BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30848_g1_i1 len=787 path=[765:0-786]

Length=787
                                                                      Score     E

ref|XP_002285141.1|  PREDICTED: peamaclein                              135   3e-36   Vitis vinifera
ref|XP_004290947.1|  PREDICTED: peamaclein-like                         134   5e-36   
ref|XP_009591073.1|  PREDICTED: peamaclein-like                         134   8e-36   
ref|XP_006472264.1|  PREDICTED: snakin-1-like                           133   1e-35   
ref|XP_006374850.1|  hypothetical protein POPTR_0014s02030g             133   2e-35   
ref|XP_009773391.1|  PREDICTED: peamaclein-like                         132   3e-35   
ref|XP_011029030.1|  PREDICTED: peamaclein-like                         132   3e-35   
ref|XP_008360977.1|  PREDICTED: peamaclein                              132   3e-35   
ref|XP_009360284.1|  PREDICTED: peamaclein                              132   4e-35   
ref|XP_006433597.1|  hypothetical protein CICLE_v10002979mg             132   4e-35   
ref|XP_008377985.1|  PREDICTED: peamaclein                              132   5e-35   
ref|XP_010059861.1|  PREDICTED: peamaclein                              131   6e-35   
gb|AFT92001.1|  gibberellin-regulated protein                           131   1e-34   
gb|AFT92002.1|  gibberellin-regulated protein                           130   2e-34   
ref|XP_009354123.1|  PREDICTED: peamaclein-like isoform X1              130   3e-34   
ref|XP_010105475.1|  hypothetical protein L484_010255                   129   5e-34   
gb|AGE15502.1|  GA-stimulated transcript-like protein 6                 129   8e-34   
ref|XP_002510126.1|  GAST1 protein precursor, putative                  127   2e-33   Ricinus communis
ref|XP_003550315.1|  PREDICTED: snakin-1                                127   3e-33   
gb|ACU13365.1|  unknown                                                 126   6e-33   Glycine max [soybeans]
ref|NP_001236984.1|  uncharacterized protein LOC100500113               126   2e-32   
ref|XP_009354124.1|  PREDICTED: peamaclein-like isoform X2              124   4e-32   
ref|XP_006422868.1|  hypothetical protein CICLE_v10029695mg             124   6e-32   
gb|KHN21405.1|  Snakin-1                                                124   6e-32   
ref|XP_006361222.1|  PREDICTED: snakin-1-like                           123   9e-32   
ref|XP_004252297.1|  PREDICTED: peamaclein                              123   1e-31   
ref|XP_010066158.1|  PREDICTED: peamaclein-like                         123   2e-31   
ref|XP_010320309.1|  PREDICTED: LOW QUALITY PROTEIN: snakin-1-like      122   2e-31   
ref|XP_006362074.1|  PREDICTED: snakin-1-like                           122   2e-31   
ref|XP_010066166.1|  PREDICTED: peamaclein-like                         122   2e-31   
ref|XP_006486958.1|  PREDICTED: snakin-1-like                           122   3e-31   
sp|Q948Z4.1|SNAK1_SOLTU  RecName: Full=Snakin-1; Flags: Precursor       122   3e-31   Solanum tuberosum [potatoes]
gb|ABQ42621.1|  snakin-1                                                122   3e-31   Solanum bulbocastanum [ornamental nightshade]
ref|XP_010099066.1|  hypothetical protein L484_011500                   122   4e-31   
ref|XP_010688303.1|  PREDICTED: peamaclein                              121   5e-31   
gb|KHN42338.1|  Snakin-1                                                121   6e-31   
emb|CDP01230.1|  unnamed protein product                                121   6e-31   
ref|XP_009620159.1|  PREDICTED: snakin-1                                121   6e-31   
ref|XP_007223838.1|  hypothetical protein PRUPE_ppa014086mg             121   6e-31   
gb|ABQ42622.1|  snakin-1                                                121   7e-31   Solanum chacoense
ref|XP_011069570.1|  PREDICTED: peamaclein                              121   8e-31   
ref|XP_006400907.1|  hypothetical protein EUTSA_v10015142mg             120   2e-30   
gb|EYU29123.1|  hypothetical protein MIMGU_mgv1a017184mg                120   2e-30   
ref|XP_009795533.1|  PREDICTED: snakin-1                                120   2e-30   
ref|XP_011069770.1|  PREDICTED: peamaclein-like                         119   6e-30   
ref|XP_004499015.1|  PREDICTED: snakin-1-like                           118   7e-30   
ref|XP_006346618.1|  PREDICTED: snakin-1-like                           118   8e-30   
gb|KDP41652.1|  hypothetical protein JCGZ_16059                         118   8e-30   
ref|XP_009380091.1|  PREDICTED: peamaclein-like                         118   1e-29   
ref|XP_007047444.1|  Gibberellin-regulated family protein, putative     118   2e-29   
ref|XP_002864654.1|  gibberellin-regulated family protein               116   4e-29   
ref|XP_009404126.1|  PREDICTED: peamaclein-like                         116   5e-29   
ref|XP_002524960.1|  conserved hypothetical protein                     116   6e-29   Ricinus communis
ref|XP_004252296.1|  PREDICTED: peamaclein-like                         115   7e-29   
ref|XP_009403087.1|  PREDICTED: peamaclein-like                         115   1e-28   
ref|XP_002300251.2|  hypothetical protein POPTR_0001s30500g             115   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009598103.1|  PREDICTED: peamaclein-like                         115   2e-28   
ref|XP_008440339.1|  PREDICTED: peamaclein-like                         114   3e-28   
gb|AFK41274.1|  unknown                                                 114   3e-28   
ref|XP_008346370.1|  PREDICTED: peamaclein-like                         114   4e-28   
gb|EYU29122.1|  hypothetical protein MIMGU_mgv1a017256mg                114   4e-28   
ref|NP_181486.1|  gibberellin-regulated protein                         113   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339505.1|  PREDICTED: peamaclein-like                         113   7e-28   
ref|XP_006281389.1|  hypothetical protein CARUB_v10027450mg             113   7e-28   
ref|NP_568914.1|  gibberellin-regulated protein                         113   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25492.1|  hypothetical protein MIMGU_mgv1a017072mg                113   1e-27   
gb|KHF99282.1|  Snakin-1                                                112   1e-27   
ref|XP_010443767.1|  PREDICTED: gibberellin-regulated protein 10-...    112   2e-27   
ref|XP_006346656.1|  PREDICTED: peamaclein-like                         111   2e-27   
ref|XP_010920764.1|  PREDICTED: peamaclein-like                         111   3e-27   
ref|XP_002313889.2|  hypothetical protein POPTR_0009s09560g             111   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009381473.1|  PREDICTED: peamaclein-like                         111   3e-27   
ref|XP_009144432.1|  PREDICTED: gibberellin-regulated protein 8-like    111   3e-27   
gb|EYU22941.1|  hypothetical protein MIMGU_mgv1a022909mg                111   4e-27   
ref|XP_010679570.1|  PREDICTED: peamaclein-like                         111   4e-27   
emb|CBI22497.3|  unnamed protein product                                111   4e-27   
ref|XP_002271730.2|  PREDICTED: snakin-1                                112   5e-27   Vitis vinifera
ref|XP_008792652.1|  PREDICTED: peamaclein-like                         110   7e-27   
ref|XP_003636819.1|  Snakin-1                                           110   7e-27   
ref|XP_010271646.1|  PREDICTED: peamaclein-like                         110   9e-27   
ref|XP_003525918.1|  PREDICTED: snakin-1                                110   1e-26   
ref|XP_007136735.1|  hypothetical protein PHAVU_009G069900g             110   1e-26   
dbj|BAB08352.1|  unnamed protein product                                109   1e-26   Arabidopsis thaliana [mouse-ear cress]
sp|P86888.1|PMLN_PRUPE  RecName: Full=Peamaclein; AltName: Allerg...    108   2e-26   
ref|XP_006829298.1|  hypothetical protein AMTR_s00001p00273070          109   2e-26   
ref|XP_006417449.1|  hypothetical protein EUTSA_v10009615mg             109   2e-26   
ref|XP_008787135.1|  PREDICTED: peamaclein-like                         109   3e-26   
gb|KCW63655.1|  hypothetical protein EUGRSUZ_G01294                     110   3e-26   
ref|XP_004496906.1|  PREDICTED: snakin-1-like                           108   3e-26   
ref|XP_010315202.1|  PREDICTED: peamaclein                              108   4e-26   
ref|XP_006346334.1|  PREDICTED: snakin-1-like                           108   4e-26   
ref|XP_010065940.1|  PREDICTED: peamaclein-like                         108   4e-26   
ref|XP_010909081.1|  PREDICTED: peamaclein-like                         108   6e-26   
ref|XP_010488933.1|  PREDICTED: gibberellin-regulated protein 7-like    108   8e-26   
ref|XP_010467274.1|  PREDICTED: gibberellin-regulated protein 7-like    108   9e-26   
ref|XP_010556423.1|  PREDICTED: peamaclein                              107   1e-25   
gb|ABK94917.1|  unknown                                                 107   1e-25   Populus trichocarpa [western balsam poplar]
gb|KHG20586.1|  Snakin-1                                                106   2e-25   
ref|XP_010906256.1|  PREDICTED: peamaclein-like                         106   3e-25   
ref|XP_010517902.1|  PREDICTED: gibberellin-regulated protein 7         107   3e-25   
ref|XP_011074384.1|  PREDICTED: peamaclein-like                         106   3e-25   
emb|CDP07216.1|  unnamed protein product                                106   3e-25   
ref|XP_004152264.1|  PREDICTED: snakin-1-like                           105   4e-25   
gb|EPS58046.1|  hypothetical protein M569_16773                         106   4e-25   
ref|XP_004501536.1|  PREDICTED: peamaclein-like                         105   8e-25   
gb|AAY51975.1|  GIR1                                                    105   8e-25   Vigna radiata [mung bean]
ref|XP_007042576.1|  Uncharacterized protein TCM_007177                 105   9e-25   
emb|CDX80222.1|  BnaC09g35200D                                          105   1e-24   
emb|CDY31590.1|  BnaA10g12810D                                          104   1e-24   
ref|XP_006298856.1|  hypothetical protein CARUB_v10014971mg             105   1e-24   
ref|NP_001077503.1|  Gibberellin-regulated GASA/GAST/Snakin famil...    104   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491469.1|  PREDICTED: gibberellin-regulated protein 8-like    103   2e-24   
ref|XP_003536595.1|  PREDICTED: snakin-1                                103   2e-24   
ref|XP_006306379.1|  hypothetical protein CARUB_v10012286mg             103   2e-24   
emb|CDY31591.1|  BnaA10g12800D                                          103   3e-24   
ref|XP_004289740.1|  PREDICTED: snakin-1-like                           103   3e-24   
ref|XP_010475933.1|  PREDICTED: gibberellin-regulated protein 8-like    103   4e-24   
ref|XP_009120506.1|  PREDICTED: gibberellin-regulated protein 10-...    103   4e-24   
ref|XP_009123227.1|  PREDICTED: gibberellin-regulated protein 7 i...    103   4e-24   
ref|XP_002283986.1|  PREDICTED: snakin-1-like                           104   4e-24   Vitis vinifera
ref|XP_009120505.1|  PREDICTED: gibberellin-regulated protein 10-...    103   5e-24   
ref|XP_004141992.1|  PREDICTED: snakin-1-like                           103   5e-24   
ref|NP_001237325.1|  uncharacterized protein LOC100527527 precursor     103   5e-24   
ref|XP_008778332.1|  PREDICTED: peamaclein-like                         103   5e-24   
ref|XP_009136261.1|  PREDICTED: gibberellin-regulated protein 7-like    103   7e-24   
emb|CBI33733.3|  unnamed protein product                                101   9e-24   
ref|XP_009148397.1|  PREDICTED: gibberellin-regulated protein 8         102   9e-24   
emb|CDX89647.1|  BnaC03g45610D                                          102   9e-24   
ref|XP_002875456.1|  hypothetical protein ARALYDRAFT_484630             102   1e-23   
gb|KCW68672.1|  hypothetical protein EUGRSUZ_F02269                     102   1e-23   
ref|XP_006409618.1|  hypothetical protein EUTSA_v10022920mg             102   1e-23   
gb|AGE15499.1|  GA-stimulated transcript-like protein 3                 102   1e-23   
gb|KFK39992.1|  hypothetical protein AALP_AA3G316000                    102   1e-23   
emb|CDX93153.1|  BnaA03g38750D                                          102   2e-23   
ref|XP_010475932.1|  PREDICTED: gibberellin-regulated protein 8-like    101   2e-23   
ref|XP_007143086.1|  hypothetical protein PHAVU_007G042400g             101   2e-23   
gb|KFK27525.1|  hypothetical protein AALP_AA8G394700                    100   2e-23   
ref|XP_010028389.1|  PREDICTED: peamaclein-like                         101   2e-23   
ref|XP_010458411.1|  PREDICTED: gibberellin-regulated protein 8-like    101   3e-23   
ref|XP_002883868.1|  gibberellin-regulated family protein               101   3e-23   
emb|CDY52417.1|  BnaCnng22380D                                          101   3e-23   
ref|XP_007160892.1|  hypothetical protein PHAVU_001G025800g             100   3e-23   
emb|CDX80223.1|  BnaC09g35190D                                          100   3e-23   
ref|XP_010458413.1|  PREDICTED: gibberellin-regulated protein 8-like    100   4e-23   
emb|CDY72009.1|  BnaCnng75550D                                          100   4e-23   
ref|XP_009123225.1|  PREDICTED: gibberellin-regulated protein 7 i...    101   4e-23   
gb|KGN52784.1|  hypothetical protein Csa_4G001520                       106   4e-23   
ref|XP_009131966.1|  PREDICTED: gibberellin-regulated protein 10-...    100   4e-23   
ref|XP_009126643.1|  PREDICTED: gibberellin-regulated protein 10        100   5e-23   
emb|CDX71072.1|  BnaC03g11560D                                          100   5e-23   
ref|XP_010028136.1|  PREDICTED: peamaclein-like                         100   5e-23   
ref|NP_001077504.1|  Gibberellin-regulated GASA/GAST/Snakin famil...    100   6e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88727.1|  BnaA03g09220D                                        99.8    9e-23   
ref|XP_006409619.1|  hypothetical protein EUTSA_v10022920mg             100   1e-22   
ref|XP_003589114.1|  Snakin-1                                         99.4    1e-22   
emb|CDY54472.1|  BnaA09g52760D                                        99.8    2e-22   
ref|XP_006292427.1|  hypothetical protein CARUB_v10018642mg           99.0    2e-22   
gb|ACJ68116.1|  hypothetical protein                                  99.0    2e-22   Brassica napus [oilseed rape]
gb|KEH44041.1|  gibberellin-regulated family protein                  99.0    2e-22   
ref|XP_006279073.1|  hypothetical protein CARUB_v10012746mg           98.6    2e-22   
emb|CDX93402.1|  BnaA06g06460D                                        98.2    4e-22   
ref|XP_002518646.1|  GAST1 protein precursor, putative                97.8    5e-22   Ricinus communis
gb|EMS63633.1|  hypothetical protein TRIUR3_22813                     97.8    6e-22   
gb|EMS63632.1|  hypothetical protein TRIUR3_22812                     97.1    9e-22   
gb|AFE82743.1|  snakin-1                                              97.1    1e-21   
gb|KDP32030.1|  hypothetical protein JCGZ_12491                       96.3    1e-21   
ref|XP_011069640.1|  PREDICTED: peamaclein-like                       96.7    2e-21   
gb|EYU37603.1|  hypothetical protein MIMGU_mgv1a024675mg              95.9    3e-21   
gb|EMT21443.1|  hypothetical protein F775_31764                       95.9    3e-21   
ref|XP_006301392.1|  hypothetical protein CARUB_v10021805mg           95.5    3e-21   
ref|XP_003559118.1|  PREDICTED: peamaclein-like                       95.9    3e-21   
emb|CDY50148.1|  BnaA01g26080D                                        95.9    3e-21   
ref|XP_004142881.1|  PREDICTED: snakin-1-like                         94.4    7e-21   
ref|XP_009403760.1|  PREDICTED: peamaclein-like                       94.7    7e-21   
gb|KFK39277.1|  hypothetical protein AALP_AA3G223500                  94.0    7e-21   
gb|EMT21444.1|  hypothetical protein F775_43887                       94.7    7e-21   
ref|NP_179096.1|  gibberellin-regulated protein                       95.1    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135633.1|  PREDICTED: peamaclein-like                       94.7    9e-21   
ref|XP_010519291.1|  PREDICTED: peamaclein-like                       94.7    9e-21   
ref|XP_003559125.1|  PREDICTED: peamaclein-like                       94.4    9e-21   
ref|NP_001051348.1|  Os03g0760800                                     94.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149636.1|  gibberellin-regulated protein 2 precursor        93.6    2e-20   Zea mays [maize]
ref|XP_007018557.1|  Gibberellin-regulated family protein             93.6    2e-20   
ref|XP_006650629.1|  PREDICTED: snakin-1-like                         93.2    2e-20   
ref|XP_006406493.1|  hypothetical protein EUTSA_v10022254mg           92.4    3e-20   
ref|NP_001183511.1|  gibberellin-regulated protein 2 precursor        93.2    3e-20   
gb|ACG44951.1|  gibberellin-regulated protein 2 precursor             93.2    3e-20   Zea mays [maize]
gb|EMS47698.1|  hypothetical protein TRIUR3_08559                     93.2    3e-20   
emb|CDY22975.1|  BnaC03g40940D                                        93.2    3e-20   
gb|ABN12953.1|  GASA-like protein                                     92.8    4e-20   Gymnadenia conopsea
ref|XP_006301929.1|  hypothetical protein CARUB_v10022405mg           92.4    4e-20   
ref|XP_008444582.1|  PREDICTED: peamaclein-like                       92.0    5e-20   
ref|XP_009617608.1|  PREDICTED: peamaclein-like                       92.0    6e-20   
gb|AAD01518.1|  Snakin-1                                              90.1    1e-19   Solanum tuberosum [potatoes]
ref|XP_002463849.1|  hypothetical protein SORBIDRAFT_01g007360        90.9    2e-19   Sorghum bicolor [broomcorn]
ref|XP_010547967.1|  PREDICTED: peamaclein                            90.9    2e-19   
ref|XP_002879804.1|  hypothetical protein ARALYDRAFT_482976           90.1    2e-19   
ref|XP_002969375.1|  hypothetical protein SELMODRAFT_440818           90.1    4e-19   
gb|ACR37248.1|  unknown                                               89.4    6e-19   Zea mays [maize]
gb|ABK22434.1|  unknown                                               89.4    9e-19   Picea sitchensis
gb|ABK25287.1|  unknown                                               89.0    1e-18   Picea sitchensis
ref|XP_004981680.1|  PREDICTED: snakin-1-like                         88.2    2e-18   
ref|XP_010685204.1|  PREDICTED: peamaclein-like                       87.8    3e-18   
ref|XP_002970705.1|  hypothetical protein SELMODRAFT_94072            86.3    4e-18   
ref|XP_008236410.1|  PREDICTED: peamaclein                            86.7    6e-18   
ref|XP_007200798.1|  hypothetical protein PRUPE_ppa024899mg           86.7    6e-18   
gb|AFK36243.1|  unknown                                               86.3    8e-18   
ref|XP_009800618.1|  PREDICTED: peamaclein-like                       85.5    9e-18   
emb|CDO97247.1|  unnamed protein product                              85.5    1e-17   
gb|KCW54793.1|  hypothetical protein EUGRSUZ_I00734                   85.1    2e-17   
ref|XP_006416023.1|  hypothetical protein EUTSA_v10009207mg           84.7    3e-17   
gb|AES96393.2|  GASA/GAST/Snakin                                      83.6    6e-17   
ref|XP_002973082.1|  hypothetical protein SELMODRAFT_99264            83.2    6e-17   
gb|ABR25339.1|  giberellin regulated family protein                   82.4    9e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002889819.1|  hypothetical protein ARALYDRAFT_471179           83.2    1e-16   
ref|XP_002976786.1|  hypothetical protein SELMODRAFT_105504           82.0    1e-16   
ref|NP_001152432.1|  gibberellin-regulated protein 2 precursor        82.8    2e-16   Zea mays [maize]
ref|XP_002970861.1|  hypothetical protein SELMODRAFT_94549            82.0    2e-16   
ref|XP_003613454.1|  Gibberellin induced protein                      82.4    2e-16   
gb|ABK21371.1|  unknown                                               82.0    5e-16   Picea sitchensis
ref|XP_007163897.1|  hypothetical protein PHAVU_L007200g              80.9    7e-16   
ref|XP_004986740.1|  PREDICTED: gibberellin-regulated protein 12-...  80.9    8e-16   
gb|ABK21812.1|  unknown                                               81.3    8e-16   Picea sitchensis
ref|XP_002969591.1|  hypothetical protein SELMODRAFT_91546            79.7    8e-16   
ref|XP_002973289.1|  hypothetical protein SELMODRAFT_99234            79.3    1e-15   
gb|ABF94978.1|  GAST1 protein precursor, putative                     80.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613435.1|  GAST1                                            78.6    4e-15   
ref|XP_006649745.1|  PREDICTED: gibberellin-regulated protein 12-...  79.0    4e-15   
ref|XP_006662142.1|  PREDICTED: gibberellin-regulated protein 12-...  79.0    5e-15   
ref|XP_004517034.1|  PREDICTED: gibberellin-regulated protein 12-...  78.2    5e-15   
ref|XP_007163834.1|  hypothetical protein PHAVU_001G268100g           77.0    1e-14   
ref|XP_007163594.1|  hypothetical protein PHAVU_001G247600g           76.6    2e-14   
ref|XP_002986081.1|  hypothetical protein SELMODRAFT_123391           75.9    2e-14   
gb|EMS48664.1|  hypothetical protein TRIUR3_03907                     75.9    3e-14   
gb|EEE58704.1|  hypothetical protein OsJ_10147                        76.3    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010665102.1|  PREDICTED: peamaclein-like                       75.5    5e-14   
ref|XP_006380659.1|  hypothetical protein POPTR_0007s10250g           75.9    6e-14   
gb|EEC74871.1|  hypothetical protein OsI_10763                        75.9    6e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006601874.1|  PREDICTED: gibberellin-regulated protein 12-...  74.7    1e-13   
ref|XP_006296776.1|  hypothetical protein CARUB_v10015821mg           74.3    1e-13   
ref|XP_006342570.1|  PREDICTED: gibberellin-regulated protein 1-like  75.1    1e-13   
ref|XP_011038137.1|  PREDICTED: gibberellin-regulated protein 2       74.3    1e-13   
ref|XP_006493084.1|  PREDICTED: gibberellin-regulated protein 12-...  74.3    1e-13   
ref|XP_002982001.1|  hypothetical protein SELMODRAFT_115445           73.6    1e-13   
ref|XP_004982447.1|  PREDICTED: snakin-1-like                         74.3    2e-13   
gb|KDO41153.1|  hypothetical protein CISIN_1g041400mg                 74.3    2e-13   
ref|XP_003613456.1|  Gibberellin-regulated protein                    74.3    2e-13   
ref|XP_006376297.1|  hypothetical protein POPTR_0013s11770g           73.9    2e-13   
ref|XP_004517033.1|  PREDICTED: gibberellin-regulated protein 12-...  73.6    2e-13   
ref|XP_009106131.1|  PREDICTED: gibberellin-regulated protein 12-...  73.9    2e-13   
emb|CDY46336.1|  BnaC01g30340D                                        73.9    2e-13   
ref|XP_010314649.1|  PREDICTED: gibberellin-regulated protein 1-like  74.3    2e-13   
emb|CBI25690.3|  unnamed protein product                              73.9    3e-13   
ref|XP_003613442.1|  GAST1                                            73.6    3e-13   
ref|XP_006395777.1|  hypothetical protein EUTSA_v10005321mg           73.9    3e-13   
ref|XP_010646211.1|  PREDICTED: gibberellin-regulated protein 12-...  73.2    4e-13   
gb|AFK37530.1|  unknown                                               72.8    5e-13   
ref|XP_002977665.1|  hypothetical protein SELMODRAFT_417581           72.8    7e-13   
ref|XP_010690459.1|  PREDICTED: gibberellin-regulated protein 1-like  72.4    8e-13   
gb|ACU43594.1|  gibberellin stimulated transcript                     72.4    8e-13   Triticum aestivum [Canadian hard winter wheat]
gb|KHN24017.1|  Protein GAST1                                         71.2    8e-13   
ref|XP_006418799.1|  hypothetical protein EUTSA_v10003002mg           71.6    1e-12   
ref|XP_002979611.1|  hypothetical protein SELMODRAFT_419248           72.4    1e-12   
gb|ADE77851.1|  unknown                                               72.4    1e-12   
ref|XP_002298694.2|  hypothetical protein POPTR_0001s32270g           71.2    1e-12   Populus trichocarpa [western balsam poplar]
ref|NP_001055630.1|  Os05g0432200                                     71.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003541683.1|  PREDICTED: gibberellin-regulated protein 12-...  71.6    1e-12   
ref|XP_007017799.1|  Gibberellin-regulated family protein isoform 1   71.6    2e-12   
ref|XP_010273304.1|  PREDICTED: uncharacterized protein LOC104608...  77.0    2e-12   
ref|XP_009404981.1|  PREDICTED: peamaclein-like                       71.2    2e-12   
ref|XP_010273303.1|  PREDICTED: uncharacterized protein LOC104608...  76.6    2e-12   
ref|XP_006420919.1|  hypothetical protein CICLE_v10006668mg           70.5    2e-12   
gb|EYU37879.1|  hypothetical protein MIMGU_mgv1a016790mg              71.2    3e-12   
ref|XP_006654443.1|  PREDICTED: gibberellin-regulated protein 2-like  70.5    3e-12   
ref|XP_007212837.1|  hypothetical protein PRUPE_ppa020764mg           70.5    3e-12   
ref|XP_007143651.1|  hypothetical protein PHAVU_007G089800g           70.5    3e-12   
ref|XP_007034357.1|  Gibberellin-regulated family protein             71.2    4e-12   
ref|XP_009108078.1|  PREDICTED: gibberellin-regulated protein 12-...  70.9    4e-12   
ref|XP_010532783.1|  PREDICTED: gibberellin-regulated protein 12      70.5    4e-12   
ref|XP_002526823.1|  Gibberellin-regulated protein 2 precursor, p...  70.1    4e-12   
ref|XP_010258350.1|  PREDICTED: gibberellin-regulated protein 6 i...  70.1    4e-12   
ref|XP_002881134.1|  gibberellin-regulated family protein             70.5    4e-12   
ref|XP_004136384.1|  PREDICTED: gibberellin-regulated protein 1-like  70.5    5e-12   
ref|XP_004489937.1|  PREDICTED: gibberellin-regulated protein 12-...  70.1    5e-12   
ref|XP_010236530.1|  PREDICTED: gibberellin-regulated protein 5-like  70.5    5e-12   
ref|XP_011080381.1|  PREDICTED: protein GAST1-like                    70.5    5e-12   
ref|XP_008780246.1|  PREDICTED: gibberellin-regulated protein 2-like  69.3    5e-12   
ref|XP_004136951.1|  PREDICTED: snakin-1-like                         69.7    6e-12   
ref|XP_009587065.1|  PREDICTED: gibberellin-regulated protein 6-like  70.1    6e-12   
ref|XP_008224510.1|  PREDICTED: gibberellin-regulated protein 12-...  70.1    6e-12   
gb|AGM38075.1|  putative gibberellin-regulated GAST1-like protein     70.1    6e-12   
ref|XP_002464248.1|  hypothetical protein SORBIDRAFT_01g014890        69.7    6e-12   
ref|XP_010274741.1|  PREDICTED: protein RSI-1-like                    69.7    6e-12   
ref|XP_008659198.1|  PREDICTED: gibberellin-regulated protein 12      70.1    7e-12   
ref|XP_002530088.1|  GAST1 protein precursor, putative                70.1    8e-12   
ref|XP_010510284.1|  PREDICTED: gibberellin-regulated protein 12-...  69.7    8e-12   
emb|CDY27104.1|  BnaA08g07420D                                        69.7    9e-12   
ref|XP_004159914.1|  PREDICTED: snakin-1-like                         69.3    9e-12   
gb|KDP26211.1|  hypothetical protein JCGZ_22457                       70.1    9e-12   
ref|XP_009781826.1|  PREDICTED: gibberellin-regulated protein 6-like  69.7    9e-12   
gb|EMT22883.1|  hypothetical protein F775_27923                       69.3    9e-12   
ref|XP_004158330.1|  PREDICTED: protein GAST1-like                    69.7    1e-11   
ref|XP_002965632.1|  hypothetical protein SELMODRAFT_84095            68.2    1e-11   
ref|XP_010673449.1|  PREDICTED: peamaclein-like                       69.3    1e-11   
ref|NP_001063170.1|  Os09g0414900                                     69.7    1e-11   
ref|XP_002467388.1|  hypothetical protein SORBIDRAFT_01g026925        69.7    1e-11   
ref|XP_010469795.1|  PREDICTED: gibberellin-regulated protein 12-...  69.3    1e-11   
gb|KGN59726.1|  hypothetical protein Csa_3G841990                     69.3    1e-11   
ref|XP_002989280.1|  hypothetical protein SELMODRAFT_129438           68.2    1e-11   
emb|CDP01621.1|  unnamed protein product                              68.9    1e-11   
emb|CBI18166.3|  unnamed protein product                              68.6    1e-11   
ref|XP_006295413.1|  hypothetical protein CARUB_v10024510mg           69.3    1e-11   
ref|NP_001176009.1|  Os10g0115550                                     69.3    1e-11   
ref|XP_006828424.1|  hypothetical protein AMTR_s00060p00095260        68.6    1e-11   
ref|XP_004490815.1|  PREDICTED: protein RSI-1-like                    68.9    1e-11   
ref|XP_010258349.1|  PREDICTED: gibberellin-regulated protein 6 i...  68.9    2e-11   
ref|XP_007227095.1|  hypothetical protein PRUPE_ppa025589mg           68.2    2e-11   
ref|XP_006440597.1|  hypothetical protein CICLE_v10023012mg           68.9    2e-11   
ref|XP_006299108.1|  hypothetical protein CARUB_v10015247mg           68.2    2e-11   
ref|XP_007028593.1|  Gibberellin-regulated family protein             68.9    2e-11   
ref|XP_010469794.1|  PREDICTED: gibberellin-regulated protein 12-...  68.9    2e-11   
ref|XP_003559685.1|  PREDICTED: peamaclein-like                       68.9    2e-11   
ref|XP_009383413.1|  PREDICTED: gibberellin-regulated protein 12      67.8    2e-11   
ref|XP_008656256.1|  PREDICTED: uncharacterized protein LOC100286041  70.5    2e-11   
emb|CAN72771.1|  hypothetical protein VITISV_034212                   70.1    2e-11   
ref|XP_010274082.1|  PREDICTED: gibberellin-regulated protein 12      68.9    2e-11   
gb|ADE77769.1|  unknown                                               68.6    2e-11   
ref|XP_010038994.1|  PREDICTED: gibberellin-regulated protein 12      68.2    2e-11   
emb|CDP14204.1|  unnamed protein product                              68.9    2e-11   
ref|XP_009797080.1|  PREDICTED: gibberellin-regulated protein 5-like  68.6    2e-11   
gb|ACG38131.1|  gibberellin-regulated protein 2 precursor             68.2    2e-11   
ref|XP_002441006.1|  hypothetical protein SORBIDRAFT_09g018790        68.9    2e-11   
ref|XP_004962265.1|  PREDICTED: protein GAST1-like isoform X2         68.9    2e-11   
ref|XP_010510285.1|  PREDICTED: gibberellin-regulated protein 12-...  68.6    2e-11   
ref|XP_004489396.1|  PREDICTED: gibberellin-regulated protein 4-like  68.2    3e-11   
ref|XP_004162561.1|  PREDICTED: gibberellin-regulated protein 1-like  68.2    3e-11   
gb|AGL92232.1|  GASA-like protein GEG2                                67.8    3e-11   
ref|XP_011097237.1|  PREDICTED: peamaclein-like                       67.8    3e-11   
ref|XP_009793969.1|  PREDICTED: protein GAST1-like                    68.2    3e-11   
gb|EYU34071.1|  hypothetical protein MIMGU_mgv1a016830mg              68.2    3e-11   
gb|ABK21087.1|  unknown                                               67.8    4e-11   
ref|XP_010471557.1|  PREDICTED: gibberellin-regulated protein 6-like  67.8    4e-11   
ref|XP_010414214.1|  PREDICTED: gibberellin-regulated protein 12-...  67.8    4e-11   
ref|XP_004496365.1|  PREDICTED: gibberellin-regulated protein 2-l...  67.8    4e-11   
ref|XP_010063765.1|  PREDICTED: gibberellin-regulated protein 2-like  67.8    4e-11   
ref|XP_006477453.1|  PREDICTED: gibberellin-regulated protein 6-like  67.8    4e-11   
ref|XP_004140359.1|  PREDICTED: protein RSI-1-like                    68.2    4e-11   
ref|XP_010685022.1|  PREDICTED: gibberellin-regulated protein 12-...  67.8    4e-11   
gb|ACF74297.1|  gibberellin-regulated protein                         67.8    4e-11   
ref|XP_009803054.1|  PREDICTED: gibberellin-regulated protein 5-l...  67.8    4e-11   
ref|XP_008464949.1|  PREDICTED: protein GAST1-like                    67.8    5e-11   
ref|XP_004496364.1|  PREDICTED: gibberellin-regulated protein 2-l...  67.8    5e-11   
ref|XP_002442726.1|  hypothetical protein SORBIDRAFT_08g001840        67.8    5e-11   
ref|XP_006407600.1|  hypothetical protein EUTSA_v10021857mg           66.6    6e-11   
ref|XP_004962264.1|  PREDICTED: protein GAST1-like isoform X1         67.8    6e-11   
gb|EEC79111.1|  hypothetical protein OsI_19744                        68.2    7e-11   
ref|XP_003523021.1|  PREDICTED: gibberellin-regulated protein 4       67.4    7e-11   
gb|KDP27148.1|  hypothetical protein JCGZ_19847                       67.4    7e-11   
ref|XP_008466485.1|  PREDICTED: gibberellin-regulated protein 1-like  67.0    7e-11   
gb|ADX36135.1|  gibberellic acid-stimulated protein 1                 67.0    7e-11   
emb|CDP08494.1|  unnamed protein product                              67.4    7e-11   
gb|ACG25489.1|  gibberellin-regulated protein 2 precursor             66.6    7e-11   
gb|EYU18662.1|  hypothetical protein MIMGU_mgv1a016553mg              67.4    7e-11   
ref|XP_009616241.1|  PREDICTED: gibberellin-regulated protein 5-like  67.0    8e-11   
gb|AFK43939.1|  unknown                                               67.0    8e-11   
ref|XP_006400040.1|  hypothetical protein EUTSA_v10015100mg           67.0    8e-11   
gb|ABK22904.1|  unknown                                               67.0    8e-11   
gb|ABK22062.1|  unknown                                               67.0    8e-11   
ref|XP_009803055.1|  PREDICTED: gibberellin-regulated protein 5-l...  67.0    8e-11   
gb|AES68406.2|  GASA/GAST/Snakin                                      68.2    8e-11   
ref|XP_003621217.1|  Gibberellin-regulated protein                    67.0    8e-11   
gb|AGE15498.1|  GA-stimulated transcript-like protein 2               67.0    8e-11   
gb|ABK21133.1|  unknown                                               67.0    8e-11   
emb|CDP21913.1|  unnamed protein product                              66.6    8e-11   
gb|AET00795.2|  GASA/GAST/Snakin                                      67.8    9e-11   
ref|XP_011075384.1|  PREDICTED: protein GAST1-like                    67.0    9e-11   
gb|KDO50409.1|  hypothetical protein CISIN_1g033715mg                 67.0    9e-11   
ref|XP_003598155.1|  Gibberellin induced protein                      68.2    9e-11   
ref|NP_001235467.1|  uncharacterized protein LOC100500003 precursor   67.0    9e-11   
ref|XP_010678520.1|  PREDICTED: gibberellin-regulated protein 6-like  66.6    9e-11   
ref|XP_002518090.1|  Gibberellin-regulated protein 4 precursor, p...  66.2    9e-11   
ref|XP_009762897.1|  PREDICTED: gibberellin-regulated protein 5-like  67.0    1e-10   
gb|AFK34043.1|  unknown                                               66.6    1e-10   
ref|XP_003617836.1|  Gibberellin induced protein                      67.8    1e-10   
ref|XP_010538071.1|  PREDICTED: gibberellin-regulated protein 6       66.6    1e-10   
emb|CDP19133.1|  unnamed protein product                              66.6    1e-10   
ref|XP_004299361.1|  PREDICTED: gibberellin-regulated protein 6-like  66.6    1e-10   
gb|EMT22213.1|  hypothetical protein F775_13483                       65.9    1e-10   
ref|XP_011045097.1|  PREDICTED: gibberellin-regulated protein 11-...  66.2    1e-10   
ref|XP_002887551.1|  hypothetical protein ARALYDRAFT_895333           66.6    1e-10   
emb|CAD10104.1|  gibberellin induced protein 3                        66.6    1e-10   
ref|XP_002284937.1|  PREDICTED: gibberellin-regulated protein 6       66.6    1e-10   
ref|XP_003589486.1|  Gibberellin-regulated protein                    66.2    1e-10   
ref|XP_010909456.1|  PREDICTED: gibberellin-regulated protein 2-like  66.2    1e-10   
ref|XP_006589456.1|  PREDICTED: gibberellin-regulated protein 2-like  66.2    1e-10   
ref|XP_010257391.1|  PREDICTED: gibberellin-regulated protein 6-like  66.6    1e-10   
gb|AGE15501.1|  GA-stimulated transcript-like protein 5               66.6    1e-10   
ref|XP_004961979.1|  PREDICTED: gibberellin-regulated protein 3-like  66.2    1e-10   
ref|XP_006421228.1|  hypothetical protein CICLE_v10006243mg           65.9    1e-10   
ref|XP_008460555.1|  PREDICTED: protein RSI-1-like                    66.2    1e-10   
emb|CAA60677.1|  gip1                                                 66.6    1e-10   
ref|XP_010248044.1|  PREDICTED: gibberellin-regulated protein 6-like  66.6    1e-10   
ref|XP_006421229.1|  hypothetical protein CICLE_v10006243mg           66.6    1e-10   
gb|AAG43509.1|AF210049_1  gibberellin-induced protein 1               66.6    1e-10   
ref|XP_006338319.1|  PREDICTED: protein GAST1-like                    66.6    1e-10   
ref|XP_006446220.1|  hypothetical protein CICLE_v10017244mg           66.2    1e-10   
gb|AAV84588.1|  Gip1-like protein                                     66.2    2e-10   
ref|XP_010530158.1|  PREDICTED: gibberellin-regulated protein 2       65.9    2e-10   
gb|KEH43555.1|  Thionin-like protein                                  65.9    2e-10   
ref|NP_001150577.1|  LOC100284210 precursor                           67.0    2e-10   
gb|EYU46338.1|  hypothetical protein MIMGU_mgv1a020071mg              65.9    2e-10   
ref|XP_004513859.1|  PREDICTED: gibberellin-regulated protein 14-...  67.4    2e-10   
ref|XP_004232126.1|  PREDICTED: protein GAST1                         66.2    2e-10   
ref|XP_006491553.1|  PREDICTED: protein GAST1-like                    66.2    2e-10   
gb|AFK42462.1|  unknown                                               65.9    2e-10   
ref|XP_009415913.1|  PREDICTED: gibberellin-regulated protein 11-...  65.5    2e-10   
ref|XP_009410001.1|  PREDICTED: gibberellin-regulated protein 6-like  65.9    2e-10   
ref|XP_007034358.1|  Gibberellin-regulated family protein             66.6    2e-10   
gb|KDP31251.1|  hypothetical protein JCGZ_11627                       65.9    2e-10   
gb|EPS65179.1|  hypothetical protein M569_09600                       66.2    2e-10   
ref|XP_010416324.1|  PREDICTED: gibberellin-regulated protein 6       65.9    2e-10   
ref|XP_006846942.1|  hypothetical protein AMTR_s00017p00002980        65.9    2e-10   
ref|XP_010428457.1|  PREDICTED: gibberellin-regulated protein 6-like  65.9    2e-10   
ref|XP_003544991.1|  PREDICTED: protein RSI-1-like                    65.5    2e-10   
ref|XP_004513860.1|  PREDICTED: gibberellin-regulated protein 14-...  67.4    2e-10   
ref|XP_002885614.1|  hypothetical protein ARALYDRAFT_898961           66.6    2e-10   
ref|XP_002871654.1|  hypothetical protein ARALYDRAFT_488368           65.5    3e-10   
ref|XP_009592386.1|  PREDICTED: gibberellin-regulated protein 5-like  65.5    3e-10   
ref|XP_010520748.1|  PREDICTED: gibberellin-regulated protein 8-like  65.1    3e-10   
ref|XP_011035751.1|  PREDICTED: gibberellin-regulated protein 4       65.5    3e-10   
ref|XP_009403172.1|  PREDICTED: gibberellin-regulated protein 6-like  65.5    3e-10   
ref|XP_007139576.1|  hypothetical protein PHAVU_008G041200g           65.5    3e-10   
ref|NP_197027.1|  gibberellin-regulated protein 4                     65.5    3e-10   
ref|XP_003632726.1|  PREDICTED: protein GAST1                         65.5    3e-10   
emb|CAD10105.1|  Gip1-like protein                                    65.5    3e-10   
ref|XP_011027306.1|  PREDICTED: protein GAST1-like                    65.5    3e-10   
ref|XP_009613810.1|  PREDICTED: gibberellin-regulated protein 5-like  65.1    3e-10   
ref|XP_002298301.2|  hypothetical protein POPTR_0001s26100g           65.9    3e-10   
ref|XP_010091518.1|  hypothetical protein L484_015945                 65.5    3e-10   
ref|XP_006340736.1|  PREDICTED: snakin-2-like                         65.1    3e-10   
ref|XP_006655989.1|  PREDICTED: gibberellin-regulated protein 6-like  65.5    3e-10   
ref|XP_002308912.2|  hypothetical protein POPTR_0006s04300g           65.5    3e-10   
ref|NP_001235994.1|  uncharacterized protein LOC100305480 precursor   65.5    4e-10   
emb|CBI30071.3|  unnamed protein product                              65.1    4e-10   
ref|XP_009419112.1|  PREDICTED: gibberellin-regulated protein 5-like  64.7    4e-10   
ref|XP_010060204.1|  PREDICTED: snakin-2-like                         65.1    4e-10   
ref|XP_008244953.1|  PREDICTED: protein GAST1-like                    65.1    4e-10   
ref|NP_001234666.1|  protein RSI-1 precursor                          65.1    4e-10   
ref|NP_177605.2|  gibberellin-regulated protein 6                     65.1    4e-10   
ref|XP_006390402.1|  hypothetical protein EUTSA_v10019355mg           65.1    4e-10   
ref|XP_010062256.1|  PREDICTED: gibberellin-regulated protein 5-like  64.7    4e-10   
gb|AEC10958.1|  gibberellin induced protein                           65.1    4e-10   
ref|XP_004491797.1|  PREDICTED: gibberellin-regulated protein 4-like  65.1    4e-10   
ref|XP_002307719.1|  hypothetical protein POPTR_0005s26020g           64.7    4e-10   
ref|XP_007216796.1|  hypothetical protein PRUPE_ppa023616mg           65.1    4e-10   
ref|NP_001149114.1|  GAST1 protein precursor                          65.5    4e-10   
gb|AAA74480.1|  gibberellin-regulated                                 65.1    5e-10   
ref|XP_009761199.1|  PREDICTED: gibberellin-regulated protein 4       65.1    5e-10   
gb|ACG30820.1|  GAST1 protein precursor                               65.5    5e-10   
ref|XP_009128056.1|  PREDICTED: gibberellin-regulated protein 6       64.7    5e-10   
ref|NP_001148171.1|  GAST1 protein precursor                          65.5    5e-10   
ref|XP_011098626.1|  PREDICTED: gibberellin-regulated protein 4-like  64.7    5e-10   
ref|XP_010558231.1|  PREDICTED: protein GAST1                         65.1    5e-10   
ref|XP_009787829.1|  PREDICTED: protein GAST1-like                    64.7    5e-10   
ref|XP_008355724.1|  PREDICTED: gibberellin-regulated protein 12-...  64.7    5e-10   
ref|XP_009775224.1|  PREDICTED: protein GAST1-like                    65.1    5e-10   
ref|XP_002439852.1|  hypothetical protein SORBIDRAFT_09g021340        64.7    5e-10   
ref|XP_006421227.1|  hypothetical protein CICLE_v10006243mg           64.7    5e-10   
ref|XP_008240742.1|  PREDICTED: protein GAST1                         65.1    5e-10   
ref|XP_006655260.1|  PREDICTED: gibberellin-regulated protein 14-...  65.5    5e-10   
ref|XP_004978341.1|  PREDICTED: gibberellin-regulated protein 6-like  64.3    5e-10   
ref|XP_010672958.1|  PREDICTED: gibberellin-regulated protein 13-...  65.1    5e-10   
emb|CDY71845.1|  BnaAnng38970D                                        64.7    5e-10   
gb|EYU22850.1|  hypothetical protein MIMGU_mgv1a016408mg              65.1    5e-10   
ref|XP_009414177.1|  PREDICTED: gibberellin-regulated protein 5-l...  65.1    6e-10   
ref|XP_011045379.1|  PREDICTED: protein GAST1-like                    64.7    6e-10   
ref|XP_010937130.1|  PREDICTED: gibberellin-regulated protein 6       64.7    6e-10   
ref|XP_008649585.1|  PREDICTED: gibberellin-regulated protein 6-like  65.5    6e-10   
ref|XP_009614794.1|  PREDICTED: gibberellin-regulated protein 6       64.7    6e-10   
ref|XP_010672957.1|  PREDICTED: gibberellin-regulated protein 13-...  64.7    6e-10   
ref|XP_010256372.1|  PREDICTED: gibberellin-regulated protein 9-like  64.7    6e-10   
gb|AFW55883.1|  GAST1 protein                                         65.1    7e-10   
ref|XP_007160664.1|  hypothetical protein PHAVU_001G006500g           64.3    7e-10   
gb|AAQ57667.2|  Gasa4-like protein                                    64.3    7e-10   
ref|XP_010673717.1|  PREDICTED: protein GAST1-like isoform X1         64.7    7e-10   
ref|XP_009347627.1|  PREDICTED: protein GAST1-like                    64.7    7e-10   
ref|NP_001238684.1|  uncharacterized protein LOC100306171 precursor   64.3    7e-10   
ref|XP_009337038.1|  PREDICTED: protein GAST1-like                    64.7    7e-10   
ref|XP_010673718.1|  PREDICTED: protein GAST1-like isoform X2         64.3    7e-10   
gb|KHN48768.1|  Protein GAST1                                         63.5    7e-10   
ref|XP_008392374.1|  PREDICTED: protein GAST1 isoform X2              64.7    7e-10   
ref|XP_006409155.1|  hypothetical protein EUTSA_v10023192mg           63.9    7e-10   
ref|XP_009414179.1|  PREDICTED: gibberellin-regulated protein 5-l...  64.7    7e-10   
ref|XP_007209788.1|  hypothetical protein PRUPE_ppa013704mg           64.3    7e-10   
ref|XP_008392373.1|  PREDICTED: protein GAST1 isoform X1              64.7    7e-10   
ref|XP_009126040.1|  PREDICTED: gibberellin-regulated protein 4-like  64.3    8e-10   
ref|XP_010246225.1|  PREDICTED: protein GAST1-like                    64.3    8e-10   
ref|XP_007151230.1|  hypothetical protein PHAVU_004G028800g           64.3    8e-10   
ref|XP_008393156.1|  PREDICTED: gibberellin-regulated protein 6       64.3    9e-10   
emb|CDX70601.1|  BnaC03g06850D                                        64.3    9e-10   



>ref|XP_002285141.1| PREDICTED: peamaclein [Vitis vinifera]
 emb|CBI19434.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK + A  +L  LVL+SSF+    A S FCDSKC  RCSKAGM DRCLKYCG+CCEEC C
Sbjct  1    MKPLLATFLLVFLVLSSSFVQNAMAGSSFCDSKCAARCSKAGMKDRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCY+DKKNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYKDKKNSKGQPKCP  88



>ref|XP_004290947.1| PREDICTED: peamaclein-like [Fragaria vesca subsp. vesca]
Length=88

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VFA  +L  LVL SS    T A S FCDSKC VRCSKAG  +RCLKYCG+CC++CNC
Sbjct  1    MKLVFATFMLVFLVLGSSVFETTMAGSHFCDSKCGVRCSKAGYKERCLKYCGICCDKCNC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG+PKCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGDPKCP  88



>ref|XP_009591073.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=88

 Score =   134 bits (337),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA L++ TLVLTSSFI  T A SDFCDSKCK+RCSKAG  DRCLKYCG+CC+EC C
Sbjct  1    MKLCFATLLVVTLVLTSSFIQTTMAGSDFCDSKCKIRCSKAGRQDRCLKYCGICCKECQC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRDKKNSKG PKCP
Sbjct  61   VPSGTYGNKDECPCYRDKKNSKGQPKCP  88



>ref|XP_006472264.1| PREDICTED: snakin-1-like [Citrus sinensis]
 gb|KDO81573.1| hypothetical protein CISIN_1g039784mg [Citrus sinensis]
Length=88

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+     +L +LVLTS+F   + A SDFCDSKC VRCSKAG  DRCLKYCG+CC++C+C
Sbjct  1    MKLALVTFLLVSLVLTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYG+KDECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGHKDECPCYRDLKNSKGKPKCP  88



>ref|XP_006374850.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
 gb|ERP52647.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
Length=88

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK VFAA+ L  LV +SS    T A S FCDSKC VRCSKAG+ DRCLKYCG+CCE+C C
Sbjct  1    MKPVFAAIFLLCLVFSSSLFEVTMAASGFCDSKCSVRCSKAGIKDRCLKYCGICCEKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_009773391.1| PREDICTED: peamaclein-like [Nicotiana sylvestris]
Length=88

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA L++ TLVLTSSFI  T A SDFCDSKCK+RCSKAG  DRCLKYCG+CC EC C
Sbjct  1    MKLCFATLLVVTLVLTSSFIQTTVAGSDFCDSKCKIRCSKAGRQDRCLKYCGICCNECQC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRDKKNSKG PKCP
Sbjct  61   VPSGTYGNKDECPCYRDKKNSKGKPKCP  88



>ref|XP_011029030.1| PREDICTED: peamaclein-like [Populus euphratica]
Length=88

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK VFAA+ L  LV +SS    T A S FCDSKC VRCSKAG+ DRCLKYCG+CCE+C C
Sbjct  1    MKPVFAAIFLLCLVFSSSLFEVTVAASGFCDSKCSVRCSKAGIKDRCLKYCGICCEKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_008360977.1| PREDICTED: peamaclein [Malus domestica]
Length=88

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VFA  +L  LVL+SSF   + A S FCDSKC VRCSKAG  +RCLKYCG+CCE+C+C
Sbjct  1    MKLVFATFMLVCLVLSSSFFEASMAGSPFCDSKCGVRCSKAGYKERCLKYCGICCEKCHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_009360284.1| PREDICTED: peamaclein [Pyrus x bretschneideri]
Length=88

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VFA  +L  LVL+SSF   + A S FCDSKC VRCSKAG  +RCLKYCG+CCE+C+C
Sbjct  1    MKLVFATFMLVCLVLSSSFFEASMAGSPFCDSKCGVRCSKAGYKERCLKYCGICCEKCHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGKDKCP  88



>ref|XP_006433597.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|ESR46837.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|KDO36540.1| hypothetical protein CISIN_1g037233mg [Citrus sinensis]
Length=88

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+     +L +LV+TS+F   + A SDFCDSKC VRCSKAG  DRCLKYCG+CC++C+C
Sbjct  1    MKLALVTFLLVSLVVTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYG+KDECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGHKDECPCYRDLKNSKGKPKCP  88



>ref|XP_008377985.1| PREDICTED: peamaclein [Malus domestica]
 ref|XP_009354125.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VFA  +L  LVLTSSF   + A S FCDSKC VRCSKAG  +RCL++CG+CCE+C C
Sbjct  1    MKLVFATFMLVCLVLTSSFFEASMAGSPFCDSKCGVRCSKAGFKNRCLRFCGICCEKCQC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_010059861.1| PREDICTED: peamaclein [Eucalyptus grandis]
 gb|KCW66306.1| hypothetical protein EUGRSUZ_F00131 [Eucalyptus grandis]
Length=89

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            K  FA  +L  L+L+ +F +   A S FCDSKC VRCSKAG MDRCL+YCG+CCE+C CV
Sbjct  3    KFAFATFLLVALLLSPAFFDAAMAGSSFCDSKCAVRCSKAGRMDRCLQYCGICCEKCQCV  62

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            PSGTYG+KDECPCYRD KNSKG PKCP
Sbjct  63   PSGTYGHKDECPCYRDMKNSKGEPKCP  89



>gb|AFT92001.1| gibberellin-regulated protein [Populus tomentosa]
 gb|AFT92013.1| gibberellin-regulated protein [Populus tomentosa]
Length=88

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK VFAA+ L  LV +SS    T A S FCDSKC  RCSKAG+ DRCLKYCG+CCE+C C
Sbjct  1    MKPVFAAVFLLCLVFSSSLFEVTMAASGFCDSKCSARCSKAGIKDRCLKYCGICCEKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>gb|AFT92002.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
 gb|AFT92014.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
Length=88

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK VFAA+ L  LV +SS    T A S FCDSKC  RCSKAG+ DRCLKYCG+CCE+C C
Sbjct  1    MKPVFAAVFLLCLVFSSSLFEVTMAASGFCDSKCSARCSKAGIKDRCLKYCGICCEKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKLECPCYRDMKNSKGKPKCP  88



>ref|XP_009354123.1| PREDICTED: peamaclein-like isoform X1 [Pyrus x bretschneideri]
Length=88

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++FA  +   L LTSSF   + A S FCDSKC VRCSKAG  DRCL++CG+CCE+C C
Sbjct  1    MKLIFATFMFVCLFLTSSFFEASMAGSPFCDSKCGVRCSKAGYKDRCLRFCGICCEKCQC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_010105475.1| hypothetical protein L484_010255 [Morus notabilis]
 gb|EXC04831.1| hypothetical protein L484_010255 [Morus notabilis]
Length=87

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VFAA ++  LVL+SSF+  T A S FCDSKC+VRCSKAG+ DRCLKYC LCC +C C
Sbjct  1    MKLVFAAFLIC-LVLSSSFVETTMAGSAFCDSKCEVRCSKAGVKDRCLKYCKLCCNKCQC  59

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYG+KDECPCYRD KNSKG  KCP
Sbjct  60   VPSGTYGHKDECPCYRDLKNSKGQSKCP  87



>gb|AGE15502.1| GA-stimulated transcript-like protein 6 [Gossypium hirsutum]
Length=88

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+V    +L +L L+S F   + A SDFCDSKC VRCSKAG+ DRCLKYCG+CCE+C+C
Sbjct  1    MKMVLMLFLLVSLALSSCFFEVSIAGSDFCDSKCAVRCSKAGVQDRCLKYCGICCEKCHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGT+G+KDECPCYRD KNSKG  KCP
Sbjct  61   VPSGTFGHKDECPCYRDMKNSKGKSKCP  88



>ref|XP_002510126.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF52313.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK  F AL L   VLTSS    T A S FCDSKC+ RC KAG+ DRCLKYCG+CCE+C C
Sbjct  1    MKPSFVALFLVCFVLTSSLFEVTVAGSGFCDSKCEKRCEKAGVKDRCLKYCGICCEKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_003550315.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN45269.1| Snakin-1 [Glycine soja]
Length=88

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MKV FAA++L  LVL+SS    + A S FC SKC  RCS+AGM DRC+K+CG+CC +CNC
Sbjct  1    MKVAFAAVLLICLVLSSSLFEVSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICCSKCNC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKAKCP  88



>gb|ACU13365.1| unknown [Glycine max]
Length=88

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MKV FAA++L  LVL+SS    + A S FC SKC  RCS+AGM DRC+K+CG+CC +CNC
Sbjct  1    MKVAFAAVLLICLVLSSSLFEVSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICCGKCNC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKAKCP  88



>ref|NP_001236984.1| uncharacterized protein LOC100500113 [Glycine max]
 gb|ACU14995.1| unknown [Glycine max]
Length=115

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMKV F A++L  LVL+SS    + A S FC SKC  RCS+AGM DRC ++CG+CC +C 
Sbjct  27   KMKVAFVAVLLICLVLSSSLFEVSMAGSAFCSSKCAKRCSRAGMKDRCTRFCGICCSKCR  86

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  87   CVPSGTYGNKHECPCYRDMKNSKGKPKCP  115



>ref|XP_009354124.1| PREDICTED: peamaclein-like isoform X2 [Pyrus x bretschneideri]
Length=86

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++FA  +   L LTSSF   + A   FCDSKC VRCSKAG  DRCL++CG+CCE+C C
Sbjct  1    MKLIFATFMFVCLFLTSSFFEASMAA--FCDSKCGVRCSKAGYKDRCLRFCGICCEKCQC  58

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  59   VPSGTYGNKDECPCYRDLKNSKGEDKCP  86



>ref|XP_006422868.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|ESR36108.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|KDO47927.1| hypothetical protein CISIN_1g034644mg [Citrus sinensis]
Length=88

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ F  +++ +L+L+ S + P  A S FCDSKC  RC +AG+ DRCLKYCG+CCE+C C
Sbjct  1    MKLHFTTVVVCSLILSFSLLEPATAGSPFCDSKCAERCKQAGVQDRCLKYCGICCEDCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDK N KG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKVNKKGKPKCP  88



>gb|KHN21405.1| Snakin-1 [Glycine soja]
Length=88

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MKV F A++L  LVL+SS    + A S FC SKC  RCS+AGM DRC ++CG+CC +C C
Sbjct  1    MKVAFVAVLLICLVLSSSLFEVSMAGSAFCSSKCAKRCSRAGMKDRCTRFCGICCSKCRC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_006361222.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score =   123 bits (309),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFI-NPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            MK  FA L L  ++ +SSFI N   A S +CD KC  RC KAG+  RCLKYCG+CC  CN
Sbjct  1    MKTSFAVLFLVVILFSSSFIENAAMATSSYCDQKCSARCWKAGLKKRCLKYCGICCVACN  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNK ECPCYRDK NSKG PKCP
Sbjct  61   CVPSGTYGNKSECPCYRDKLNSKGKPKCP  89



>ref|XP_004252297.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=88

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA L+L TL LT+ FI  T A SDFCDSKC VRCSKAG  DRCLKYCG+CCEEC+C
Sbjct  1    MKLSFATLLLVTLFLTTFFIPATIAGSDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +PSGTYG+KDECPCYRDKKNSKG PKCP
Sbjct  61   LPSGTYGHKDECPCYRDKKNSKGGPKCP  88



>ref|XP_010066158.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63991.1| hypothetical protein EUGRSUZ_G01678 [Eucalyptus grandis]
Length=89

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            K+  A  +L   + +S F + T A S FCDSKC VRCSKAG  DRCL+YCG+ C++C CV
Sbjct  3    KLTLATFLLVAFLFSSFFFDATMAGSSFCDSKCAVRCSKAGRKDRCLEYCGIFCDKCQCV  62

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            PSGTYG+KDECPCYRD KNSKG PKCP
Sbjct  63   PSGTYGHKDECPCYRDMKNSKGQPKCP  89



>ref|XP_010320309.1| PREDICTED: LOW QUALITY PROTEIN: snakin-1-like [Solanum lycopersicum]
Length=88

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+    L+L TLV+T SFI  T A S FCDSKCK+RCSKAG+ DRCLKYCG+CCEEC C
Sbjct  1    MKLFLLTLLLVTLVITPSFIQTTMAGSYFCDSKCKLRCSKAGLADRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>ref|XP_006362074.1| PREDICTED: snakin-1-like [Solanum tuberosum]
 gb|ABQ42623.1| snakin-1 [Solanum chacoense]
 gb|ABQ42624.1| snakin-1 [Solanum tuberosum]
 gb|ABQ42625.1| snakin-1 [Solanum commersonii]
 gb|ACI23371.1| snakin-1 [Solanum tuberosum]
 gb|ACI23372.1| snakin-1 [Solanum tuberosum]
 gb|ACI23373.1| snakin-1 [Solanum tuberosum]
 gb|ACI23374.1| snakin-1 [Solanum tuberosum]
 gb|ACL79835.1| Snakin-1 [Solanum tuberosum]
 gb|ACZ04322.1| snakin-1 [Solanum tuberosum]
 gb|AFQ40003.1| snakin-1 [Solanum chacoense]
 gb|AFQ40008.1| snakin-1 [Capsicum annuum]
 gb|AFQ40009.1| snakin-1 [Solanum nigrum]
 gb|AFQ40010.1| snakin-1 [Petunia x hybrida]
 gb|AFQ40011.1| snakin-1 [Nicotiana tabacum]
 gb|AFQ40012.1| snakin-1 [Solanum lycopersicum]
 gb|AFQ40013.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40014.1| snakin-1 [Solanum palustre]
 gb|AFQ40015.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40016.1| snakin-1 [Solanum nigrum]
Length=88

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+    L+L TLV+T S I  T A S+FCDSKCK+RCSKAG+ DRCLKYCG+CCEEC C
Sbjct  1    MKLFLLTLLLVTLVITPSLIQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>ref|XP_010066166.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63994.1| hypothetical protein EUGRSUZ_G01682 [Eucalyptus grandis]
Length=89

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            K+     +L   +L+SS  + T A S FCDSKC  RCSKAG  DRCL+YC +CC++C CV
Sbjct  3    KLALTTFLLVAFLLSSSLFDATMAGSSFCDSKCAARCSKAGKKDRCLEYCRICCKKCQCV  62

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            PSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  63   PSGTYGNKDECPCYRDMKNSKGQPKCP  89



>ref|XP_006486958.1| PREDICTED: snakin-1-like [Citrus sinensis]
Length=88

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ F  +++ +L+L+ S + P  A S FCDSKC  RC  AG+ DRCLKYCG+CCE+C C
Sbjct  1    MKLHFTTVVVCSLILSFSLLEPAMAGSPFCDSKCAERCKLAGVQDRCLKYCGICCEDCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDK N KG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKVNKKGKPKCP  88



>sp|Q948Z4.1|SNAK1_SOLTU RecName: Full=Snakin-1; Flags: Precursor [Solanum tuberosum]
 emb|CAC44032.1| snakin-1 [Solanum tuberosum]
Length=88

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+    L+L TLV+T S I  T A S FCDSKCK+RCSKAG+ DRCLKYCG+CCEEC C
Sbjct  1    MKLFLLTLLLVTLVITPSLIQTTMAGSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>gb|ABQ42621.1| snakin-1 [Solanum bulbocastanum]
Length=88

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+    L+L TLV+T SFI  T A S+FCDSKCK+RCSKAG+ DRCLKYCG+CCEEC C
Sbjct  1    MKLFLLTLLLVTLVITPSFIQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKC  363
            VPSGTYGNK ECPCYRDKKNSKG  KC
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKSKC  87



>ref|XP_010099066.1| hypothetical protein L484_011500 [Morus notabilis]
 gb|EXB76655.1| hypothetical protein L484_011500 [Morus notabilis]
Length=91

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +1

Query  109  VVFAALILATLVLTSSFINPTHA--DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            + FAA +L  L L+SSF  P+ A   S FC+ KC  RCSKAG++DRC+KYCG+CCE+C C
Sbjct  4    ISFAAFLLCALHLSSSFFYPSTAYFQSGFCEDKCTTRCSKAGVLDRCMKYCGICCEQCMC  63

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDK++ KG PKCP
Sbjct  64   VPSGTYGNKHECPCYRDKRSKKGKPKCP  91



>ref|XP_010688303.1| PREDICTED: peamaclein [Beta vulgaris subsp. vulgaris]
Length=87

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA L++ TLV+++  ++ T+A SDFCDSKC VRCSKAG  DRCLKYCG+CCE C C
Sbjct  1    MKIAFATLLVVTLVVSTL-VDSTNAGSDFCDSKCNVRCSKAGYQDRCLKYCGICCEACQC  59

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRDKKNSKG PKCP
Sbjct  60   VPSGTYGNKDECPCYRDKKNSKGKPKCP  87



>gb|KHN42338.1| Snakin-1 [Glycine soja]
Length=90

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPT--HADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+VF  LIL +L+L+ SF+ P   + DS +C +KC  RCS AG+ DRC+KYCG+CC EC
Sbjct  1    MKLVFGTLILCSLLLSFSFLEPVIAYEDSSYCSNKCADRCSSAGVKDRCVKYCGICCAEC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDK N KG PKCP
Sbjct  61   KCVPSGTYGNKHECPCYRDKLNKKGKPKCP  90



>emb|CDP01230.1| unnamed protein product [Coffea canephora]
Length=88

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VF  L+L  LVL SSFI  T A S FCDSKC VRCSKAG+ DRCLKYC +CC+ECNC
Sbjct  1    MKLVFFTLLLLALVLNSSFIPATMAGSSFCDSKCGVRCSKAGVQDRCLKYCKICCQECNC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKPKCP  88



>ref|XP_009620159.1| PREDICTED: snakin-1 [Nicotiana tomentosiformis]
Length=88

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++ A L+L TLVLT SFI  T A S +CDSKCK+RC+KAG+MDRCLKYCG+CCEEC C
Sbjct  1    MKLLLATLLLFTLVLTPSFIQTTMAGSSYCDSKCKLRCAKAGVMDRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKN+KG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNNKGKPKCP  88



>ref|XP_007223838.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
 gb|EMJ25037.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
Length=88

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA  +L  L+L+SS    T A S FCDSKC VRCSKAG  +RCLKYCG+CCE+C+C
Sbjct  1    MKLGFATFLLVCLLLSSSVFEATMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKGNPKCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGNPKCP  88



>gb|ABQ42622.1| snakin-1 [Solanum chacoense]
Length=88

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+    L+L TLV+T S +  T A S+FCDSKCK+RCSKAG+ DRCLKYCG+CCEEC C
Sbjct  1    MKLFLLTLLLVTLVITPSLMQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>ref|XP_011069570.1| PREDICTED: peamaclein [Sesamum indicum]
 ref|XP_011069571.1| PREDICTED: peamaclein [Sesamum indicum]
Length=88

 Score =   121 bits (303),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK       +  +++TS+  +    DS FCD KC VRCSKAG  DRCLKYCG+CCE+C+
Sbjct  3    KMKSRILVFAIVLIMITSAMGDD---DSSFCDGKCSVRCSKAGRQDRCLKYCGICCEKCH  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKGNPKCP
Sbjct  60   CVPSGTYGNKDECPCYRDMKNSKGNPKCP  88



>ref|XP_006400907.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
 gb|ESQ42360.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
Length=91

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC-  276
            KMK V     + +L+LTSS    + ADS  C  KC +RCSKAG  DRCLKYC +CCE+C 
Sbjct  2    KMKFVVVQFFIISLLLTSSLFMLSTADSSPCGGKCNMRCSKAGRQDRCLKYCNICCEKCN  61

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            NCVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  62   NCVPSGTYGNKDECPCYRDMKNSKGQPKCP  91



>gb|EYU29123.1| hypothetical protein MIMGU_mgv1a017184mg [Erythranthe guttata]
Length=89

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHAD-SDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            MK   A L+L TL+L S+F+  T A    FCDSKC  RCSKAG+  RC+KYCG+CC  CN
Sbjct  1    MKCWIATLLLVTLILGSAFLESTEATYPSFCDSKCGERCSKAGLKKRCIKYCGICCAACN  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNK ECPCYRDK NSKG  KCP
Sbjct  61   CVPSGTYGNKSECPCYRDKLNSKGKSKCP  89



>ref|XP_009795533.1| PREDICTED: snakin-1 [Nicotiana sylvestris]
Length=88

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++   L+L TLVLT SFI  T A S +CDSKCK+RC+KAG+MDRCLKYCG+CCEEC C
Sbjct  1    MKLLLTTLLLLTLVLTPSFIQTTMAGSSYCDSKCKLRCAKAGVMDRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKK++KG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKKSNKGKPKCP  88



>ref|XP_011069770.1| PREDICTED: peamaclein-like [Sesamum indicum]
 ref|XP_011069771.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=88

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MKV FAAL+L TLVL+SS ++ T A + +C+ KC VRCSKAG+ DRCLKYCG+CCEEC C
Sbjct  1    MKVHFAALLLLTLVLSSSLMDTTMALASYCEEKCGVRCSKAGVKDRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKPKCP  88



>ref|XP_004499015.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSD-FCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            MK  FA L+L  L+L+SS    + A  + FC  KC +RCSKAGM DRCLK+CG+CC +C 
Sbjct  1    MKPAFATLLLVCLILSSSMFEISLAGYEGFCSPKCAMRCSKAGMRDRCLKFCGICCSKCK  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   CVPSGTYGNKHECPCYRDMKNSKGKPKCP  89



>ref|XP_006346618.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA L+L  LVLTS  I  T A SDFCDSKC  RCSKAG  DRCLKYCG+CC EC+C
Sbjct  2    MKLNFATLLLVALVLTSFLIPATIAGSDFCDSKCNYRCSKAGRQDRCLKYCGICCTECHC  61

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGT GNKDECPCYRDKKNSKG PKCP
Sbjct  62   VPSGTSGNKDECPCYRDKKNSKGGPKCP  89



>gb|KDP41652.1| hypothetical protein JCGZ_16059 [Jatropha curcas]
Length=88

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK VFAA +L +L+LTSSF   T A S FCDSKC  RC+ AG+ DRCLKYCG+CCE+C C
Sbjct  1    MKPVFAAFLLVSLLLTSSFFELTKAGSAFCDSKCGARCANAGVKDRCLKYCGICCEKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDYKNSKGKPKCP  88



>ref|XP_009380091.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK + A + L  ++ TSS++  T A S FC SKCKVRCSKA + DRCLKYCGLCCE+C C
Sbjct  1    MKPLHAIVALLLILFTSSYLQATMAGSAFCGSKCKVRCSKASVKDRCLKYCGLCCEQCRC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
            VPSGTYG+KDECPCYRDK    G    PKCP
Sbjct  61   VPSGTYGHKDECPCYRDKYTGSGKRRRPKCP  91



>ref|XP_007047444.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
 gb|EOX91601.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
Length=107

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 68/107 (64%), Gaps = 19/107 (18%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHA-------------------DSDFCDSKCKVRCSKA  225
            MK  FA  +  +LVL+SSF+  + A                       CDSKC  RCSKA
Sbjct  1    MKFFFATFLFVSLVLSSSFVQLSFAIPVVPTPTPAAPVPPPSPAPPSVCDSKCGERCSKA  60

Query  226  GMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            G+ DRCLKYCG+CC ECNCVPSGTYGNK ECPCYRDK NSKG PKCP
Sbjct  61   GIKDRCLKYCGICCRECNCVPSGTYGNKSECPCYRDKLNSKGKPKCP  107



>ref|XP_002864654.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40913.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK      I+ +L+LTSS    + ADS  C  KC VRCSKAG  DRCLKYC +CCE+CN 
Sbjct  1    MKFQVVQFIIISLLLTSSLFMLSTADSSPCGGKCNVRCSKAGRQDRCLKYCNICCEKCNY  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   CVPSGTYGNKDECPCYRDMKNSKGTSKCP  89



>ref|XP_009404126.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK +++ L L  ++  SS +  T A S FC+SKCKVRCSKA + DRCLKYCGLCCE+C C
Sbjct  1    MKPLYSILALLLVLFASSCLQATMAGSAFCESKCKVRCSKASVQDRCLKYCGLCCEQCRC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
            VPSGTYG+KDECPCYRDK    G    PKCP
Sbjct  61   VPSGTYGHKDECPCYRDKYTGSGKRRRPKCP  91



>ref|XP_002524960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37457.1| conserved hypothetical protein [Ricinus communis]
Length=101

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 13/101 (13%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHA-------------DSDFCDSKCKVRCSKAGMMDRC  243
            MK++ +  +L  L+++SSF+  T A              + +C+ KC  RC+ AG  DRC
Sbjct  1    MKLLLSTFLLIVLIVSSSFLQSTMAAPPPTGPLTAPSPTASYCELKCGARCANAGYKDRC  60

Query  244  LKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +KYCG+CC EC CVPSGTYGNK ECPCYRDKKNSKGNPKCP
Sbjct  61   MKYCGICCAECKCVPSGTYGNKSECPCYRDKKNSKGNPKCP  101



>ref|XP_004252296.1| PREDICTED: peamaclein-like [Solanum lycopersicum]
Length=89

 Score =   115 bits (289),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ F+ L+L  LVLTS  I  T A S+FCDSKC  RCSKAG  DRCLKYCG+CC EC+C
Sbjct  2    MKLKFSTLLLVALVLTSFLIPATIAGSEFCDSKCNFRCSKAGRQDRCLKYCGICCAECHC  61

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGT GNKDECPCYRDKKNSKG PKCP
Sbjct  62   VPSGTSGNKDECPCYRDKKNSKGGPKCP  89



>ref|XP_009403087.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++  +L++  ++ TSS      A S FCDSKCKVRCSKA + DRCLK+CGLCCE C C
Sbjct  1    MKLLHPSLVILLILFTSSCAQLAMARSAFCDSKCKVRCSKASLQDRCLKFCGLCCETCRC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
            VPSGTYGNKDECPCYRDK    G    PKCP
Sbjct  61   VPSGTYGNKDECPCYRDKYTGVGKRRRPKCP  91



>ref|XP_002300251.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
 gb|EEE85056.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
Length=88

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FAAL+L +L+ +SSF+ P  A S FC  KC  RC+ AG+ DRCLKYCG+CCE+C C
Sbjct  1    MKLFFAALLLCSLLFSSSFLEPVMAKSSFCTKKCNTRCANAGIQDRCLKYCGICCEQCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDK+NSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKRNSKGKPKCP  88



>ref|XP_009598103.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=90

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHA--DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+    L++ +LVLTSSF+  + A  D   CDSKC VRC KAG+  RCL YCG+CC +C
Sbjct  1    MKLAMITLLIVSLVLTSSFLQSSVAYDDPSSCDSKCAVRCGKAGIAKRCLTYCGICCNKC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            NCVPSG YGNK ECPCYRD  NSKG  KCP
Sbjct  61   NCVPSGNYGNKSECPCYRDMLNSKGKSKCP  90



>ref|XP_008440339.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=94

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 66/94 (70%), Gaps = 6/94 (6%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSD------FCDSKCKVRCSKAGMMDRCLKYCGLC  264
            MK +   L+L + +L+S F+    ADS        CDSKC VRC  AG+ DRCLKYCGLC
Sbjct  1    MKSLSVTLVLLSFILSSFFLQYGTADSSTTYAPSVCDSKCGVRCLNAGVKDRCLKYCGLC  60

Query  265  CEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C++C CVPSGTYGNK ECPCYRDK NSKG  KCP
Sbjct  61   CQQCKCVPSGTYGNKSECPCYRDKLNSKGKSKCP  94



>gb|AFK41274.1| unknown [Lotus japonicus]
Length=90

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILAT-LVLTSSFINPTHADSD-FCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+ FA ++L   LVL+SS+   + A S  FCD+KC+ RCSKA + DRCLK+CG+CC++C
Sbjct  1    MKLAFANVLLVMCLVLSSSWFEVSMASSSGFCDTKCEQRCSKASIQDRCLKFCGICCDKC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRD KNSKG  KCP
Sbjct  61   KCVPSGTYGNKHECPCYRDLKNSKGKIKCP  90



>ref|XP_008346370.1| PREDICTED: peamaclein-like [Malus domestica]
Length=88

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHA--DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+ F   +L  L+LTSSF++P  A   S +C  KC  RC+ AG+ DRC+KYCG+CCE C
Sbjct  1    MKLYFP--LLCFLLLTSSFMDPAMALATSPYCSDKCSTRCAVAGVQDRCMKYCGICCEAC  58

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDKKN KG PKCP
Sbjct  59   KCVPSGTYGNKHECPCYRDKKNDKGKPKCP  88



>gb|EYU29122.1| hypothetical protein MIMGU_mgv1a017256mg [Erythranthe guttata]
Length=86

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK   AA + A LV +S F   T A    C  KC+VRCSKA   + CLKYCG+CC +C C
Sbjct  1    MKPWIAAFLFAMLVTSSGFFELTAAIQ--CSPKCEVRCSKASAKENCLKYCGICCAKCQC  58

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKGNPKCP
Sbjct  59   VPSGTYGNKDECPCYRDMKNSKGNPKCP  86



>ref|NP_181486.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O80641.1|GASA8_ARATH RecName: Full=Gibberellin-regulated protein 8; AltName: Full=GAST1 
protein homolog 8; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27845.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AEC09692.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=87

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+V     + +L+LTSSF   + ADS  C  KC VRCSKAG  + CLKYC +CC++CNC
Sbjct  1    MKLVVVQFFIISLLLTSSFSVLSSADSS-CGGKCNVRCSKAGQHEECLKYCNICCQKCNC  59

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGT+G+KDECPCYRD KNSKG  KCP
Sbjct  60   VPSGTFGHKDECPCYRDMKNSKGGSKCP  87



>ref|XP_009339505.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
 ref|XP_009339508.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHA--DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+ F   +L  L+LTSSF++P  A   S +C  KC  RC+ AG+ DRC+KYCG+CCE C
Sbjct  1    MKLYFP--LLCFLLLTSSFMDPAMALATSPYCSDKCSTRCAVAGVRDRCIKYCGICCEAC  58

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDKKN KG PKCP
Sbjct  59   KCVPSGTYGNKHECPCYRDKKNDKGKPKCP  88



>ref|XP_006281389.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
 gb|EOA14287.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
Length=88

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK     + + +L+LTSS    + AD+  C  +C VRCSKAG  DRCLKYC +CC++C+C
Sbjct  1    MKFPVVQICIISLLLTSSLFMLSTADTSTCGGRCNVRCSKAGRQDRCLKYCNICCQKCDC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK+ECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKNECPCYRDMKNSKGTSKCP  88



>ref|NP_568914.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|Q8LFM2.1|GASAA_ARATH RecName: Full=Gibberellin-regulated protein 10; AltName: Full=GAST1 
protein homolog 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM61329.1| contains similarity to gibberellin-stimulated transcript 1 like 
protein [Arabidopsis thaliana]
 dbj|BAC42796.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00469.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97241.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=89

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK     +++ +L++TSS    + ADS  C  KC VRCSKAG  DRCLKYC +CCE+CN 
Sbjct  1    MKFPAVKVLIISLLITSSLFILSTADSSPCGGKCNVRCSKAGRQDRCLKYCNICCEKCNY  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   CVPSGTYGNKDECPCYRDMKNSKGTSKCP  89



>gb|EYU25492.1| hypothetical protein MIMGU_mgv1a017072mg [Erythranthe guttata]
Length=94

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 74/94 (79%), Gaps = 6/94 (6%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADS------DFCDSKCKVRCSKAGMMDRCLKYCGLC  264
            MKV+FA L+L TLVLTSS I+ T A S       +C  KC VRCSKAG+ DRCLKYCG+C
Sbjct  1    MKVLFATLLLVTLVLTSSLIHSTMAHSPAVLGEGYCGKKCAVRCSKAGVKDRCLKYCGIC  60

Query  265  CEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C EC CVPSGTYGNK ECPCYRDKKNSKG+PKCP
Sbjct  61   CNECKCVPSGTYGNKHECPCYRDKKNSKGHPKCP  94



>gb|KHF99282.1| Snakin-1 [Gossypium arboreum]
 gb|KHF99299.1| Snakin-1 [Gossypium arboreum]
Length=88

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  157  FINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDK  336
            F   + A SDFCDSKC VRCSKAG+ DRCLKYCG+CCE+C+CVPSGT+G+KDECPCYRD 
Sbjct  19   FFEVSIAGSDFCDSKCAVRCSKAGVQDRCLKYCGICCEKCHCVPSGTFGHKDECPCYRDM  78

Query  337  KNSKGNPKCP  366
            KNSKG  KCP
Sbjct  79   KNSKGKSKCP  88



>ref|XP_010443767.1| PREDICTED: gibberellin-regulated protein 10-like [Camelina sativa]
Length=87

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK       + +L++TSS    + ADS  C  KC VRCSKAG  DRCLKYC +CCE+C C
Sbjct  1    MKFPVVQFFIISLLVTSSLFMLSTADSS-CGGKCNVRCSKAGRQDRCLKYCNICCEKCQC  59

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYG+KDECPCYRD K+SKG PKCP
Sbjct  60   VPSGTYGHKDECPCYRDMKSSKGTPKCP  87



>ref|XP_006346656.1| PREDICTED: peamaclein-like [Solanum tuberosum]
Length=69

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  178  DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNP  357
              DFCDSKC VRCSKAG  DRCLKYCG+CCEEC+CVPSGTYG+KDECPCYRDKKNSKG P
Sbjct  7    QEDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHCVPSGTYGHKDECPCYRDKKNSKGGP  66

Query  358  KCP  366
            KCP
Sbjct  67   KCP  69



>ref|XP_010920764.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=90

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MKVV A L L  L+L+SS++    A S +CDSKCKVRC+KAG+MDRCLKYCG+CCEEC C
Sbjct  1    MKVVTATLALLLLILSSSYLQAAMAGSAYCDSKCKVRCAKAGVMDRCLKYCGMCCEECKC  60

Query  283  VPSGTYGNKDECPCYRDK--KNSKGNPKCP  366
            VPSGTYGNKDECPCYRDK  K     PKCP
Sbjct  61   VPSGTYGNKDECPCYRDKVTKGDSKKPKCP  90



>ref|XP_002313889.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
 gb|EEE87844.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
Length=89

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            K+ FA L+L +L+ +SSF+ P  A S FC  KC+ RC+ AG+ DRCLKYCG+CCE+C CV
Sbjct  3    KLFFATLLLCSLLFSSSFLEPVMAKSSFCAKKCETRCANAGIQDRCLKYCGICCEQCKCV  62

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            PSGTYGNK ECPCYRDK+NSKG PKCP
Sbjct  63   PSGTYGNKHECPCYRDKRNSKGKPKCP  89



>ref|XP_009381473.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=94

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHA-DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            +M+ +FA L L  ++ TSS    T A  S FC SKCKVRCSKA + DRC+K CGLCCE C
Sbjct  2    EMRPLFATLTLVLILFTSSCQQVTMAAGSAFCGSKCKVRCSKASLQDRCIKVCGLCCEAC  61

Query  277  NCVPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
             CVPSGTYGNKDECPCYRDK   +G    PKCP
Sbjct  62   RCVPSGTYGNKDECPCYRDKYTGEGVRRRPKCP  94



>ref|XP_009144432.1| PREDICTED: gibberellin-regulated protein 8-like [Brassica rapa]
 emb|CDY20958.1| BnaA08g25670D [Brassica napus]
 emb|CDY20617.1| BnaC08g14410D [Brassica napus]
Length=88

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK++     +   +LTSSF  P+ ADS  C  KC VRCSKA   + CLKYC +CCE+CN 
Sbjct  1    MKLMVVQFCIIFFLLTSSFFVPSTADSS-CGGKCNVRCSKASQHEECLKYCNICCEKCNG  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  60   CVPSGTYGNKDECPCYRDIKNSKGGPKCP  88



>gb|EYU22941.1| hypothetical protein MIMGU_mgv1a022909mg [Erythranthe guttata]
Length=93

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 65/93 (70%), Gaps = 5/93 (5%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFI--NPTHADSD---FCDSKCKVRCSKAGMMDRCLKYCGLCC  267
            MK++    ++  L L  +F    P  A SD   FCD KC VRCSKAG  +RCL+YC +CC
Sbjct  1    MKLMSTTTLVLALFLVGTFAESGPAEAPSDISGFCDEKCAVRCSKAGRQNRCLQYCRICC  60

Query  268  EECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             +CNCVPSGTYGN+DECPCYRD KN KG PKCP
Sbjct  61   AKCNCVPSGTYGNRDECPCYRDWKNPKGGPKCP  93



>ref|XP_010679570.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=95

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 9/96 (9%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSD--------FCDSKCKVRCSKAGMMDRCLKYCG  258
            MK + A L L  LVL SSF++P+ A +D        FC SKC +RCSK+G  D C+K+C 
Sbjct  1    MKFLIATLSLLFLVLASSFVHPSLALADAVKSNTNSFCGSKCGIRCSKSGHED-CMKFCL  59

Query  259  LCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            LCCE+CNCVPSGTYGNK ECPCYRD +NSKG  KCP
Sbjct  60   LCCEKCNCVPSGTYGNKHECPCYRDMRNSKGTSKCP  95



>emb|CBI22497.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK +F  L+L +L+L S F  PT   + FC  KC  RCS+A ++DRC+KYCG+CC+EC C
Sbjct  1    MKHLFPTLLLLSLLLHSCFSQPTTDGAGFCGLKCSKRCSQAAVLDRCMKYCGICCQECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNSKGKPKCP  88



>ref|XP_002271730.2| PREDICTED: snakin-1 [Vitis vinifera]
Length=139

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK +F  L+L +L+L S F  PT   + FC  KC  RCS+A ++DRC+KYCG+CC+EC C
Sbjct  52   MKHLFPTLLLLSLLLHSCFSQPTTDGAGFCGLKCSKRCSQAAVLDRCMKYCGICCQECKC  111

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKNSKG PKCP
Sbjct  112  VPSGTYGNKHECPCYRDKKNSKGKPKCP  139



>ref|XP_008792652.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=91

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK +   L L  L+L SS++  T A S FC+SKCKVRCSKAG+ DRCLKYCG+CCEEC+C
Sbjct  1    MKTLHTTLALLVLLLASSYLQATMAGSPFCNSKCKVRCSKAGVRDRCLKYCGICCEECHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
            VPSGTYG+KDECPCYRDK    G    PKCP
Sbjct  61   VPSGTYGHKDECPCYRDKYTGSGKRRRPKCP  91



>ref|XP_003636819.1| Snakin-1 [Medicago truncatula]
 ref|XP_003638468.1| Snakin-1 [Medicago truncatula]
 gb|KEH35780.1| GASA/GAST/Snakin [Medicago truncatula]
Length=85

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA   +  LVL+SS +  + A SDFC+SKC VRCSKA + DRCLK+CG+CCE+CNC
Sbjct  1    MKLAFA---ILLLVLSSSLLEVSFAGSDFCNSKCAVRCSKASIQDRCLKFCGICCEKCNC  57

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  58   VPSGTYGNKDECPCYRDMKNSKGKGKCP  85



>ref|XP_010271646.1| PREDICTED: peamaclein-like [Nelumbo nucifera]
Length=94

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHAD------SDFCDSKCKVRCSKAGMMDRCLKYCGLC  264
            MK+V A  +L +L+L+S  +  T         +  C  KC  RCSKAG  DRC+KYC +C
Sbjct  1    MKLVLAVFLLVSLILSSYLLEATAQGPSLPDYTGLCTPKCNGRCSKAGYQDRCMKYCMIC  60

Query  265  CEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C++C CVPSGTYGNK ECPCYRDKKN+KG PKCP
Sbjct  61   CQDCKCVPSGTYGNKHECPCYRDKKNNKGKPKCP  94



>ref|XP_003525918.1| PREDICTED: snakin-1 [Glycine max]
 gb|ACU14133.1| unknown [Glycine max]
 gb|KHN45165.1| Snakin-1 [Glycine soja]
Length=88

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FA ++L  LVL+SSF+  + A S FCDSKC  RC+KAG+ DRCL++CG+CCE+CNC
Sbjct  1    MKLEFANVLLLCLVLSSSFLEISMAGSPFCDSKCAQRCAKAGVQDRCLRFCGICCEKCNC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKDECPCYRDMKNSKGKDKCP  88



>ref|XP_007136735.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
 gb|ESW08729.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
Length=89

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VFA  +L  L+L+SSF+  + A S FCDSKC  RC+KAG+ DRCLK+CG+CCE+C+C
Sbjct  2    MKLVFANALLVCLLLSSSFLEISMAGSGFCDSKCARRCAKAGVKDRCLKFCGICCEKCHC  61

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  62   VPSGTYGNKDECPCYRDLKNSKGKGKCP  89



>dbj|BAB08352.1| unnamed protein product [Arabidopsis thaliana]
Length=88

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK     +++ +L++TSS    + ADS  C  KC VRCSKAG  DRCLKYC +CCE+CN 
Sbjct  1    MKFPAVKVLIISLLITSSLFILSTADSS-CGGKCNVRCSKAGRQDRCLKYCNICCEKCNY  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  60   CVPSGTYGNKDECPCYRDMKNSKGTSKCP  88



>sp|P86888.1|PMLN_PRUPE RecName: Full=Peamaclein; AltName: Allergen=Pru p 7 [Prunus persica]
Length=63

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  SDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPK  360
            S FCDSKC VRCSKAG  +RCLKYCG+CCE+C+CVPSGTYGNKDECPCYRD KNSKGNPK
Sbjct  2    SSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPK  61

Query  361  CP  366
            CP
Sbjct  62   CP  63



>ref|XP_006829298.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
 gb|ERM96714.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
Length=87

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK    A+ L  L+  SS +  +   S FC++KC VRCSKA +MDRC+KYC LCCEECNC
Sbjct  1    MKTSGVAIFLLALLCLSS-VPVSLGGSPFCNAKCGVRCSKAAVMDRCIKYCRLCCEECNC  59

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNKD+CPCYRDK +   NPKCP
Sbjct  60   VPSGTYGNKDQCPCYRDKLSKNRNPKCP  87



>ref|XP_006417449.1| hypothetical protein EUTSA_v10009615mg [Eutrema salsugineum]
 gb|ESQ35802.1| hypothetical protein EUTSA_v10009615mg [Eutrema salsugineum]
Length=88

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK+V   L +  ++LTSSF   + ADS  C  KC VRCSKA   + CLKYC +CCE+CN 
Sbjct  1    MKLVVVQLSIIFILLTSSFCELSTADSS-CGGKCDVRCSKASQHEECLKYCNICCEKCNG  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+GNKDECPCYRD KNSKG PKCP
Sbjct  60   CVPSGTFGNKDECPCYRDLKNSKGGPKCP  88



>ref|XP_008787135.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=92

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDK--KNSK  348
            A S FCDSKCKVRC+KAG+MDRCL YCG+CCEEC CVPSGTYGNKDECPCYRDK  KN K
Sbjct  27   AGSAFCDSKCKVRCAKAGVMDRCLHYCGVCCEECKCVPSGTYGNKDECPCYRDKVTKNDK  86

Query  349  GNPKCP  366
              PKCP
Sbjct  87   KKPKCP  92



>gb|KCW63655.1| hypothetical protein EUGRSUZ_G01294 [Eucalyptus grandis]
Length=124

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++   L+L +L+L+ +   P+ A S FC +KCK RC+KAG+MDRC+KYC +CC+EC C
Sbjct  37   MKLLAPTLLLCSLLLSFALSEPSSATSPFCGNKCKGRCAKAGVMDRCVKYCNICCQECGC  96

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDK++SKG PKCP
Sbjct  97   VPSGTYGNKHECPCYRDKRSSKGKPKCP  124



>ref|XP_004496906.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPT--HADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK +F  L+  +L L SS + P   + DS +C +KC  RCSKAG+ DRC+KYC +CC +C
Sbjct  1    MKPLFTVLLFCSL-LCSSILEPAIAYEDSSYCSNKCSDRCSKAGVQDRCVKYCEICCAQC  59

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDK N+KG PKCP
Sbjct  60   KCVPSGTYGNKHECPCYRDKLNNKGKPKCP  89



>ref|XP_010315202.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=89

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  148  TSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCY  327
            TSSF+ P  A S +C  KC+ RCSKAG+ DRC+KYC LCC +C CVP+GTYGNK +CPCY
Sbjct  17   TSSFLQPATAKSVYCTQKCEARCSKAGLKDRCVKYCELCCAKCKCVPNGTYGNKHQCPCY  76

Query  328  RDKKNSKGNPKCP  366
            RD KNSKG PKCP
Sbjct  77   RDMKNSKGKPKCP  89



>ref|XP_006346334.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  148  TSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCY  327
            TSSF+ P  A S +C  KC+ RCSKAG+ DRC+KYC LCC +C CVP+GTYGNK +CPCY
Sbjct  17   TSSFLQPATAKSVYCAQKCEARCSKAGLKDRCVKYCELCCAKCKCVPNGTYGNKHQCPCY  76

Query  328  RDKKNSKGNPKCP  366
            RD KNSKG PKCP
Sbjct  77   RDMKNSKGKPKCP  89



>ref|XP_010065940.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
Length=88

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++   L+L +L+L+ +   P+ A S FC +KCK RC+KAG+MDRC+KYC +CC+EC C
Sbjct  1    MKLLAPTLLLCSLLLSFALSEPSSATSPFCGNKCKGRCAKAGVMDRCVKYCNICCQECGC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDK++SKG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKRSSKGKPKCP  88



>ref|XP_010909081.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=91

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK + AAL L  ++L SS++  T A S FCDSKCKVRCSKA   DRCLKYCGLCCEEC C
Sbjct  1    MKPLHAALALLLILLASSYLQATMAGSPFCDSKCKVRCSKASYQDRCLKYCGLCCEECRC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
            VPSGTYG+KDECPCYRDK    G    PKCP
Sbjct  61   VPSGTYGHKDECPCYRDKYTGFGKKRRPKCP  91



>ref|XP_010488933.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 20/108 (19%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-------------------DFCDSKCKVRCSK  222
            MK++ + L+LA+L+L TSS  + T +D+                    +C  KC+ RC +
Sbjct  1    MKIIVSILVLASLLLVTSSLASATVSDAFGSGAAAPAPQIKGGPALETWCGQKCEARCKE  60

Query  223  AGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            AG+ DRCLKYCG+CC++C CVPSGTYGNK ECPCYRDK  +KG PKCP
Sbjct  61   AGLKDRCLKYCGICCKDCQCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_010467274.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 20/108 (19%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-------------------DFCDSKCKVRCSK  222
            MK++ + L+LA+L+L TSS  + T +D+                    +C  KC+ RC +
Sbjct  1    MKIIVSILVLASLLLVTSSLASATVSDAFGSGAAAPAPQIKDGPALETWCGQKCEARCKE  60

Query  223  AGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            AG+ DRCLKYCG+CC++C CVPSGTYGNK ECPCYRDK  +KG PKCP
Sbjct  61   AGLKDRCLKYCGICCKDCQCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_010556423.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=90

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
            TH D DFC++KC  RCSKAG  DRCLKYC +CCE+C+CVPSGTYG+KDECPCYRD KNSK
Sbjct  26   THGD-DFCEAKCTERCSKAGRQDRCLKYCNICCEKCHCVPSGTYGHKDECPCYRDMKNSK  84

Query  349  GNPKCP  366
            G+PKCP
Sbjct  85   GDPKCP  90



>gb|ABK94917.1| unknown [Populus trichocarpa]
Length=87

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +1

Query  112  VFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPS  291
            VF  L+L  L++             FC  KC  RC+ AG+ DRCLKYCG+CCE+C CVPS
Sbjct  8    VFIYLVLEILIMLV-----ISCGVAFCTKKCNTRCANAGIQDRCLKYCGICCEQCKCVPS  62

Query  292  GTYGNKDECPCYRDKKNSKGNPKCP  366
            GTYGNK ECPCYRDK+NSKG PKCP
Sbjct  63   GTYGNKHECPCYRDKRNSKGKPKCP  87



>gb|KHG20586.1| Snakin-1 [Gossypium arboreum]
Length=86

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+VF   +L +L+L+SS    + A   FC+SKCK+RCSKAG+  RCLKYCG+CC +C C
Sbjct  1    MKLVFVTFLLVSLILSSSLFEVSMAG--FCNSKCKIRCSKAGIRARCLKYCGICCAKCKC  58

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  59   VPSGTYGNKHECPCYRDLKNSKGKPKCP  86



>ref|XP_010906256.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=91

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK ++  L L  L+L SS++  T A S FCDSKCKVRCSKAG+ DRCLKYCG+CCEEC+C
Sbjct  1    MKALYTTLALLVLLLASSYLQATMAGSPFCDSKCKVRCSKAGVQDRCLKYCGICCEECHC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKG---NPKCP  366
            VPSGTYG+KDECPCYRDK    G    PKCP
Sbjct  61   VPSGTYGHKDECPCYRDKYTGSGKRRRPKCP  91



>ref|XP_010517902.1| PREDICTED: gibberellin-regulated protein 7 [Camelina sativa]
Length=108

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 20/108 (19%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-------------------DFCDSKCKVRCSK  222
            MK++ + L+LA+L+L TSS  + T +D+                    +C  KC+ RC +
Sbjct  1    MKIIVSILVLASLLLVTSSLASATVSDAFGSGAAAPAPQIKDGPALETWCGQKCEGRCKE  60

Query  223  AGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            AG+ DRCLKYCG+CC++C CVPSGTYGNK ECPCYRDK  +KG PKCP
Sbjct  61   AGLKDRCLKYCGICCKDCQCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_011074384.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=93

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  154  SFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRD  333
            S I    A SD CD KC VRCSKAG+ DRCLKYCG+CC EC CVPSGTYGNK ECPCYRD
Sbjct  24   SSITLPAASSD-CDEKCGVRCSKAGVKDRCLKYCGICCAECKCVPSGTYGNKHECPCYRD  82

Query  334  KKNSKGNPKCP  366
            KKNSKG PKCP
Sbjct  83   KKNSKGKPKCP  93



>emb|CDP07216.1| unnamed protein product [Coffea canephora]
Length=88

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A++ FCDSKC VRCSKAG+M RCLKYCG+CC  C+CVPSGTYGNK EC CYRDK NSKG 
Sbjct  25   ANTSFCDSKCGVRCSKAGLMKRCLKYCGICCAACSCVPSGTYGNKSECRCYRDKLNSKGK  84

Query  355  PKCP  366
            PKCP
Sbjct  85   PKCP  88



>ref|XP_004152264.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156848.1| PREDICTED: snakin-1-like [Cucumis sativus]
Length=89

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  151  SSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYR  330
            SSFI+  +A   FCD KCK RCSKAG+ DRC+KYCG+CC  C CVPSGTYGNK ECPCYR
Sbjct  18   SSFIDIVNAKPVFCDKKCKKRCSKAGVKDRCIKYCGICCGYCKCVPSGTYGNKHECPCYR  77

Query  331  DKKNSKGNPKCP  366
            D ++SKG PKCP
Sbjct  78   DMRSSKGRPKCP  89



>gb|EPS58046.1| hypothetical protein M569_16773 [Genlisea aurea]
Length=94

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  124  LILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYG  303
              L +L+L + F+    A +  CD  C+ RCS+AG++DRCLKYCG+CC +CNCVPSGT+G
Sbjct  15   FYLLSLILVA-FLVADVAGAGLCDGSCRSRCSRAGVVDRCLKYCGICCAKCNCVPSGTFG  73

Query  304  NKDECPCYRDKKNSKGNPKCP  366
            NK +CPCYRD +NSKG PKCP
Sbjct  74   NKHQCPCYRDLRNSKGKPKCP  94



>ref|XP_004501536.1| PREDICTED: peamaclein-like [Cicer arietinum]
Length=86

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S FCD++C  RCSKA   DRCLKYCG+CCE+CNCVPSGTYGNKDECPCYRD KNSKG 
Sbjct  23   AGSTFCDTRCGERCSKASFQDRCLKYCGICCEKCNCVPSGTYGNKDECPCYRDMKNSKGQ  82

Query  355  PKCP  366
             KCP
Sbjct  83   GKCP  86



>gb|AAY51975.1| GIR1 [Vigna radiata]
Length=88

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FAA++L  L+L+ SF   + A S FC SKC  RCSKAG  DRCLK CG+CC +C C
Sbjct  1    MKLSFAAMLLLCLLLSFSFFQLSSAASGFCSSKCANRCSKAGRKDRCLKLCGICCSKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDLKNSKGKGKCP  88



>ref|XP_007042576.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
 gb|EOX98407.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
Length=90

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHAD--SDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK++FA L++ +L+L+SS + P  A   S FC  KC  RC KA + DRC+KYCGLCCE+C
Sbjct  1    MKLLFATLLVCSLLLSSSLLEPAMAQPLSPFCVGKCDARCKKAAVWDRCIKYCGLCCEQC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDKK+ KG PKCP
Sbjct  61   KCVPSGTYGNKHECPCYRDKKSKKGTPKCP  90



>emb|CDX80222.1| BnaC09g35200D [Brassica napus]
Length=92

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK+      + +L+L+SS    + ADS  C+ KC VRCSKAG  DRCL+YC +CCE+C+
Sbjct  2    KMKLAIVQFFMISLLLSSSLFMLSKADSSPCNGKCNVRCSKAGRQDRCLQYCNICCEKCD  61

Query  280  --CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CVPSGTYGN+DECPCYRD KNSKG PKCP
Sbjct  62   DHCVPSGTYGNRDECPCYRDMKNSKGQPKCP  92



>emb|CDY31590.1| BnaA10g12810D [Brassica napus]
Length=92

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK+      + +L+L+SS    ++ DS  C+ KC  RCSKAG  DRCLKYC +CCE+C+
Sbjct  2    KMKLAIVQFFMISLLLSSSLFMLSNGDSSSCNGKCNARCSKAGRQDRCLKYCNICCEKCD  61

Query  280  --CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  62   DHCVPSGTYGNKDECPCYRDMKNSKGQPKCP  92



>ref|XP_006298856.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
 gb|EOA31754.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
Length=108

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 20/108 (19%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-------------------DFCDSKCKVRCSK  222
            MK++ + L+LA+L+L TSS  + T +D+                    +C  KC+ RC  
Sbjct  1    MKIIVSILVLASLLLVTSSLASATFSDAFGSGAVAPAPQMKDGPVLEKWCGQKCEGRCKA  60

Query  223  AGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            AGM DRCLKYCG+CC++C CVPSGTYGNK EC CYRDK  +KG PKCP
Sbjct  61   AGMKDRCLKYCGICCKDCQCVPSGTYGNKHECACYRDKLTNKGTPKCP  108



>ref|NP_001077503.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
 gb|ABF59173.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28601.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
Length=90

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAG-MMDRCLKYCGLCCEEC  276
            KM VV    I+ +L+LTSSF   + ADS  C  KC VRCSKA    + CL+ C +CC++C
Sbjct  2    KMPVVVQFFII-SLLLTSSFYVLSSADSSACGGKCSVRCSKADRTHEECLEDCDICCQKC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            NCVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   NCVPSGTYGNKDECPCYRDMKNSKGGSKCP  90



>ref|XP_010491469.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
 ref|XP_010491484.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGM-MDRCLKYCGLCCEECN  279
            MK++     + +L+LT+S    + ADS  C  KC VRCSK     + C+K C +CC +CN
Sbjct  1    MKLIVIQFFIISLLLTTSLTEISSADSSACGGKCNVRCSKNDRKHEECIKDCNICCGKCN  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  61   CVPSGTYGNKDECPCYRDIKNSKGGPKCP  89



>ref|XP_003536595.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN06785.1| Snakin-1 [Glycine soja]
Length=90

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPT--HADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+VFA L+L +L+L+SSF+ P   + DS +C +KC  RCS AG+ DRCL+YCG+CC EC
Sbjct  1    MKLVFATLLLCSLLLSSSFLEPVIAYEDSSYCSNKCSDRCSSAGVKDRCLRYCGICCAEC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK +CPCYRDK N KG PKCP
Sbjct  61   KCVPSGTYGNKHQCPCYRDKLNKKGKPKCP  90



>ref|XP_006306379.1| hypothetical protein CARUB_v10012286mg [Capsella rubella]
 gb|EOA39277.1| hypothetical protein CARUB_v10012286mg [Capsella rubella]
Length=89

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMD-RCLKYCGLCCEECN  279
            MK++     + TL+LTSS    ++ADS  C  KC VRC+KA      CLK C +CCE+CN
Sbjct  1    MKLIVVQFFMITLLLTSSLFVFSNADSAACGGKCNVRCAKADRTHGECLKDCNICCEKCN  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+GNKDECPCYRD  NSKG  KCP
Sbjct  61   CVPSGTFGNKDECPCYRDMTNSKGGSKCP  89



>emb|CDY31591.1| BnaA10g12800D [Brassica napus]
Length=92

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK+V     + +L+L+SS    ++ADS  C+ KC  RCSKAG  DRCLKYC +CCE+C+
Sbjct  2    KMKLVVVQFFIISLLLSSSLFTLSNADSSPCNGKCNARCSKAGRQDRCLKYCNICCEKCD  61

Query  280  --CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  62   DHCVPSGTYGNKDECPCYRDMKNSKGEPKCP  92



>ref|XP_004289740.1| PREDICTED: snakin-1-like [Fragaria vesca subsp. vesca]
Length=88

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ F  L+   L+ +S       A S  C +KC  RC+ AG+ DRCLKYCG+CCEEC C
Sbjct  1    MKISFPVLLCFLLLSSSLMEPAFSATSSNCSNKCSNRCAVAGVQDRCLKYCGICCEECKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRDKKN+KG PKCP
Sbjct  61   VPSGTYGNKHECPCYRDKKNNKGRPKCP  88



>ref|XP_010475933.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMM-DRCLKYCGLCCEECN  279
            MK++     + +L+LTSSF   + ADS  CD KCKVRCSK     D+C K C +CC +CN
Sbjct  1    MKLIVIQFFIISLLLTSSFFKISSADS-LCDGKCKVRCSKNDREPDKCFKLCNICCHKCN  59

Query  280  -CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  60   NCVPSGTYGNKDECPCYRDMKNSKGGSKCP  89



>ref|XP_009120506.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK+      + +L+L+SS    ++ADS  C+ KC  RCSKAG  DRCLKYC +CCE+C+
Sbjct  2    KMKLATVQFFVISLLLSSSLFMLSNADSSSCNGKCNARCSKAGRQDRCLKYCNICCEKCD  61

Query  280  --CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CVPSGTYG+KDECPCYRD KNSKG PKCP
Sbjct  62   DHCVPSGTYGHKDECPCYRDMKNSKGQPKCP  92



>ref|XP_009123227.1| PREDICTED: gibberellin-regulated protein 7 isoform X2 [Brassica 
rapa]
Length=100

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 12/100 (12%)
 Frame = +1

Query  103  MKVVFAALILAT-LVLTSSFINPTHAD-----------SDFCDSKCKVRCSKAGMMDRCL  246
            MK++ +   +A+ L++TSS  + T +              +C  KC+VRC +AGM DRCL
Sbjct  1    MKIILSIFFVASFLLITSSLASATISAPAPEIKDGAELEKWCGGKCEVRCEEAGMKDRCL  60

Query  247  KYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            KYCG+CC+EC CVPSGTYGNK EC CYRDK +SK  PKCP
Sbjct  61   KYCGICCKECKCVPSGTYGNKHECACYRDKLSSKKTPKCP  100



>ref|XP_002283986.1| PREDICTED: snakin-1-like [Vitis vinifera]
Length=127

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            FCDSKC VRC+ AG+ DRC+KYCG+CC+EC CVPSGTYGNK ECPCYRDK NSKG PKCP
Sbjct  68   FCDSKCGVRCANAGVYDRCVKYCGICCQECKCVPSGTYGNKSECPCYRDKLNSKGKPKCP  127



>ref|XP_009120505.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK+V     + +L+L+SS    ++ADS  C+ KC  RCSKAG  DRCLKYC +CCE+C+
Sbjct  2    KMKLVVLQFFIISLLLSSSLFTLSNADSSPCNGKCNARCSKAGRQDRCLKYCNICCEKCD  61

Query  280  --CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  62   DHCVPSGTYGNKDECPCYRDMKNSKGEPKCP  92



>ref|XP_004141992.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004163840.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN48576.1| hypothetical protein Csa_6G493840 [Cucumis sativus]
Length=95

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
            T+A    CDSKC VRC  AG+ DRCLKYCGLCC++C CVPSGTYGNK ECPCYRDK NSK
Sbjct  30   TYAPKGVCDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPSGTYGNKSECPCYRDKLNSK  89

Query  349  GNPKCP  366
            G  KCP
Sbjct  90   GKSKCP  95



>ref|NP_001237325.1| uncharacterized protein LOC100527527 precursor [Glycine max]
 gb|ACU16624.1| unknown [Glycine max]
Length=90

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPT--HADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK+VF  L+L +L+L+ SF+ P   + DS +C +KC  RCS AG+ DRC+KYCG+CC EC
Sbjct  1    MKLVFGTLLLCSLLLSFSFLEPVIAYEDSSYCSNKCADRCSSAGVKDRCVKYCGICCAEC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDK N KG PKCP
Sbjct  61   KCVPSGTYGNKHECPCYRDKLNKKGKPKCP  90



>ref|XP_008778332.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=91

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 55/69 (80%), Gaps = 3/69 (4%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
            T A S FCDSKCKVRCSKA   DRCLKYCG+CCEEC+CVPSGTYGNKDECPCYRDK    
Sbjct  23   TIAGSPFCDSKCKVRCSKASFQDRCLKYCGVCCEECHCVPSGTYGNKDECPCYRDKYTGF  82

Query  349  G---NPKCP  366
            G    PKCP
Sbjct  83   GKRRRPKCP  91



>ref|XP_009136261.1| PREDICTED: gibberellin-regulated protein 7-like [Brassica rapa]
Length=106

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 68/106 (64%), Gaps = 18/106 (17%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-----------------DFCDSKCKVRCSKAG  228
            M+++ + L +A+L+L TSS  + T +                    +C  KC+VRC  AG
Sbjct  1    MRIIVSILFVASLLLITSSLASATISGGGGAAAPAPEIKVGPELDKWCGGKCEVRCKDAG  60

Query  229  MMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            M DRCLKYCG+CC+EC CVPSGTYGNK ECPCYRDK +SK  PKCP
Sbjct  61   MNDRCLKYCGICCKECKCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>emb|CBI33733.3| unnamed protein product [Vitis vinifera]
Length=67

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            FCDSKC VRC+ AG+ DRC+KYCG+CC+EC CVPSGTYGNK ECPCYRDK NSKG PKCP
Sbjct  8    FCDSKCGVRCANAGVYDRCVKYCGICCQECKCVPSGTYGNKSECPCYRDKLNSKGKPKCP  67



>ref|XP_009148397.1| PREDICTED: gibberellin-regulated protein 8 [Brassica rapa]
Length=88

 Score =   102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK+V     +  ++LTSSF   + ADS  C  KC VRCSKA   D C+K C +CC++CN 
Sbjct  1    MKLVIVQFSIIFILLTSSFFVLSTADSS-CGGKCNVRCSKASQHDLCIKDCNICCQKCNG  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+G++DECPCYRD KNSKG PKCP
Sbjct  60   CVPSGTFGHRDECPCYRDMKNSKGGPKCP  88



>emb|CDX89647.1| BnaC03g45610D [Brassica napus]
Length=106

 Score =   102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 68/106 (64%), Gaps = 18/106 (17%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-----------------DFCDSKCKVRCSKAG  228
            M+++ + L +A+L+L TSS  + T +                    +C  KC+VRC  AG
Sbjct  1    MRIIVSILFVASLLLITSSLASATISGGGGAAALAPEIKVGPELDKWCGGKCEVRCKDAG  60

Query  229  MMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            M DRCLKYCG+CC+EC CVPSGTYGNK ECPCYRDK +SK  PKCP
Sbjct  61   MNDRCLKYCGICCKECKCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_002875456.1| hypothetical protein ARALYDRAFT_484630 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51715.1| hypothetical protein ARALYDRAFT_484630 [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 65/90 (72%), Gaps = 3/90 (3%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAG-MMDRCLKYCGLCCEEC  276
            KM VV    I+ +L+LTSSF   + ADS  C  KC VRCSKA    + CLK C +CC++C
Sbjct  2    KMLVVVQFFII-SLLLTSSFFVLSSADSS-CGGKCDVRCSKADRQHEECLKDCNICCQKC  59

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            NCVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  60   NCVPSGTYGNKDECPCYRDLKNSKGESKCP  89



>gb|KCW68672.1| hypothetical protein EUGRSUZ_F02269 [Eucalyptus grandis]
Length=89

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFA-ALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            MK+V A A +LA L+++SS +N   A S FC SKC  RC+KAG+ DRCLKYC +CC++C 
Sbjct  1    MKMVRATAFLLACLLVSSSLLNSAMAGSSFCGSKCSARCAKAGLKDRCLKYCQICCDKCK  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNK ECPCYRD +NSKG PKCP
Sbjct  61   CVPSGTYGNKHECPCYRDLRNSKGKPKCP  89



>ref|XP_006409618.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51071.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=107

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 19/107 (18%)
 Frame = +1

Query  103  MKVVFAALILATLVLT-SSFINPT------------------HADSDFCDSKCKVRCSKA  225
            MK++ + L +A+L+L  SS  + T                   A   +C  KC+VRC K+
Sbjct  1    MKIIISILFVASLLLIISSLASATVSGGGGGAVAPAPELKDGAALEKWCGGKCEVRCKKS  60

Query  226  GMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            GM DRCL YCG+CC+EC CVPSGTYGNKDEC CYRDK +SK  PKCP
Sbjct  61   GMKDRCLNYCGICCKECKCVPSGTYGNKDECACYRDKLSSKMTPKCP  107



>gb|AGE15499.1| GA-stimulated transcript-like protein 3 [Gossypium hirsutum]
Length=90

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHAD--SDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK++F  L+L +L+L SS   PT A   S FC+ KCK RC+KA + DRC KYCG+CCEEC
Sbjct  1    MKLLFLTLLLCSLLLCSSVFAPTMAQPRSPFCEGKCKGRCNKAAVWDRCFKYCGICCEEC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDK N+KG PKCP
Sbjct  61   KCVPSGTYGNKHECPCYRDKVNNKGKPKCP  90



>gb|KFK39992.1| hypothetical protein AALP_AA3G316000 [Arabis alpina]
Length=105

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 17/105 (16%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS----------------DFCDSKCKVRCSKAGM  231
            MK++ + L++A+L+L TSS    T +                  ++C  KC+ RC +AGM
Sbjct  1    MKILVSILVVASLLLITSSLAAATVSGGGSAVAPAESKDAAVLENWCGGKCEGRCKEAGM  60

Query  232  MDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             DRCLKYCG+CC+EC CVPSGTYGNK EC CYRDK  SK  PKCP
Sbjct  61   KDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLTSKKTPKCP  105



>emb|CDX93153.1| BnaA03g38750D [Brassica napus]
Length=106

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 18/106 (17%)
 Frame = +1

Query  103  MKVVFAALILATLVL-TSSFINPTHADS-----------------DFCDSKCKVRCSKAG  228
            M+++ + L +A+L+L TSS  + T +                    +C  KC VRC  AG
Sbjct  1    MRIIVSILFVASLLLITSSLASATISGGGGAAAPAPEIKVGPELDKWCGGKCVVRCKDAG  60

Query  229  MMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            M DRCLKYCG+CC+EC CVPSGTYGNK ECPCYRDK +SK  PKCP
Sbjct  61   MNDRCLKYCGICCKECKCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_010475932.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=90

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAG-MMDRCLKYCGLCCEECN  279
            MK++     + +L+LTSSF   + ADS  C  KC VRCSK     + C+K C +CC++CN
Sbjct  1    MKLIVIQFFIISLLLTSSFFEISSADSSACGGKCTVRCSKNDRQHEECIKDCNICCQKCN  60

Query  280  -CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGN+DECPCYRD KNSKG  KCP
Sbjct  61   NCVPSGTYGNRDECPCYRDMKNSKGGSKCP  90



>ref|XP_007143086.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
 gb|ESW15080.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
Length=90

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHA--DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            MK++FA L+L +L+L+SSF+    A  +S +C SKC  RCS AG+ DRCLKYCG+CC EC
Sbjct  1    MKLLFATLLLCSLLLSSSFLESAMAYEESSYCSSKCSDRCSAAGVKDRCLKYCGICCAEC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCYRDK N KG PKCP
Sbjct  61   KCVPSGTYGNKHECPCYRDKLNKKGKPKCP  90



>gb|KFK27525.1| hypothetical protein AALP_AA8G394700 [Arabis alpina]
Length=69

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC-NCVPSGTYGNKDECPCYRDKKNS  345
            + ADS  CD KC +RCSKAG  DRCLKYC +CC++C NCVPSGTYGNKDECPCYRD KNS
Sbjct  3    STADSSPCDGKCNMRCSKAGRQDRCLKYCNICCQKCDNCVPSGTYGNKDECPCYRDMKNS  62

Query  346  KGNPKCP  366
            KG PKCP
Sbjct  63   KGQPKCP  69



>ref|XP_010028389.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW55129.1| hypothetical protein EUGRSUZ_I01086 [Eucalyptus grandis]
Length=87

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  148  TSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCY  327
            TS F+ P      FC+ KC+ RC+KA +  RC KYC +CC EC CVPSGTYGNK +CPCY
Sbjct  15   TSIFMEPVLGKPAFCEGKCRARCAKAKVKGRCAKYCNICCAECKCVPSGTYGNKHQCPCY  74

Query  328  RDKKNSKGNPKCP  366
            R+KKNSKG PKCP
Sbjct  75   RNKKNSKGKPKCP  87



>ref|XP_010458411.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=88

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGM-MDRCLKYCGLCCEECN  279
            MK++     + +L+ TSSF   + ADS  C  KC VRCSK     + C+K C +CC +CN
Sbjct  1    MKLIVIQFFIISLLFTSSFFALSSADSS-CGEKCNVRCSKNDRKHEECIKDCNICCGKCN  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  60   CVPSGTYGNKDECPCYRDIKNSKGGPKCP  88



>ref|XP_002883868.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60127.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=108

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 20/108 (19%)
 Frame = +1

Query  103  MKVVFAALILAT-LVLTSSFINPTHADS-------------------DFCDSKCKVRCSK  222
            MK++ + L LA+ L++TSS  + T +D+                    +C  KC+ RC  
Sbjct  1    MKIIISILFLASVLLITSSLASATVSDAIGSGAVAPAPEIKYGPALEKWCGQKCEGRCKA  60

Query  223  AGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            AGM DRCLKYC +CC++C CVPSGTYGNK EC CYRDK +SKG PKCP
Sbjct  61   AGMKDRCLKYCVICCKDCQCVPSGTYGNKHECACYRDKLSSKGTPKCP  108



>emb|CDY52417.1| BnaCnng22380D [Brassica napus]
Length=108

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 20/108 (19%)
 Frame = +1

Query  103  MKVVFAALILAT-LVLTSSFINPTHAD-------------------SDFCDSKCKVRCSK  222
            MK++ +   +A+ L++TSS  + T +                      +C  KC+VRC +
Sbjct  1    MKIILSIFFVASFLIITSSLASATISGGGGGGAVAPAPEIKDGAELEKWCGGKCEVRCEE  60

Query  223  AGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            AGM DRCLKYCG+CC+EC CVPSGTYGNK EC CYRDK +SK  PKCP
Sbjct  61   AGMKDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLSSKKTPKCP  108



>ref|XP_007160892.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
 gb|ESW32886.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
Length=88

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK+ FAA++L  L+L+SS    + A S FC SKC  RCSKAGM DRCLK+CG+CC +C C
Sbjct  1    MKLSFAAMLLLCLLLSSSLFQASSAGSGFCASKCAQRCSKAGMKDRCLKFCGICCSKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            VPSGTYGNK ECPCYRD KNSKG  KCP
Sbjct  61   VPSGTYGNKHECPCYRDMKNSKGKGKCP  88



>emb|CDX80223.1| BnaC09g35190D [Brassica napus]
Length=92

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK+      + +L+L+SS    ++ADS  C+ KC  RCSKAG  DRCLKYC +CCE+C+
Sbjct  2    KMKLAVVQFFIISLLLSSSLFMLSNADSSPCNGKCNARCSKAGRQDRCLKYCNICCEKCD  61

Query  280  --CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CVPSGTYGNKDECPCYRD KNS G PKCP
Sbjct  62   DHCVPSGTYGNKDECPCYRDTKNSNGKPKCP  92



>ref|XP_010458413.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAG-MMDRCLKYCGLCCEECN  279
            MK++     + +L+L SSF   + ADS  C  KC VRCSK     + C+K C +CC++C 
Sbjct  1    MKLIVIQFFIISLLLMSSFFVLSSADSSACGGKCNVRCSKNDRQHEECIKDCNICCQKCK  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNS+G  KCP
Sbjct  61   CVPSGTYGNKDECPCYRDMKNSQGGSKCP  89



>emb|CDY72009.1| BnaCnng75550D [Brassica napus]
Length=88

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK+V     +  L++TSS    + ADS  C  KC VRCSKA   D C+K C +CC++CN 
Sbjct  1    MKLVIVQFSIIFLLVTSSLFVLSTADSS-CGGKCNVRCSKASQHDLCIKDCNICCQKCNG  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYG++DECPCYRD KNSKG PKCP
Sbjct  60   CVPSGTYGHRDECPCYRDIKNSKGGPKCP  88



>ref|XP_009123225.1| PREDICTED: gibberellin-regulated protein 7 isoform X1 [Brassica 
rapa]
Length=107

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 19/107 (18%)
 Frame = +1

Query  103  MKVVFAALILAT-LVLTSSFINPTHAD------------------SDFCDSKCKVRCSKA  225
            MK++ +   +A+ L++TSS  + T +                     +C  KC+VRC +A
Sbjct  1    MKIILSIFFVASFLLITSSLASATISGGGGGAVAPAPEIKDGAELEKWCGGKCEVRCEEA  60

Query  226  GMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            GM DRCLKYCG+CC+EC CVPSGTYGNK EC CYRDK +SK  PKCP
Sbjct  61   GMKDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLSSKKTPKCP  107



>gb|KGN52784.1| hypothetical protein Csa_4G001520 [Cucumis sativus]
Length=422

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  151  SSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYR  330
            SSFI+  +A   FCD KCK RCSKAG+ DRC+KYCG+CC  C CVPSGTYGNK ECPCYR
Sbjct  18   SSFIDIVNAKPVFCDKKCKKRCSKAGVKDRCIKYCGICCGYCKCVPSGTYGNKHECPCYR  77

Query  331  DKKNSKGNP  357
            D ++SKG P
Sbjct  78   DMRSSKGRP  86



>ref|XP_009131966.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=89

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC-N  279
            MK       + +L+L+SS    ++ADS  C+ KC VRCSKA + DRCLKYC +CC +C N
Sbjct  1    MKSAVVQFYVISLLLSSSLFMLSNADSSPCNGKCNVRCSKARIQDRCLKYCNICCGKCDN  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  61   CVPSGTYGNKDECPCYRDMKNSKGGPKCP  89



>ref|XP_009126643.1| PREDICTED: gibberellin-regulated protein 10 [Brassica rapa]
 emb|CDY09248.1| BnaA02g06740D [Brassica napus]
Length=89

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK+  A +    + L  S      +++  CD KC  RCSKAG  DRCLKYC +CCE+CN 
Sbjct  1    MKMKRAVVSFVIISLILSSSLFMLSEASPCDGKCNARCSKAGRKDRCLKYCNICCEKCNY  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  61   CVPSGTYGNKDECPCYRDMKNSKGQPKCP  89



>emb|CDX71072.1| BnaC03g11560D [Brassica napus]
Length=91

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK       + +L+L+SS +  ++ADS  C+ KC VRCSKA + DRCLKYC +CC +C+
Sbjct  2    KMKSAVVQFYVISLLLSSSLLMLSNADSSPCNGKCNVRCSKARIQDRCLKYCNICCGKCD  61

Query  280  -CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  62   YCVPSGTYGNKDECPCYRDMKNSKGGPKCP  91



>ref|XP_010028136.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW54794.1| hypothetical protein EUGRSUZ_I00735 [Eucalyptus grandis]
Length=93

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +1

Query  103  MKVVFAALILATLV------LTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLC  264
            MK+ FAAL+L +LV        ++ ++P  A  + CD+KC VRC  AG+ DRCLKYCGLC
Sbjct  1    MKLAFAALLLVSLVLGSSLHAMANDLSPQPA-PNSCDAKCGVRCQNAGVKDRCLKYCGLC  59

Query  265  CEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C++C CVPSGTYGNK ECPCYRD KNSKG  KCP
Sbjct  60   CQKCQCVPSGTYGNKSECPCYRDMKNSKGTAKCP  93



>ref|NP_001077504.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
 gb|ABF59285.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28602.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
Length=89

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 3/90 (3%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAG-MMDRCLKYCGLCCEEC  276
            KM VV    I+ +L+LTSSF   + ADS  C  KC VRCSKA    + CL+ C +CC++C
Sbjct  2    KMPVVVQFFII-SLLLTSSFYVLSSADSS-CGGKCSVRCSKADRTHEECLEDCDICCQKC  59

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            NCVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  60   NCVPSGTYGNKDECPCYRDMKNSKGGSKCP  89



>emb|CDX88727.1| BnaA03g09220D [Brassica napus]
Length=91

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  100  KMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN  279
            KMK       + +L+L+SS    ++ADS  C+ KC VRCSKA + DRCLKYC +CC +C+
Sbjct  2    KMKSAVVQFYVISLLLSSSLFMLSNADSSPCNGKCNVRCSKARIHDRCLKYCNICCGKCD  61

Query  280  -CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  62   YCVPSGTYGNKDECPCYRDMKNSKGGPKCP  91



>ref|XP_006409619.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51072.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=112

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 67/112 (60%), Gaps = 24/112 (21%)
 Frame = +1

Query  103  MKVVFAALILATLVLT-SSFINPT-----------------------HADSDFCDSKCKV  210
            MK++ + L +A+L+L  SS  + T                        A   +C  KC+V
Sbjct  1    MKIIISILFVASLLLIISSLASATVSVYGDEGGGGGAVAPAPELKDGAALEKWCGGKCEV  60

Query  211  RCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            RC K+GM DRCL YCG+CC+EC CVPSGTYGNKDEC CYRDK +SK  PKCP
Sbjct  61   RCKKSGMKDRCLNYCGICCKECKCVPSGTYGNKDECACYRDKLSSKMTPKCP  112



>ref|XP_003589114.1| Snakin-1 [Medicago truncatula]
 gb|ABD33278.1| Gibberellin regulated protein [Medicago truncatula]
 gb|ACJ86188.1| unknown [Medicago truncatula]
 gb|AES59365.1| gibberellin-regulated family protein [Medicago truncatula]
 gb|AFK38793.1| unknown [Medicago truncatula]
Length=91

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSD---FCDSKCKVRCSKAGMMDRCLKYCGLCCEE  273
            MK  FAA++L  L+L+S     + A +D   FC SKC  RCSKAGM DRC+K+CG+CC +
Sbjct  1    MKPAFAAMLLVCLILSSFMFEMSIAGTDSGRFCSSKCGQRCSKAGMKDRCMKFCGICCGK  60

Query  274  CNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C CVPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   CKCVPSGTYGNKHECPCYRDMKNSKGKPKCP  91



>emb|CDY54472.1| BnaA09g52760D [Brassica napus]
Length=109

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 67/109 (61%), Gaps = 21/109 (19%)
 Frame = +1

Query  103  MKVVFAALILAT-LVLTSSFINPTHAD--------------------SDFCDSKCKVRCS  219
            MK++ +   +A+ L++TSS  + T +                       +C  KC+VRC 
Sbjct  1    MKIILSIFFVASFLLITSSLASATISGGGGGGGAVAPAPEIKDGAELEKWCGGKCEVRCE  60

Query  220  KAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +AGM DRCLKYCG+CC+EC CVPSGTYGNK EC CYRDK +SK  PKCP
Sbjct  61   EAGMKDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLSSKKTPKCP  109



>ref|XP_006292427.1| hypothetical protein CARUB_v10018642mg [Capsella rubella]
 gb|EOA25325.1| hypothetical protein CARUB_v10018642mg [Capsella rubella]
Length=88

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMD-RCLKYCGLCCEECN  279
            MK++ A   + +L+LTSS    ++A S  CD KC VRC+KA      CLK C +CCE+CN
Sbjct  1    MKLMVAQFFMISLLLTSSLFVHSNAGSA-CDGKCNVRCAKADRTHGECLKDCNICCEKCN  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+GNKDECPCYRD  NSKG  KCP
Sbjct  60   CVPSGTFGNKDECPCYRDLINSKGGSKCP  88



>gb|ACJ68116.1| hypothetical protein [Brassica napus]
Length=89

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            MK       + +L+L+SS    ++ADS  C+ KC VRCSKA + DRCLKYC +CC +C+ 
Sbjct  1    MKSAVVQFYVISLLLSSSLFMLSNADSSPCNGKCNVRCSKARIQDRCLKYCNICCGKCDY  60

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGTYGNKDECPCYRD KNSKG PKCP
Sbjct  61   CVPSGTYGNKDECPCYRDMKNSKGGPKCP  89



>gb|KEH44041.1| gibberellin-regulated family protein [Medicago truncatula]
Length=90

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
             + DS  C SKC  RCSKAG+ DRC+KYC +CC EC CVPSGTYGNK ECPCYRDK N+K
Sbjct  25   AYEDSSNCSSKCSDRCSKAGVQDRCVKYCEICCNECKCVPSGTYGNKHECPCYRDKVNNK  84

Query  349  GNPKCP  366
            G PKCP
Sbjct  85   GKPKCP  90



>ref|XP_006279073.1| hypothetical protein CARUB_v10012746mg [Capsella rubella]
 gb|EOA11971.1| hypothetical protein CARUB_v10012746mg [Capsella rubella]
Length=88

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMD-RCLKYCGLCCEECN  279
            MK++ A   + +L+LTSS    ++A S  CD KC VRC+KA      CLK C +CCE+CN
Sbjct  1    MKLMVAQFFMISLLLTSSLFVLSNAGSA-CDGKCNVRCAKADRTHGECLKDCNICCEKCN  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+GNKDECPCYRD  NSKG  KCP
Sbjct  60   CVPSGTFGNKDECPCYRDLINSKGGSKCP  88



>emb|CDX93402.1| BnaA06g06460D [Brassica napus]
Length=94

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECN-  279
            + +V     +  ++LTSSF   + ADS  C  KC VRCSKA   D C+K C +CC++CN 
Sbjct  7    VGLVIVQFSIIFILLTSSFFVLSTADSS-CGGKCNVRCSKASQHDLCIKDCNICCQKCNG  65

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+G++DECPCYRD KNSKG PKCP
Sbjct  66   CVPSGTFGHRDECPCYRDMKNSKGGPKCP  94



>ref|XP_002518646.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF43571.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  166  PTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNS  345
            P  A S FC +KC  RC++AG+ DRC+KYC +CC EC CVPSGTYGNK ECPCYRDKKNS
Sbjct  22   PVMAKSLFCANKCNDRCARAGVKDRCIKYCEICCAECKCVPSGTYGNKLECPCYRDKKNS  81

Query  346  KGNPKCP  366
            KG  KCP
Sbjct  82   KGKSKCP  88



>gb|EMS63633.1| hypothetical protein TRIUR3_22813 [Triticum urartu]
Length=98

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG-  351
            A S FCDSKC VRCSKAG  D CLKYCG+CC ECNCVPSGT GNKDECPCYRDK    G 
Sbjct  32   AGSAFCDSKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGA  91

Query  352  --NPKCP  366
               PKCP
Sbjct  92   RTRPKCP  98



>gb|EMS63632.1| hypothetical protein TRIUR3_22812 [Triticum urartu]
Length=94

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG-  351
            A S FCDSKC VRCSKAG  D CLKYCG+CC +CNCVPSGT GNKDECPCYRDK   +G 
Sbjct  28   AGSAFCDSKCGVRCSKAGRHDDCLKYCGICCAQCNCVPSGTAGNKDECPCYRDKTTGQGA  87

Query  352  --NPKCP  366
               PKCP
Sbjct  88   RKRPKCP  94



>gb|AFE82743.1| snakin-1 [Medicago sativa]
 gb|AFJ54172.1| snakin-1 [Medicago sativa]
Length=91

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSD---FCDSKCKVRCSKAGMMDRCLKYCGLCCEE  273
            MK  FAA++L  L+L+S     + A +D   FC S C  RCSKAGM DRC+K+CG+CC +
Sbjct  1    MKPAFAAMLLVCLILSSFMFEMSIAGTDSGRFCSSICGQRCSKAGMKDRCMKFCGICCGK  60

Query  274  CNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C CVPSGTYGNK ECPCYRD KNSKG PKCP
Sbjct  61   CKCVPSGTYGNKHECPCYRDMKNSKGKPKCP  91



>gb|KDP32030.1| hypothetical protein JCGZ_12491 [Jatropha curcas]
Length=79

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CD KC  RCS AG  DRCLKYCG+CC+EC CVPSGTYGNK ECPCYRDKKNSKG  KCP
Sbjct  21   CDLKCGTRCSNAGYKDRCLKYCGICCQECKCVPSGTYGNKSECPCYRDKKNSKGQSKCP  79



>ref|XP_011069640.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=91

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  163  NPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKN  342
            +P    S FC  KC VRCS A   DRCLKYCG+CC +CNCVPSGT+GNKDECPCYRD KN
Sbjct  24   DPPSDLSAFCKGKCDVRCSLASRKDRCLKYCGICCTKCNCVPSGTFGNKDECPCYRDLKN  83

Query  343  SKGNPKCP  366
            SKG  KCP
Sbjct  84   SKGESKCP  91



>gb|EYU37603.1| hypothetical protein MIMGU_mgv1a024675mg [Erythranthe guttata]
Length=93

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  163  NPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKN  342
            + ++   ++C S C +RC++AG+ DRCLKYCG+CC++C CVPSGTYGNK +CPCYRD ++
Sbjct  26   DQSYDSVNYCASSCDLRCARAGVKDRCLKYCGICCDKCKCVPSGTYGNKHQCPCYRDMRS  85

Query  343  SKGNPKCP  366
            SKG PKCP
Sbjct  86   SKGKPKCP  93



>gb|EMT21443.1| hypothetical protein F775_31764 [Aegilops tauschii]
Length=94

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG-  351
            A S FCD KC VRCSKAG  D CLKYCG+CC ECNCVPSGT GNKDECPCYRDK    G 
Sbjct  28   AGSAFCDGKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGA  87

Query  352  --NPKCP  366
               PKCP
Sbjct  88   RKRPKCP  94



>ref|XP_006301392.1| hypothetical protein CARUB_v10021805mg [Capsella rubella]
 gb|EOA34290.1| hypothetical protein CARUB_v10021805mg [Capsella rubella]
Length=88

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMD-RCLKYCGLCCEECN  279
            MK++     + +L+LTSS    ++A  + C  KC VRC+KA      CL+ C +CCE+CN
Sbjct  1    MKLIVVQFFIISLLLTSSLFVLSNAGLE-CGGKCNVRCAKADRTHGECLQDCNICCEKCN  59

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+GNKDECPCYRD +NSKG  KCP
Sbjct  60   CVPSGTFGNKDECPCYRDLQNSKGGSKCP  88



>ref|XP_003559118.1| PREDICTED: peamaclein-like [Brachypodium distachyon]
Length=93

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S+FCDSKC  RCSKA   D CLKYCG+CC ECNCVPSGT GNKDECPCYRDK   KG+
Sbjct  27   AGSEFCDSKCSFRCSKASRHDDCLKYCGICCAECNCVPSGTSGNKDECPCYRDKTTGKGS  86

Query  355  PK  360
             K
Sbjct  87   RK  88



>emb|CDY50148.1| BnaA01g26080D [Brassica napus]
Length=96

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  139  LVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDEC  318
            + + ++          +C S+C+ RC+KAG  DRCLKYCG+CC +C CVPSGT+GNK +C
Sbjct  21   VFIATAAPGRIRGMEVYCRSRCRGRCAKAGFQDRCLKYCGICCRQCKCVPSGTFGNKHQC  80

Query  319  PCYRDKKNSKGNPKCP  366
            PCYRDK +SKG PKCP
Sbjct  81   PCYRDKLSSKGKPKCP  96



>ref|XP_004142881.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156376.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN62465.1| hypothetical protein Csa_2G354910 [Cucumis sativus]
Length=85

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  184  DFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKC  363
             FC  KC+ RCSKAG+ DRC+KYCG+CCE+C CVPSGTYGNK ECPCY + KNSKGN KC
Sbjct  25   GFCGWKCRRRCSKAGVRDRCMKYCGICCEKCGCVPSGTYGNKHECPCYGNLKNSKGNSKC  84

Query  364  P  366
            P
Sbjct  85   P  85



>ref|XP_009403760.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYR  330
            ADS +C SKCKVRC+KAG+MDRCL YCG+CCEEC CVPSGTYGNKDECPCYR
Sbjct  26   ADSAYCKSKCKVRCAKAGVMDRCLYYCGMCCEECKCVPSGTYGNKDECPCYR  77



>gb|KFK39277.1| hypothetical protein AALP_AA3G223500 [Arabis alpina]
Length=63

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C S+C+ RC+KAG  DRCLKYCG+CC +C CVPSGT+GNK +CPCYRDK +SKG PKCP
Sbjct  4    YCGSRCRGRCAKAGFQDRCLKYCGICCRQCKCVPSGTFGNKHQCPCYRDKLSSKGKPKCP  63



>gb|EMT21444.1| hypothetical protein F775_43887 [Aegilops tauschii]
Length=98

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG-  351
            A S FCDSKC VRCSKA   D CLKYCG+CC ECNCVPSGT GNKDECPCYRDK    G 
Sbjct  32   AGSAFCDSKCGVRCSKASRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGA  91

Query  352  --NPKCP  366
               PKCP
Sbjct  92   RTRPKCP  98



>ref|NP_179096.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O82328.1|GASA7_ARATH RecName: Full=Gibberellin-regulated protein 7; AltName: Full=GAST1 
protein homolog 7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC61287.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AAO22720.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AAO42417.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AEC06348.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=108

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C  KC+ RC +AGM DRCLKYCG+CC++C CVPSGTYGNK EC CYRDK +SKG PKCP
Sbjct  49   WCGQKCEGRCKEAGMKDRCLKYCGICCKDCQCVPSGTYGNKHECACYRDKLSSKGTPKCP  108



>ref|XP_009135633.1| PREDICTED: peamaclein-like [Brassica rapa]
Length=97

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C S+C+ RCSKAG  DRC+KYCG+CC +C CVPSGT+GNK +CPCYRD  +SKG PKCP
Sbjct  38   YCGSRCRGRCSKAGFRDRCIKYCGICCRQCKCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  97



>ref|XP_010519291.1| PREDICTED: peamaclein-like [Tarenaya hassleriana]
Length=99

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C  +C  RC+KAG  DRCLKYCG+CC EC CVPSGTYG+K ECPCYRDK +SKG PKCP
Sbjct  40   YCGKRCNGRCAKAGFQDRCLKYCGICCRECKCVPSGTYGHKHECPCYRDKMSSKGRPKCP  99



>ref|XP_003559125.1| PREDICTED: peamaclein-like [Brachypodium distachyon]
Length=93

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
            + + S FCDSKC  RCSKAG  D CLKYCG+CC ECNCVPSGT GNKDECPCYRDK   K
Sbjct  25   SMSGSAFCDSKCSFRCSKAGRHDDCLKYCGICCAECNCVPSGTSGNKDECPCYRDKTTGK  84

Query  349  GNPK  360
            G+ K
Sbjct  85   GSRK  88



>ref|NP_001051348.1| Os03g0760800 [Oryza sativa Japonica Group]
 gb|AAK63933.1|AC084282_14 putative protein of gibberellin-stimulated transcript [Oryza 
sativa Japonica Group]
 dbj|BAD67542.1| Gibberellin stimulated transcript related protein 1 [Oryza sativa 
Japonica Group]
 gb|ABF99002.1| Gibberellin-regulated protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13262.1| Os03g0760800 [Oryza sativa Japonica Group]
 gb|EAY91938.1| hypothetical protein OsI_13625 [Oryza sativa Indica Group]
 gb|EAZ28663.1| hypothetical protein OsJ_12674 [Oryza sativa Japonica Group]
 dbj|BAH00426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=93

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG-  351
            A SDFCD KCKVRCSKA   D CLKYCG+CC  CNCVPSGT GNKDECPCYRD     G 
Sbjct  27   AGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGHGA  86

Query  352  --NPKCP  366
               PKCP
Sbjct  87   RKRPKCP  93



>ref|NP_001149636.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACG36191.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=95

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S FCD KC VRCSKA   D CLKYCG+CC  CNCVPSGT GNKDECPCYRD     GN
Sbjct  29   AGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTGHGN  88

Query  355  ---PKCP  366
               PKCP
Sbjct  89   RTRPKCP  95



>ref|XP_007018557.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY15782.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=95

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNC  282
            MK++    +L +LVL+SSF   + A S FCDSKCKVRCSKAG  DRCLKYCG+CC++C C
Sbjct  1    MKLILVTFLLVSLVLSSSFFEVSMAGSGFCDSKCKVRCSKAGAKDRCLKYCGICCKKCKC  60

Query  283  VPSGTYGNKDECPCYRDKKNSKGN  354
            VPSGTYGNK ECPCYRD KNSKG 
Sbjct  61   VPSGTYGNKQECPCYRDMKNSKGQ  84



>ref|XP_006650629.1| PREDICTED: snakin-1-like [Oryza brachyantha]
Length=94

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A SDFCD KCKVRCSKA   D CL+YCG+CC  CNCVPSGT GNKDECPCYRD    +G 
Sbjct  28   AGSDFCDGKCKVRCSKASRHDDCLRYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGQGT  87

Query  355  ---PKCP  366
               PKCP
Sbjct  88   RKRPKCP  94



>ref|XP_006406493.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
 gb|ESQ47946.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
Length=67

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C S+C+ RC+KAG  DRC+KYCG+CC EC CVPSGT+GNK +CPCYRD  +SKG PKCP
Sbjct  8    YCGSRCRERCAKAGFQDRCIKYCGICCRECKCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  67



>ref|NP_001183511.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACR33840.1| unknown [Zea mays]
 gb|ACR37199.1| unknown [Zea mays]
 gb|ACR37238.1| unknown [Zea mays]
 gb|AFW67550.1| gibberellin-regulated protein 2 [Zea mays]
Length=96

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S FCD KC VRCSKA   D CLKYCG+CC  CNCVPSGT GNKDECPCYRD     GN
Sbjct  30   AGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTGHGN  89

Query  355  ---PKCP  366
               PKCP
Sbjct  90   RTRPKCP  96



>gb|ACG44951.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=96

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S FCD KC VRCSKA   D CLKYCG+CC  CNCVPSGT GNKDECPCYRD     GN
Sbjct  30   AGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTGHGN  89

Query  355  ---PKCP  366
               PKCP
Sbjct  90   RIRPKCP  96



>gb|EMS47698.1| hypothetical protein TRIUR3_08559 [Triticum urartu]
Length=94

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG-  351
            A S FCD KC VRCSKA   D CLKYCG+CC ECNCVPSGT GNKDECPCYRDK    G 
Sbjct  28   AGSAFCDGKCGVRCSKASRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGA  87

Query  352  --NPKCP  366
               PKCP
Sbjct  88   RKRPKCP  94



>emb|CDY22975.1| BnaC03g40940D [Brassica napus]
Length=97

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C S+C+ RCSKAG  DRC+KYCG+CC +C CVPSGT+GNK +CPCYRD  +SKG PKCP
Sbjct  38   YCVSRCRGRCSKAGFRDRCIKYCGICCRQCKCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  97



>gb|ABN12953.1| GASA-like protein [Gymnadenia conopsea]
Length=97

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +1

Query  151  SSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYR  330
            +S+     + S FC  KCKVRCSKA   DRCL+YCG+CC  C CVPSGTYGNKDECPCYR
Sbjct  23   ASYSQMASSQSAFCGEKCKVRCSKASDHDRCLRYCGVCCNLCGCVPSGTYGNKDECPCYR  82

Query  331  DKKNSKGN---PKCP  366
            DK    G    PKCP
Sbjct  83   DKYTGVGQRRRPKCP  97



>ref|XP_006301929.1| hypothetical protein CARUB_v10022405mg [Capsella rubella]
 gb|EOA34827.1| hypothetical protein CARUB_v10022405mg [Capsella rubella]
Length=86

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMD-RCLKYCGLCCEECN  279
            MK+V     + +L+LTSS    ++A S+ C+ KC VRC+KA      CL+ C +CCE+C 
Sbjct  1    MKIV--QFFVISLLLTSSLFVLSNAGSE-CNGKCNVRCAKADRTHGECLQDCNICCEKCK  57

Query  280  CVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CVPSGT+GNKDECPCYRD KNSKG  KCP
Sbjct  58   CVPSGTFGNKDECPCYRDLKNSKGGSKCP  86



>ref|XP_008444582.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=85

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  184  DFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKC  363
             FC  KC+ RCSKAG+ DRC+KYCG+CC +C CVPSGTYGNK ECPCY + KNSKGN KC
Sbjct  25   GFCGWKCRRRCSKAGVRDRCMKYCGICCVKCGCVPSGTYGNKHECPCYGNLKNSKGNSKC  84

Query  364  P  366
            P
Sbjct  85   P  85



>ref|XP_009617608.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=91

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            +++ A +++  L+LTSSF+    A S +C  K     +K G+  +C+KYC LCC +C CV
Sbjct  7    RLLVAFMLVFALLLTSSFLETATAKSVYCAHK--ATNAKLGVPSQCVKYCELCCAKCKCV  64

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            P+GTYGNK + PCYRD KNSKG PKCP
Sbjct  65   PTGTYGNKHQYPCYRDMKNSKGKPKCP  91



>gb|AAD01518.1| Snakin-1 [Solanum tuberosum]
Length=50

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  217  SKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            SKAG+ DRCLKYCG+CCEEC CVPSGTYGNK ECPCYRDKKNSKG  KCP
Sbjct  1    SKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP  50



>ref|XP_002463849.1| hypothetical protein SORBIDRAFT_01g007360 [Sorghum bicolor]
 gb|EER90847.1| hypothetical protein SORBIDRAFT_01g007360 [Sorghum bicolor]
Length=93

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S FCD KC VRCSKA   D CLKYCG+CC  CNCVPSGT G+KDECPCYRD     GN
Sbjct  27   AGSAFCDGKCGVRCSKASRHDDCLKYCGICCASCNCVPSGTAGHKDECPCYRDMTTGHGN  86

Query  355  ---PKCP  366
               PKCP
Sbjct  87   RTRPKCP  93



>ref|XP_010547967.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=105

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C+ +C+VRC  AGM DRCL YCG+CC +C CVPSGT GNK EC CYRDK +SKG PKCP
Sbjct  46   WCEDRCEVRCRVAGMHDRCLNYCGICCRDCKCVPSGTSGNKHECACYRDKLSSKGTPKCP  105



>ref|XP_002879804.1| hypothetical protein ARALYDRAFT_482976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56063.1| hypothetical protein ARALYDRAFT_482976 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  TLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV---PSGTYGN  306
            +L+L S+F   + AD   C  KC VRCSKAG  + CLKY  +CC +CNC    PS T+GN
Sbjct  2    SLLLASTFFVLSSADCVTCGGKCNVRCSKAGQHEECLKYYNICCHKCNCTRHCPSDTFGN  61

Query  307  KDECPCYRDKKNSKGNPKCP  366
            KDECPCYRD KNSKG  KCP
Sbjct  62   KDECPCYRDMKNSKGGSKCP  81



>ref|XP_002969375.1| hypothetical protein SELMODRAFT_440818 [Selaginella moellendorffii]
 gb|EFJ29463.1| hypothetical protein SELMODRAFT_440818 [Selaginella moellendorffii]
Length=101

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 53/97 (55%), Gaps = 5/97 (5%)
 Frame = +1

Query  91   MFGKMKVVFAALILATLVLTSSFINPTHADSDF-----CDSKCKVRCSKAGMMDRCLKYC  255
            + G   +VF         ++S     T           C   C  RC  A + DRC+ YC
Sbjct  5    VLGFAILVFLVAAFQISAVSSMIQGSTGRSRQLLAKIDCAQACTSRCEVASVHDRCMNYC  64

Query  256  GLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            G+CC+ CNCVPSG YGNKDEC CYRDKKNSKG  KCP
Sbjct  65   GICCQSCNCVPSGHYGNKDECSCYRDKKNSKGKAKCP  101



>gb|ACR37248.1| unknown [Zea mays]
 gb|ACR37359.1| unknown [Zea mays]
Length=96

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S FCD KC VRCSKA   D  LKYCG+CC  CNCVPSGT GNKDECPCYRD     GN
Sbjct  30   AGSGFCDGKCAVRCSKASRHDDRLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTGHGN  89

Query  355  ---PKCP  366
               PKCP
Sbjct  90   RTRPKCP  96



>gb|ABK22434.1| unknown [Picea sitchensis]
 gb|ABK25425.1| unknown [Picea sitchensis]
Length=111

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  82   LQFMFGKMKVVFAALILATLVLTSSFINPTHADSDF----CDSKCKVRCSKAGMMDRCLK  249
            L  +FG + +V  ++       +       H D       C S C  RC+ A + DRCLK
Sbjct  13   LVMLFGLLNLVVCSVEDEINGFSLGQPQTLHKDRHLLALNCGSACGKRCALASVKDRCLK  72

Query  250  YCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            YCG+CC  C CVP GTYGNK+ CPCYRD KN+KG PKCP
Sbjct  73   YCGICCSSCQCVPPGTYGNKNACPCYRDMKNAKGKPKCP  111



>gb|ABK25287.1| unknown [Picea sitchensis]
Length=111

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  82   LQFMFGKMKVVFAALILATLVLTSSFINPTHADSDF----CDSKCKVRCSKAGMMDRCLK  249
            L  +FG + +V  ++       +       H D       C S C  RC+ A + DRCLK
Sbjct  13   LVMLFGLLNLVVCSVEDEINGFSLGQPQTLHKDRHLLALNCGSACGKRCALASVKDRCLK  72

Query  250  YCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            YCG+CC  C CVP GTYGNK+ CPCYRD KN+KG PKCP
Sbjct  73   YCGICCSSCQCVPPGTYGNKNACPCYRDLKNAKGKPKCP  111



>ref|XP_004981680.1| PREDICTED: snakin-1-like [Setaria italica]
Length=94

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +1

Query  181  SDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN--  354
            S+FCDS C  RCSKA   D CLKYCG+CC +CNCVPSGT G+KDECPCYRD     GN  
Sbjct  30   SEFCDSNCARRCSKASRHDDCLKYCGICCADCNCVPSGTAGHKDECPCYRDMTTGTGNRT  89

Query  355  -PKCP  366
             PKCP
Sbjct  90   RPKCP  94



>ref|XP_010685204.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=101

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINP---------THADSDFCDSKCKVRCSKAGMMDRCLKYC  255
            + V+F +LIL + +L  +   P           + + FC +KC VRC+  G+  RC+KYC
Sbjct  5    LVVLFISLILCSALLDINNAQPLSPSQSPDTVESTTGFCSNKCGVRCALKGVNSRCMKYC  64

Query  256  GLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             +CC +C+CVPSGT GN +ECPCYRD K   G PKCP
Sbjct  65   MMCCGKCSCVPSGTSGNLNECPCYRDWKAPNGRPKCP  101



>ref|XP_002970705.1| hypothetical protein SELMODRAFT_94072, partial [Selaginella moellendorffii]
 gb|EFJ28031.1| hypothetical protein SELMODRAFT_94072, partial [Selaginella moellendorffii]
Length=59

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C   C  RC+ A + DRC+ YCG+CC+ CNCVPSG YGNKDEC CYRDKKNSKG  KCP
Sbjct  1    CAQACTSRCAVASVHDRCMNYCGICCQSCNCVPSGHYGNKDECSCYRDKKNSKGKAKCP  59



>ref|XP_008236410.1| PREDICTED: peamaclein [Prunus mume]
Length=90

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
              A S +C  KC  RC+ AG+ DRC+KYCG+CCEEC CVPSGTYGNK ECPCYRDKKN K
Sbjct  25   AQAKSKYCSDKCSSRCAVAGVQDRCIKYCGICCEECKCVPSGTYGNKHECPCYRDKKNKK  84

Query  349  GNPKCP  366
            G PKCP
Sbjct  85   GKPKCP  90



>ref|XP_007200798.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
 gb|EMJ01997.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
Length=91

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  169  THADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSK  348
              A S +C  KC  RC+ AG+ DRC+KYCG+CCEEC CVPSGTYGNK ECPCYRDKKN K
Sbjct  26   AQAKSKYCSDKCSTRCAVAGVQDRCIKYCGICCEECKCVPSGTYGNKHECPCYRDKKNKK  85

Query  349  GNPKCP  366
            G PKCP
Sbjct  86   GKPKCP  91



>gb|AFK36243.1| unknown [Lotus japonicus]
 gb|AFK45019.1| unknown [Lotus japonicus]
Length=94

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  178  DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNP  357
            +S FC SKC  RCSKAGM DRC+++CG+CC +C CVPSGTYGNK ECPCYRD KNSKG P
Sbjct  32   ESGFCGSKCAQRCSKAGMQDRCIRFCGICCGKCKCVPSGTYGNKHECPCYRDMKNSKGKP  91

Query  358  KCP  366
            KCP
Sbjct  92   KCP  94



>ref|XP_009800618.1| PREDICTED: peamaclein-like, partial [Nicotiana sylvestris]
Length=72

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            CDSKC VR  KAG+  RCL YCG+ C +CNCVPSG YGNK ECPCYRD  NSKG  KCP
Sbjct  14   CDSKCAVRRGKAGIAKRCLTYCGIYCNKCNCVPSGNYGNKSECPCYRDMLNSKGKSKCP  72



>emb|CDO97247.1| unnamed protein product [Coffea canephora]
Length=89

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  148  TSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCY  327
            ++SFI PT   S +C  +CK RC+KAG+ DRCL+YC +CC +C CVPSGT+GNK +CPCY
Sbjct  17   SNSFIEPTMGVSVYCARECKARCAKAGVRDRCLRYCKICCGKCKCVPSGTHGNKHQCPCY  76

Query  328  RDKKNSKGNPKCP  366
            RD KNSKG  KCP
Sbjct  77   RDMKNSKGKAKCP  89



>gb|KCW54793.1| hypothetical protein EUGRSUZ_I00734 [Eucalyptus grandis]
Length=93

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = +1

Query  103  MKVVFAALILA------TLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLC  264
            MK+ FA L+L       ++   +  ++P  + S  CD+KC VRC K+   D+CLKYCG+C
Sbjct  1    MKLAFATLLLVSLVLSFSIHAMAGDLSPQPSPSS-CDAKCAVRCQKSWRKDKCLKYCGIC  59

Query  265  CEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C++C+CVPSG Y +K ECPCYRD K+ +G  KCP
Sbjct  60   CQKCHCVPSGPYADKSECPCYRDMKSPQGKDKCP  93



>ref|XP_006416023.1| hypothetical protein EUTSA_v10009207mg [Eutrema salsugineum]
 gb|ESQ34376.1| hypothetical protein EUTSA_v10009207mg [Eutrema salsugineum]
Length=91

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADS---DFCDSKCKVRCSKAGMMDRCLKYCGLCCEE  273
            M  + A L + +L+  + F N     S   + C   C  RCSKA  M+ CL YC LCC++
Sbjct  1    MVKLIAVLTVFSLLFATRFSNTGGEGSLTVEDCPKACDFRCSKAFKMESCLFYCNLCCKQ  60

Query  274  CNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C CVPSGTYGNK+ECPCY + KN    PKCP
Sbjct  61   CLCVPSGTYGNKEECPCYNNWKNKSDGPKCP  91



>gb|AES96393.2| GASA/GAST/Snakin [Medicago truncatula]
Length=83

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = +1

Query  97   GKMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
             K    F  +++ T V+  +++N        C  KC  RCSK      CL YC LCC +C
Sbjct  2    AKFICAFLFMLVITFVIQETYVN--------CAPKCDYRCSKTSHRKACLTYCNLCCAKC  53

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYGNK ECPCY + +N  G PKCP
Sbjct  54   LCVPSGTYGNKQECPCYDNWRNKNGGPKCP  83



>ref|XP_002973082.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
 gb|EFJ25456.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
Length=68

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C S C  RCSKA   DRC+KYC +CC +CNCVP GTYGNK+ CPCY + KNSKG PKCP
Sbjct  10   CGSACDYRCSKADAHDRCIKYCNICCGKCNCVPPGTYGNKETCPCYNNLKNSKGGPKCP  68



>gb|ABR25339.1| giberellin regulated family protein [Oryza sativa Indica Group]
Length=61

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +1

Query  193  DSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKG---NPKC  363
            D KCKVRCSKA   D CLKYCG+CC  CNCVPSGT GNKDECPCYRD     G    PKC
Sbjct  1    DGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGHGARKRPKC  60

Query  364  P  366
            P
Sbjct  61   P  61



>ref|XP_002889819.1| hypothetical protein ARALYDRAFT_471179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66078.1| hypothetical protein ARALYDRAFT_471179 [Arabidopsis lyrata subsp. 
lyrata]
Length=90

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +1

Query  103  MKVVFAA-LILATLVLTSSFINPTHADSDFCDSKCKVRCSKAG-MMDRCLKYCGLCCEEC  276
            MK++ A    + +L+LTSS+   + ADS  C  KC VRCSKA    + CL+ C +CC++C
Sbjct  1    MKMLVAVQFFIISLLLTSSYFVLSSADSSACGGKCNVRCSKADRTHEECLEDCNICCQQC  60

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            NCVPSGTYGNKDECPCYRD KNSKG  KCP
Sbjct  61   NCVPSGTYGNKDECPCYRDMKNSKGGSKCP  90



>ref|XP_002976786.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
 gb|EFJ22455.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
Length=61

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C S C  RCSKA   DRC+KYC +CC +CNCVP GTYGNK+ CPCY + KNSKG PKCP
Sbjct  3    CGSACDYRCSKADAHDRCIKYCNICCGKCNCVPPGTYGNKETCPCYNNLKNSKGGPKCP  61



>ref|NP_001152432.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACG47587.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=96

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +1

Query  175  ADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGN  354
            A S  CD KC VRCSKA   D CLK CG+CC  CNCV SGT GNKDECPCYRD     GN
Sbjct  30   AGSXXCDGKCAVRCSKASRHDDCLKXCGICCATCNCVLSGTAGNKDECPCYRDMTTGHGN  89

Query  355  ---PKCP  366
               PKCP
Sbjct  90   RTRPKCP  96



>ref|XP_002970861.1| hypothetical protein SELMODRAFT_94549, partial [Selaginella moellendorffii]
 gb|EFJ28187.1| hypothetical protein SELMODRAFT_94549, partial [Selaginella moellendorffii]
Length=67

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C S C+ RC  A +  RCLKYC +CC EC+CVPSG  GN+DECPCYRDKKNS+G  KCP
Sbjct  9    CTSACETRCLVANLHKRCLKYCNICCVECHCVPSGHSGNEDECPCYRDKKNSRGGDKCP  67



>ref|XP_003613454.1| Gibberellin induced protein [Medicago truncatula]
 gb|AES96412.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 54/92 (59%), Gaps = 8/92 (9%)
 Frame = +1

Query  115  FAALILATL--VLTSSFINPTHADSDF------CDSKCKVRCSKAGMMDRCLKYCGLCCE  270
             A LI A L  ++TS  I   +A  +       C  KC  RCSK      CL YC LCC 
Sbjct  1    MAKLICAFLFMLVTSFVIQDVYAGGEGSLKPAECAPKCDYRCSKTAYKKACLTYCNLCCA  60

Query  271  ECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C CVPSGTYGNK+ECPCY + KN KG PKCP
Sbjct  61   KCLCVPSGTYGNKEECPCYNNWKNKKGGPKCP  92



>gb|ABK21371.1| unknown [Picea sitchensis]
Length=117

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 57/105 (54%), Gaps = 17/105 (16%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDF-----------------CDSKCKVRCSKAGM  231
            + V+ AAL    ++ T   IN +   +                   C S+C  RC  A  
Sbjct  13   LLVLIAALEWQVVLSTDQGINGSGVTTVHPASSPSPSPAPAPPLIDCKSECDRRCKVAPR  72

Query  232  MDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
               CLK+CG+CC  C CVPSGT GNKDECPCYRDK++S+G PKCP
Sbjct  73   QKACLKFCGICCNACKCVPSGTRGNKDECPCYRDKRSSQGKPKCP  117



>ref|XP_007163897.1| hypothetical protein PHAVU_L007200g [Phaseolus vulgaris]
 gb|ESW35891.1| hypothetical protein PHAVU_L007200g [Phaseolus vulgaris]
Length=92

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADS---DFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            K V+A L+L  +   +         S   + C   C+VRCSK  +   CL YC LCC++C
Sbjct  3    KFVWAFLLLFLMTFVTQLAYGGGEGSLKPEECPGACEVRCSKTRVKKACLFYCNLCCDKC  62

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGT GNK+ECPCY + KN  G PKCP
Sbjct  63   LCVPSGTVGNKEECPCYNNWKNENGGPKCP  92



>ref|XP_004986740.1| PREDICTED: gibberellin-regulated protein 12-like [Setaria italica]
Length=101

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSS--FINPTHADSDF----CDSKCKVRCSKAGMMDRCLKYCGLC  264
            + +V   L LA +V  S+  F  P  A+       C  KC  RCS       CL +C  C
Sbjct  8    ISIVLFLLALAFVVEVSAGGFYKPAGAEGSVPIEQCPDKCDYRCSATSHKKPCLFFCNYC  67

Query  265  CEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C++C CVPSGTYGNK+ECPCY + KN +G PKCP
Sbjct  68   CQKCLCVPSGTYGNKEECPCYNNMKNKEGGPKCP  101



>gb|ABK21812.1| unknown [Picea sitchensis]
Length=121

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C S+C  RC  A     CLK+CG+CC  C CVPSGT GNKDECPCYRDK++S+G PKCP
Sbjct  63   CKSECDRRCKVAPRQKACLKFCGICCNACKCVPSGTRGNKDECPCYRDKRSSQGKPKCP  121



>ref|XP_002969591.1| hypothetical protein SELMODRAFT_91546, partial [Selaginella moellendorffii]
 gb|EFJ29679.1| hypothetical protein SELMODRAFT_91546, partial [Selaginella moellendorffii]
Length=67

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C S C+ RC  A +  RCLKYC +CC  C+CVPSG  GN+DECPCYRDKKNS+G  KCP
Sbjct  9    CTSACETRCLVANLHKRCLKYCNICCVACHCVPSGHSGNEDECPCYRDKKNSRGGDKCP  67



>ref|XP_002973289.1| hypothetical protein SELMODRAFT_99234, partial [Selaginella moellendorffii]
 ref|XP_002976615.1| hypothetical protein SELMODRAFT_105312, partial [Selaginella 
moellendorffii]
 gb|EFJ22284.1| hypothetical protein SELMODRAFT_105312, partial [Selaginella 
moellendorffii]
 gb|EFJ25663.1| hypothetical protein SELMODRAFT_99234, partial [Selaginella moellendorffii]
Length=60

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C S C  RCSKA + +RC+K+C +CC +CNCVP GT GNK++CPCY + KNSKG PKCP
Sbjct  2    CPSACDYRCSKASLHNRCIKFCNICCRKCNCVPPGTAGNKEKCPCYNNIKNSKGGPKCP  60



>gb|ABF94978.1| GAST1 protein precursor, putative [Oryza sativa Japonica Group]
Length=101

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSS-----FINPTHADSDF----CDSKCKVRCSKAGMMDRCLKYC  255
               +F  L LA +   S      F  P  A+       C  KC  RCS     + CLKYC
Sbjct  5    FSTIFLLLALAFVAEVSGSTNGGFYRPVGAEGSVSIEECPQKCDYRCSATKRQEPCLKYC  64

Query  256  GLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             +CC++C CVPSGT GNK+ECPCY + K+S+GN KCP
Sbjct  65   NICCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKCP  101



>ref|XP_003613435.1| GAST1 [Medicago truncatula]
Length=92

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +1

Query  94   FGKMKVVFAALILATLVLTSSFINPTHA-DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCE  270
              K    F  +++ T V+  ++     +     C  KC  RCSK      CL YC LCC 
Sbjct  1    MAKFICAFLFMLVITFVIQETYAGGEGSLRPQDCAPKCDYRCSKTSHRKACLTYCNLCCA  60

Query  271  ECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C CVPSGTYGNK ECPCY + +N  G PKCP
Sbjct  61   KCLCVPSGTYGNKQECPCYDNWRNKNGGPKCP  92



>ref|XP_006649745.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=101

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  CDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C  KC  RCS     + CLKYC +CC++C CVPSGTYG+K+ECPCY + K+S+GNPKCP
Sbjct  43   CPQKCDYRCSATKHREPCLKYCNICCQKCLCVPSGTYGHKEECPCYNNMKSSQGNPKCP  101



>ref|XP_006662142.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=104

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 46/96 (48%), Gaps = 0/96 (0%)
 Frame = +1

Query  79   PLQFMFGKMKVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCG  258
            P+ F    M  V          +   F        + C  KC  RCS       CL YC 
Sbjct  9    PIVFFLVAMSFVVVVSGQKNGAIYHLFGGEGSVTIEECPDKCNYRCSATSHTKACLTYCN  68

Query  259  LCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CCE C CVPSGTYGNK+ECPCY + K  +G PKCP
Sbjct  69   YCCERCLCVPSGTYGNKEECPCYNNLKTQEGKPKCP  104



>ref|XP_004517034.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = +1

Query  115  FAALILATLVLTSSFINPTHADSDF------CDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            F   IL  LV+  + I  T+A  +       C + C +RCS     + CL YC LCC +C
Sbjct  4    FVCAILLMLVMAFA-IKDTYAGKEGSLRPKECATACALRCSATQYKEACLTYCNLCCAKC  62

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYG+K+ECPCY + K  KG PKCP
Sbjct  63   LCVPSGTYGHKEECPCYNNWKTKKGGPKCP  92



>ref|XP_007163834.1| hypothetical protein PHAVU_001G268100g [Phaseolus vulgaris]
 gb|ESW35828.1| hypothetical protein PHAVU_001G268100g [Phaseolus vulgaris]
Length=92

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADS---DFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            K VF  L+++ +V  S         S     C   C+ RCSK  +   CL +C +CC++C
Sbjct  3    KFVFVLLLISLMVFVSQLAYGGGEGSLKPGECSKACEYRCSKTRIPTTCLHFCNMCCDKC  62

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYG+K+ECPCY + K+ +  PKCP
Sbjct  63   LCVPSGTYGHKEECPCYNNWKSRQRKPKCP  92



>ref|XP_007163594.1| hypothetical protein PHAVU_001G247600g [Phaseolus vulgaris]
 gb|ESW35588.1| hypothetical protein PHAVU_001G247600g [Phaseolus vulgaris]
Length=92

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADS---DFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            K VFA L++  +   S         S     C   C+ RCSKA +   CL +C +CC++C
Sbjct  3    KFVFAFLLIFLMAFVSELAYGGGEGSLKPGECPKACEYRCSKARIPTTCLHFCNMCCDKC  62

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYG+K+ECPCY + K+ +G  KCP
Sbjct  63   LCVPSGTYGHKEECPCYNNWKSKQGKSKCP  92



>ref|XP_002986081.1| hypothetical protein SELMODRAFT_123391 [Selaginella moellendorffii]
 gb|EFJ12900.1| hypothetical protein SELMODRAFT_123391 [Selaginella moellendorffii]
Length=69

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  160  INPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKK  339
            + PT +    C + C  RCSKAG+  RCLKYC +CC +C CVP GT GN++ CPCY + K
Sbjct  1    MYPTPSLLIDCAAACDYRCSKAGLHKRCLKYCNICCGKCQCVPPGTAGNREVCPCYNEMK  60

Query  340  NSKGNPKCP  366
            NS+G  KCP
Sbjct  61   NSRGGHKCP  69



>gb|EMS48664.1| hypothetical protein TRIUR3_03907 [Triticum urartu]
Length=85

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +1

Query  127  ILATLVLTSSFINPTHADSDFCDSKCKVRCSKA-GMMDRCLKYCGLCCEECNCVPSGTYG  303
            +L   +L +S +    A S FC  KC VRC ++      C+KYCGLCCEEC CVP+G  G
Sbjct  1    MLLVFLLAASLLPAGDAASGFCAGKCAVRCGRSRAKRGACMKYCGLCCEECACVPTGRSG  60

Query  304  N--KDECPCYRDKKNS--KGNPKCP  366
            +  +DECPCYRD   +  +  PKCP
Sbjct  61   SRXRDECPCYRDMLTAGPRKRPKCP  85



>gb|EEE58704.1| hypothetical protein OsJ_10147 [Oryza sativa Japonica Group]
Length=119

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 13/107 (12%)
 Frame = +1

Query  85   QFMFGKMKVVFAALILATL---------VLTSSFINPTHADSDF----CDSKCKVRCSKA  225
            Q+++   K  F   I                  F  P  A+       C  KC  RCS  
Sbjct  13   QYIYAGKKTEFLTRITLHFCSKPAEVSGSTNGGFYRPVGAEGSVSIEECPQKCDYRCSAT  72

Query  226  GMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
               + CLKYC +CC++C CVPSGT GNK+ECPCY + K+S+GN KCP
Sbjct  73   KRQEPCLKYCNICCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKCP  119



>ref|XP_010665102.1| PREDICTED: peamaclein-like [Vitis vinifera]
Length=97

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  109  VVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVP  288
            V+   +++  L   S  +   +A+   C SKC  RCSKAG    CL+ C  CCE CNCVP
Sbjct  12   VILCFVLVHELETKSGHLVTANAEKIDCKSKCAYRCSKAGWHKLCLRACNTCCERCNCVP  71

Query  289  SGTYGNKDECPCYRDKKNSKGNPKCP  366
             GT GN+D CPCY       G  KCP
Sbjct  72   PGTAGNEDVCPCYAKMTTHGGRHKCP  97



>ref|XP_006380659.1| hypothetical protein POPTR_0007s10250g [Populus trichocarpa]
 gb|ERP58456.1| hypothetical protein POPTR_0007s10250g [Populus trichocarpa]
Length=102

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  FCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            FCD KCK RC+KAG   RC  YC +CC++C CVPSGTYGNK ECPCYRDK NSKG  KCP
Sbjct  43   FCDPKCKARCAKAGYYQRCYDYCIICCKDCKCVPSGTYGNKSECPCYRDKLNSKGTSKCP  102



>gb|EEC74871.1| hypothetical protein OsI_10763 [Oryza sativa Indica Group]
Length=119

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 13/107 (12%)
 Frame = +1

Query  85   QFMFGKMKVVFAALILATL---------VLTSSFINPTHADSDF----CDSKCKVRCSKA  225
            Q+++   K  F   I                  F  P  A+       C  KC  RCS  
Sbjct  13   QYIYAGKKTEFLTRITLHFCSKPAEVSGSTNGGFYRPVGAEGSVSIEECPQKCDYRCSAT  72

Query  226  GMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
               + CLKYC +CC++C CVPSGT GNK+ECPCY + K+S+GN KCP
Sbjct  73   KRQEPCLKYCNVCCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKCP  119



>ref|XP_006601874.1| PREDICTED: gibberellin-regulated protein 12-like [Glycine max]
Length=92

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADS---DFCDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            K V A L++  +   +         S     C   C  RCSKA     CL +C LCC +C
Sbjct  3    KFVCALLLIFVMAFVTQVAYGGGEGSLTPQECPGACDYRCSKARARKACLYFCNLCCAKC  62

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYG+K+ECPCY + K +KG PKCP
Sbjct  63   LCVPSGTYGHKEECPCYNNWKTNKGTPKCP  92



>ref|XP_006296776.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
 gb|EOA29674.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
Length=91

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADS---DFCDSKCKVRCSKAGMMDRCLKYCGLCCEE  273
            M       I+ + +  + F N     S     C + C VRCS       CL YC  CC++
Sbjct  1    MAKFIVIFIVLSFLFATQFSNDGGEGSLTIAECPAACNVRCSATSHKKPCLFYCNYCCKK  60

Query  274  CNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            C CVPSGTYG+K+ECPCY + K  +G PKCP
Sbjct  61   CLCVPSGTYGHKEECPCYNNWKTQEGGPKCP  91



>ref|XP_006342570.1| PREDICTED: gibberellin-regulated protein 1-like [Solanum tuberosum]
Length=113

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  163  NPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKN  342
            NPT+  +  C + C+ RCS A     CL+ CG CC  CNCVP GT GN+D CPCYRD   
Sbjct  46   NPTYIPTSECGTACEARCSLASRHKMCLRACGTCCTRCNCVPPGTSGNQDLCPCYRDMLT  105

Query  343  SKGNPKCP  366
              G  KCP
Sbjct  106  HHGKHKCP  113



>ref|XP_011038137.1| PREDICTED: gibberellin-regulated protein 2 [Populus euphratica]
Length=91

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            K  F   IL  +++    I    A    C SKC+ RCSKA     C++ C  CC+ CNCV
Sbjct  5    KTTFILAILCLVLMHELQIYAVEAGDINCKSKCEYRCSKASRHKMCIRACNTCCQRCNCV  64

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            P GT GN+D CPCY +     G  KCP
Sbjct  65   PPGTSGNEDTCPCYANMTTHGGRHKCP  91



>ref|XP_006493084.1| PREDICTED: gibberellin-regulated protein 12-like [Citrus sinensis]
Length=95

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query  109  VVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVP  288
            V+F +++ A  V  +          + C S C  RCS     + C+++C +CC++C CVP
Sbjct  12   VLFLSVVFAVEVANAG--GEGSLKPEQCASACNYRCSATSHRNPCIEFCNMCCKKCLCVP  69

Query  289  SGTYGNKDECPCYRDKKNSKGNPKCP  366
            SGTYG+K+ECPCY + K  +G PKCP
Sbjct  70   SGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_002982001.1| hypothetical protein SELMODRAFT_115445 [Selaginella moellendorffii]
 gb|EFJ17094.1| hypothetical protein SELMODRAFT_115445 [Selaginella moellendorffii]
Length=69

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  160  INPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKK  339
            + PT +    C + C  RCSKAG+  RCLKYC +CC +C CVP GT GN++ C CY + K
Sbjct  1    MYPTPSVLIDCAAACDYRCSKAGLHKRCLKYCNICCGKCQCVPPGTAGNREVCACYNEMK  60

Query  340  NSKGNPKCP  366
            NS+G  KCP
Sbjct  61   NSRGGHKCP  69



>ref|XP_004982447.1| PREDICTED: snakin-1-like [Setaria italica]
Length=101

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +1

Query  157  FINPTHADSDFCDSKCKVRCSKAGMMDR--CLKYCGLCCEECNCVPSGTYGNKDECPCYR  330
            ++    A S FC SKC VRC +A    R  C++ CGLCCEECNCVP+G  G  +ECPCYR
Sbjct  28   WLQTAGAASGFCSSKCGVRCGRASARARGACMRTCGLCCEECNCVPTGARGGVNECPCYR  87

Query  331  D--KKNSKGNPKCP  366
            +      +  PKCP
Sbjct  88   NMLTAGPRKRPKCP  101



>gb|KDO41153.1| hypothetical protein CISIN_1g041400mg [Citrus sinensis]
Length=95

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query  109  VVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCVP  288
            V+F +++ A  V  +          + C S C  RCS     + C+++C +CC++C CVP
Sbjct  12   VLFLSVVFAVEVANAG--GEGSLKPEQCASACNYRCSATSHRNPCIEFCNMCCKKCLCVP  69

Query  289  SGTYGNKDECPCYRDKKNSKGNPKCP  366
            SGTYG+K+ECPCY + K  +G PKCP
Sbjct  70   SGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_003613456.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES96414.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +1

Query  94   FGKMKVVFAALILATLVLTSSFINPTHA-DSDFCDSKCKVRCSKAGMMDRCLKYCGLCCE  270
              K+   F  +++ + V+   +     +   + C + C VRCS       CL YC  CC 
Sbjct  1    MAKLVCAFLFMLVTSFVIQDVYAGGEGSLKPEECSAACDVRCSATMYKKACLTYCNYCCA  60

Query  271  ECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
            +C CVPSGTYG+K+ECPCY + K  +G PKCP
Sbjct  61   KCLCVPSGTYGHKEECPCYANLKTHEGGPKCP  92



>ref|XP_006376297.1| hypothetical protein POPTR_0013s11770g [Populus trichocarpa]
 gb|ERP54094.1| hypothetical protein POPTR_0013s11770g [Populus trichocarpa]
Length=91

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  106  KVVFAALILATLVLTSSFINPTHADSDFCDSKCKVRCSKAGMMDRCLKYCGLCCEECNCV  285
            K  F   IL   ++    I    A    C SKC+ RCSKA     C++ C  CC+ CNCV
Sbjct  5    KTTFILAILCLALMHELQIRTVEAGKINCKSKCEYRCSKASRHKMCIRACNTCCQRCNCV  64

Query  286  PSGTYGNKDECPCYRDKKNSKGNPKCP  366
            P GT GN+D CPCY +     G  KCP
Sbjct  65   PPGTSGNEDTCPCYANMTTHGGRHKCP  91



>ref|XP_004517033.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 51/90 (57%), Gaps = 7/90 (8%)
 Frame = +1

Query  115  FAALILATLVLTSSFINPTHADSDF------CDSKCKVRCSKAGMMDRCLKYCGLCCEEC  276
            F   IL  LV+  + IN T+A  +       C + C  RCS       CL YC LCC +C
Sbjct  4    FVCAILLMLVMAFA-INDTYAGKEGSLRPEECAAACDQRCSATQYKKACLTYCNLCCAKC  62

Query  277  NCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
             CVPSGTYG+K+EC CY + K  +G PKCP
Sbjct  63   LCVPSGTYGHKEECACYNNWKTKEGGPKCP  92



>ref|XP_009106131.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
 emb|CDY18069.1| BnaA01g23300D [Brassica napus]
Length=104

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 49/104 (47%), Gaps = 16/104 (15%)
 Frame = +1

Query  103  MKVVFAALILATLVLTSSFINPTHADSDF----------------CDSKCKVRCSKAGMM  234
            M      LI+ + +  + F N    +                   C + C VRCS     
Sbjct  1    MTKFITVLIVFSFLFATQFSNANELEYSSESIHTEGGEGSVKIGDCPAACDVRCSATSHK  60

Query  235  DRCLKYCGLCCEECNCVPSGTYGNKDECPCYRDKKNSKGNPKCP  366
              CL YC  CC++C CVPSGTYGNK ECPCY + K  +G PKCP
Sbjct  61   SACLMYCNQCCKKCLCVPSGTYGNKQECPCYNNWKTQEGGPKCP  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1426075485344