  W+R+PSVP+  + F  +F++G
Sbjct  256   WAVASAWDCGGVFRLEVRGASRLRRGAAAATRALDRVAKWLRVPSVPDFFRPFAGWFVYG  315

Query  1022  LRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLW  1198
             L  +G   +   E+L+A   N+AR       L +A +   DP+R  IPHW+  S  +DLW
Sbjct  316   LGGDGGDAAVAAEALFASIVNMARGAAAAVALEVAAM---DPLRSRIPHWRRLSCAEDLW  372

Query  1199  CI  1204
             C+
Sbjct  373   CM  374



>ref|XP_010469898.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=393

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 147/411 (36%), Positives = 232/411 (56%), Gaps = 39/411 (9%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVV+R Y++ RD + ++ +E  CE+G + +  L  D   DPI R+RN+PL  M+VAE G 
Sbjct  12    EVVIRCYDDRRDIIQMDRVEKSCEIGHDAQTLLSTDSFGDPICRIRNSPLFTMLVAEVG-  70

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VG I+GS++ V    K         V V Y+LGLRV  Q+RR GIG+ LV+ LE W
Sbjct  71    -NKLVGSIQGSVKPVEFHDKS--------VRVGYVLGLRVVPQYRRRGIGSILVRKLEEW  121

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK-PIGSDVAVVRV  667
               S+ ADY YMAT   N+AS+ LF GTL Y  FR P++LV PV+      + SD+ +  +
Sbjct  122   FVSHNADYAYMATQKDNEASLGLFIGTLGYNVFRNPAILVNPVNPGGSLKLPSDIGIRML  181

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNH  844
               + AES YRR+   ++EFFP DI+ +L N+L++GT++A  K +++ +W           
Sbjct  182   KVKEAESLYRRHVAATTEFFPDDIDKILRNRLSVGTWVAYYKNDNIGSW-----------  230

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A+LS+WD+ +V+ +++K            + +  +++    + S+P++   FG+YFL+G+
Sbjct  231   AMLSVWDSSKVFNLRIKKAPLSYLLLTKVSNLFGKILSLFGIRSLPDLFTPFGFYFLYGV  290

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRG-CELLIAEV------SPDDPVRRGIPHWKNFS  1183
               EG    +++ +L    HN+A  D  G C++++ EV        D  + R IPHWK  S
Sbjct  291   HAEGPLSGKLVRALCEHVHNMAAADDAGACKVIVVEVDGGSNGDDDSFLGRCIPHWKMLS  350

Query  1184  W-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
                D+WCIK L    + N  ++ + +   S   S +        FVDPRD+
Sbjct  351   CDDDMWCIKPLKCEEEMNGLSEFSKMCLRSKPRSSL--------FVDPRDV  393



>ref|XP_003558548.1| PREDICTED: probable N-acetyltransferase HLS1 isoform X1 [Brachypodium 
distachyon]
Length=399

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 152/371 (41%), Positives = 216/371 (58%), Gaps = 19/371 (5%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGIS  313
             V++R+Y+   D+   E ++  CEVG  G   L  DLL DP+ R+R++P ++M+VAE    
Sbjct  3     VLIREYDPSTDREGTEAVDRDCEVGPTGGMSLHADLLGDPVARIRHSPAYLMLVAETSGG  62

Query  314   ---KEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLE  484
                + IVGVIRG+++ V+ G+      +  +  V YILGLRVS  HRR+GI  +LV+ LE
Sbjct  63    PGGRRIVGVIRGTVKPVATGKH--QSCAPAFASVGYILGLRVSPSHRRMGIALELVRRLE  120

Query  485   NWGRSNGADYIYMATDCSNQASINLFTG-TLNYVKFRTPSVLVQPVHRHK-KPIGSDVAV  658
              W    GA+Y YMAT+ SN+AS+ LFTG  L Y KFRTPS+LV PVH H+ +P     A+
Sbjct  121   QWFALRGAEYAYMATEKSNEASLRLFTGPKLGYSKFRTPSLLVHPVHAHRLRPPRRVTAL  180

Query  659   VRVPPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMA--VPKESLSTWEPDSGVF  832
             V +    AE  YRR F    EFFP DI  VL N L+LGTF+A  V  E  S      GV 
Sbjct  181   VPLDALDAEKLYRRRFARDVEFFPTDIGAVLGNTLSLGTFLAVVVGAEDASKKFEWRGVE  240

Query  833   ------PTNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSK  994
                   P + A+ S+WD   V++++++G S  ++A    +R LDR   W+R+PSVP+  +
Sbjct  241   QFLASPPASWAVASLWDCGGVFRLEMRGASRARRALAAASRALDRAAKWMRVPSVPDFFR  300

Query  995   NFGYYFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWK  1174
              F  +F +GL  EG       ++L A   N+AR       + +A     DP+RR +PHW+
Sbjct  301   PFAGWFAYGLAGEGDEAPLAAKALLASFVNMARGRAAAVAVEVAAC---DPLRRRLPHWR  357

Query  1175  NFSW-QDLWCI  1204
               S  +DLWC+
Sbjct  358   RLSCTEDLWCM  368



>emb|CDY02031.1| BnaC04g14700D [Brassica napus]
Length=390

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 145/415 (35%), Positives = 232/415 (56%), Gaps = 50/415 (12%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +VV+R Y ++RD++ +E +E  CE+G + +  L  D L DPI R+RN P   M+VAE  +
Sbjct  12    KVVIRCYNDQRDRIEMECVEKSCEIGND-QTFLFTDTLGDPICRIRNTPRFTMLVAE--V  68

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VG I+GS++ V    K         V+V Y+L LRV   +RR GIG+ LV+ LE W
Sbjct  69    RNKLVGSIQGSVKPVKLQDKS--------VNVGYVLALRVMPPYRRHGIGSMLVRKLEEW  120

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               S+ ADY YMAT   N+AS+ LF G L YV FR P++LV PV+     + SD+ + ++ 
Sbjct  121   FMSHNADYAYMATQKDNEASLGLFVGKLGYVIFRNPAILVNPVNPRGLKLPSDIGIRKLK  180

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK--ESLSTWEPDSGVFPTNH  844
              + A S+YR++   +++FFP DI  +L NKL++GT++A  K  + + +W           
Sbjct  181   VKEAASWYRKHVVSNTDFFPHDIVKILRNKLSIGTWVAYYKNNDKIISW-----------  229

Query  845   AILSIWDAKEVYKVQVK----GLSALKQAC-FLGTRVLDRLIPWIRLPSVPNVSKNFGYY  1009
             AILS+W++ +V+K+++         L + C F+G     R +P++ L ++P++   FG+Y
Sbjct  230   AILSVWNSSKVFKLRIGKAPLSFVILTKVCNFVG-----RFLPFLGLTALPDLFTPFGFY  284

Query  1010  FLFGLRMEGQSGSEMMESLWAFAHNVARNDRRG-CELLIAEV-----SPDDPVRRGIPHW  1171
             FL+G+  EG    +++ +L     N+A  D  G C++++ EV       D  +RR +PHW
Sbjct  285   FLYGVHAEGPLRGKLVRTLCEHVSNMAVLDDGGECKVVVVEVDGESNGSDYSLRRCVPHW  344

Query  1172  KNFSW-QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             K  S   D WCI             +  N    S   ++  +  S  +FVDPRD+
Sbjct  345   KMLSCDDDTWCI---------KPLKREENTTSLSDFTNMFLNSKSRCLFVDPRDV  390



>ref|XP_002968586.1| hypothetical protein SELMODRAFT_231183 [Selaginella moellendorffii]
 gb|EFJ30840.1| hypothetical protein SELMODRAFT_231183 [Selaginella moellendorffii]
Length=377

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 156/407 (38%), Positives = 217/407 (53%), Gaps = 37/407 (9%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             E+ VR+Y+   D   VEELE  C+ G  G   L  D + DP+GRVR+  L+ M+VAE  I
Sbjct  2     ELRVRKYDPLGDARRVEELERLCDAGPSGSMSLFADSMGDPLGRVRHFALYTMLVAE--I  59

Query  311   SKEIVGVIRGSIRSVSRGQK----GKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQS  478
              +EIVGVIR  I+ +  G+K    G    S      AYILGLRVS  HRR GIG  L + 
Sbjct  60    GEEIVGVIRAGIKEMVCGRKRLSGGSGKESAIRARCAYILGLRVSPLHRRKGIGLALARR  119

Query  479   LENWGRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAV  658
             +E W R  GA Y YM T+ SN AS  LF G L +   R+PS+LV PV +H + I S + +
Sbjct  120   IEQWCRDKGAAYAYMMTEKSNVASSGLFVGKLQFRPVRSPSILVHPVFQHWESIPSHIRL  179

Query  659   VRVPPQLAESYYRRNFDGSSEFFP-KDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFP  835
              R+ P  A   Y R + G+++FFP  DI+ +   KL  G F        S+W        
Sbjct  180   TRLAPADAAEIY-RCYSGATDFFPAADIDSI---KLLEGVF--------SSW--------  219

Query  836   TNHAILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFL  1015
                A++S+W   E++ ++V G     +A    +R LDR +PW+R+ S P+V + FG +FL
Sbjct  220   ---AVVSVWKTNEIFTLEVSGAPWRIRAAAAASRALDRALPWLRISSFPDVFQPFGIHFL  276

Query  1016  FGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFS-WQD  1192
             FG+   G    E++ +L   A NVAR  R GC ++ AE+   DP+   +PHWK+ S   D
Sbjct  277   FGIAGGGARSGELVAALCKNARNVAR--RNGCAVVAAEMGAADPLLGSVPHWKSLSTMDD  334

Query  1193  LWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
             LWC+           N  A       S ++ M     + +FVDPRD 
Sbjct  335   LWCV----KDLVGIKNTGATVTATPDSGENWMDLPMGSPVFVDPRDF  377



>gb|AGT17212.1| GCN5-related N-acetyltransferase-like protein [Saccharum hybrid 
cultivar R570]
Length=411

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 152/390 (39%), Positives = 213/390 (55%), Gaps = 56/390 (14%)
 Frame = +2

Query  134   VVVRQYEEERDKVAVEELESQCEVG----QEGKP-------------------------R  226
             + VR+++ ERD  AVEELE  C+VG    Q   P                          
Sbjct  15    IRVREFDVERDLRAVEELERLCQVGLSSDQGSDPVADHDGGAEKTARSSKKKKKKKKGMS  74

Query  227   LVIDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRG--QKGKNDNSTDYV  400
             L ++ + DP  RVR+AP +VM+VAE+G   E+VGVI+   R VSRG  ++  + +S  +V
Sbjct  75    LYVEQIGDPFARVRHAPDNVMLVAEYGQEDEVVGVIKVCTRMVSRGKKKQSLSSSSKQFV  134

Query  401   DVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNGADYIYMATDCSNQASINLFTGTLNY  580
              VA +LGLRVS  HRR GI T+LV+  E+W  + GA Y  MAT  SN AS+ LFTG   Y
Sbjct  135   KVACLLGLRVSPSHRRHGIATELVRRAESWCAARGAAYATMATTESNAASLALFTGRFAY  194

Query  581   VKFRTPSVLVQPVHRHKKPIGSDVAVVRVP----------PQLAESYYRRNFDGSSEFFP  730
               F+ P  L  PVHRH+         VR+P          P  A +Y       ++EF P
Sbjct  195   APFKRPVFLGHPVHRHR---------VRIPRAHRVLRLPPPLAAAAYAALLPPSAAEFLP  245

Query  731   KDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPT-NHAILSIWDAKEVYKVQVKGLSA  907
              D+  +LN+KL LGT++A+ +       PD     T + A+LS+WDA    +++V G   
Sbjct  246   ADLPALLNHKLTLGTYLAIQRGG----GPDENPARTPSFALLSVWDATRSLRLRVGGAPT  301

Query  908   LKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQSGSEMMESLWAFAHNV  1087
             L +A     R LDR  PW+++PSVP++ + FG Y ++GLRM G  G  ++ SL   AHNV
Sbjct  302   LLRASLAAARALDRHAPWLQVPSVPDIFRPFGTYLMYGLRMSGPEGPALLRSLCRHAHNV  361

Query  1088  ARNDRRGCELLIAEVSPDDPVRRGIPHWKN  1177
             AR +   C +L A++ PDDP +  +PHW N
Sbjct  362   ARKN-PACAVLAADLGPDDPAKAVVPHWPN  390



>ref|XP_002438760.1| hypothetical protein SORBIDRAFT_10g025680 [Sorghum bicolor]
 gb|EER90127.1| hypothetical protein SORBIDRAFT_10g025680 [Sorghum bicolor]
Length=442

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 166/415 (40%), Positives = 230/415 (55%), Gaps = 59/415 (14%)
 Frame = +2

Query  119   EKLPEVVVRQYEEERDKVAVEELESQCEVGQEGKPR------------------------  226
             EK     VR+++ ERD  AVEELE +C+VG  G                           
Sbjct  4     EKKVSFRVREFDMERDLAAVEELERRCQVGLGGDDDPDDDDDDDDDSGRGGGSKRRKTTK  63

Query  227   --------------LVIDLLDDPIGRVRNAPLHVMMVAEHGISKEIVGVIRGSIRSVSRG  364
                           L ++L+ DP+ RVR+AP HVM+VAE+G   E+VG+I+  +R VSRG
Sbjct  64    RKKKKKKKKKKGMSLSVELVGDPLARVRHAPEHVMLVAEYGEEAEMVGLIKACVRVVSRG  123

Query  365   QKGKNDNSTD-------------YVDVAYILGLRVSSQHRRLGIGTKLVQSLENWGRSNG  505
               GK    +              YV VA +LGLRVS  HRRLGI T LV+  E W R  G
Sbjct  124   SGGKTQKPSSSSPKQQQPPSPPAYVKVACLLGLRVSPSHRRLGIATALVERAEEWCRERG  183

Query  506   ADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVR-VPPQLA  682
             A +  MAT  SN AS+ LFTG   Y  FR P  L +PVH H+ PI S   V +  PP  A
Sbjct  184   ASHATMATTTSNAASLALFTGRFGYAPFRRPEFLGRPVHAHRLPIPSTHRVYQLPPPLAA  243

Query  683   ESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKESLSTWEPDSGVFPTNHAILSIW  862
              +Y R +   ++EF P D+  +L +KL LGTF+A+  ES    +P +   P + A+LS+W
Sbjct  244   AAYARLSPPHATEFLPADMPALLAHKLTLGTFVAI--ESGPERDPSA---PPSFAVLSVW  298

Query  863   DAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLRMEGQS  1042
             D+    +++V+G  AL +A     R LDR  PW+R+PS+P++ + FG Y L+GLRM G +
Sbjct  299   DSTRSMRLRVRGAPALLRASLAALRALDRGAPWMRVPSIPDIFRPFGAYLLYGLRMSGPA  358

Query  1043  GSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
             G +++ SL   AHNVAR +   C ++ A+V+PDDP    +P W+ FS  +D+WCI
Sbjct  359   GPDLLRSLCHHAHNVARKN-PDCAVVAADVAPDDPAAAAVPRWRRFSCDEDVWCI  412



>ref|XP_002314944.2| hypothetical protein POPTR_0010s15480g [Populus trichocarpa]
 gb|EEF01115.2| hypothetical protein POPTR_0010s15480g [Populus trichocarpa]
Length=397

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/410 (34%), Positives = 230/410 (56%), Gaps = 29/410 (7%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             +VV+R+Y E+RD   V +LE +CE+G   +  +  +++ DP+ R+R  P+HVM+VAE   
Sbjct  8     KVVIREYNEDRDIKVVGKLERKCEIGSNKEVSIFTNMMGDPLSRIRFYPVHVMLVAELRE  67

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
             + E+VGV++G I+ V             YV +  ILGLRVS +HRR+GIG +LV+S+E W
Sbjct  68    NGELVGVVKGCIKCVG------TRFGASYVRLGCILGLRVSPRHRRMGIGLELVKSVEEW  121

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
                NGA Y ++AT+ +N AS NLFT   NY+ F +  + VQP     K +  D+ + ++ 
Sbjct  122   LIGNGAHYTFLATEKNNVASTNLFTSKCNYMNFTSLVIFVQPASLPVKGLSQDIKIEKLQ  181

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPKE----SLSTWEPDSGVF--  832
                A   Y   F  S + +P D++ +L  KL++GT+++  KE    SL + E +  +   
Sbjct  182   TDQAIYLYNNKFK-SKDIYPTDVDAILKEKLSIGTWVSYFKEEEWISLHSNERNEDIITR  240

Query  833   -PTNHAILSIWDAKEVYKVQV-KGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGY  1006
              P++ A+ SIW++ E YK+ + K     K      +   D++ P ++ P   ++ K FG+
Sbjct  241   TPSSWAMFSIWNSCEAYKLHIRKSHHPFKFFHATLSHARDKIFPCLKFPICHSLQKPFGF  300

Query  1007  YFLFGLRMEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW  1186
              FLFGL  EG+   E+M+S+W+FA  +A N  + C+++I+E+   DP+   +P   + S+
Sbjct  301   LFLFGLYGEGERLQELMKSIWSFASRLAEN-VKDCKVIISELGVSDPLIEHVPQESSMSF  359

Query  1187  -QDLWCIkhlnlvgdnnnnnkaanivhdSSEDSIMYHDSSALIFVDPRDI  1333
               DLW +             K  + + D +E+ ++    +  +FVDPRD 
Sbjct  360   INDLWYL------------KKVNDNITDDNEEPVVMGQVTGNVFVDPRDF  397



>ref|XP_006488559.1| PREDICTED: probable N-acetyltransferase HLS1-like isoform X2 
[Citrus sinensis]
Length=339

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/360 (37%), Positives = 200/360 (56%), Gaps = 57/360 (16%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EV+ R Y+ + D+  VE+LE +CEVG   +  L  D L DPI R+RN+P++ M+VAE  +
Sbjct  5     EVITRSYDRQIDRARVEDLERRCEVGPAERVFLFTDTLGDPICRIRNSPMYKMLVAE--L  62

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
              +E+VGVI+GSI+ V+  +  +     D   V Y+LGLRV+  HRR GIG+ LV  LE W
Sbjct  63    DRELVGVIQGSIKQVTVQKPHE-----DLAKVGYVLGLRVAPLHRRKGIGSSLVCKLEEW  117

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKKPIGSDVAVVRVP  670
               SN  DY YMAT+  N+AS+ LF   L YV FRTP++LV PV+       S+V + ++ 
Sbjct  118   FTSNDVDYAYMATEKDNEASVKLFVNKLGYVNFRTPAILVHPVNNRMFHTPSNVQIRKLR  177

Query  671   PQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNHA  847
              + AE+ Y + F  S+EFFP DI  +L NKL+LGT++A P+ E +  +  +  +FP + A
Sbjct  178   IEEAENLYYK-FMASTEFFPYDIGNILRNKLSLGTWVAYPRGEIVGEFGSNGQIFPKSWA  236

Query  848   ILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGLR  1027
             ++S+W++ E++K++                                              
Sbjct  237   MVSVWNSGELFKLR----------------------------------------------  250

Query  1028  MEGQSGSEMMESLWAFAHNVARNDRRGCELLIAEVSPDDPVRRGIPHWKNFSW-QDLWCI  1204
              EG    +M+ +L  F HN+A    + C++++ EV   D +R  IPHWK  S  +DLWCI
Sbjct  251   -EGPLSGKMVRTLCQFVHNMASTKSKDCKVIVTEVGGSDALRLHIPHWKLLSCPEDLWCI  309



>ref|XP_010414316.1| PREDICTED: probable N-acetyltransferase HLS1 [Camelina sativa]
Length=393

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/368 (37%), Positives = 212/368 (58%), Gaps = 31/368 (8%)
 Frame = +2

Query  131   EVVVRQYEEERDKVAVEELESQCEVGQEGKPRLVIDLLDDPIGRVRNAPLHVMMVAEHGI  310
             EVV+R Y++ RD + ++ +E  CE+G + +  L  D L DPI R+RN+ L  M+VAE G 
Sbjct  12    EVVIRCYDDRRDIIQMDRVEKSCEIGHDDQTLLSTDSLGDPICRIRNSLLFTMLVAEVG-  70

Query  311   SKEIVGVIRGSIRSVSRGQKGKNDNSTDYVDVAYILGLRVSSQHRRLGIGTKLVQSLENW  490
               ++VG I+GS++ V    K         V V Y+LGLRV  Q+RR GIG+ LV+ LE W
Sbjct  71    -NKVVGSIQGSVKPVEFHDKS--------VRVGYVLGLRVVPQYRRRGIGSILVRKLEEW  121

Query  491   GRSNGADYIYMATDCSNQASINLFTGTLNYVKFRTPSVLVQPVHRHKK-PIGSDVAVVRV  667
               S+ ADY YMAT   N+AS+ LF G L Y  FR P++LV PV+      + SD+ +  +
Sbjct  122   FGSHNADYAYMATQKDNEASLGLFVGKLGYNVFRNPAILVNPVNPGGSLKLPSDIGIRML  181

Query  668   PPQLAESYYRRNFDGSSEFFPKDINLVLNNKLNLGTFMAVPK-ESLSTWEPDSGVFPTNH  844
               + AES YR +   ++EFFP DI+ +L N+L++GT++A  K +++ +W           
Sbjct  182   KVKEAESLYRTHVAATTEFFPDDIDSILRNRLSVGTWVAYYKNDNIGSW-----------  230

Query  845   AILSIWDAKEVYKVQVKGLSALKQACFLGTRVLDRLIPWIRLPSVPNVSKNFGYYFLFGL  1024
             A+LS+WD+ +V+ +++K            ++V    +    + S+P++   FG+YFL+G+
Sbjct  231   AMLSVWDSSKVFNLRIKKSRLSYLLLTKASKVFGTFLSLFGIRSLPDLFTPFGFYFLYGV  290

Query  1025  RMEGQSGSEMMESLWAFAHNVARNDRRGC-ELLIAEVS------PDDPVRRGIPHWKNFS  1183
               EG    +++ +L    HN+A +D  G  ++++ EV        DD + R IPHWK  S
Sbjct  291   HAEGPLSGKLVRALCEHVHNMAASDDAGARKVVVVEVDGGSNGEDDDSLGRCIPHWKMLS  350

Query  1184  W-QDLWCI  1204
                D+WCI
Sbjct  351   CDDDMWCI  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3721193409042