BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30820_g1_i1 len=782 path=[760:0-781]

Length=782
                                                                      Score     E

ref|XP_002277794.1|  PREDICTED: EH domain-containing protein 1          403   1e-134   Vitis vinifera
ref|XP_004149345.1|  PREDICTED: EH domain-containing protein 1-like     402   2e-134   
emb|CAN67909.1|  hypothetical protein VITISV_034695                     402   2e-134   Vitis vinifera
ref|XP_010913401.1|  PREDICTED: EH domain-containing protein 1-like     399   4e-133   
ref|XP_010270065.1|  PREDICTED: EH domain-containing protein 1          399   6e-133   
ref|XP_011046717.1|  PREDICTED: EH domain-containing protein 3          398   9e-133   
ref|XP_006452453.1|  hypothetical protein CICLE_v10007883mg             394   1e-132   
ref|XP_008449138.1|  PREDICTED: EH domain-containing protein 1          398   1e-132   
ref|XP_008805597.1|  PREDICTED: EH domain-containing protein 1-li...    398   1e-132   
ref|XP_008805595.1|  PREDICTED: EH domain-containing protein 1-li...    397   1e-132   
ref|XP_010252586.1|  PREDICTED: EH domain-containing protein 1-li...    394   2e-132   
ref|XP_008805596.1|  PREDICTED: EH domain-containing protein 1-li...    397   2e-132   
ref|XP_010063047.1|  PREDICTED: EH domain-containing protein 1          397   2e-132   
ref|XP_010096102.1|  EH domain-containing protein 1                     397   3e-132   
gb|KDO62119.1|  hypothetical protein CISIN_1g009050mg                   397   4e-132   
gb|EYU27376.1|  hypothetical protein MIMGU_mgv1a004087mg                397   4e-132   
gb|KDP39189.1|  hypothetical protein JCGZ_00946                         396   5e-132   
ref|XP_011095452.1|  PREDICTED: EH domain-containing protein 1-like     396   7e-132   
ref|XP_006475006.1|  PREDICTED: EH domain-containing protein 3-like     395   1e-131   
gb|KCW70227.1|  hypothetical protein EUGRSUZ_F03500                     397   1e-131   
ref|XP_010252585.1|  PREDICTED: EH domain-containing protein 1-li...    394   2e-131   
ref|XP_006829517.1|  hypothetical protein AMTR_s00074p00139810          394   3e-131   
ref|XP_006452452.1|  hypothetical protein CICLE_v10007883mg             394   6e-131   
gb|KGN56098.1|  hypothetical protein Csa_3G073890                       392   2e-130   
ref|XP_002531194.1|  EH-domain-containing protein, putative             392   3e-130   Ricinus communis
ref|XP_002885363.1|  calcium-binding EF hand family protein             391   5e-130   
ref|XP_004294399.1|  PREDICTED: EH domain-containing protein 1-like     391   7e-130   
dbj|BAB02809.1|  unnamed protein product                                390   8e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13787.1|  unnamed protein product                                390   1e-129   
ref|NP_566657.1|  EPS15 homology domain 1 protein                       390   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009603511.1|  PREDICTED: EH domain-containing protein 1-li...    387   2e-129   
ref|XP_008799457.1|  PREDICTED: EH domain-containing protein 1-like     389   3e-129   
ref|XP_007020711.1|  EPS15 domain 1                                     389   3e-129   
ref|XP_010544277.1|  PREDICTED: EH domain-containing protein 1          389   4e-129   
ref|XP_010090952.1|  EH domain-containing protein 1                     388   4e-129   
ref|XP_006646902.1|  PREDICTED: EH domain-containing protein 1-like     389   5e-129   
ref|XP_010508763.1|  PREDICTED: EH domain-containing protein 1-like     389   6e-129   
ref|XP_009589164.1|  PREDICTED: EH domain-containing protein 1-li...    385   6e-129   
gb|KHG22957.1|  EH domain-containing 1                                  385   7e-129   
gb|EYU33672.1|  hypothetical protein MIMGU_mgv1a004199mg                387   1e-128   
ref|XP_009393691.1|  PREDICTED: EH domain-containing protein 1-like     387   2e-128   
ref|XP_004491428.1|  PREDICTED: EH domain-containing protein 3-like     387   2e-128   
ref|XP_004966283.1|  PREDICTED: EH domain-containing protein 1-like     387   2e-128   
ref|XP_006344871.1|  PREDICTED: EH domain-containing protein 1-like     387   3e-128   
ref|XP_010313928.1|  PREDICTED: EH domain-containing protein 3-like     387   3e-128   
ref|XP_009603507.1|  PREDICTED: EH domain-containing protein 1-li...    387   3e-128   
ref|XP_006406402.1|  hypothetical protein EUTSA_v10020459mg             383   3e-128   
emb|CDY50093.1|  BnaC01g32680D                                          386   4e-128   
ref|NP_001045954.1|  Os02g0158100                                       386   4e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296699.1|  hypothetical protein CARUB_v10013398mg             386   4e-128   
ref|XP_009776641.1|  PREDICTED: EH domain-containing protein 1 is...    383   6e-128   
ref|XP_002437485.1|  hypothetical protein SORBIDRAFT_10g027960          386   6e-128   Sorghum bicolor [broomcorn]
ref|XP_009598340.1|  PREDICTED: EH domain-containing protein 1-li...    383   6e-128   
ref|XP_009589162.1|  PREDICTED: EH domain-containing protein 1-li...    385   7e-128   
ref|XP_008644157.1|  PREDICTED: uncharacterized protein LOC100384...    385   8e-128   
emb|CDY25408.1|  BnaA05g18760D                                          385   8e-128   
ref|XP_003617631.1|  EH-domain-containing protein                       385   8e-128   
ref|XP_009779286.1|  PREDICTED: EH domain-containing protein 1-li...    382   9e-128   
emb|CDY50090.1|  BnaC01g32650D                                          386   1e-127   
ref|XP_009779284.1|  PREDICTED: EH domain-containing protein 1-li...    382   1e-127   
ref|XP_009770780.1|  PREDICTED: EH domain-containing protein 1-li...    381   1e-127   
ref|XP_009770779.1|  PREDICTED: EH domain-containing protein 1-li...    382   1e-127   
ref|XP_009361045.1|  PREDICTED: EH domain-containing protein 1-like     385   1e-127   
ref|XP_009334157.1|  PREDICTED: EH domain-containing protein 1-like     385   1e-127   
ref|XP_009111206.1|  PREDICTED: EH domain-containing protein 1-li...    382   1e-127   
ref|XP_009348303.1|  PREDICTED: EH domain-containing protein 1-like     385   2e-127   
ref|XP_010466211.1|  PREDICTED: EH domain-containing protein 1-like     385   2e-127   
ref|XP_008359253.1|  PREDICTED: EH domain-containing protein 1-like     385   2e-127   
ref|XP_008226997.1|  PREDICTED: EH domain-containing protein 1          384   2e-127   
ref|XP_010665753.1|  PREDICTED: EH domain-containing protein 1-like     384   2e-127   
ref|XP_007213895.1|  hypothetical protein PRUPE_ppa003834mg             384   2e-127   
ref|XP_003574764.1|  PREDICTED: EH domain-containing protein 1-like     384   2e-127   
ref|XP_002264320.1|  PREDICTED: EH domain-containing protein 3-like     384   4e-127   Vitis vinifera
ref|XP_009770782.1|  PREDICTED: EH domain-containing protein 1-li...    383   5e-127   
ref|XP_006406401.1|  hypothetical protein EUTSA_v10020459mg             384   5e-127   
ref|XP_009776638.1|  PREDICTED: EH domain-containing protein 1 is...    383   6e-127   
ref|XP_009598338.1|  PREDICTED: EH domain-containing protein 1-li...    383   6e-127   
ref|XP_007154000.1|  hypothetical protein PHAVU_003G082600g             383   7e-127   
gb|AFK42442.1|  unknown                                                 383   7e-127   
ref|XP_009598337.1|  PREDICTED: EH domain-containing protein 1-li...    383   7e-127   
ref|XP_009776639.1|  PREDICTED: EH domain-containing protein 1 is...    383   8e-127   
ref|XP_002453335.1|  hypothetical protein SORBIDRAFT_04g004020          383   8e-127   Sorghum bicolor [broomcorn]
gb|EMT01492.1|  EH domain-containing protein 1                          383   8e-127   
emb|CBI35707.3|  unnamed protein product                                384   9e-127   
ref|XP_009145649.1|  PREDICTED: EH domain-containing protein 1 is...    382   1e-126   
ref|XP_009145648.1|  PREDICTED: EH domain-containing protein 1 is...    382   1e-126   
ref|XP_009145651.1|  PREDICTED: EH domain-containing protein 1 is...    382   1e-126   
ref|XP_009145650.1|  PREDICTED: EH domain-containing protein 1 is...    382   1e-126   
ref|XP_009770776.1|  PREDICTED: EH domain-containing protein 1-li...    382   1e-126   
ref|XP_009111201.1|  PREDICTED: EH domain-containing protein 1-li...    382   2e-126   
ref|XP_003529656.1|  PREDICTED: EH domain-containing protein 1-like     382   2e-126   
ref|XP_010324305.1|  PREDICTED: EH domain-containing protein 1-li...    382   2e-126   
ref|XP_009779278.1|  PREDICTED: EH domain-containing protein 1-li...    382   2e-126   
ref|XP_004951833.1|  PREDICTED: EH domain-containing protein 1-like     384   2e-126   
ref|XP_010324304.1|  PREDICTED: EH domain-containing protein 1-li...    382   2e-126   
ref|XP_010052899.1|  PREDICTED: EH domain-containing protein 1-li...    382   2e-126   
ref|XP_010928404.1|  PREDICTED: EH domain-containing protein 1-like     382   3e-126   
emb|CDY29816.1|  BnaC05g31740D                                          381   3e-126   
ref|XP_006346193.1|  PREDICTED: EH domain-containing protein 1-like     381   3e-126   
ref|XP_004157728.1|  PREDICTED: EH domain-containing protein 1-like     381   3e-126   
ref|XP_008458980.1|  PREDICTED: EH domain-containing protein 1          381   4e-126   
dbj|BAJ86819.1|  predicted protein                                      381   4e-126   
ref|XP_003563453.1|  PREDICTED: EH domain-containing protein 1-like     381   4e-126   
ref|XP_010422242.1|  PREDICTED: EH domain-containing protein 1-like     377   4e-126   
ref|XP_004145425.1|  PREDICTED: EH domain-containing protein 1-like     381   4e-126   
ref|XP_007142331.1|  hypothetical protein PHAVU_008G271300g             381   5e-126   
ref|XP_003550477.1|  PREDICTED: EH domain-containing protein 1-like     381   5e-126   
dbj|BAJ95881.1|  predicted protein                                      380   1e-125   
ref|XP_011097835.1|  PREDICTED: EH domain-containing protein 1-li...    380   1e-125   
ref|XP_011097837.1|  PREDICTED: EH domain-containing protein 1-li...    380   1e-125   
ref|XP_006287437.1|  hypothetical protein CARUB_v10000641mg             380   1e-125   
gb|KHN03510.1|  EH domain-containing protein 1                          380   1e-125   
gb|EPS68571.1|  hypothetical protein M569_06192                         379   2e-125   
ref|XP_003610495.1|  EH-domain-containing protein                       379   2e-125   
gb|KHN38249.1|  EH domain-containing protein 1                          379   2e-125   
gb|KDP20684.1|  hypothetical protein JCGZ_21155                         379   2e-125   
ref|NP_001140588.1|  uncharacterized protein LOC100272658               379   3e-125   Zea mays [maize]
ref|XP_003519595.1|  PREDICTED: EH domain-containing protein 1-like     379   3e-125   
ref|XP_002874791.1|  calcium-binding EF hand family protein             379   3e-125   
ref|XP_010455720.1|  PREDICTED: EH domain-containing protein 1-li...    378   4e-125   
ref|NP_567299.2|  EPS15 homology domain 2 protein                       379   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974517.1|  EPS15 homology domain 2 protein                       378   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058410.1|  Os06g0687800                                       378   5e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455719.1|  PREDICTED: EH domain-containing protein 1-li...    378   6e-125   
gb|EMT05303.1|  EH domain-containing protein 1                          378   6e-125   
gb|EMS68080.1|  EH domain-containing protein 1                          378   7e-125   
ref|XP_010433113.1|  PREDICTED: EH domain-containing protein 1-li...    378   7e-125   
ref|XP_010433120.1|  PREDICTED: EH domain-containing protein 1-li...    378   7e-125   
gb|EAZ02155.1|  hypothetical protein OsI_24244                          378   8e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_004507655.1|  PREDICTED: EH domain-containing protein 1-li...    377   9e-125   
ref|XP_009357511.1|  PREDICTED: EH domain-containing protein 1-li...    375   1e-124   
ref|NP_001266688.1|  EH-domain-containing protein 1                     377   1e-124   
ref|XP_006657273.1|  PREDICTED: EH domain-containing protein 1-like     377   2e-124   
gb|KHN28769.1|  EH domain-containing protein 1                          385   2e-124   
ref|XP_007211540.1|  hypothetical protein PRUPE_ppa003972mg             376   3e-124   
ref|XP_004500109.1|  PREDICTED: EH domain-containing protein 1-like     376   3e-124   
ref|XP_006352528.1|  PREDICTED: EH domain-containing protein 1-li...    376   3e-124   
ref|XP_006352527.1|  PREDICTED: EH domain-containing protein 1-li...    376   4e-124   
emb|CDX94536.1|  BnaC09g23000D                                          375   6e-124   
ref|XP_009114592.1|  PREDICTED: EH domain-containing protein 1 is...    375   8e-124   
ref|XP_008384122.1|  PREDICTED: EH domain-containing protein 1-like     375   8e-124   
emb|CDY16689.1|  BnaA09g20670D                                          375   8e-124   
ref|XP_009357509.1|  PREDICTED: EH domain-containing protein 1-li...    375   8e-124   
ref|XP_008224739.1|  PREDICTED: EH domain-containing protein 1-like     375   1e-123   
ref|XP_004293342.1|  PREDICTED: EH domain-containing protein 1-like     375   1e-123   
ref|XP_009114593.1|  PREDICTED: EH domain-containing protein 1 is...    375   1e-123   
gb|KFK39351.1|  hypothetical protein AALP_AA3G233100                    374   2e-123   
ref|XP_009390979.1|  PREDICTED: EH domain-containing protein 1-li...    374   2e-123   
ref|XP_010675784.1|  PREDICTED: EH domain-containing protein 1-like     374   2e-123   
ref|XP_009390978.1|  PREDICTED: EH domain-containing protein 1-li...    374   2e-123   
ref|XP_006449830.1|  hypothetical protein CICLE_v10014814mg             374   2e-123   
ref|XP_002316591.2|  calcium-binding EF hand family protein             373   3e-123   Populus trichocarpa [western balsam poplar]
ref|XP_009390977.1|  PREDICTED: EH domain-containing protein 1-li...    374   3e-123   
gb|KDO78396.1|  hypothetical protein CISIN_1g008954mg                   374   3e-123   
gb|KFK32206.1|  hypothetical protein AALP_AA6G211000                    374   3e-123   
ref|XP_010538746.1|  PREDICTED: EH domain-containing protein 1 is...    374   3e-123   
ref|XP_011000650.1|  PREDICTED: EH domain-containing protein 1-like     374   3e-123   
ref|XP_004486203.1|  PREDICTED: EH domain-containing protein 1-like     374   4e-123   
ref|XP_010538744.1|  PREDICTED: EH domain-containing protein 1 is...    374   4e-123   
ref|XP_002518408.1|  EH-domain-containing protein, putative             373   5e-123   Ricinus communis
ref|XP_006396726.1|  hypothetical protein EUTSA_v10028561mg             373   5e-123   
gb|AIE88276.1|  hypothetical protein OG_BBa0063K01.7                    371   6e-123   
ref|XP_006602183.1|  PREDICTED: EH domain-containing protein 1-like     372   8e-123   
ref|XP_003594167.1|  EH-domain-containing protein                       372   1e-122   
ref|XP_009401415.1|  PREDICTED: EH domain-containing protein 1-like     372   1e-122   
gb|KHG01502.1|  EH domain-containing 1                                  369   2e-122   
ref|XP_003547274.1|  PREDICTED: EH domain-containing protein 1-like     371   3e-122   
ref|NP_001054202.1|  Os04g0669300                                       371   4e-122   Oryza sativa Japonica Group [Japonica rice]
gb|KEH33921.1|  EPS15-like domain protein                               371   4e-122   
emb|CDP04464.1|  unnamed protein product                                372   4e-122   
ref|XP_007026228.1|  EPS15 domain 2 isoform 4                           371   5e-122   
ref|XP_002970092.1|  hypothetical protein SELMODRAFT_92582              370   5e-122   
ref|XP_007147670.1|  hypothetical protein PHAVU_006G144500g             370   5e-122   
ref|XP_001784382.1|  predicted protein                                  370   5e-122   
gb|AEV41063.1|  putative EH-domain-containing protein 1                 370   6e-122   
ref|XP_007026225.1|  EPS15 domain 2 isoform 1                           370   6e-122   
ref|XP_010327191.1|  PREDICTED: EH domain-containing protein 1-like     370   6e-122   
gb|AEV41109.1|  putative EH-domain-containing protein 1                 370   6e-122   
ref|XP_007026226.1|  EPS15 domain 2 isoform 2                           370   6e-122   
gb|AEV40966.1|  putative EH-domain-containing protein 1                 370   7e-122   
ref|XP_002985283.1|  hypothetical protein SELMODRAFT_121714             370   7e-122   
ref|XP_006467361.1|  PREDICTED: EH domain-containing protein 1-like     370   8e-122   
ref|XP_006652990.1|  PREDICTED: EH domain-containing protein 1-like     369   2e-121   
gb|AEV41016.1|  putative EH-domain-containing protein 1                 368   6e-121   
ref|XP_006586764.1|  PREDICTED: EH domain-containing protein 1-like     367   7e-121   
gb|KHN40844.1|  EH domain-containing protein 1                          367   7e-121   
ref|XP_001772546.1|  predicted protein                                  367   1e-120   
ref|XP_009398680.1|  PREDICTED: EH domain-containing protein 1-like     366   3e-120   
ref|XP_002447292.1|  hypothetical protein SORBIDRAFT_06g032210          365   5e-120   Sorghum bicolor [broomcorn]
ref|XP_009776640.1|  PREDICTED: EH domain-containing protein 1 is...    364   1e-119   
ref|XP_009598339.1|  PREDICTED: EH domain-containing protein 1-li...    364   1e-119   
tpg|DAA35457.1|  TPA: hypothetical protein ZEAMMB73_021494              363   4e-119   
ref|NP_001167939.1|  uncharacterized protein LOC100381653               363   4e-119   Zea mays [maize]
ref|XP_004507654.1|  PREDICTED: EH domain-containing protein 1-li...    364   4e-119   
ref|XP_007145728.1|  hypothetical protein PHAVU_007G262900g             362   8e-119   
gb|KEH33927.1|  calcium-binding EF hand protein                         357   5e-118   
ref|XP_011096032.1|  PREDICTED: EH domain-containing protein 1-like     360   9e-118   
ref|XP_009334827.1|  PREDICTED: EH domain-containing protein 1-li...    358   2e-117   
ref|XP_003579456.1|  PREDICTED: EH domain-containing protein 1-like     358   5e-117   
ref|XP_009334825.1|  PREDICTED: EH domain-containing protein 1-li...    359   6e-117   
ref|XP_009334826.1|  PREDICTED: EH domain-containing protein 1-li...    358   9e-117   
ref|XP_010675794.1|  PREDICTED: EH domain-containing protein 1-like     353   1e-116   
ref|XP_007026227.1|  EPS15 domain 2 isoform 3                           357   3e-116   
gb|EYU27756.1|  hypothetical protein MIMGU_mgv1a004743mg                352   3e-115   
ref|XP_009352442.1|  PREDICTED: EH domain-containing protein 1-like     352   6e-115   
ref|XP_010487999.1|  PREDICTED: EH domain-containing protein 1-like     352   7e-115   
ref|XP_008370549.1|  PREDICTED: EH domain-containing protein 1-like     349   2e-114   
emb|CAJ86083.1|  H0818H01.5                                             351   3e-114   Oryza sativa [red rice]
ref|XP_007145730.1|  hypothetical protein PHAVU_007G263100g             348   2e-113   
gb|KHG30640.1|  EH domain-containing 1                                  347   1e-112   
ref|XP_009626939.1|  PREDICTED: EH domain-containing protein 1-like     346   2e-112   
ref|XP_002985697.1|  hypothetical protein SELMODRAFT_122705             345   4e-112   
ref|XP_009769722.1|  PREDICTED: EH domain-containing protein 1-like     345   7e-112   
ref|XP_004250246.1|  PREDICTED: EH domain-containing protein 1-like     344   8e-112   
ref|XP_002974220.1|  hypothetical protein SELMODRAFT_414547             344   1e-111   
ref|XP_006352380.1|  PREDICTED: EH domain-containing protein 1-like     340   3e-110   
gb|KCW77036.1|  hypothetical protein EUGRSUZ_D01382                     328   1e-106   
ref|XP_010054613.1|  PREDICTED: EH domain-containing protein 1-like     330   3e-106   
emb|CDO98110.1|  unnamed protein product                                327   5e-105   
ref|XP_002298819.2|  hypothetical protein POPTR_0001s36630g             324   3e-104   Populus trichocarpa [western balsam poplar]
ref|NP_001170407.1|  uncharacterized protein LOC100384394               310   2e-103   Zea mays [maize]
ref|XP_009779289.1|  PREDICTED: EH domain-containing protein 1-like     308   7e-103   
ref|XP_010042271.1|  PREDICTED: EH domain-containing protein 1-like     313   1e-102   
gb|EMT24958.1|  EH domain-containing protein 1                          312   3e-100   
ref|XP_007026229.1|  EPS15 domain 2 isoform 5                           304   1e-96    
gb|ABR16762.1|  unknown                                                 292   2e-96    Picea sitchensis
ref|XP_005643284.1|  hypothetical protein COCSUDRAFT_38543              286   2e-89    
ref|XP_002966377.1|  hypothetical protein SELMODRAFT_85478              278   8e-88    
ref|XP_002978188.1|  hypothetical protein SELMODRAFT_108442             278   8e-88    
ref|XP_009402015.1|  PREDICTED: EH domain-containing protein 1-like     277   3e-86    
gb|AAD48968.1|AF147263_10  contains similarity to Pfam family PF0...    274   6e-85    Arabidopsis thaliana [mouse-ear cress]
gb|KDD73486.1|  hypothetical protein H632_c2126p0                       253   3e-78    
ref|XP_002499973.1|  predicted protein                                  253   1e-77    Micromonas commoda
gb|KFM29283.1|  EH domain-containing protein 1                          256   4e-77    
gb|EIE86499.1|  hypothetical protein RO3G_11210                         252   3e-76    
gb|ELT99462.1|  hypothetical protein CAPTEDRAFT_108382                  252   3e-76    
emb|CCI42136.1|  unnamed protein product                                252   3e-76    
gb|ABI13180.1|  hypothetical protein                                    248   8e-76    Emiliania huxleyi
ref|XP_003055188.1|  predicted protein                                  251   9e-76    
ref|XP_004365433.1|  past-1                                             250   2e-75    
ref|XP_010016866.1|  PREDICTED: EH domain-containing protein 4          248   3e-75    
gb|KFQ44554.1|  EH domain-containing protein 4                          247   4e-75    
ref|XP_010078610.1|  PREDICTED: EH domain-containing protein 4          245   4e-75    
gb|KFV12676.1|  EH domain-containing protein 4                          245   4e-75    
ref|XP_008870165.1|  hypothetical protein H310_06767                    248   5e-75    
ref|XP_007115392.1|  PREDICTED: EH domain-containing protein 4          244   6e-75    
ref|XP_010194597.1|  PREDICTED: EH domain-containing protein 4          247   1e-74    
gb|KFP29463.1|  EH domain-containing protein 4                          246   1e-74    
ref|XP_009997919.1|  PREDICTED: EH domain-containing protein 4          246   1e-74    
gb|EHJ75206.1|  past-1                                                  245   1e-74    
ref|XP_005143974.1|  PREDICTED: EH domain-containing protein 4          248   1e-74    
ref|XP_005860350.1|  PREDICTED: EH domain-containing protein 4          246   1e-74    
gb|KFU91131.1|  EH domain-containing protein 4                          246   1e-74    
gb|KFQ19842.1|  EH domain-containing protein 4                          244   2e-74    
ref|XP_008943007.1|  PREDICTED: EH domain-containing protein 4          244   2e-74    
ref|XP_005438833.1|  PREDICTED: EH domain-containing protein 4          246   2e-74    
emb|CEG64411.1|  hypothetical protein RMATCC62417_01389                 247   3e-74    
ref|XP_004481540.1|  PREDICTED: EH domain-containing protein 4          247   3e-74    
gb|KFV09622.1|  EH domain-containing protein 4                          245   3e-74    
ref|XP_005780580.1|  RME1A, RME-1/EHD family protein                    248   3e-74    
ref|XP_009976813.1|  PREDICTED: EH domain-containing protein 4          245   3e-74    
ref|XP_009819162.1|  PREDICTED: EH domain-containing protein 4          245   4e-74    
ref|XP_003774169.1|  PREDICTED: EH domain-containing protein 1          243   4e-74    
ref|XP_009822927.1|  hypothetical protein H257_01428                    246   4e-74    
gb|KGL79408.1|  EH domain-containing protein 4                          244   4e-74    
gb|KFV40206.1|  EH domain-containing protein 4                          244   4e-74    
ref|XP_003480447.1|  PREDICTED: EH domain-containing protein 4          242   5e-74    
ref|XP_010987578.1|  PREDICTED: EH domain-containing protein 4          244   5e-74    
ref|XP_010160386.1|  PREDICTED: EH domain-containing protein 4          244   5e-74    
ref|XP_009708214.1|  PREDICTED: EH domain-containing protein 4          244   5e-74    
gb|KFZ52861.1|  EH domain-containing protein 4                          244   6e-74    
gb|KFP61900.1|  EH domain-containing protein 4                          244   6e-74    
gb|KFW63762.1|  EH domain-containing protein 4                          244   7e-74    
gb|KDO25885.1|  hypothetical protein SPRG_08827                         245   9e-74    
ref|XP_006178915.1|  PREDICTED: EH domain-containing protein 4          244   9e-74    
ref|XP_004751230.1|  PREDICTED: EH domain-containing protein 4          246   1e-73    
ref|XP_009317530.1|  PREDICTED: EH domain-containing protein 4          244   1e-73    
ref|XP_010285892.1|  PREDICTED: EH domain-containing protein 4          243   1e-73    
ref|XP_009638548.1|  PREDICTED: EH domain-containing protein 4          244   1e-73    
ref|XP_009944909.1|  PREDICTED: EH domain-containing protein 4          243   1e-73    
ref|XP_008498509.1|  PREDICTED: EH domain-containing protein 4          244   1e-73    
gb|KFQ75454.1|  EH domain-containing protein 4                          243   1e-73    
gb|KFP17185.1|  EH domain-containing protein 4                          243   1e-73    
ref|XP_009100301.1|  PREDICTED: EH domain-containing protein 4          243   1e-73    
gb|EPB88290.1|  hypothetical protein HMPREF1544_04874                   245   1e-73    
ref|XP_005685580.1|  PREDICTED: EH domain-containing protein 4          244   1e-73    
gb|KFQ06632.1|  EH domain-containing protein 4                          243   1e-73    
ref|XP_009275888.1|  PREDICTED: EH domain-containing protein 4          243   1e-73    
ref|XP_008141256.1|  PREDICTED: EH domain-containing protein 4          245   1e-73    
ref|XP_007536541.1|  PREDICTED: EH domain-containing protein 4          245   2e-73    
ref|XP_009491400.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
ref|XP_010303846.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
dbj|GAA28369.2|  EH domain-containing protein 4                         246   2e-73    
gb|KFM06361.1|  EH domain-containing protein 4                          243   2e-73    
ref|XP_006093124.1|  PREDICTED: EH domain-containing protein 4          245   2e-73    
gb|KFO12378.1|  EH domain-containing protein 4                          243   2e-73    
ref|XP_005231616.1|  PREDICTED: EH domain-containing protein 4          246   2e-73    
ref|XP_004056086.1|  PREDICTED: EH domain-containing protein 4-like     241   2e-73    
ref|XP_009926813.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
ref|XP_010132463.1|  PREDICTED: EH domain-containing protein 4          240   2e-73    
ref|XP_009574894.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
gb|KFW03891.1|  EH domain-containing protein 4                          243   2e-73    
gb|KFR07234.1|  EH domain-containing protein 4                          243   2e-73    
gb|KFQ58277.1|  EH domain-containing protein 4                          243   2e-73    
gb|KFV43089.1|  EH domain-containing protein 4                          243   2e-73    
gb|KFO88536.1|  EH domain-containing protein 4                          240   2e-73    
ref|XP_005502466.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
ref|XP_010151488.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
ref|XP_010578501.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
ref|XP_005480269.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
gb|ELR57574.1|  EH domain-containing protein 1                          241   2e-73    
gb|KFQ11660.1|  EH domain-containing protein 4                          243   2e-73    
gb|KFP54845.1|  EH domain-containing protein 4                          243   2e-73    
ref|XP_009970978.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
gb|KFZ65648.1|  EH domain-containing protein 4                          243   2e-73    
gb|KFV93705.1|  EH domain-containing protein 4                          243   2e-73    
emb|CEJ02932.1|  hypothetical protein RMCBS344292_16924                 240   2e-73    
ref|XP_005419595.1|  PREDICTED: EH domain-containing protein 4          243   2e-73    
ref|XP_005894142.1|  PREDICTED: EH domain-containing protein 1          241   2e-73    
gb|KFP05853.1|  EH domain-containing protein 4                          244   2e-73    
ref|XP_005978480.1|  PREDICTED: EH domain-containing protein 4          244   2e-73    
ref|XP_007055830.1|  PREDICTED: EH domain-containing protein 4          242   3e-73    
ref|NP_001178982.1|  EH domain-containing protein 4                     244   3e-73    
ref|XP_004609647.1|  PREDICTED: EH domain-containing protein 4          244   3e-73    
ref|XP_008049496.1|  PREDICTED: EH domain-containing protein 1          239   3e-73    
ref|XP_010187051.1|  PREDICTED: EH domain-containing protein 4          242   3e-73    
ref|XP_004010522.1|  PREDICTED: EH domain-containing protein 4          244   3e-73    
ref|XP_004321137.1|  PREDICTED: EH domain-containing protein 4          244   3e-73    
ref|XP_003791796.1|  PREDICTED: EH domain-containing protein 4          244   3e-73    
ref|XP_007081848.1|  PREDICTED: EH domain-containing protein 4          244   3e-73    
gb|KFQ38745.1|  EH domain-containing protein 4                          242   4e-73    
ref|XP_006736705.1|  PREDICTED: EH domain-containing protein 4          243   4e-73    
gb|KFV86317.1|  EH domain-containing protein 4                          242   4e-73    
ref|XP_009472149.1|  PREDICTED: EH domain-containing protein 4          243   4e-73    
ref|XP_004400455.1|  PREDICTED: EH domain-containing protein 4          244   4e-73    
ref|XP_008618010.1|  hypothetical protein SDRG_13692                    244   4e-73    
ref|XP_008046657.1|  PREDICTED: EH domain-containing protein 4          244   4e-73    
ref|XP_004709424.1|  PREDICTED: EH domain-containing protein 4          244   4e-73    
ref|XP_003641397.2|  PREDICTED: EH domain-containing protein 4          243   4e-73    
ref|XP_010963486.1|  PREDICTED: EH domain-containing protein 4          244   4e-73    
ref|XP_008418633.1|  PREDICTED: EH domain-containing protein 1-li...    241   4e-73    
ref|XP_004687941.1|  PREDICTED: EH domain-containing protein 4          244   4e-73    
ref|XP_006130426.1|  PREDICTED: EH domain-containing protein 4          243   4e-73    
ref|XP_003987301.1|  PREDICTED: EH domain-containing protein 4          244   5e-73    
gb|KGL95706.1|  EH domain-containing protein 4                          242   5e-73    
ref|XP_004274008.1|  PREDICTED: EH domain-containing protein 4          244   5e-73    
ref|XP_009682975.1|  PREDICTED: EH domain-containing protein 4          243   5e-73    
ref|XP_010216053.1|  PREDICTED: EH domain-containing protein 4          245   5e-73    
ref|XP_002913248.1|  PREDICTED: EH domain-containing protein 4-like     244   5e-73    
ref|XP_009568342.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    242   5e-73    
ref|XP_009897284.1|  PREDICTED: EH domain-containing protein 4          242   5e-73    
gb|KFV66207.1|  EH domain-containing protein 4                          242   5e-73    
ref|XP_005700037.1|  PREDICTED: EH domain-containing protein 1          241   6e-73    
ref|XP_008530738.1|  PREDICTED: EH domain-containing protein 1          241   6e-73    
ref|XP_009168139.1|  hypothetical protein T265_04985                    244   7e-73    
ref|XP_005030493.1|  PREDICTED: EH domain-containing protein 4          243   7e-73    
ref|XP_005598506.1|  PREDICTED: EH domain-containing protein 1          241   8e-73    
ref|XP_005381377.1|  PREDICTED: EH domain-containing protein 4          241   8e-73    
ref|XP_008585669.1|  PREDICTED: EH domain-containing protein 4 is...    242   8e-73    
gb|KFW74974.1|  EH domain-containing protein 4                          241   8e-73    
ref|XP_007657150.1|  PREDICTED: EH domain-containing protein 1          239   9e-73    
gb|KFR09569.1|  EH domain-containing protein 4                          241   9e-73    
ref|XP_009071493.1|  PREDICTED: EH domain-containing protein 4          239   9e-73    
ref|XP_004174503.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    243   9e-73    
gb|KFP78973.1|  EH domain-containing protein 4                          239   9e-73    
ref|XP_007180877.1|  PREDICTED: EH domain-containing protein 4          244   1e-72    
ref|XP_009931465.1|  PREDICTED: EH domain-containing protein 4          241   1e-72    
ref|XP_004623435.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    243   1e-72    
ref|XP_002899341.1|  conserved hypothetical protein                     244   1e-72    
ref|XP_009886277.1|  PREDICTED: EH domain-containing protein 4          243   1e-72    
emb|CDQ83634.1|  unnamed protein product                                239   1e-72    
gb|EGW10710.1|  EH domain-containing protein 1                          239   1e-72    
ref|XP_008700443.1|  PREDICTED: EH domain-containing protein 4          243   1e-72    
ref|XP_004927463.1|  PREDICTED: EH domain-containing protein 1-like     243   1e-72    
gb|ETK93910.1|  hypothetical protein L915_02946                         243   1e-72    
ref|XP_004421511.1|  PREDICTED: EH domain-containing protein 4          243   1e-72    
ref|XP_004713576.1|  PREDICTED: EH domain-containing protein 1          239   1e-72    
ref|XP_007502798.1|  PREDICTED: EH domain-containing protein 1-like     242   2e-72    
gb|EHH27240.1|  PAST-like protein 4                                     241   2e-72    
gb|ETI54061.1|  hypothetical protein F443_03079                         243   2e-72    
ref|XP_005990842.1|  PREDICTED: EH domain-containing protein 4          244   2e-72    
gb|AAF40472.1|AF181265_1  EH domain containing 4                        241   2e-72    
ref|XP_008916119.1|  hypothetical protein PPTG_19423                    243   2e-72    
gb|ETM00403.1|  hypothetical protein L917_02847                         243   2e-72    
ref|XP_004660949.1|  PREDICTED: EH domain-containing protein 4          242   2e-72    
ref|XP_008925583.1|  PREDICTED: EH domain-containing protein 4          242   2e-72    
gb|KFO63593.1|  EH domain-containing protein 4                          240   2e-72    
gb|ETM53605.1|  hypothetical protein L914_02911                         243   2e-72    
ref|XP_007658871.1|  PREDICTED: EH domain-containing protein 4          243   2e-72    
ref|XP_002718009.2|  PREDICTED: EH domain-containing protein 4          242   2e-72    
emb|CEJ00342.1|  hypothetical protein RMCBS344292_14400                 242   2e-72    
ref|NP_998039.1|  EH-domain containing 1a                               242   2e-72    
ref|XP_010596668.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    239   3e-72    
gb|AAG28784.1|AF307137_1  EH domain-containing protein FKSG7            242   3e-72    
ref|XP_851017.1|  PREDICTED: EH domain-containing protein 4             242   3e-72    
ref|XP_005959392.1|  PREDICTED: EH domain-containing protein 1          241   3e-72    
ref|XP_008637914.1|  PREDICTED: EH domain-containing protein 4          240   3e-72    
ref|XP_004019933.1|  PREDICTED: EH domain-containing protein 1          242   4e-72    
ref|NP_647540.1|  EH domain-containing protein 4                        241   4e-72    
ref|XP_010120632.1|  PREDICTED: EH domain-containing protein 4          239   4e-72    
emb|CDS09414.1|  hypothetical protein LRAMOSA10774                      241   4e-72    
gb|KFM71674.1|  EH domain-containing protein 1                          241   4e-72    
gb|KFP42875.1|  EH domain-containing protein 4                          239   4e-72    
ref|XP_004578211.1|  PREDICTED: EH domain-containing protein 4          241   4e-72    
gb|ACJ76619.1|  EH-domain containing 1 (predicted)                      238   5e-72    
ref|XP_004380712.1|  PREDICTED: EH domain-containing protein 4          241   5e-72    
ref|XP_001918265.2|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    242   5e-72    
ref|XP_003935732.1|  PREDICTED: EH domain-containing protein 4          241   5e-72    
ref|XP_006158780.1|  PREDICTED: EH domain-containing protein 4          244   5e-72    
ref|XP_011052393.1|  PREDICTED: EH domain-containing protein 3          241   6e-72    
ref|XP_006632232.1|  PREDICTED: EH domain-containing protein 4-like     241   6e-72    
emb|CDQ69117.1|  unnamed protein product                                237   6e-72    
ref|XP_007257996.1|  PREDICTED: EH domain-containing protein 4          241   6e-72    
ref|XP_010395897.1|  PREDICTED: EH domain-containing protein 4          241   6e-72    
ref|XP_008845031.1|  PREDICTED: EH domain-containing protein 4          241   7e-72    
dbj|BAE01936.1|  unnamed protein product                                238   7e-72    
emb|CEG72115.1|  hypothetical protein RMATCC62417_07727                 241   7e-72    
dbj|GAM18969.1|  hypothetical protein SAMD00019534_021440               240   7e-72    
ref|XP_003419656.1|  PREDICTED: EH domain-containing protein 1          241   7e-72    
ref|XP_009537814.1|  hypothetical protein PHYSODRAFT_529936             242   7e-72    
ref|NP_001245064.1|  EH domain-containing protein 4                     241   8e-72    
ref|NP_644670.1|  EH domain-containing protein 4                        241   8e-72    
ref|XP_010367370.1|  PREDICTED: EH domain-containing protein 4          241   8e-72    
ref|XP_008015119.1|  PREDICTED: EH domain-containing protein 4          241   8e-72    
gb|KFO32966.1|  EH domain-containing protein 4                          239   8e-72    
dbj|BAE41953.1|  unnamed protein product                                239   8e-72    
ref|XP_006920525.1|  PREDICTED: EH domain-containing protein 4          241   8e-72    
dbj|BAF85323.1|  unnamed protein product                                241   8e-72    
ref|XP_004618455.1|  PREDICTED: EH domain-containing protein 1          241   8e-72    
ref|XP_510639.2|  PREDICTED: EH domain-containing protein 4             241   9e-72    
dbj|BAE43123.1|  unnamed protein product                                239   9e-72    
ref|XP_002825386.1|  PREDICTED: EH domain-containing protein 4          241   9e-72    
ref|XP_005047071.1|  PREDICTED: EH domain-containing protein 4          239   9e-72    
ref|XP_006745613.1|  PREDICTED: EH domain-containing protein 1 is...    240   9e-72    
ref|XP_006216738.1|  PREDICTED: EH domain-containing protein 1          240   9e-72    
emb|CEG64412.1|  hypothetical protein RMATCC62417_01389                 237   9e-72    
ref|XP_010836316.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    240   9e-72    
ref|XP_010955402.1|  PREDICTED: EH domain-containing protein 1          240   9e-72    
gb|ACQ62995.1|  EH-domain containing 1 (predicted)                      240   9e-72    
gb|AEG42345.1|  EH-domain containing protein                            240   9e-72    
ref|XP_003266806.1|  PREDICTED: EH domain-containing protein 4          241   9e-72    
ref|XP_006883045.1|  PREDICTED: EH domain-containing protein 4          241   1e-71    
ref|XP_005814925.1|  PREDICTED: EH domain-containing protein 1-like     240   1e-71    
ref|XP_001362234.1|  PREDICTED: EH domain-containing protein 4          241   1e-71    
gb|ABG66989.1|  EH-domain containing 1                                  240   1e-71    
ref|NP_001015578.1|  EH domain-containing protein 1                     240   1e-71    
dbj|BAG60021.1|  unnamed protein product                                239   1e-71    
ref|XP_006056578.1|  PREDICTED: EH domain-containing protein 1          240   1e-71    
gb|EHB10335.1|  EH domain-containing protein 4                          238   1e-71    
ref|XP_006991300.1|  PREDICTED: EH domain-containing protein 4          240   1e-71    
emb|CDQ63138.1|  unnamed protein product                                238   1e-71    
ref|XP_006745612.1|  PREDICTED: EH domain-containing protein 1 is...    240   1e-71    
ref|XP_003379210.1|  EH domain-containing protein                       240   1e-71    
ref|XP_007933480.1|  PREDICTED: EH domain-containing protein 4          240   1e-71    
ref|XP_010623348.1|  PREDICTED: EH domain-containing protein 4          239   1e-71    
ref|XP_005808390.1|  PREDICTED: EH domain-containing protein 3-like     240   1e-71    
ref|NP_598599.2|  EH domain-containing protein 4                        240   1e-71    
dbj|BAG61156.1|  unnamed protein product                                239   1e-71    
ref|XP_005284662.1|  PREDICTED: EH domain-containing protein 4          240   1e-71    
dbj|BAE93881.1|  EH-domain containing 4                                 240   2e-71    
dbj|BAN21100.1|  past-1                                                 239   2e-71    
gb|ERE70803.1|  EH domain-containing protein 4                          239   2e-71    
ref|XP_005316504.1|  PREDICTED: EH domain-containing protein 4          240   2e-71    
ref|XP_008418632.1|  PREDICTED: EH domain-containing protein 1-li...    239   2e-71    
ref|XP_006104388.1|  PREDICTED: EH domain-containing protein 1          236   2e-71    
ref|NP_001080707.1|  EH-domain containing 4                             239   2e-71    
ref|XP_004383816.1|  PREDICTED: EH domain-containing protein 1          239   2e-71    
ref|XP_006831806.1|  PREDICTED: EH domain-containing protein 4          239   2e-71    
ref|XP_966867.1|  PREDICTED: EH domain-containing protein 3-like        239   2e-71    
dbj|BAE35852.1|  unnamed protein product                                239   2e-71    
dbj|BAE35217.1|  unnamed protein product                                239   2e-71    
ref|NP_034249.1|  EH domain-containing protein 1                        239   2e-71    
dbj|BAE39763.1|  unnamed protein product                                239   2e-71    
ref|XP_005522550.1|  PREDICTED: EH domain-containing protein 4          239   2e-71    
ref|XP_002916751.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    241   2e-71    
ref|XP_004896291.1|  PREDICTED: EH domain-containing protein 4          238   3e-71    
ref|XP_698033.4|  PREDICTED: EH domain-containing protein 4             239   3e-71    
gb|AAI60908.1|  Ehd1 protein                                            240   3e-71    
gb|AAH37094.1|  EH-domain containing 1                                  239   3e-71    
ref|XP_006034137.1|  PREDICTED: EH domain-containing protein 4          239   3e-71    
ref|XP_009064815.1|  hypothetical protein LOTGIDRAFT_196647             239   3e-71    
ref|XP_003510772.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    238   3e-71    
ref|XP_003498135.1|  PREDICTED: EH domain-containing protein 4 is...    238   3e-71    
ref|XP_010994338.1|  PREDICTED: EH domain-containing protein 1          241   3e-71    
gb|EIE85679.1|  hypothetical protein RO3G_10389                         239   3e-71    
ref|XP_005660782.1|  PREDICTED: EH domain-containing protein 1 is...    239   3e-71    
ref|XP_009006688.1|  PREDICTED: EH domain-containing protein 1 is...    239   4e-71    
gb|EZA59004.1|  EH domain-containing protein                            239   4e-71    
ref|XP_003122601.2|  PREDICTED: EH domain-containing protein 1 is...    239   4e-71    
ref|XP_004656697.1|  PREDICTED: EH domain-containing protein 1          239   4e-71    
ref|XP_007462099.1|  PREDICTED: EH domain-containing protein 1 is...    239   4e-71    
ref|XP_004264369.1|  PREDICTED: EH domain-containing protein 1          239   4e-71    
dbj|BAG62076.1|  unnamed protein product                                238   4e-71    
emb|CAH91525.1|  hypothetical protein                                   235   4e-71    
ref|XP_002755558.3|  PREDICTED: EH domain-containing protein 1 is...    239   4e-71    
ref|XP_007462100.1|  PREDICTED: EH domain-containing protein 1 is...    239   4e-71    
ref|XP_004887841.1|  PREDICTED: EH domain-containing protein 1          239   4e-71    
ref|XP_006901528.1|  PREDICTED: EH domain-containing protein 1 is...    239   4e-71    
ref|XP_007518643.1|  PREDICTED: EH domain-containing protein 1          239   4e-71    
ref|XP_004051595.1|  PREDICTED: EH domain-containing protein 1          239   4e-71    



>ref|XP_002277794.1| PREDICTED: EH domain-containing protein 1 [Vitis vinifera]
 emb|CBI26690.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQE+LL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAAV-GPIGKELFEKEQENLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNVD F+E LSGY
Sbjct  450  HAYIISHLKKEMPTMMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFPNVDHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQTVDDMLGYDIP+LLKSFRNPYD
Sbjct  510  SIDKFERLKPKMIQTVDDMLGYDIPELLKSFRNPYD  545



>ref|XP_004149345.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
 ref|XP_004167751.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=547

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 208/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G++LFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNE-AVTGPLGKDLFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GKAK QQRLIDNLADEF KVQ+EYHLPAGDFPNV+QF+ETLSGY
Sbjct  452  HAYIISHLRKEMPTMIGKAKTQQRLIDNLADEFGKVQREYHLPAGDFPNVEQFRETLSGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ+VDDMLGYD+PDLLK+FRNPYD
Sbjct  512  NFDKFEKLKPKMIQSVDDMLGYDVPDLLKNFRNPYD  547



>emb|CAN67909.1| hypothetical protein VITISV_034695 [Vitis vinifera]
Length=546

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  332  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQE+LL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPVNEAAV-GPIGKELFEKEQENLLSDLKDIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNVD F+E LSGY
Sbjct  451  HAYIISHLKKEMPTMMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFPNVDHFREVLSGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQTVDDMLGYDIP+LLKSFRNPYD
Sbjct  511  SIDKFERLKPKMIQTVDDMLGYDIPELLKSFRNPYD  546



>ref|XP_010913401.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=543

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNK+DQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  329  HKLDISDEFKRVIGSLRGHDDKIRVVLNKSDQVDTQQLMRVYGALMWSLGKVLNTPEVMR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPINEAAV-GPIGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE LSGY
Sbjct  448  HAYIISHLRKEMPAMIGKAKAQQRLIDNLEDEFPKVQREFHLPAGDFPNVEHFKEVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQTVDDMLGYDIP+LL+SFRNPY+
Sbjct  508  SIDKFEKLKPKMIQTVDDMLGYDIPELLRSFRNPYE  543



>ref|XP_010270065.1| PREDICTED: EH domain-containing protein 1 [Nelumbo nucifera]
Length=544

 Score =   399 bits (1024),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNEAAV-GPIGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAY+ISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNVD F+E LSGY
Sbjct  449  HAYVISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFPNVDHFREILSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  509  SIDKFERLKPKMIQAVDDMLGYDIPELLKNFRNPYD  544



>ref|XP_011046717.1| PREDICTED: EH domain-containing protein 3 [Populus euphratica]
Length=545

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAAV-GPIGKELFEKEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+MMGKAK QQRL+DNLA+EF KVQ+E+HLP GDFPNV+QF+E LSGY
Sbjct  450  HAYIISHLRKEMPAMMGKAKAQQRLLDNLAEEFGKVQREFHLPPGDFPNVEQFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  510  NFDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  545



>ref|XP_006452453.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65693.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=438

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  224  HKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  283

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A+ GP+G+ELFEKEQ+DLL+DLKDIPK+ACD RINEFVKRAR+AKI
Sbjct  284  VYIGSFNDKPVNESAF-GPLGKELFEKEQDDLLSDLKDIPKKACDLRINEFVKRARAAKI  342

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+MMGKAK QQ+LIDNLA+EF KVQKE+HLP GDFPNV+ FKE LSGY
Sbjct  343  HAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFPNVEHFKEILSGY  402

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  403  SFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  438



>ref|XP_008449138.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=547

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 206/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G++LFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNEAA-TGPLGKDLFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GKAK QQRLIDNLADEF KVQ+EYHLPAGDFPNV+QF+ETL GY
Sbjct  452  HAYIISHLRKEMPAMIGKAKTQQRLIDNLADEFGKVQREYHLPAGDFPNVEQFRETLGGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ+VDDMLGYD+P LLK+FRNPYD
Sbjct  512  NFDKFEKLKPKMIQSVDDMLGYDVPQLLKNFRNPYD  547



>ref|XP_008805597.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Phoenix 
dactylifera]
Length=544

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIGRELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINEAAV-GPIGRELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE LSGY
Sbjct  449  HAYIISHLKKEMPAMIGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFPNVEHFKEVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQTVDDMLGY+IP+LL+SF+NPY+
Sbjct  509  SIDKFEKLKPKMIQTVDDMLGYEIPELLRSFKNPYE  544



>ref|XP_008805595.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=544

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIGRELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINEAAV-GPIGRELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE LSGY
Sbjct  449  HAYIISHLKKEMPAMIGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFPNVEHFKEVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQTVDDMLGY+IP+LL+SF+NPY+
Sbjct  509  SIDKFEKLKPKMIQTVDDMLGYEIPELLRSFKNPYE  544



>ref|XP_010252586.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=450

 Score =   394 bits (1013),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL G+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  236  HKLDISDEFKRVIGSLHGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  295

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  296  VYIGSFNDKPVNEVA-TGPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  354

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAKVQQRL+DNL DEF KVQKE+HLPAGDFPN++QF+E LSGY
Sbjct  355  HAYIISHLKKEMPAMMGKAKVQQRLLDNLEDEFSKVQKEFHLPAGDFPNIEQFREILSGY  414

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMI+ VDDMLGYDIP+LLK+FRNPY+
Sbjct  415  NIDKFEKLKPKMIKAVDDMLGYDIPELLKNFRNPYE  450



>ref|XP_008805596.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=549

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  335  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  394

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIGRELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  395  VYIGSFNDKPINEAAV-GPIGRELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  453

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE LSGY
Sbjct  454  HAYIISHLKKEMPAMIGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFPNVEHFKEVLSGY  513

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQTVDDMLGY+IP+LL+SF+NPY+
Sbjct  514  SIDKFEKLKPKMIQTVDDMLGYEIPELLRSFKNPYE  549



>ref|XP_010063047.1| PREDICTED: EH domain-containing protein 1 [Eucalyptus grandis]
Length=545

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAA-TGPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLKKEMPAMMGKAKTQQRLIDNLEDEFAKVQREFHLPPGDFPNVEHFRERLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             +D+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  510  NLDKFEKLKPKMIQAVDDMLGYDIPDLLKHFRNPYD  545



>ref|XP_010096102.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB63267.1| EH domain-containing protein 1 [Morus notabilis]
Length=542

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKV+NTPEVMR
Sbjct  328  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVINTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL DLKDIPK+ACDRRINEFVKR R+AKI
Sbjct  388  VYIGSFNDKPVNEAA-TGPIGKELFEKEQEDLLADLKDIPKKACDRRINEFVKRTRAAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNLADEF KVQ+E+HLP GDFPNV+QF+E L GY
Sbjct  447  HAYIISHLKKEMPAMMGKAKAQQRLIDNLADEFGKVQREFHLPPGDFPNVEQFREVLRGY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  507  NFDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  542



>gb|KDO62119.1| hypothetical protein CISIN_1g009050mg [Citrus sinensis]
Length=545

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 206/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A+ GP+G+ELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNESAF-GPLGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+MMGKAK QQ+LIDNLA+EF KVQKE+HLP GDFPNV+ FKE LSGY
Sbjct  450  HAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFPNVEHFKEILSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  510  SFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  545



>gb|EYU27376.1| hypothetical protein MIMGU_mgv1a004087mg [Erythranthe guttata]
Length=544

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVNR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GP+GRELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINEAAA-GPLGRELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQ+LIDNL DEF KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  449  HAYIISHLKKEMPAMMGKAKAQQKLIDNLPDEFAKVQREHHLPAGDFPNVEHFREVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             +DRFE LKPKMIQ+VDDMLGYDIPDLLK+FRNPYD
Sbjct  509  SLDRFEKLKPKMIQSVDDMLGYDIPDLLKNFRNPYD  544



>gb|KDP39189.1| hypothetical protein JCGZ_00946 [Jatropha curcas]
Length=545

 Score =   396 bits (1018),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVVNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAAV-GPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLID+LADEF KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLKKEMPAMMGKAKTQQRLIDSLADEFGKVQREFHLPPGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  545



>ref|XP_011095452.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=544

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINEAA-SGPIGKELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  449  HAYIISHLKKEMPAMMGKAKTQQRLIDNLPDEFAKVQREHHLPAGDFPNVEHFREVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ+VDDMLGYDIP+LLK+FRNPYD
Sbjct  509  SIDKFEKLKPKMIQSVDDMLGYDIPELLKNFRNPYD  544



>ref|XP_006475006.1| PREDICTED: EH domain-containing protein 3-like [Citrus sinensis]
Length=545

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP NE+A+ GP+G+ELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPANESAF-GPLGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+MMGKAK QQ+LIDNLA+EF KVQKE+HLP GDFPNV+ FKE LSGY
Sbjct  450  HAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFPNVEHFKEILSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  510  SFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  545



>gb|KCW70227.1| hypothetical protein EUGRSUZ_F03500 [Eucalyptus grandis]
Length=613

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEVMR
Sbjct  399  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVMR  458

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  459  VYIGSFNDKPVNEAA-TGPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  517

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  518  HAYIISHLKKEMPAMMGKAKTQQRLIDNLEDEFAKVQREFHLPPGDFPNVEHFRERLSGY  577

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             +D+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  578  NLDKFEKLKPKMIQAVDDMLGYDIPDLLKHFRNPYD  613



>ref|XP_010252585.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=536

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL G+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  322  HKLDISDEFKRVIGSLHGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  381

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  382  VYIGSFNDKPVNEVA-TGPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  440

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAKVQQRL+DNL DEF KVQKE+HLPAGDFPN++QF+E LSGY
Sbjct  441  HAYIISHLKKEMPAMMGKAKVQQRLLDNLEDEFSKVQKEFHLPAGDFPNIEQFREILSGY  500

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMI+ VDDMLGYDIP+LLK+FRNPY+
Sbjct  501  NIDKFEKLKPKMIKAVDDMLGYDIPELLKNFRNPYE  536



>ref|XP_006829517.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
 gb|ERM96933.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
Length=543

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVNR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPINEGAI-GPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHLRKEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE LSGY
Sbjct  448  HSYIISHLRKEMPAMLGKAKTQQRLIDNLEDEFAKVQREHHLPAGDFPNVEHFKEVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE L+PKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  508  SIDKFEKLRPKMIQNVDDMLGYDIPELLKNFRNPYE  543



>ref|XP_006452452.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65692.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=563

 Score =   394 bits (1012),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  349  HKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  408

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A+ GP+G+ELFEKEQ+DLL+DLKDIPK+ACD RINEFVKRAR+AKI
Sbjct  409  VYIGSFNDKPVNESAF-GPLGKELFEKEQDDLLSDLKDIPKKACDLRINEFVKRARAAKI  467

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+MMGKAK QQ+LIDNLA+EF KVQKE+HLP GDFPNV+ FKE LSGY
Sbjct  468  HAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFPNVEHFKEILSGY  527

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  528  SFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  563



>gb|KGN56098.1| hypothetical protein Csa_3G073890 [Cucumis sativus]
Length=562

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 208/231 (90%), Gaps = 16/231 (7%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRR-------------  322
            VYIGSFNDKP+NE A  GP+G++LFEKEQEDLL+DLKDIPK+ACDRR             
Sbjct  393  VYIGSFNDKPVNE-AVTGPLGKDLFEKEQEDLLSDLKDIPKKACDRRVSFPSLTILIFLI  451

Query  323  --INEFVKRARSAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAG  496
              INEFVKRAR+AKIHAYIISHLRKEMP+M+GKAK QQRLIDNLADEF KVQ+EYHLPAG
Sbjct  452  EMINEFVKRARAAKIHAYIISHLRKEMPTMIGKAKTQQRLIDNLADEFGKVQREYHLPAG  511

Query  497  DFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            DFPNV+QF+ETLSGY  D+FE LKPKMIQ+VDDMLGYD+PDLLK+FRNPYD
Sbjct  512  DFPNVEQFRETLSGYNFDKFEKLKPKMIQSVDDMLGYDVPDLLKNFRNPYD  562



>ref|XP_002531194.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF31171.1| EH-domain-containing protein, putative [Ricinus communis]
Length=550

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 203/215 (94%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  336  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  395

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE+A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  396  VYIGSFNDKPINEDAI-GPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  454

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+K MP+M+GKAK QQRLIDNL +EF KVQ E+HLP GDFPNV+QF+E LSGY
Sbjct  455  HAYIISHLKKAMPTMVGKAKAQQRLIDNLGEEFGKVQSEFHLPPGDFPNVEQFREVLSGY  514

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPY
Sbjct  515  SIDKFEKLKPKMIQAVDDMLGYDIPELLKNFRNPY  549



>ref|XP_002885363.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61622.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  336  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  395

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  396  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  454

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL DEF KVQ+E+HLP GDFPNVD F+E LSGY
Sbjct  455  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKGDFPNVDHFREVLSGY  514

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  515  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  550



>ref|XP_004294399.1| PREDICTED: EH domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=545

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFE+EQEDLL DLKDIPK++CDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNE-AASGPIGKELFEREQEDLLADLKDIPKKSCDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+++GKAK QQ+L DNL DEF+KVQ+E+HLP GDFPNV+QF+ETLSGY
Sbjct  450  HAYIISHLRKEMPALIGKAKTQQKLTDNLEDEFKKVQREFHLPPGDFPNVEQFRETLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D FE LKP MI+ VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  SFDNFEKLKPSMIKAVDDMLGYDIPELLKNFRNPYD  545



>dbj|BAB02809.1| unnamed protein product [Arabidopsis thaliana]
Length=524

 Score =   390 bits (1001),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  310  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  369

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  370  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  428

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL DEF KVQ+E+HLP GDFPNVD F+E LSGY
Sbjct  429  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKGDFPNVDHFREVLSGY  488

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  489  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  524



>emb|CDP13787.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEVA-TGPIGKELFEKEQDDLLADLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRL+DNL  EF KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLKKEMPAMMGKAKTQQRLVDNLEVEFGKVQREFHLPAGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ+VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  SIDKFEKLKPKMIQSVDDMLGYDIPELLKNFRNPYD  545



>ref|NP_566657.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 ref|NP_001030731.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 gb|AAK59418.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42408.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19984.1| AT3G20290 [Arabidopsis thaliana]
 gb|AEE76359.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 gb|AEE76360.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
Length=545

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL DEF KVQ+E+HLP GDFPNVD F+E LSGY
Sbjct  450  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKGDFPNVDHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  510  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  545



>ref|XP_009603511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=467

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  253  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  312

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  313  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  371

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  372  HAYIISHLKKEMPAMMGKAKTQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  431

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  432  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFRNPYD  467



>ref|XP_008799457.1| PREDICTED: EH domain-containing protein 1-like [Phoenix dactylifera]
Length=544

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL GHDDKIRV+LNKADQVDTQQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLHGHDDKIRVILNKADQVDTQQLMRVYGALLWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            +YIGSFNDKP+NE A  GPIG+ELFE+EQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  IYIGSFNDKPVNE-AVVGPIGKELFEREQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLID+L DEF KVQKE+HLP GDFPNVD FKE LSGY
Sbjct  449  HAYIISHLKKEMPAMMGKAKTQQRLIDDLEDEFAKVQKEFHLPIGDFPNVDHFKEVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML YDIPDLL+ FRNPYD
Sbjct  509  NIDKFEKLKPKMIQAVDDMLAYDIPDLLRRFRNPYD  544



>ref|XP_007020711.1| EPS15 domain 1 [Theobroma cacao]
 gb|EOY12236.1| EPS15 domain 1 [Theobroma cacao]
Length=547

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNEAA-TGPIGKELFEKEQEDLLADLKDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+II HLRKEMP+MMGKAK QQRLIDNLADEF KVQ+++HLP GDFPNV+ F+E LSGY
Sbjct  452  HAHIIGHLRKEMPTMMGKAKTQQRLIDNLADEFGKVQRDHHLPPGDFPNVEHFREVLSGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  512  NFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  547



>ref|XP_010544277.1| PREDICTED: EH domain-containing protein 1 [Tarenaya hassleriana]
Length=548

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  334  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  393

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPI+E A+ GPIG+ELFEKEQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  394  VYIGSFSDKPIDE-AFTGPIGKELFEKEQEDLLADLKDIPKKACDRRINEFVKRARAAKI  452

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAKVQQ+LIDNL D F KVQ+E+HLP GDFPNV+QF+E L+GY
Sbjct  453  HAYIISHLKKEMPALMGKAKVQQKLIDNLEDVFGKVQREHHLPRGDFPNVEQFREVLTGY  512

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  513  NIDKFEKLKPKLIQAVDDMLGYDIPELLKNFRNPYD  548



>ref|XP_010090952.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB41537.1| EH domain-containing protein 1 [Morus notabilis]
Length=510

 Score =   388 bits (996),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  296  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  355

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG +LFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  356  VYIGSFNDKPINEAAV-GPIGLDLFEKEQDDLLADLVDIPKKACDRRINEFVKRARAAKI  414

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL +EF KVQ+E+HLPAGDFPNV+ F+E L+GY
Sbjct  415  HAYIISHLKKEMPAMMGKAKTQQRLIDNLEEEFAKVQREFHLPAGDFPNVEHFREVLNGY  474

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQTVDDMLGY+IP+LLK+FRNPYD
Sbjct  475  SIDKFEKLKPKLIQTVDDMLGYEIPELLKNFRNPYD  510



>ref|XP_006646902.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  328  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG++LFEKEQEDLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  388  VYIGSFNDKPVNESAV-GPIGKDLFEKEQEDLLCDLKDIPKKACDRRVNEFVKRARAAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFP V+ FKE L GY
Sbjct  447  HAYIIGHLKKEMPAMMGKAKAQQRLIDNLGDEFAKVQREYHLPAGDFPEVEHFKEVLGGY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPK++Q VDDML YDIP+LLK+FRNPY+
Sbjct  507  SIDKFEKMKPKLVQAVDDMLAYDIPELLKNFRNPYE  542



>ref|XP_010508763.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=563

 Score =   389 bits (999),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  349  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  408

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  409  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  467

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  468  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEHFREVLSGY  527

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLKSFRNPYD
Sbjct  528  NIDKFEKLKPKMLQTVDDMLGYDIPELLKSFRNPYD  563



>ref|XP_009589164.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009589165.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=469

 Score =   385 bits (990),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  255  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  314

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  315  VYIGSFNDKPINEAA-TGPVGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  373

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHL+KEMP+M+GKAK QQ+LIDNL D+F KVQKE+HLP GDFPNV+ F+E LSGY
Sbjct  374  HSYIISHLKKEMPAMIGKAKTQQKLIDNLEDQFVKVQKEHHLPPGDFPNVEHFREVLSGY  433

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ+VDDMLGYDIP+LLK+FRNPYD
Sbjct  434  NIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  469



>gb|KHG22957.1| EH domain-containing 1 [Gossypium arboreum]
Length=452

 Score =   385 bits (989),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  238  HKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  297

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  298  VYIGSFNDKPVNEAA-TGPIGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  356

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII+HL+KEMP+M+GKAK QQRLIDNL  EF KVQ+++HLP GDFPNV+ FKE LSGY
Sbjct  357  HAYIIAHLKKEMPAMIGKAKTQQRLIDNLEGEFGKVQRDHHLPPGDFPNVEHFKEILSGY  416

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  417  NFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  452



>gb|EYU33672.1| hypothetical protein MIMGU_mgv1a004199mg [Erythranthe guttata]
Length=539

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  325  HKLDISDEFKRVIESLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVNR  384

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GP+G ELFE+EQ+DLLNDLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  385  VYIGSFNDKPINE-ASAGPLGLELFEREQDDLLNDLKDIPKKACDRRINEFVKRARAAKI  443

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+ EMPSMMGKAK QQ+LIDNLADEF KVQ+E+HLPAGDFPNV+QFK+ L+GY
Sbjct  444  HAYIMSHLKNEMPSMMGKAKAQQKLIDNLADEFAKVQREHHLPAGDFPNVEQFKDKLNGY  503

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKMIQ+VDDML YDIP LLK+FRNPYD
Sbjct  504  NIDKFERMKPKMIQSVDDMLAYDIPQLLKNFRNPYD  539



>ref|XP_009393691.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNK+DQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGHDDKIRVVLNKSDQVDTQQLMRVYGALMWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GP+G+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  388  VYIGSFNDKPINEAAV-GPLGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHLR EMP+M+GKAK QQRLIDNL DEF KVQ+EYHLPAGDFPNV+ F+E L GY
Sbjct  447  HSYIISHLRNEMPAMLGKAKAQQRLIDNLEDEFAKVQREYHLPAGDFPNVEHFREILGGY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML YDIP+LL++FRNPY+
Sbjct  507  SIDKFEKLKPKMIQAVDDMLAYDIPELLRNFRNPYE  542



>ref|XP_004491428.1| PREDICTED: EH domain-containing protein 3-like [Cicer arietinum]
Length=543

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  329  HKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVIR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N NA  GPIG+ELFEKEQEDLL+DLKDIPK ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPVN-NAVSGPIGKELFEKEQEDLLSDLKDIPKAACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQ+LIDNLA EF KVQ+E+HLP GDFPNV+ F+E+L GY
Sbjct  448  HAYIISHLKKEMPAMMGKAKAQQKLIDNLAGEFGKVQREFHLPPGDFPNVEHFRESLRGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML YDIP+LLK+F+NPYD
Sbjct  508  NIDKFEKLKPKMIQVVDDMLAYDIPNLLKNFKNPYD  543



>ref|XP_004966283.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=544

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GP+G+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNESAV-GPLGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFP V+ FKE LSGY
Sbjct  449  HAYIIGHLKKEMPTMMGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFPYVEHFKEVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE +KPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  509  SFDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_006344871.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GPIG+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDEPINEAAI-GPIGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHL+KEMP+M+GKAK QQ+L+DNL D+F KVQKE+HLPAGDFPNV+ F+E LSGY
Sbjct  450  HSYIISHLKKEMPAMIGKAKTQQKLVDNLEDQFMKVQKEHHLPAGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ+VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  NIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_010313928.1| PREDICTED: EH domain-containing protein 3-like [Solanum lycopersicum]
Length=545

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN+ A  GPIG+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINDAAI-GPIGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHL+KEMP+M+GKAK QQ+LIDNL D+F KVQKE+HLPAGDFPN++ F+E LSGY
Sbjct  450  HSYIISHLKKEMPAMIGKAKTQQKLIDNLEDQFMKVQKEHHLPAGDFPNIEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ+VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  NIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_009603507.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603508.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603510.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=543

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKAKTQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  508  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFRNPYD  543



>ref|XP_006406402.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47855.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=443

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  229  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  288

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFE EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  289  VYIGSFSDKPINEAA-TGPIGRELFEMEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  347

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E L GY
Sbjct  348  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEHFREVLIGY  407

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  408  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  443



>emb|CDY50093.1| BnaC01g32680D [Brassica napus]
Length=531

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  317  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  376

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  377  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  435

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNV+QF+E LSGY
Sbjct  436  HACIISHLKKEMPAIMGKAKAQQKLVDNLEDVFGKVQREHHLPKGDFPNVEQFREVLSGY  495

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  496  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  531



>ref|NP_001045954.1| Os02g0158100 [Oryza sativa Japonica Group]
 dbj|BAD28029.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAD28174.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAF07868.1| Os02g0158100 [Oryza sativa Japonica Group]
 gb|EEC72529.1| hypothetical protein OsI_05922 [Oryza sativa Indica Group]
 gb|EEE56343.1| hypothetical protein OsJ_05448 [Oryza sativa Japonica Group]
Length=543

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG++LFEKEQ+DLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPVNESAV-GPIGKDLFEKEQDDLLCDLKDIPKKACDRRVNEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFP+V+ FKE L GY
Sbjct  448  HAYIIGHLKKEMPAMMGKAKAQQRLIDNLGDEFAKVQREYHLPAGDFPDVEHFKEVLGGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPK++Q VDDML YDIP+LLK+FRNPY+
Sbjct  508  NIDKFEKMKPKLVQAVDDMLAYDIPELLKNFRNPYE  543



>ref|XP_006296699.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
 gb|EOA29597.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
Length=545

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVCR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+++GKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLKKEMPAIIGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  510  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_009776641.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=470

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  256  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  315

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  316  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  374

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  375  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  434

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  435  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  470



>ref|XP_002437485.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
 gb|EER88852.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
Length=544

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GP+G+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNESAV-GPLGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLP+GDFP V+ FKE LSGY
Sbjct  449  HAYIIGHLKKEMPTMMGKAKAQQRLIDNLPDEFAKVQREYHLPSGDFPYVEHFKEVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE +KPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  509  SFDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_009598340.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=470

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  256  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  315

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  316  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  374

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  375  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  434

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  435  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  470



>ref|XP_009589162.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=545

 Score =   385 bits (990),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEAA-TGPVGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHL+KEMP+M+GKAK QQ+LIDNL D+F KVQKE+HLP GDFPNV+ F+E LSGY
Sbjct  450  HSYIISHLKKEMPAMIGKAKTQQKLIDNLEDQFVKVQKEHHLPPGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ+VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  NIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_008644157.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 ref|XP_008644158.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 gb|AFW69172.1| hypothetical protein ZEAMMB73_263235 [Zea mays]
Length=544

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GP+G+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNESAV-GPLGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLP+GDFP V+ FKE LSGY
Sbjct  449  HAYIIGHLKKEMPTMMGKAKAQQRLIDNLPDEFAKVQREYHLPSGDFPYVEHFKEVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE +KPKM+Q VDDMLGYDIP+LLK+FRNPY+
Sbjct  509  SFDKFEKVKPKMVQAVDDMLGYDIPELLKNFRNPYE  544



>emb|CDY25408.1| BnaA05g18760D [Brassica napus]
Length=525

 Score =   385 bits (988),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  311  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  370

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFE EQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  371  VYIGSFSDKPINE-ASTGPIGRELFEMEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  429

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNVDQF+E LSGY
Sbjct  430  HAYIISHLKKEMPAIMGKAKAQQKLMDNLEDVFGKVQREHHLPKGDFPNVDQFREVLSGY  489

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  490  NFDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  525



>ref|XP_003617631.1| EH-domain-containing protein [Medicago truncatula]
 gb|AET00590.1| calcium-binding EF hand protein [Medicago truncatula]
Length=543

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+ A  GPIG+ELFEKEQEDLL+DLKDIPK ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPVND-AVSGPIGKELFEKEQEDLLSDLKDIPKAACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQ+LIDNLA EF KVQ+E+HLP GDFPNV+ F+E+LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKAKAQQKLIDNLAGEFGKVQREFHLPPGDFPNVEHFRESLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDML YDIP+LLK+F+NPYD
Sbjct  508  NIDKFEKLKPKMLQVVDDMLAYDIPNLLKNFKNPYD  543



>ref|XP_009779286.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009779287.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009779288.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score =   382 bits (980),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLG+VLNTPEV R
Sbjct  222  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGRVLNTPEVTR  281

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  282  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  340

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  341  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  400

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  401  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  436



>emb|CDY50090.1| BnaC01g32650D [Brassica napus]
Length=570

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  356  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  415

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  416  VYIGSFSDKPINEAAT-GPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  474

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+QF+E LSGY
Sbjct  475  HACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEQFREVLSGY  534

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  535  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  570



>ref|XP_009779284.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009779285.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLG+VLNTPEV R
Sbjct  253  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGRVLNTPEVTR  312

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  313  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  371

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  372  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  431

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  432  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  467



>ref|XP_009770780.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLG+VLNTPEV R
Sbjct  222  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGRVLNTPEVTR  281

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  282  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  340

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  341  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  400

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  401  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  436



>ref|XP_009770779.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLG+VLNTPEV R
Sbjct  253  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGRVLNTPEVTR  312

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  313  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  371

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  372  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  431

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  432  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  467



>ref|XP_009361045.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=546

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  332  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+GRELFE+EQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPVNEAA-TGPVGRELFEREQEDLLADLKDIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GK+K Q++LIDNL +EF+KVQ+E+HLP GDFPNVD +KE L+GY
Sbjct  451  HAYIISHLRKEMPAMLGKSKAQRKLIDNLENEFKKVQREHHLPPGDFPNVDHYKEILTGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+ E LKPKMI  VD+MLGYDIP+LLK FRNPYD
Sbjct  511  SIDKLERLKPKMIDAVDEMLGYDIPELLKKFRNPYD  546



>ref|XP_009334157.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  332  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPVNEAA-TGPVGKELFEKEQEDLLADLKDIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+++GKAK QQRLIDNL DEF+KVQ+E+HLP GDFP+VD F++ LSGY
Sbjct  451  HAYIISHLKKEMPAILGKAKAQQRLIDNLEDEFKKVQREHHLPPGDFPDVDHFRDILSGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID FE LKPKMI  VD+MLGYDIP+LLK+FRNPYD
Sbjct  511  SIDNFEKLKPKMIDAVDEMLGYDIPELLKNFRNPYD  546



>ref|XP_009111206.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Brassica 
rapa]
Length=470

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  256  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  315

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  316  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  374

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP G FPNV+QF+E LSGY
Sbjct  375  HACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGVFPNVEQFREVLSGY  434

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  435  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  470



>ref|XP_009348303.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  332  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPVNEAA-TGPVGKELFEKEQEDLLADLKDIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+++GKAK QQRLIDNL DEF+KVQ+E+HLP GDFP+VD F++ LSGY
Sbjct  451  HAYIISHLKKEMPAILGKAKAQQRLIDNLEDEFKKVQREHHLPPGDFPDVDHFRDILSGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID FE LKPKMI  VD+MLGYDIP+LLK+FRNPYD
Sbjct  511  SIDNFEKLKPKMIDAVDEMLGYDIPELLKNFRNPYD  546



>ref|XP_010466211.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDK RVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKSRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLKKEMPTLMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP LLKSF+NPYD
Sbjct  510  NIDKFEKLKPKMLQTVDDMLGYDIPQLLKSFKNPYD  545



>ref|XP_008359253.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=546

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAA-TGPVGKELFEKEQEDLLADLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+++GKAK QQRLIDNL DEF+KVQ+E+HLP GDFP+VD F++ LSGY
Sbjct  450  HAYIISHLKKEMPAILGKAKAQQRLIDNLEDEFKKVQREHHLPPGDFPDVDHFRDILSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID FE LKPKMI  VD+MLGYDIP+LLK+FRNPYD
Sbjct  510  SIDNFEKLKPKMIDAVDEMLGYDIPELLKNFRNPYD  545



>ref|XP_008226997.1| PREDICTED: EH domain-containing protein 1 [Prunus mume]
Length=545

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQEDLL DLKDIPK++CDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAA-TGPVGKELFEKEQEDLLADLKDIPKKSCDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLP GDFP+VD F++ LSGY
Sbjct  450  HAYIISHLKKEMPAMLGKAKTQQRLIDNLEDEFGKVQREFHLPPGDFPDVDHFRDILSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMI+ VD+MLGYDIP+LLK+FRNPY
Sbjct  510  NIDKFEKLKPKMIEAVDEMLGYDIPELLKNFRNPY  544



>ref|XP_010665753.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI+  A  GP+GR+LFE+EQ DLLNDLKDIPK+ACDRRINE+VKRAR+AKI
Sbjct  389  VYIGSFNDKPIDAEAV-GPMGRDLFEREQNDLLNDLKDIPKKACDRRINEYVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPSMMGKAK QQRLIDNL DEF KVQ+E+HLPAGDFP ++ F+E L GY
Sbjct  448  HAYIISHLKKEMPSMMGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFPYLEHFREVLGGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  508  SIDKFEKLKPKMIQNVDDMLGYDIPELLKNFRNPYE  543



>ref|XP_007213895.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
 gb|EMJ15094.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
Length=545

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQEDLL DLKDIPK++CDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAA-TGPVGKELFEKEQEDLLADLKDIPKKSCDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQRLIDNL DEF KVQ+E+HLP GDFP+VD F++ LSGY
Sbjct  450  HAYIISHLKKEMPAMLGKAKTQQRLIDNLEDEFGKVQREFHLPPGDFPDVDHFRDILSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMI+ VD+MLGYDIP+LLK+FRNPY
Sbjct  510  NIDKFEKLKPKMIEAVDEMLGYDIPELLKNFRNPY  544



>ref|XP_003574764.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 198/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG++LFEKEQEDLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNESAV-GPIGKDLFEKEQEDLLADLKDIPKKACDRRVNEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP++MGKAK QQRLIDNL DEF KVQ+EYHLPAGDFP+ + FKE L GY
Sbjct  450  HAYIIGHLKKEMPAVMGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFPDAEHFKEVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE +KPKM+Q VDDML YDIP+LLK+  NPY
Sbjct  510  SIDKFEKMKPKMVQAVDDMLAYDIPELLKNLSNPY  544



>ref|XP_002264320.1| PREDICTED: EH domain-containing protein 3-like [Vitis vinifera]
Length=545

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG++LFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAAV-GPIGKDLFEKEQDDLLADLIDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRL DNL DEF K+Q+E+HLPAGDFPNV+ F+E L+GY
Sbjct  450  HAYIISHLKKEMPAMMGKAKAQQRLTDNLEDEFAKIQREFHLPAGDFPNVEHFREVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>ref|XP_009770782.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
sylvestris]
Length=543

 Score =   383 bits (984),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  508  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  543



>ref|XP_006406401.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47854.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=545

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFE EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFSDKPINEAA-TGPIGRELFEMEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E L GY
Sbjct  450  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEHFREVLIGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  510  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_009776638.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=546

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  332  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  451  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  511  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  546



>ref|XP_009598338.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  450  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_007154000.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25994.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=543

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI +L GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  329  HKLDISDEFKRVIGALHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE  + GP G+ELFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  389  VYIGSFNDKPINE-GFVGPFGQELFEKEQNDLLADLVDIPRKACDSRINEFVKRARSAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLR EMP+MMGKAK QQRLI+NL DEF+KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLRNEMPAMMGKAKAQQRLIENLEDEFRKVQREFHLPAGDFPNVEHFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPYD
Sbjct  508  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  543



>gb|AFK42442.1| unknown [Medicago truncatula]
Length=543

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+ A  GPIG+ELFEKEQEDLL+DLKDIPK ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPVND-AVSGPIGKELFEKEQEDLLSDLKDIPKAACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQ+LIDNLA EF KVQ+E+HLP  DFPNV+ F+E+LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKAKAQQKLIDNLAGEFGKVQREFHLPPSDFPNVEHFRESLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDML YDIP+LLK+F+NPYD
Sbjct  508  NIDKFEKLKPKMLQVVDDMLAYDIPNLLKNFKNPYD  543



>ref|XP_009598337.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=546

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  332  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  451  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  511  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  546



>ref|XP_009776639.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=545

 Score =   383 bits (983),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  450  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_002453335.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
 gb|EES06311.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
Length=547

 Score =   383 bits (983),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N++A  GPIG++LFE+EQ+DLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNDSAV-GPIGKDLFEREQDDLLCDLKDIPKKACDRRVNEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL +EF KVQ+EYHLPAGDFP+V+ FK+ L GY
Sbjct  452  HAYIIGHLKKEMPAMMGKAKAQQRLIDNLGEEFAKVQREYHLPAGDFPDVEHFKQVLGGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDML +DIP+LLK+FRNPY+
Sbjct  512  SIDKFEKLKPKMVQAVDDMLAHDIPELLKNFRNPYE  547



>gb|EMT01492.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=556

 Score =   383 bits (984),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  342  HKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  401

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG+ELFEKEQEDLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  402  VYIGSFNDKPVNESAV-GPIGKELFEKEQEDLLADLKDIPKKACDRRVNEFVKRARAAKI  460

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII  L+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFP+V+ FK+ L+GY
Sbjct  461  HAYIIGQLKKEMPAMMGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFPDVEHFKQVLAGY  520

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE +KPKM+Q VDDML +DIPDLLK+F NPY
Sbjct  521  SIDKFEKMKPKMVQAVDDMLAHDIPDLLKNFSNPY  555



>emb|CBI35707.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  361  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  420

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG++LFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  421  VYIGSFNDKPVNEAAV-GPIGKDLFEKEQDDLLADLIDIPKKACDRRINEFVKRARAAKI  479

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRL DNL DEF K+Q+E+HLPAGDFPNV+ F+E L+GY
Sbjct  480  HAYIISHLKKEMPAMMGKAKAQQRLTDNLEDEFAKIQREFHLPAGDFPNVEHFREVLNGY  539

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  540  SIDKFEKLKPKMIQAVDDMLGYDIPELLKNFRNPYE  575



>ref|XP_009145649.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=544

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE +  GPIGRELFE EQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFSDKPINEVS-TGPIGRELFEMEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNVDQF+E LSGY
Sbjct  449  HAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFPNVDQFREVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  509  NFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  544



>ref|XP_009145648.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=545

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE +  GPIGRELFE EQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFSDKPINEVS-TGPIGRELFEMEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNVDQF+E LSGY
Sbjct  450  HAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFPNVDQFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  510  NFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  545



>ref|XP_009145651.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Brassica 
rapa]
Length=543

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  329  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE +  GPIGRELFE EQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFSDKPINEVS-TGPIGRELFEMEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNVDQF+E LSGY
Sbjct  448  HAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFPNVDQFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  508  NFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  543



>ref|XP_009145650.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Brassica 
rapa]
Length=544

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE +  GPIGRELFE EQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFSDKPINEVS-TGPIGRELFEMEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNVDQF+E LSGY
Sbjct  449  HAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFPNVDQFREVLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  509  NFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  544



>ref|XP_009770776.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770777.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770778.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLG+VLNTPEV R
Sbjct  329  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGRVLNTPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  508  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  543



>ref|XP_009111201.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Brassica 
rapa]
Length=546

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  332  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP G FPNV+QF+E LSGY
Sbjct  451  HACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGVFPNVEQFREVLSGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP+LLK+FRNPYD
Sbjct  511  NIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  546



>ref|XP_003529656.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFN KPINE  + GP+G+ELFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  391  VYIGSFNVKPINE-GFVGPLGQELFEKEQNDLLADLVDIPRKACDSRINEFVKRARSAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLR EMP+MMGKAK QQRLIDNL DEF+KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREFHLPAGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPYD
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  545



>ref|XP_010324305.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
lycopersicum]
Length=545

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+ E A  GP+G+ELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPMREAAA-GPLGKELFEKEQDDLLTDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  450  HAYIISHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_009779278.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779279.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779280.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779281.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779282.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779283.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLG+VLNTPEV R
Sbjct  329  HKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGRVLNTPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKNIPKKACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QKE+HLPAGDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFPNVEHFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  508  SIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  543



>ref|XP_004951833.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=597

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  383  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  442

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG++LFE+EQ+DLL DLKDIPK+ACDR++NEFVKRAR+AKI
Sbjct  443  VYIGSFNDKPVNETAV-GPIGKDLFEREQDDLLCDLKDIPKKACDRQVNEFVKRARAAKI  501

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFP+V+ FK+ L GY
Sbjct  502  HAYIIGHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREYHLPAGDFPDVEHFKQVLGGY  561

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDML YDIP+LLK+F+NPY+
Sbjct  562  NIDKFEKLKPKMVQAVDDMLAYDIPELLKNFKNPYE  597



>ref|XP_010324304.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
lycopersicum]
Length=554

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  340  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVAR  399

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+ E A  GP+G+ELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  400  VYIGSFNDKPMREAAA-GPLGKELFEKEQDDLLTDLKDIPKKACDRRINEFVKRARAAKI  458

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  459  HAYIISHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  518

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  519  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  554



>ref|XP_010052899.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW77035.1| hypothetical protein EUGRSUZ_D01381 [Eucalyptus grandis]
Length=547

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  333  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+    GPIGR+LFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNDGIV-GPIGRDLFEKEQDDLLADLIDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ++YHLPAGDFP+VD F+E LSGY
Sbjct  452  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQRDYHLPAGDFPSVDHFREVLSGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY+
Sbjct  512  NIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  547



>ref|XP_010928404.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=545

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  331  HKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +NE A  GP+G+ELFE+EQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKLVNEAAV-GPVGKELFEREQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLID+L DEF KVQ+E+HLP GDFPN D F+E LSGY
Sbjct  450  HAYIISHLKKEMPAMMGKAKTQQRLIDDLEDEFAKVQREFHLPIGDFPNADHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML YDIP+LL+ FRNPYD
Sbjct  510  NIDKFEKLKPKMIQAVDDMLAYDIPELLQRFRNPYD  545



>emb|CDY29816.1| BnaC05g31740D [Brassica napus]
Length=526

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  312  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  371

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE +  GPIGRELFE EQEDLL+DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  372  VYIGSFSDKPINEVS-TGPIGRELFEMEQEDLLSDLKNIPKKACDRRINEFVKRARAAKI  430

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+L+DNL D F KVQ+E+HLP GDFPNVD F+E LSGY
Sbjct  431  HAYIISHLKKEMPAIMGKAKAQQKLMDNLEDVFGKVQREHHLPKGDFPNVDHFREVLSGY  490

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKM+QTVDDMLGYDIP+LLK+F+NPYD
Sbjct  491  NFDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  526



>ref|XP_006346193.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+ E A  GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPMREAAA-GPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  450  HAYIISHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  510  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_004157728.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIGSLRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIGR+LF KEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNE-ASVGPIGRDLFVKEQDDLLADLIDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFPNV+ F+E L+GY
Sbjct  450  HAYIMSHLKKEMPAMMGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFPNVEHFREVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+F+NPY+
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYDIPELLKNFKNPYE  545



>ref|XP_008458980.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=545

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIGSLRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIGR+LF KEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNE-ASVGPIGRDLFVKEQDDLLADLIDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFPNV+ F+E L+GY
Sbjct  450  HAYIMSHLKKEMPAMMGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFPNVEHFREVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+F+NPY+
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYDIPELLKNFKNPYE  545



>dbj|BAJ86819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  333  HKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG+ELFEKEQEDLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNESAV-GPIGKELFEKEQEDLLADLKDIPKKACDRRVNEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII  L+KEMP+M+GKAK QQRLIDNL DEF KVQ+EYHLPAGDFP+V+ FK+ L+GY
Sbjct  452  HAYIIGQLKKEMPAMIGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFPDVEHFKQVLAGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE +KPKM+Q VDDML +DIPDLLK+F NPY
Sbjct  512  SIDKFEKIKPKMVQAVDDMLAHDIPDLLKNFSNPY  546



>ref|XP_003563453.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNESAV-GPIGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+ +MP+MMGKAK QQRLIDNL DEF KVQ+E+HLPAGDFP V+ FK+ L GY
Sbjct  450  HAYIIGHLKNQMPTMMGKAKAQQRLIDNLQDEFAKVQREHHLPAGDFPYVEHFKDVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  510  SIDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>ref|XP_010422242.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=428

 Score =   377 bits (968),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  214  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  273

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  274  VYIGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  332

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHLRKEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  333  NAYIMSHLRKEMPAMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFPSVEHFREVLGGY  392

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  393  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  428



>ref|XP_004145425.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIGSLRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIGR+LF KEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNE-ASVGPIGRDLFVKEQDDLLADLIDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+EYHLPAGDFPNV+ F+E L+GY
Sbjct  450  HAYIMSHLKKEMPAMMGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFPNVEHFREVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIP+LLK+F+NPY+
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYDIPELLKNFKNPYE  545



>ref|XP_007142331.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
 gb|ESW14325.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
Length=543

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVL TPEVMR
Sbjct  329  HKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLKTPEVMR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+D P+N+ A  GP+G+ELFEKEQ+DLL+DLKDIPK ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFSDNPVNDAA-TGPLGKELFEKEQDDLLSDLKDIPKAACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GK+K QQ+LIDNLA EF KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMIGKSKAQQKLIDNLAAEFGKVQREFHLPAGDFPNVEYFRERLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML YDIP+LLKSFRNPYD
Sbjct  508  NIDKFEKLKPKMIQAVDDMLAYDIPNLLKSFRNPYD  543



>ref|XP_003550477.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIGSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN+  + GP+G+ELFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  391  VYIGSFNDKPINK-GFVGPLGQELFEKEQNDLLADLVDIPRKACDSRINEFVKRARSAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLR EMP+MMGKAK QQRLIDNL DEF+KVQ+EYHLPAGDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREYHLPAGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPY
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPY  544



>dbj|BAJ95881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+ E+A  GPIG+ELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVKESAV-GPIGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+ +MPSMMGKAK QQ+LIDNL DEF KVQ+E+HLPAGDFP V+ F+E L GY
Sbjct  450  HAYIIGHLKNQMPSMMGKAKAQQKLIDNLEDEFAKVQREHHLPAGDFPYVEHFREALGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  510  SIDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>ref|XP_011097835.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Sesamum 
indicum]
Length=538

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  324  HKLDISDEFKRVIESLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  383

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E    GP+G+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  384  VYIGSFNDKPIREGV-GGPMGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  442

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLR EMP+M+GKAK Q+RLID+L DEF KVQ+E+HLPAGDFP+V+ F+E LSGY
Sbjct  443  HAYIIGHLRNEMPTMIGKAKTQKRLIDDLGDEFAKVQREHHLPAGDFPDVEHFRELLSGY  502

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             IDRFE LKPKMIQ+VDDML +DIP LL+ FRNPYD
Sbjct  503  SIDRFERLKPKMIQSVDDMLAHDIPQLLQKFRNPYD  538



>ref|XP_011097837.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Sesamum 
indicum]
Length=537

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  323  HKLDISDEFKRVIESLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVMR  382

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E    GP+G+ELFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  383  VYIGSFNDKPIREGV-GGPMGKELFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  441

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLR EMP+M+GKAK Q+RLID+L DEF KVQ+E+HLPAGDFP+V+ F+E LSGY
Sbjct  442  HAYIIGHLRNEMPTMIGKAKTQKRLIDDLGDEFAKVQREHHLPAGDFPDVEHFRELLSGY  501

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             IDRFE LKPKMIQ+VDDML +DIP LL+ FRNPYD
Sbjct  502  SIDRFERLKPKMIQSVDDMLAHDIPQLLQKFRNPYD  537



>ref|XP_006287437.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
 gb|EOA20335.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
Length=545

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+EYHLPAGDFP+V+ F+E L GY
Sbjct  450  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREYHLPAGDFPSVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>gb|KHN03510.1| EH domain-containing protein 1 [Glycine soja]
Length=545

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL GHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLG+VLNTPEV+R
Sbjct  331  HKLDISDEFKRVIGSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGRVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN+  + GP+G+ELFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  391  VYIGSFNDKPINK-GFVGPLGQELFEKEQNDLLADLVDIPRKACDSRINEFVKRARSAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLR EMP+MMGKAK QQRLIDNL DEF+KVQ+EYHLPAGDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREYHLPAGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPY
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPY  544



>gb|EPS68571.1| hypothetical protein M569_06192, partial [Genlisea aurea]
Length=541

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN N   GP+G +LFEKEQEDLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINVNVV-GPLGGDLFEKEQEDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+K MP+MMGKAK QQ+LIDNLADEF KVQ+E+HLP GDFPN++ F++TL GY
Sbjct  449  HACIISHLKKAMPAMMGKAKAQQKLIDNLADEFAKVQREHHLPVGDFPNMEHFRDTLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRN  640
             ID+FE LKPKMIQTVDDMLGYDIP+LLK+FRN
Sbjct  509  NIDKFEKLKPKMIQTVDDMLGYDIPELLKNFRN  541



>ref|XP_003610495.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES92692.1| calcium-binding EF hand protein [Medicago truncatula]
Length=542

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  328  HKLDISDEFKRVIYSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVVR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE  + GP+G+ELF+KEQ DLL+DL DIP++ACD RINEFVKRARSAKI
Sbjct  388  VYIGSFNDKPINE-GFVGPLGQELFKKEQNDLLSDLVDIPRKACDGRINEFVKRARSAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+ EMP+MMGKAKVQQRLIDNL DEF+KVQ+E+HLPAGDFPN+D F+E LS Y
Sbjct  447  HAYIVSHLKMEMPAMMGKAKVQQRLIDNLEDEFKKVQREFHLPAGDFPNIDHFREVLSSY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+F+ LKPKMIQ VDDMLGY+IP+LLK FRNPYD
Sbjct  507  SIDKFDKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  542



>gb|KHN38249.1| EH domain-containing protein 1 [Glycine soja]
Length=546

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVL TPEVMR
Sbjct  332  HKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLKTPEVMR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+ A  GP+G+ELFEKEQ+DLL+DLKD+PK ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPVNDAA-TGPLGKELFEKEQDDLLSDLKDVPKAACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQ+LIDNLA EF KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  451  HAYIISHLKKEMPAMIGKAKAQQKLIDNLAAEFGKVQREFHLPPGDFPNVEFFRERLSGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM Q VDDML YDIP+LLK+FRNPYD
Sbjct  511  NIDKFEKLKPKMTQAVDDMLAYDIPNLLKNFRNPYD  546



>gb|KDP20684.1| hypothetical protein JCGZ_21155 [Jatropha curcas]
Length=545

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 199/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE   + P+  ELFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEETVN-PMFLELFEKEQDDLLMDLVDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNVD FKE L+GY
Sbjct  450  HAYIISHLKKEMPAIMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFPNVDHFKEVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPY  544



>ref|NP_001140588.1| uncharacterized protein LOC100272658 [Zea mays]
 gb|ACF84132.1| unknown [Zea mays]
 gb|AFW66483.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N++A  GPIG++LFE+EQ+DLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNDSAV-GPIGKDLFEREQDDLLCDLKDIPKKACDRRVNEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+MMGKAK QQRLIDNL +EF KVQ+EYHLPAGDFP+V+ FK+ L GY
Sbjct  452  HAYIIGHLKKEMPAMMGKAKAQQRLIDNLDEEFAKVQREYHLPAGDFPDVEHFKQVLGGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDML +DIP+LLK+ RNPY+
Sbjct  512  SIDKFEKLKPKMVQAVDDMLAHDIPELLKNLRNPYE  547



>ref|XP_003519595.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=543

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVL TPEVMR
Sbjct  329  HKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLKTPEVMR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+ A  GP+G+ELFEKEQ+DLL+DLKD+PK ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPVNDAA-TGPLGKELFEKEQDDLLSDLKDVPKAACDRRINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+M+GKAK QQ+LIDNLA EF KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMIGKAKAQQKLIDNLAAEFGKVQREFHLPPGDFPNVEFFRERLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM Q VDDML YDIP+LLK+FRNPYD
Sbjct  508  NIDKFEKLKPKMTQAVDDMLAYDIPNLLKNFRNPYD  543



>ref|XP_002874791.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51050.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE+A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEDAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  450  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFPSVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|XP_010455720.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   378 bits (971),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  330  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  449  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFPSVEHFREVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  509  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  544



>ref|NP_567299.2| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 gb|ACE79044.1| At4g05520 [Arabidopsis thaliana]
 gb|AEE82529.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=546

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL D+PK+ACDR+INEFVKRARSAKI
Sbjct  391  VYIGSFNDKPINEVAV-GPIGKELFEKEQNDLLADLMDVPKKACDRKINEFVKRARSAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  450  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFPSVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|NP_974517.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 gb|AEE82530.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=545

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  330  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL D+PK+ACDR+INEFVKRARSAKI
Sbjct  390  VYIGSFNDKPINEVAV-GPIGKELFEKEQNDLLADLMDVPKKACDRKINEFVKRARSAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  449  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFPSVEHFREVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  509  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  544



>ref|NP_001058410.1| Os06g0687800 [Oryza sativa Japonica Group]
 dbj|BAD45606.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAD46062.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAF20324.1| Os06g0687800 [Oryza sativa Japonica Group]
 gb|EAZ38080.1| hypothetical protein OsJ_22427 [Oryza sativa Japonica Group]
 dbj|BAG93051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNESAV-GPIGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+II HL+KEMP+MMGKAK QQRLIDNL +EF KVQ+E HLPAGDFP V+ F++ L GY
Sbjct  449  HAHIIGHLKKEMPAMMGKAKAQQRLIDNLENEFAKVQREQHLPAGDFPYVEHFRDVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKM+Q VDDMLGYDIP+LLK+FRNPY+
Sbjct  509  SIDKFEKIKPKMVQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_010455719.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  450  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFPSVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>gb|EMT05303.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=545

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+ E+A  GPIG+ELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVKESAV-GPIGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+ +MP+MMGKAK QQ+LIDNL  EF KVQ+E+HLPAGDFP V+ F+E L GY
Sbjct  450  HAYIIGHLKNQMPTMMGKAKAQQKLIDNLEGEFAKVQREHHLPAGDFPYVEHFREALGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             IDRFE +KPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  510  SIDRFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>gb|EMS68080.1| EH domain-containing protein 1 [Triticum urartu]
Length=545

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+ E+A  GPIG+ELFEKEQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVKESAV-GPIGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+ +MP+MMGKAK QQ+LIDNL  EF KVQ+E+HLPAGDFP V+ F+E L GY
Sbjct  450  HAYIIGHLKNQMPTMMGKAKAQQKLIDNLEGEFAKVQREHHLPAGDFPYVEHFREALGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             IDRFE +KPKMIQ VDDMLGYDIP+LLK+FRNPY+
Sbjct  510  SIDRFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>ref|XP_010433113.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  450  NAYIMSHLKKEMPTMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFPSVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDMLGYDIPDLLK FRNPYD
Sbjct  510  NIDKFEKLKPKMVQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|XP_010433120.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  330  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMDIPKKACDRKINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ F+E L GY
Sbjct  449  NAYIMSHLKKEMPTMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFPSVEHFREVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDMLGYDIPDLLK FRNPYD
Sbjct  509  NIDKFEKLKPKMVQAVDDMLGYDIPDLLKKFRNPYD  544



>gb|EAZ02155.1| hypothetical protein OsI_24244 [Oryza sativa Indica Group]
Length=544

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNESAV-GPIGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+II HL+KEMP+MMGKAK QQRLIDNL  EF KVQ+E HLPAGDFP V+ F++ L GY
Sbjct  449  HAHIIGHLKKEMPAMMGKAKAQQRLIDNLETEFAKVQREQHLPAGDFPYVEHFRDVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKM+Q VDDMLGYDIP+LLK+FRNPY+
Sbjct  509  SIDKFEKIKPKMVQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_004507655.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Cicer 
arietinum]
Length=542

 Score =   377 bits (969),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  328  HKLDVSDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVVR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE +  GP+G+ LFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  388  VYIGSFNDKPINEGSV-GPLGQALFEKEQNDLLADLVDIPRKACDGRINEFVKRARSAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP+M+GKAK QQRLIDNL DEF+KVQ+E+HLPAGDFPNVD F+E L+GY
Sbjct  447  HAYIISHLKMEMPAMIGKAKAQQRLIDNLEDEFKKVQREFHLPAGDFPNVDHFREVLNGY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IPDLL  FRNPY
Sbjct  507  SIDKFEKLKPKMIQAVDDMLGYEIPDLLNKFRNPY  541



>ref|XP_009357511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=481

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  267  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  326

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE    GPIG+ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  327  VYIGSFNDKPVNEGVV-GPIGKELFEKEQDDLLSDLVDIPKKACDRRINEFVKRARAAKI  385

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP++MGK+K Q++LIDNL +EF KVQ+++HLPAGDFP+V+ F+E L GY
Sbjct  386  HAYIMSHLKKEMPAVMGKSKAQRKLIDNLEEEFAKVQRDFHLPAGDFPDVEHFREVLGGY  445

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+F+ LKPKMIQ VDDMLGYDIP+LLK FRNPY+
Sbjct  446  SIDKFDKLKPKMIQAVDDMLGYDIPELLKKFRNPYN  481



>ref|NP_001266688.1| EH-domain-containing protein 1 [Zea mays]
 gb|ACG43126.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  333  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N++A  GPIG++LFE+EQ+DLL DLKDIPK+ACDRR+NEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNDSAV-GPIGKDLFEREQDDLLCDLKDIPKKACDRRVNEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP++MGKAK QQRLIDNL +EF KVQ+EYHLPAGDFP+V+ FK+ L GY
Sbjct  452  HAYIIGHLKKEMPAVMGKAKAQQRLIDNLEEEFAKVQREYHLPAGDFPDVEHFKQVLGGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+Q VDDML +DIP+LLK+ RNPY+
Sbjct  512  SIDKFEKLKPKMVQAVDDMLAHDIPELLKNLRNPYE  547



>ref|XP_006657273.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=545

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GPIG+ELFE+EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNESAV-GPIGKELFEREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+II HL+KEMP+MMGKAK QQRLIDNL  EF KVQ+E HLPAGDFP V+ +K+ L GY
Sbjct  450  HAHIIGHLKKEMPAMMGKAKAQQRLIDNLETEFAKVQREQHLPAGDFPYVEHYKDVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKM+Q VDDMLGYDIP++LK+FRNPY+
Sbjct  510  SIDKFEKIKPKMVQAVDDMLGYDIPEVLKNFRNPYE  545



>gb|KHN28769.1| EH domain-containing protein 1 [Glycine soja]
Length=822

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  608  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVVR  667

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFN KPINE  + GP+G+ELFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  668  VYIGSFNVKPINE-GFVGPLGQELFEKEQNDLLADLVDIPRKACDSRINEFVKRARSAKI  726

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLR EMP+MMGKAK QQRLIDNL DEF+KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  727  HAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREFHLPAGDFPNVEHFREVLSGY  786

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPYD
Sbjct  787  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  822



>ref|XP_007211540.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
 gb|EMJ12739.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
Length=537

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  323  HKLDISDEFKRVITSLSGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  382

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GP+G+ELFEKEQ +LL DL DIPK+ACDRRINEFVKRAR+AK 
Sbjct  383  VYIGSFNDKPVNESAV-GPMGKELFEKEQNNLLADLVDIPKKACDRRINEFVKRARAAKT  441

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRL+DNL DEF KVQ+++HLPAGDFP+V+ FKE L GY
Sbjct  442  HAYIISHLKKEMPAMMGKAKTQQRLMDNLEDEFAKVQRDFHLPAGDFPDVEHFKEVLKGY  501

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLG +IP+LLK+FRNPYD
Sbjct  502  NIDKFEKLKPKMIQAVDDMLGREIPELLKNFRNPYD  537



>ref|XP_004500109.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 198/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNK+DQVDTQQLMR+YGALMWSLGKVLN PEVMR
Sbjct  328  HKLDISDEFKRVISSLRGHDDKIRVVLNKSDQVDTQQLMRIYGALMWSLGKVLNIPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+ A +G +G ELFE+EQ+DLL+DLKDIPK+ACDR+INEFVKRAR+AKI
Sbjct  388  VYIGSFNDKPVNDRA-NGLLGNELFEREQDDLLSDLKDIPKKACDRKINEFVKRARAAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+K+MP+MMGKAK QQ+LIDNL  EF KVQ+EYHLP GDFPNVD FKE LSGY
Sbjct  447  HAYIISHLKKQMPTMMGKAKAQQKLIDNLEGEFAKVQREYHLPPGDFPNVDHFKEVLSGY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPK IQ VDDML +DIP+LLKSFRNPY
Sbjct  507  NIDKFEKLKPKAIQAVDDMLAHDIPNLLKSFRNPY  541



>ref|XP_006352528.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
tuberosum]
Length=541

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKAD+VDTQQLMRVYGALMWSLGKV NTPEV R
Sbjct  327  HKLDISDEFKRVIASLQGHDDKIRVVLNKADKVDTQQLMRVYGALMWSLGKVQNTPEVSR  386

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND PINE+   GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AK+
Sbjct  387  VYIGSFNDSPINED-LTGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKV  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGK+K Q+RLIDNLADEF K+QKE+HLPAGDFP+V+ F+E LSGY
Sbjct  446  HAYIISHLKKEMPAMMGKSKTQKRLIDNLADEFVKIQKEHHLPAGDFPDVEHFREILSGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F+NPY+
Sbjct  506  NIDKFEKLKPKLIQAVDDMLGYDIPELLKNFKNPYE  541



>ref|XP_006352527.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKAD+VDTQQLMRVYGALMWSLGKV NTPEV R
Sbjct  329  HKLDISDEFKRVIASLQGHDDKIRVVLNKADKVDTQQLMRVYGALMWSLGKVQNTPEVSR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND PINE+   GP+G+ELFEKEQ+DLL DLK+IPK+ACDRRINEFVKRAR+AK+
Sbjct  389  VYIGSFNDSPINED-LTGPLGKELFEKEQDDLLTDLKNIPKKACDRRINEFVKRARAAKV  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGK+K Q+RLIDNLADEF K+QKE+HLPAGDFP+V+ F+E LSGY
Sbjct  448  HAYIISHLKKEMPAMMGKSKTQKRLIDNLADEFVKIQKEHHLPAGDFPDVEHFREILSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F+NPY+
Sbjct  508  NIDKFEKLKPKLIQAVDDMLGYDIPELLKNFKNPYE  543



>emb|CDX94536.1| BnaC09g23000D [Brassica napus]
Length=547

 Score =   375 bits (964),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DL+ DL  IPK+ACDR+INEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPINE-AVVGPIGKELFEKEQNDLITDLMTIPKKACDRKINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL  EF+KVQ+EYHLPAGDFP+V+ F+E L GY
Sbjct  452  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFPSVEHFREVLGGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPY+
Sbjct  512  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  547



>ref|XP_009114592.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=546

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  332  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DL+ DL  IPK+ACDR+INEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPINE-AVVGPIGKELFEKEQNDLITDLMTIPKKACDRKINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL  EF+KVQ+EYHLPAGDFP+V+ F+E L GY
Sbjct  451  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFPSVEHFREVLGGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPY+
Sbjct  511  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  546



>ref|XP_008384122.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=541

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  327  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  386

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE    GPIG+ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  387  VYIGSFNDKPVNEGVV-GPIGKELFEKEQDDLLSDLVDIPKKACDRRINEFVKRARAAKI  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP++MGK+K Q++LIDNL +EF KVQ+++HLPAGDFP+V+ F+E L GY
Sbjct  446  HAYIMSHLKKEMPAVMGKSKAQRKLIDNLEEEFAKVQRDFHLPAGDFPDVEHFREVLGGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+F+ LKPKMIQ VDDMLGYDIP+LLK FRNPY+
Sbjct  506  SIDKFDKLKPKMIQAVDDMLGYDIPELLKKFRNPYN  541



>emb|CDY16689.1| BnaA09g20670D [Brassica napus]
Length=546

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  332  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DL+ DL  IPK+ACDR+INEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPINE-AVVGPIGKELFEKEQNDLITDLMTIPKKACDRKINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL  EF+KVQ+EYHLPAGDFP+V+ F+E L GY
Sbjct  451  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFPSVEHFREVLGGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPY+
Sbjct  511  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  546



>ref|XP_009357509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  327  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  386

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE    GPIG+ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  387  VYIGSFNDKPVNEGVV-GPIGKELFEKEQDDLLSDLVDIPKKACDRRINEFVKRARAAKI  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP++MGK+K Q++LIDNL +EF KVQ+++HLPAGDFP+V+ F+E L GY
Sbjct  446  HAYIMSHLKKEMPAVMGKSKAQRKLIDNLEEEFAKVQRDFHLPAGDFPDVEHFREVLGGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+F+ LKPKMIQ VDDMLGYDIP+LLK FRNPY+
Sbjct  506  SIDKFDKLKPKMIQAVDDMLGYDIPELLKKFRNPYN  541



>ref|XP_008224739.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
 ref|XP_008224740.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
Length=537

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  323  HKLDISDEFKRVITSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  382

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+A  GP+G+ELFEKEQ DLL DL DIPK+ACDRRINEFVKRAR+AK 
Sbjct  383  VYIGSFNDKPVNESAV-GPMGKELFEKEQNDLLADLVDIPKKACDRRINEFVKRARAAKT  441

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGK K QQRL+DNL DEF KVQ+++HLPAGDFP+V+ F+E L GY
Sbjct  442  HAYIISHLKKEMPAMMGKTKTQQRLMDNLEDEFAKVQRDFHLPAGDFPDVEHFREVLKGY  501

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLG +IP+LLK+FRNPYD
Sbjct  502  NIDKFEKLKPKMIQAVDDMLGREIPELLKNFRNPYD  537



>ref|XP_004293342.1| PREDICTED: EH domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=543

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  329  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+GRELFE EQ DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPVNEEAV-GPMGRELFEMEQGDLLADLVDIPKKACDRQINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGK+K Q+RL++NL +EF KVQ+EYHLP GDFPNV+QF+E LS Y
Sbjct  448  HAYIISHLKKEMPAMMGKSKTQKRLLENLEEEFAKVQREYHLPPGDFPNVEQFREVLSNY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +KPKMIQ VDDMLGY+IP+LLK+ RNPYD
Sbjct  508  NIDKFEKVKPKMIQAVDDMLGYEIPELLKNLRNPYD  543



>ref|XP_009114593.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=545

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A  GPIG+ELFEKEQ DL+ DL  IPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINE-AVVGPIGKELFEKEQNDLITDLMTIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL  EF+KVQ+EYHLPAGDFP+V+ F+E L GY
Sbjct  450  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFPSVEHFREVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPY+
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  545



>gb|KFK39351.1| hypothetical protein AALP_AA3G233100 [Arabis alpina]
Length=543

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  329  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPIN+ +  GPIGRELFE EQ+DLL+DLKDIPK+ACDRRINEFVKRA++AKI
Sbjct  389  VYIGSFSDKPINK-SLTGPIGRELFEMEQDDLLSDLKDIPKKACDRRINEFVKRAKAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  448  HACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFAKVQREHHLPKGDFPNVEHFREVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKM+QTVD+MLGYDIP+LLK+F NPY
Sbjct  508  NIDKFEKLKPKMLQTVDEMLGYDIPELLKTFGNPY  542



>ref|XP_009390979.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=539

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            +KLDISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  325  YKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLWSLGKVLNTPEVMR  384

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELF +EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  385  VYIGSFNDKPVNEAA-SGPIGKELFVREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  443

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPSMMGKAK QQRL+DNL DEF KVQKE+HLP GDFP+V+ F+E L+GY
Sbjct  444  HAYIISHLKKEMPSMMGKAKAQQRLVDNLEDEFVKVQKEFHLPPGDFPDVEHFREVLNGY  503

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE L+ KMIQ VDDML YDIP+LL  FRNPYD
Sbjct  504  NIDKFEKLRHKMIQAVDDMLAYDIPELLNRFRNPYD  539



>ref|XP_010675784.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  330  HKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+  NE A DGPIGRELFEKE +DL+ DLKDIPK+ACDRRINE+VKRAR+AKI
Sbjct  390  VYIGSFNDRTSNE-AIDGPIGRELFEKEHDDLIADLKDIPKKACDRRINEYVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP+M+GKAK QQRLIDNL DEF+KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  449  HAYIIGHLKKEMPAMIGKAKAQQRLIDNLEDEFRKVQREFHLPAGDFPNVEHFREVLRGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKP+ +Q VDDMLGYDIP+LL+SF+NPYD
Sbjct  509  NFDKFEKLKPQKVQAVDDMLGYDIPELLRSFKNPYD  544



>ref|XP_009390978.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            +KLDISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  330  YKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELF +EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNEAA-SGPIGKELFVREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPSMMGKAK QQRL+DNL DEF KVQKE+HLP GDFP+V+ F+E L+GY
Sbjct  449  HAYIISHLKKEMPSMMGKAKAQQRLVDNLEDEFVKVQKEFHLPPGDFPDVEHFREVLNGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE L+ KMIQ VDDML YDIP+LL  FRNPYD
Sbjct  509  NIDKFEKLRHKMIQAVDDMLAYDIPELLNRFRNPYD  544



>ref|XP_006449830.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
 gb|ESR63070.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
Length=547

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN     GPIG+ELFEKEQ+DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPINGEVV-GPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLP GDFPNV+ F+E L+ Y
Sbjct  452  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML Y+IP+LLK+FRNPY+
Sbjct  512  NIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE  547



>ref|XP_002316591.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE97203.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=525

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  311  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  370

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE      +  ELFEKEQ DLL DL DIPK+ACDRRINEFVKRAR+AK+
Sbjct  371  VYIGSFNDKPINEETAS-QMFCELFEKEQNDLLMDLVDIPKKACDRRINEFVKRARAAKM  429

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE L+GY
Sbjct  430  HAYIISHLKKEMPAIMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFPNVEHFKEVLNGY  489

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IP+LLKSFRNPY
Sbjct  490  SIDKFEKLKPKMIQAVDDMLGYEIPELLKSFRNPY  524



>ref|XP_009390977.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            +KLDISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  330  YKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG+ELF +EQ+DLL+DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKPVNEAA-SGPIGKELFVREQDDLLSDLKDIPKKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPSMMGKAK QQRL+DNL DEF KVQKE+HLP GDFP+V+ F+E L+GY
Sbjct  449  HAYIISHLKKEMPSMMGKAKAQQRLVDNLEDEFVKVQKEFHLPPGDFPDVEHFREVLNGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE L+ KMIQ VDDML YDIP+LL  FRNPYD
Sbjct  509  NIDKFEKLRHKMIQAVDDMLAYDIPELLNRFRNPYD  544



>gb|KDO78396.1| hypothetical protein CISIN_1g008954mg [Citrus sinensis]
Length=547

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN     GPIG+ELFEKEQ+DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPINGEVV-GPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLP GDFPNV+ F+E L+ Y
Sbjct  452  HAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML Y+IP+LLK+FRNPY+
Sbjct  512  NIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE  547



>gb|KFK32206.1| hypothetical protein AALP_AA6G211000 [Arabis alpina]
Length=545

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A DGP+G+ LFEKEQ DL+ DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINEAA-DGPLGKVLFEKEQNDLIADLMDIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP++MGK+K QQRL+DNL +EF KVQ+E+HLPAGDFP+V+ FKE L GY
Sbjct  450  NAYIMSHLKKEMPAVMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFPSVEHFKEVLGGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPY+
Sbjct  510  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  545



>ref|XP_010538746.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=543

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  329  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE+A  GP+G+ LF KEQ DLL DL +IPK+ACDR+INEFVKRAR+AKI
Sbjct  389  VYIGSFNDKPINESAV-GPLGKGLFVKEQNDLLADLMNIPKKACDRKINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI++HL+KEMP MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFPNV+ F++ LSGY
Sbjct  448  HAYIMNHLKKEMPVMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFPNVEHFRQVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYD+PDLLK FRNPYD
Sbjct  508  NIDKFERLKPKMIQAVDDMLGYDVPDLLKKFRNPYD  543



>ref|XP_011000650.1| PREDICTED: EH domain-containing protein 1-like [Populus euphratica]
Length=545

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE      +  ELFEKEQ DLL DL DIPK+ACDRRINEFVKRAR+AK+
Sbjct  391  VYIGSFNDKPINEETAS-QMFCELFEKEQNDLLMDLVDIPKKACDRRINEFVKRARAAKM  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQRLIDNL DEF KVQ+E+HLPAGDFPNV+ FKE L+GY
Sbjct  450  HAYIISHLKKEMPAIMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFPNVEHFKEVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IP+LLKSFRNPY
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPELLKSFRNPY  544



>ref|XP_004486203.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG++DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  328  HKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP +E  + GP+G+ LFEKEQ DLL DL DIPK+ACDRRINEFVKRARSAKI
Sbjct  388  VYIGSFNDKPTDE-GFVGPLGKNLFEKEQNDLLTDLLDIPKKACDRRINEFVKRARSAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL  EF KV++E+HLPAGDFP+V+ FKE LSGY
Sbjct  447  HAYIISHLKKEMPAIMGKAKTQQKLIDNLDSEFAKVKREFHLPAGDFPSVEHFKEVLSGY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ +DDMLGY+IP+LLK FRNPYD
Sbjct  507  SIDKFEKLKPKMIQAIDDMLGYEIPELLKKFRNPYD  542



>ref|XP_010538744.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538745.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=545

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE+A  GP+G+ LF KEQ DLL DL +IPK+ACDR+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPINESAV-GPLGKGLFVKEQNDLLADLMNIPKKACDRKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI++HL+KEMP MMGK+K QQRL+DNL +EF KVQ+E+HLPAGDFPNV+ F++ LSGY
Sbjct  450  HAYIMNHLKKEMPVMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFPNVEHFRQVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYD+PDLLK FRNPYD
Sbjct  510  NIDKFERLKPKMIQAVDDMLGYDVPDLLKKFRNPYD  545



>ref|XP_002518408.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF43795.1| EH-domain-containing protein, putative [Ricinus communis]
Length=545

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  331  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI+E   + P+ RELFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPIDEENVN-PMFRELFEKEQDDLLMDLVDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLRKEMP+++GKAK QQRLIDNL DEF KVQ+EYHLPAGDFPNV+ FKE L+GY
Sbjct  450  HAYIISHLRKEMPTIVGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFPNVEHFKEVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDMLGY+IP LL +FRNPY
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPQLLNNFRNPY  544



>ref|XP_006396726.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
 gb|ESQ38179.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
Length=544

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG++DKIRVVLNKAD VDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  330  HKLDISDEFKRVITSLRGNEDKIRVVLNKADLVDTQQLMRVYGALMWSLGKVLNTPEVVR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VY+GSFNDKPINE A  GPIG+ELFEKEQ DLL DL  IPK+ACDR+INEFVKRAR+AKI
Sbjct  390  VYVGSFNDKPINEAAV-GPIGKELFEKEQNDLLADLMVIPKKACDRKINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KVQ+EYHLPAGDFP+V+ F+E L GY
Sbjct  449  NAYIMSHLKKEMPAMMGKSKAQQRLMDNLQEEFAKVQQEYHLPAGDFPSVEHFREVLGGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGYDIPDLLK FRNPYD
Sbjct  509  NIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  544



>gb|AIE88276.1| hypothetical protein OG_BBa0063K01.7 [Oryza glaberrima]
Length=487

 Score =   371 bits (952),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL+GHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  273  HKLDISDEFKRVIGSLKGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  332

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E    GP+G+ELFEKEQEDLL+DL DIPK+ACDRRINEFVKR+RSAK+
Sbjct  333  VYIGSFNDKPIRETVA-GPLGKELFEKEQEDLLSDLNDIPKKACDRRINEFVKRSRSAKV  391

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D L ++F KVQKE HLPAGDFP+VD+++ETLS Y
Sbjct  392  HAHIISHLKKEMPALMGKAKAQQRLLDTLDEQFAKVQKELHLPAGDFPSVDEYRETLSAY  451

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  452  NFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  487



>ref|XP_006602183.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=541

 Score =   372 bits (956),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 198/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMR+YGALMWSLGKVLN PEVMR
Sbjct  327  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRIYGALMWSLGKVLNVPEVMR  386

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK IN+ +  GP+G ELF+KEQ+DLL+DLKDIPK+ACDR+INEFVKRAR+AKI
Sbjct  387  VYIGSFNDKTIND-SLSGPLGNELFQKEQDDLLSDLKDIPKKACDRKINEFVKRARAAKI  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+K+MP+M+GKAK QQ+LIDNL  EF K+QKE+HLP GDFPNV+ FKETLSGY
Sbjct  446  HAYIISHLKKQMPAMIGKAKAQQKLIDNLDTEFVKIQKEFHLPPGDFPNVEHFKETLSGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE L  KMIQTVDDML YD+P+LLK+FRNPY
Sbjct  506  NIDKFEKLNKKMIQTVDDMLAYDVPNLLKTFRNPY  540



>ref|XP_003594167.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES64418.1| calcium-binding EF hand protein [Medicago truncatula]
Length=540

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG++DKIRVVLNK+DQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  326  HKLDISDEFKRVISSLRGNEDKIRVVLNKSDQVDTQQLMRVYGALMWSLGKVLNTPEVAR  385

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP NE   D P+G+ LFEKEQ DLL DL DIPK+ACDRRINEFVKRARSAKI
Sbjct  386  VYIGSFNDKPTNEGFAD-PLGKNLFEKEQNDLLADLLDIPKKACDRRINEFVKRARSAKI  444

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQ+LIDNL +EF KV++EYHLP GDFP+V+ F+E LSGY
Sbjct  445  HAYIISHLKKEMPTMMGKAKAQQKLIDNLDNEFAKVKREYHLPPGDFPSVEHFREVLSGY  504

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ +DDMLGY+IP+LLK FRNPYD
Sbjct  505  SIDKFEKLKPKMIQAIDDMLGYEIPELLKKFRNPYD  540



>ref|XP_009401415.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGAL WSLGKVLNTPEVMR
Sbjct  326  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALTWSLGKVLNTPEVMR  385

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N  A  GP+G+ELFEKEQ+DLL+DLKDIPK+ACDR+INEFVKRAR+AKI
Sbjct  386  VYIGSFNDKPVNSMAV-GPVGKELFEKEQDDLLSDLKDIPKKACDRKINEFVKRARAAKI  444

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHLR +MP+M+GK K QQRLI+NL +EF KVQ++YHLP GDFP+V  FKE LSGY
Sbjct  445  HAYIISHLRNQMPAMLGKTKAQQRLINNLENEFAKVQRDYHLPPGDFPDVQHFKEVLSGY  504

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPKMIQ VDDML +DIP+LL+ FRNPY
Sbjct  505  NIDKFEKLKPKMIQAVDDMLAFDIPELLRKFRNPY  539



>gb|KHG01502.1| EH domain-containing 1 [Gossypium arboreum]
Length=475

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMR+YGALMWSLGKVLNTPEV+R
Sbjct  261  HKLDISDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRIYGALMWSLGKVLNTPEVVR  320

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFN+KP+NE  + GPIG+ LFEKEQEDLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  321  VYIGSFNEKPVNE-GFTGPIGKALFEKEQEDLLTDLKDIPKKACDRRINEFVKRARAAKI  379

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+ HL+KEMP+ +GKAK Q RL DNL +EF KVQ++YHLP GDFP+V+ FKE L GY
Sbjct  380  HAYIVGHLKKEMPTFIGKAKTQHRLTDNLEEEFVKVQRDYHLPPGDFPDVENFKEVLRGY  439

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VD+MLGYDIP+LLK+ RNPYD
Sbjct  440  SFDRFEKLKPKMIQDVDEMLGYDIPNLLKTLRNPYD  475



>ref|XP_003547274.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
 gb|KHN32982.1| EH domain-containing protein 1 [Glycine soja]
Length=539

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+ LRG+DDKIRVVLNKADQV+TQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  325  HKLDISDEFKRVIACLRGNDDKIRVVLNKADQVNTQQLMRVYGALMWSLGKVLNTPEVTR  384

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP++E  +  P+G++LFEKEQ +LL DL DIPK+ACDRRINEFVKRARSAKI
Sbjct  385  VYIGSFNDKPMDE-GFVSPLGQDLFEKEQNNLLADLMDIPKKACDRRINEFVKRARSAKI  443

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQRL+DNL +EF KVQ+E+HLPAGDFPNV+ F+E LSGY
Sbjct  444  HAYIISHLKKEMPAIMGKAKAQQRLLDNLEEEFAKVQREFHLPAGDFPNVEHFREVLSGY  503

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPYD
Sbjct  504  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  539



>ref|NP_001054202.1| Os04g0669300 [Oryza sativa Japonica Group]
 emb|CAE02814.2| OSJNBa0043A12.19 [Oryza sativa Japonica Group]
 dbj|BAF16116.1| Os04g0669300 [Oryza sativa Japonica Group]
 gb|EEC78218.1| hypothetical protein OsI_17853 [Oryza sativa Indica Group]
 gb|EEE61874.1| hypothetical protein OsJ_16560 [Oryza sativa Japonica Group]
Length=542

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL+GHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLKGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E    GP+G+ELFEKEQEDLL+DL DIPK+ACDRRINEFVKR+RSAK+
Sbjct  388  VYIGSFNDKPIRETVA-GPLGKELFEKEQEDLLSDLNDIPKKACDRRINEFVKRSRSAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D L ++F KVQKE HLPAGDFP+VD+++ETLS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQRLLDTLDEQFAKVQKELHLPAGDFPSVDEYRETLSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  507  NFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>gb|KEH33921.1| EPS15-like domain protein [Medicago truncatula]
Length=543

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMR+YGALMWSLGKVLN PEV R
Sbjct  329  HKLDISDEFKRVITSLKGHDDKIRVVLNKADQVDTQQLMRIYGALMWSLGKVLNIPEVTR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+P+N N  +G +G ELFE+EQEDLL DLKDIPK+ACDR+INEFVKRAR+AKI
Sbjct  389  VYIGSFNDQPVN-NVVNGVLGNELFEREQEDLLTDLKDIPKKACDRKINEFVKRARAAKI  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+K+MP+MMGKAK QQ+LIDNL  EF KVQKE+HLPAGDFPNV+ FK+ LSGY
Sbjct  448  HAYIISHLKKQMPAMMGKAKAQQKLIDNLEGEFAKVQKEFHLPAGDFPNVEHFKDVLSGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE LKPK IQ VDDML +DIP+LLK+FRNPY
Sbjct  508  NIDKFEKLKPKSIQAVDDMLAHDIPNLLKTFRNPY  542



>emb|CDP04464.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 201/217 (93%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGK+LNTPEV+R
Sbjct  366  HKLDISDEFKRVISSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKILNTPEVVR  425

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG++LFEKEQ+DLL DL DIPK+ACDR+INE VKRAR+AKI
Sbjct  426  VYIGSFNDKPVNEEAV-GPIGKDLFEKEQDDLLVDLMDIPKKACDRQINELVKRARAAKI  484

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETL-SG  538
            HAYI+SHL+KEMPS+MGKAK QQRLIDNL D F KVQKE+HLPAGDFP+V+ F+E L SG
Sbjct  485  HAYIMSHLKKEMPSLMGKAKTQQRLIDNLEDVFSKVQKEFHLPAGDFPSVEHFREVLKSG  544

Query  539  YKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            YKID FE +KPK+IQ VDDMLGYDIP+LL++FRNPY+
Sbjct  545  YKIDDFEKIKPKLIQAVDDMLGYDIPELLRNFRNPYE  581



>ref|XP_007026228.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
 gb|EOY28850.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
Length=546

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  332  HKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMWSLGKVLNTPEVVR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +NE A  GP+G++LFEKEQ+DLL DL DIP++ACDRRINEFVKRAR+AKI
Sbjct  392  VYIGSFNDKLLNEAAI-GPLGQDLFEKEQDDLLKDLIDIPRKACDRRINEFVKRARAAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+++HLPAGDFP+V+ ++E L+GY
Sbjct  451  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFPSVEHYREVLNGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY+
Sbjct  511  SIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  546



>ref|XP_002970092.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
 gb|EFJ29216.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
Length=544

 Score =   370 bits (951),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  330  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN+ A  GPIG+ELFEKEQ DLL DLKDIP++ACDR+INEFVKRAR+ KI
Sbjct  390  VYIGSFNDKPINDRAL-GPIGKELFEKEQNDLLADLKDIPRKACDRKINEFVKRARAVKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YI+ HL+KEMP+MMGK K QQRL+DNL +EF+KVQ+E  LP GDFP+VD F+E LSGY
Sbjct  449  HSYIVGHLKKEMPAMMGKTKAQQRLVDNLEEEFRKVQREQRLPPGDFPDVDAFRERLSGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKP+MIQ+VDDMLG+DIP+LLK FRNPYD
Sbjct  509  NFDKFEKLKPRMIQSVDDMLGHDIPNLLKKFRNPYD  544



>ref|XP_007147670.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
 gb|ESW19664.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
Length=535

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  321  HKLDISDEFKRVITSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  380

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI+E  +  P+G++LFEKEQ +LL DL DIPK+ACDRRINEFVKRARSAKI
Sbjct  381  VYIGSFNDKPIDE-GFVSPLGQDLFEKEQNNLLADLIDIPKKACDRRINEFVKRARSAKI  439

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQRL DNL +EF KVQ+E+HLPAGDFPNV+ F+E L+ Y
Sbjct  440  HAYIISHLKKEMPAIMGKAKAQQRLTDNLEEEFAKVQREFHLPAGDFPNVEHFREVLNSY  499

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK FRNPYD
Sbjct  500  SIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  535



>ref|XP_001784382.1| predicted protein [Physcomitrella patens]
 gb|EDQ50787.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   370 bits (949),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIR+VLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  307  HKLDISDEFKRVITSLRGHDDKIRIVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVNR  366

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PI+E+   GPIG++LFEKEQEDLL DLKDIP++ACDRRINEFVKRAR AKI
Sbjct  367  VYIGSFNDRPIDEDKV-GPIGKDLFEKEQEDLLADLKDIPRKACDRRINEFVKRARQAKI  425

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII  L+KEMP+M+GK K QQRLIDNL DEF KVQ+E+HLPAGDFP+V+ ++E L+GY
Sbjct  426  HAYIIGQLKKEMPAMIGKVKAQQRLIDNLEDEFGKVQREFHLPAGDFPSVEHYRERLAGY  485

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKM+QT+DDMLGYDIP+LLK FRNPY+
Sbjct  486  NFDKFEKLKPKMLQTIDDMLGYDIPELLKKFRNPYE  521



>gb|AEV41063.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKR+RSAK+
Sbjct  388  VYIGSFNDKPIRETAA-GPLGTELFEKEQDDLLSDLNDIPKKACDRRINEFVKRSRSAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D+L ++F KVQKE HLPAGDFP+V++++ETLS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFPSVEEYRETLSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  507  NFDKFEKLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_007026225.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
 gb|EOY28847.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
Length=545

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +NE A  GP+G++LFEKEQ+DLL DL DIP++ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKLLNEAAI-GPLGQDLFEKEQDDLLKDLIDIPRKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+++HLPAGDFP+V+ ++E L+GY
Sbjct  450  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFPSVEHYREVLNGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY+
Sbjct  510  SIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  545



>ref|XP_010327191.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKAD+VDTQQLMRVYGALMWSLGKV NTPEV R
Sbjct  333  HKLDISDEFKRVIASLQGHDDKIRVVLNKADKVDTQQLMRVYGALMWSLGKVQNTPEVSR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND PINE+   GP+G+ELFEKEQ+DLL DLK+IPK+ACDRR+NEFVKRAR+AK+
Sbjct  393  VYIGSFNDSPINED-LTGPLGKELFEKEQDDLLTDLKNIPKKACDRRVNEFVKRARAAKV  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI SHL+KEMP+MMGK+K Q+RLIDNLADEF K+QKE+HLP GDFP+V  F+E LSGY
Sbjct  452  HAYITSHLKKEMPAMMGKSKTQKRLIDNLADEFVKIQKEHHLPPGDFPDVQHFREILSGY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK+IQ VDDMLGYDIP+LLK+F+NPY+
Sbjct  512  NIDKFEKLKPKLIQAVDDMLGYDIPELLKNFKNPYE  547



>gb|AEV41109.1| putative EH-domain-containing protein 1 [Oryza officinalis]
Length=542

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKR+RSAK+
Sbjct  388  VYIGSFNDKPIRETAA-GPLGTELFEKEQDDLLSDLNDIPKKACDRRINEFVKRSRSAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D+L ++F KVQKE HLPAGDFP+V++++ETLS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFPSVEEYRETLSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  507  NFDKFEKLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_007026226.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
 gb|EOY28848.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
Length=544

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  330  HKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMWSLGKVLNTPEVVR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +NE A  GP+G++LFEKEQ+DLL DL DIP++ACDRRINEFVKRAR+AKI
Sbjct  390  VYIGSFNDKLLNEAAI-GPLGQDLFEKEQDDLLKDLIDIPRKACDRRINEFVKRARAAKI  448

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+++HLPAGDFP+V+ ++E L+GY
Sbjct  449  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFPSVEHYREVLNGY  508

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY+
Sbjct  509  SIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  544



>gb|AEV40966.1| putative EH-domain-containing protein 1 [Oryza punctata]
Length=542

 Score =   370 bits (950),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKR+RSAK+
Sbjct  388  VYIGSFNDKPIRETAA-GPLGTELFEKEQDDLLSDLNDIPKKACDRRINEFVKRSRSAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D+L ++F KVQKE HLPAGDFP+V++++ETLS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFPSVEEYRETLSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  507  NFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_002985283.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
 gb|EFJ13777.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
Length=552

 Score =   370 bits (951),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  338  HKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  397

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN+ A  GPIG+ELFEKEQ DLL DLKDIP++ACDR+INEFVKRAR+ KI
Sbjct  398  VYIGSFNDKPINDRAL-GPIGKELFEKEQNDLLADLKDIPRKACDRKINEFVKRARAVKI  456

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YI+ HL+KEMP+MMGK K QQRL+DNL +EF+KVQ+E  LP GDFP+VD F+E LSGY
Sbjct  457  HSYIVGHLKKEMPAMMGKTKAQQRLVDNLEEEFRKVQREQRLPPGDFPDVDAFRERLSGY  516

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKP+MIQ+VDDMLG+DIP+LLK FRNPYD
Sbjct  517  NFDKFEKLKPRMIQSVDDMLGHDIPNLLKKFRNPYD  552



>ref|XP_006467361.1| PREDICTED: EH domain-containing protein 1-like [Citrus sinensis]
Length=547

 Score =   370 bits (950),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPIN     GPI +ELFEKEQ+DLL DL DIPK+ACDR+INEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPINGEVV-GPIEQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+E+HLP GDFPNV+ F+E L+ Y
Sbjct  452  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDML Y+IP+LLK+FRNPY+
Sbjct  512  NIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE  547



>ref|XP_006652990.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E+A  GP+G ELFEKEQ+DLL+DL +IPK+ACDRRINEFVKRARSAK+
Sbjct  388  VYIGSFNDKPIKESAA-GPLGIELFEKEQDDLLSDLNNIPKKACDRRINEFVKRARSAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D L +EF KVQKE HLPAGDFP VD+++E LS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQRLLDGLDEEFAKVQKELHLPAGDFPGVDEYREALSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  507  NFDKFEKLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>gb|AEV41016.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   368 bits (944),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRG+DDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGYDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELFEKEQ+DLL+DL DIPK+ACDRRINEFVKR+RSAK+
Sbjct  388  VYIGSFNDKPIRETAA-GPLGTELFEKEQDDLLSDLNDIPKKACDRRINEFVKRSRSAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQRL+D+L ++F KVQKE HLPAGDFP+V++++ETLS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFPSVEEYRETLSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK++Q VDDML YDIPDLLKSFRNPY+
Sbjct  507  NFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_006586764.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=539

 Score =   367 bits (943),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL G+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  325  HKLDISDEFKRVIASLHGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  384

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP++E  +  P+G++LFEKEQ +LL DL DIPK+ACDRRINEFVKRARSAKI
Sbjct  385  VYIGSFNDKPMDE-GFVSPLGQDLFEKEQNNLLADLMDIPKKACDRRINEFVKRARSAKI  443

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK +QRL+DNL +EF KVQ+E+HLPAGDFPNV+ F+E L+GY
Sbjct  444  HAYIISHLKKEMPAIMGKAKARQRLLDNLEEEFAKVQREFHLPAGDFPNVEHFREVLNGY  503

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLG++IP+LLK FRNPYD
Sbjct  504  NIDKFEKLKPKMIQAVDDMLGFEIPELLKKFRNPYD  539



>gb|KHN40844.1| EH domain-containing protein 1 [Glycine soja]
Length=541

 Score =   367 bits (943),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL G+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  327  HKLDISDEFKRVIASLHGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVTR  386

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP++E  +  P+G++LFEKEQ +LL DL DIPK+ACDRRINEFVKRARSAKI
Sbjct  387  VYIGSFNDKPMDE-GFVSPLGQDLFEKEQNNLLADLMDIPKKACDRRINEFVKRARSAKI  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK +QRL+DNL +EF KVQ+E+HLPAGDFPNV+ F+E L+GY
Sbjct  446  HAYIISHLKKEMPAIMGKAKARQRLLDNLEEEFAKVQREFHLPAGDFPNVEHFREVLNGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLG++IP+LLK FRNPYD
Sbjct  506  NIDKFEKLKPKMIQAVDDMLGFEIPELLKKFRNPYD  541



>ref|XP_001772546.1| predicted protein [Physcomitrella patens]
 gb|EDQ62588.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRG+ DKIR+VLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  332  HKLDISDEFKRVITSLRGNTDKIRIVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+PI+E    GPIG++LFE+EQEDLL+DLKDIP++ACDR+INEFVKRAR AKI
Sbjct  392  VYIGSFNDRPIDETKL-GPIGKDLFEREQEDLLSDLKDIPRKACDRKINEFVKRARQAKI  450

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII  L+KEMP+MMGK+K QQRLIDNL D+F KVQ+E+HLP GDFP+V+ ++E L+GY
Sbjct  451  HAYIIGQLKKEMPAMMGKSKAQQRLIDNLEDQFAKVQREFHLPPGDFPSVEHYRERLAGY  510

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKM+Q VDDMLGYDIP+LLK FRNPYD
Sbjct  511  NFDKFEKLKPKMLQAVDDMLGYDIPELLKKFRNPYD  546



>ref|XP_009398680.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            +KLDISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  330  YKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALLWSLGKVLNTPEVMR  389

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE A    IG+ LFEKEQEDLL+DL DIPK+ACDRRINEFVKRAR+AK+
Sbjct  390  VYIGSFNDKPINE-AEHAVIGK-LFEKEQEDLLSDLNDIPKKACDRRINEFVKRARAAKV  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP+MMGKAK QQ+LIDNL +EF KVQKE+HL  GDFPNVDQF+E L GY
Sbjct  448  HACIISHLKKEMPAMMGKAKAQQKLIDNLEEEFLKVQKEFHLAPGDFPNVDQFREVLGGY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE +K KMIQ VDDMLGYDIP+LLK FRNPYD
Sbjct  508  NIDKFEKMKHKMIQAVDDMLGYDIPELLKRFRNPYD  543



>ref|XP_002447292.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
 gb|EES11620.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
Length=542

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  328  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELF+KEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AK+
Sbjct  388  VYIGSFNDKPIRETAA-GPLGMELFQKEQDDLLSDLNDIPKKACDRRINEFVKRARAAKV  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQ+L+D+L D F KVQKE HLP GDFP+V++++E LS Y
Sbjct  447  HAHIISHLKKEMPALMGKAKAQQKLLDSLDDHFAKVQKELHLPPGDFPSVEEYRELLSAY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE L+PKM+Q VDDML YDIPDLLK FRNPYD
Sbjct  507  NFDRFERLRPKMVQGVDDMLAYDIPDLLKKFRNPYD  542



>ref|XP_009776640.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=541

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 194/216 (90%), Gaps = 6/216 (3%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  332  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+     INEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKK-----INEFVKRARAAKI  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  446  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  506  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  541



>ref|XP_009598339.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 194/216 (90%), Gaps = 6/216 (3%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  332  HKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVAR  391

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DLK+IPK+     INEFVKRAR+AKI
Sbjct  392  VYIGSFNDKPMNEAA-TGPLGKELFEKEQDDLLTDLKNIPKK-----INEFVKRARAAKI  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HLRKEMP+M+GKAK QQRLID L +EF KVQ+E+HLPAGDFPNV+ F+E L GY
Sbjct  446  HAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFPNVEHFREVLGGY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE LKPKMIQ VDDMLGYDIP+LLK+FRNPYD
Sbjct  506  SFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  541



>tpg|DAA35457.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=541

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 193/216 (89%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  327  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  386

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELF+KEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AK+
Sbjct  387  VYIGSFNDKPIRETAA-GPLGMELFQKEQDDLLSDLNDIPKKACDRRINEFVKRARAAKV  445

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQ+L+D L  +F KVQKE HLP GDFP+V++++E LS Y
Sbjct  446  HAHIISHLKKEMPALMGKAKAQQKLLDGLDQQFAKVQKELHLPPGDFPSVEEYRELLSAY  505

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE L+PKM+Q VDDML YDIPDLLK FRNPYD
Sbjct  506  NFDRFEKLRPKMVQGVDDMLAYDIPDLLKKFRNPYD  541



>ref|NP_001167939.1| uncharacterized protein LOC100381653 [Zea mays]
 gb|ACN26585.1| unknown [Zea mays]
 tpg|DAA35458.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=543

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 193/216 (89%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  329  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELF+KEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AK+
Sbjct  389  VYIGSFNDKPIRETAA-GPLGMELFQKEQDDLLSDLNDIPKKACDRRINEFVKRARAAKV  447

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+IISHL+KEMP++MGKAK QQ+L+D L  +F KVQKE HLP GDFP+V++++E LS Y
Sbjct  448  HAHIISHLKKEMPALMGKAKAQQKLLDGLDQQFAKVQKELHLPPGDFPSVEEYRELLSAY  507

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE L+PKM+Q VDDML YDIPDLLK FRNPYD
Sbjct  508  NFDRFEKLRPKMVQGVDDMLAYDIPDLLKKFRNPYD  543



>ref|XP_004507654.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Cicer 
arietinum]
Length=567

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/240 (74%), Positives = 197/240 (82%), Gaps = 26/240 (11%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  328  HKLDVSDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMWSLGKVLNTPEVVR  387

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPINE +  GP+G+ LFEKEQ DLL DL DIP++ACD RINEFVKRARSAKI
Sbjct  388  VYIGSFNDKPINEGSV-GPLGQALFEKEQNDLLADLVDIPRKACDGRINEFVKRARSAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQK-------------------------  466
            HAYIISHL+ EMP+M+GKAK QQRLIDNL DEF+K                         
Sbjct  447  HAYIISHLKMEMPAMIGKAKAQQRLIDNLEDEFKKVSSFHFSFLILLSFLITCYFHLAKQ  506

Query  467  VQKEYHLPAGDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
            VQ+E+HLPAGDFPNVD F+E L+GY ID+FE LKPKMIQ VDDMLGY+IPDLL  FRNPY
Sbjct  507  VQREFHLPAGDFPNVDHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPDLLNKFRNPY  566



>ref|XP_007145728.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
 gb|ESW17722.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
Length=540

 Score =   362 bits (929),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVD QQLMR+YGALMWSLGKVLN PEVMR
Sbjct  326  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDPQQLMRIYGALMWSLGKVLNVPEVMR  385

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +++ +  G +G ELF+KEQ+DLL+DLKDIPK+ACDR+INEFVKRAR+  I
Sbjct  386  VYIGSFNDKFMHD-SISGQLGDELFQKEQDDLLSDLKDIPKKACDRKINEFVKRARAVVI  444

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+K+MPSM+GKAK QQ+LIDNL  EF KVQ+E+HLPAGDFPNV+QFKETLSGY
Sbjct  445  HAYIISHLKKQMPSMIGKAKAQQKLIDNLDVEFGKVQREFHLPAGDFPNVEQFKETLSGY  504

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             IDRFE L  KMIQTVDDML YDIP+LLK+FRNPY
Sbjct  505  NIDRFEKLNKKMIQTVDDMLAYDIPNLLKAFRNPY  539



>gb|KEH33927.1| calcium-binding EF hand protein [Medicago truncatula]
Length=437

 Score =   357 bits (915),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 191/213 (90%), Gaps = 3/213 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMR+YGALMWSLGKV N PE+MR
Sbjct  227  HKLDISDEFKRVITSLKGHDDKIRVVLNKADQVDTQQLMRIYGALMWSLGKVFNIPEIMR  286

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND+P+N     G +G ELFE+EQEDLL DLKDIPK+ACDR+INEFVKRAR+AKI
Sbjct  287  VYIGSFNDQPVNNI---GVLGNELFEREQEDLLTDLKDIPKKACDRKINEFVKRARAAKI  343

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP ++GKAK QQ+LIDNL  EF KVQ+E+HLPAGDFPNVD FKE LS Y
Sbjct  344  HAYIISHLKKEMPIVIGKAKAQQKLIDNLEVEFAKVQREFHLPAGDFPNVDHFKEVLSVY  403

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRN  640
             ID+FE LKPKMIQ VDDML +DIP+LLK+FRN
Sbjct  404  NIDKFEKLKPKMIQDVDDMLAHDIPNLLKTFRN  436



>ref|XP_011096032.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
 ref|XP_011096033.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=547

 Score =   360 bits (923),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 199/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  333  HKLDISDEFKRVISSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNEAA-AGPVGKELFEKEQDDLLLDLIDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP++MGKAK Q+RL+DNL  EF+KVQ+EYHLPAGDFPNV+ F+E LS Y
Sbjct  452  HAYIMSHLKKEMPALMGKAKTQRRLMDNLETEFEKVQREYHLPAGDFPNVEHFREVLSRY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID FE LKPKMIQ VDDMLGYDIP+LLK+FRN YD
Sbjct  512  NIDDFEKLKPKMIQAVDDMLGYDIPELLKNFRNIYD  547



>ref|XP_009334827.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009334845.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
Length=545

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMWSLG+V+NTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMWSLGRVVNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ DLL+DL DIPK+AC+R+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAA-TGPVGKELFEKEQGDLLSDLNDIPKKACERKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP+M  K+  QQ+LIDNL DEF+KVQ E+HLP GDFP+V+++++ LSGY
Sbjct  450  HAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFPDVNRYRDILSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMI  VD+MLGYDIP+LLK FRNP+D
Sbjct  510  SFDKFETLKPKMIDAVDEMLGYDIPELLKKFRNPFD  545



>ref|XP_003579456.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=548

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 192/216 (89%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL+G+DDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  334  HKLDISDEFKRVIGSLKGNDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  393

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKPI E A  GP+G ELFE+EQEDL++DL DIPK+ACDRRINEFVKRARSAK+
Sbjct  394  VYIGSFNDKPIRETAA-GPLGMELFEREQEDLMSDLNDIPKKACDRRINEFVKRARSAKV  452

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYII HL+KEMP++MGK K QQRL++ L ++F KVQKE  LPAGDFP+V+++++TLS  
Sbjct  453  HAYIIGHLKKEMPALMGKGKAQQRLLETLEEQFDKVQKEMRLPAGDFPSVEEYRDTLSAC  512

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE L+PKM+Q VDDML YDIPDLLK FRNPYD
Sbjct  513  NFDRFERLRPKMLQAVDDMLAYDIPDLLKQFRNPYD  548



>ref|XP_009334825.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009334842.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=591

 Score =   359 bits (921),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMWSLG+V+NTPEVMR
Sbjct  377  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMWSLGRVVNTPEVMR  436

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ DLL+DL DIPK+AC+R+INEFVKRAR+AKI
Sbjct  437  VYIGSFNDKPVNEAA-TGPVGKELFEKEQGDLLSDLNDIPKKACERKINEFVKRARAAKI  495

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP+M  K+  QQ+LIDNL DEF+KVQ E+HLP GDFP+V+++++ LSGY
Sbjct  496  HAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFPDVNRYRDILSGY  555

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMI  VD+MLGYDIP+LLK FRNP+D
Sbjct  556  SFDKFETLKPKMIDAVDEMLGYDIPELLKKFRNPFD  591



>ref|XP_009334826.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009334843.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=591

 Score =   358 bits (920),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMWSLG+V+NTPEVMR
Sbjct  377  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMWSLGRVVNTPEVMR  436

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ DLL+DL DIPK+AC+R+INEFVKRAR+AKI
Sbjct  437  VYIGSFNDKPVNEAA-TGPVGKELFEKEQGDLLSDLNDIPKKACERKINEFVKRARAAKI  495

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP+M  K+  QQ+LIDNL DEF+KVQ E+HLP GDFP+V+++++ LSGY
Sbjct  496  HAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFPDVNRYRDILSGY  555

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMI  VD+MLGYDIP+LLK FRNP+D
Sbjct  556  SFDKFETLKPKMIDAVDEMLGYDIPELLKKFRNPFD  591



>ref|XP_010675794.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=446

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 192/213 (90%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSL+GHDDKIRVVLNKADQV+TQQLMR+YGALMWSLGKVLNTPEV R
Sbjct  232  HKLDISDEFKRVISSLKGHDDKIRVVLNKADQVETQQLMRIYGALMWSLGKVLNTPEVTR  291

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFND P+NE A  GP+G++LF KEQ DLL DLKDIPK AC+RR+NEFVKRAR+AKI
Sbjct  292  VYIGSFNDGPLNEAA-AGPMGQDLFLKEQSDLLADLKDIPKNACNRRVNEFVKRARAAKI  350

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+KEMP ++GKAK Q+ LIDNL  EF+KVQ+EYHLPAGDFPNV+ FKE L GY
Sbjct  351  HALIISHLKKEMPLLIGKAKAQETLIDNLEIEFRKVQREYHLPAGDFPNVEHFKEVLKGY  410

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRN  640
             ID+FE LKPKMIQ VD+MLGYDIP+LL++F++
Sbjct  411  NIDKFEKLKPKMIQAVDEMLGYDIPELLRNFKS  443



>ref|XP_007026227.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
 gb|EOY28849.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
Length=574

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/245 (72%), Positives = 201/245 (82%), Gaps = 30/245 (12%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +NE A  GP+G++LFEKEQ+DLL DL DIP++ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFNDKLLNEAAI-GPLGQDLFEKEQDDLLKDLIDIPRKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQK-------------------------  466
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF K                         
Sbjct  450  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVLLCFISLSSHLFPFIFIRFSLLVL  509

Query  467  ----VQKEYHLPAGDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
                VQ+++HLPAGDFP+V+ ++E L+GY ID+FE LKPKMIQ VDDMLGY+IP+LLK+F
Sbjct  510  ARKQVQRDFHLPAGDFPSVEHYREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKNF  569

Query  635  RNPYD  649
            RNPY+
Sbjct  570  RNPYE  574



>gb|EYU27756.1| hypothetical protein MIMGU_mgv1a004743mg [Erythranthe guttata]
Length=512

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV R
Sbjct  298  HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSR  357

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ+DLL DL DIPK+ACDRRINEFVKRAR AKI
Sbjct  358  VYIGSFNDKPVNEAAI-GPVGKELFEKEQDDLLLDLIDIPKKACDRRINEFVKRARDAKI  416

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIIS L+KEMP++MGKAK Q++L+DNL   F+KVQKEYHLPAGDFP+V+ F+E LS Y
Sbjct  417  HAYIISQLKKEMPAVMGKAKAQRKLVDNLEKVFEKVQKEYHLPAGDFPSVEHFREVLSRY  476

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID FE LKPKMIQ VDDML YDIP+LLKSFRN Y
Sbjct  477  SIDDFEKLKPKMIQAVDDMLSYDIPELLKSFRNLY  511



>ref|XP_009352442.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=550

 Score =   352 bits (904),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMWSLG+V+NTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMWSLGRVVNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ELFEKEQ DLL+DL DIPK+AC+R+INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNEAA-TGPVGKELFEKEQGDLLSDLNDIPKKACERKINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP+M  K+  QQ+LIDNL DEF+KVQ E+HLP GDFP+V+++++ LSGY
Sbjct  450  HAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFPDVNRYRDILSGY  509

Query  542  KIDRFEYLKPK-----MIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPK     MI  VD+MLGYDIP+LLK FRNP+D
Sbjct  510  SFDKFETLKPKMIDAAMIDAVDEMLGYDIPELLKKFRNPFD  550



>ref|XP_010487999.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 192/216 (89%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQ+L + +   +    KVLNTPEV R
Sbjct  331  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQRLWKGWFDSVDLFXKVLNTPEVSR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF+DKPINE A  GPIGRELFEKEQ+DLL DLKDIPK+ACDRRINEFVKRAR+AKI
Sbjct  391  VYIGSFSDKPINEAA-TGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKI  449

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP++MGKAK QQ+LIDNL D F KVQ+E+HLP GDFPNV+ F+E LSGY
Sbjct  450  HAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFPNVEHFREVLSGY  509

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKM+QTVDDMLGYDIP LLKSF+NPYD
Sbjct  510  NIDKFEKLKPKMLQTVDDMLGYDIPQLLKSFKNPYD  545



>ref|XP_008370549.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=476

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 190/216 (88%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDE+KRVISSL GHDDKIRVVLNKADQ DTQQLMRVYGALMWSLG+V NTPEVMR
Sbjct  262  HKLDVSDEYKRVISSLHGHDDKIRVVLNKADQSDTQQLMRVYGALMWSLGRVFNTPEVMR  321

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +NE A  GP+G+ELFEKE  DLL+DL DIPK+AC+R+INEFVKRAR+AKI
Sbjct  322  VYIGSFNDKXVNEAA-TGPVGKELFEKELGDLLSDLNDIPKKACERKINEFVKRARAAKI  380

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+ EMP+M  K+  QQ+LIDNL DEF+KVQ E+HLP GDFP+V+++++ LSGY
Sbjct  381  HACIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFPDVNRYRDILSGY  440

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID FE LKPKMI  VD+MLGYDIP+LLK F+NPYD
Sbjct  441  SIDNFEKLKPKMIDAVDEMLGYDIPELLKKFKNPYD  476



>emb|CAJ86083.1| H0818H01.5 [Oryza sativa Indica Group]
 emb|CAJ86201.1| B0811B10.21 [Oryza sativa Indica Group]
Length=555

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 197/256 (77%), Gaps = 41/256 (16%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL+GHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPEVMR
Sbjct  301  HKLDISDEFKRVIGSLKGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPEVMR  360

Query  182  VYIG----------------------------------------SFNDKPINENAYDGPI  241
            VYIG                                        SFNDKPI E    GP+
Sbjct  361  VYIGYDVIFPRSFTFTYGNASINLMVLQRSHNLTTDNSKLTCDSSFNDKPIRETV-AGPL  419

Query  242  GRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKIHAYIISHLRKEMPSMMGKAK  421
            G+ELFEKEQEDLL+DL DIPK+ACDRRINEFVKR+RSAK+HA+IISHL+KEMP++MGKAK
Sbjct  420  GKELFEKEQEDLLSDLNDIPKKACDRRINEFVKRSRSAKVHAHIISHLKKEMPALMGKAK  479

Query  422  VQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDML  601
             QQRL+D L ++F KVQKE HLPAGDFP+VD+++ETLS Y  D+FE LKPK++Q VDDML
Sbjct  480  AQQRLLDTLDEQFAKVQKELHLPAGDFPSVDEYRETLSAYNFDKFERLKPKLVQGVDDML  539

Query  602  GYDIPDLLKSFRNPYD  649
             YDIPDLLKSFRNPY+
Sbjct  540  AYDIPDLLKSFRNPYE  555



>ref|XP_007145730.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
 gb|ESW17724.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
Length=538

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSLRGHDDKIRVVLNKADQVD QQLMR+YGALMWSLGKVLN PEVMR
Sbjct  324  HKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDPQQLMRIYGALMWSLGKVLNVPEVMR  383

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +++ +  GP+G ELF+KEQ+DLL+DLKDIPK+ACDR+INEFVKRAR   I
Sbjct  384  VYIGSFNDKFVHD-SISGPLGNELFQKEQDDLLSDLKDIPKKACDRKINEFVKRARDVVI  442

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+K+MP+M+GKAK QQ+LIDNL  EF KVQ+E+HLPAGDFP+V+QFKE L  Y
Sbjct  443  HAYIISHLKKQMPTMIGKAKAQQKLIDNLDVEFGKVQREFHLPAGDFPDVEQFKENLRSY  502

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             ID+FE L  KMI  VDDML +DIP+LLK+FRNPY
Sbjct  503  NIDKFEKLNKKMIDKVDDMLAHDIPNLLKAFRNPY  537



>gb|KHG30640.1| EH domain-containing 1 [Gossypium arboreum]
Length=542

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVIS LRG+DDKIRVVLNKA QVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  329  HKLDISDEFKRVISCLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMWSLGKVLNTPEVVR  388

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK INE   D P+G++LFEKEQ+DLL DL DIP++ACDRRINEFVKRAR+AKI
Sbjct  389  VYIGSFNDKQINEA--DDPLGQDLFEKEQDDLLKDLLDIPRKACDRRINEFVKRARAAKI  446

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            +AYI+SHL+KEMPSMMGKAK QQRLIDNL DEF KVQ+EYHLP GDFP+V+ ++E L+ Y
Sbjct  447  NAYIVSHLKKEMPSMMGKAKAQQRLIDNLQDEFAKVQREYHLPPGDFPSVEHYREVLNNY  506

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPK++Q VDDMLGY+IP+LLK+FRNPY+
Sbjct  507  NIDKFEKLKPKLVQAVDDMLGYEIPELLKNFRNPYE  542



>ref|XP_009626939.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=548

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  334  HKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  393

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP G++LFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  394  VYIGSFNDKPVNEEAV-GPTGKDLFEKEQDDLLDDLIDIPKKACDRRINEFVKRARAAKI  452

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHL+KEMP++MGK+K QQ+LI NL + F+KVQKE+ LP GDFP+VD F+E LS Y
Sbjct  453  HSYIISHLKKEMPALMGKSKTQQKLIQNLDNVFEKVQKEFRLPPGDFPSVDHFREVLSHY  512

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             I+ FE LKPKMIQ VDDMLG+DIP+LLK+FRNPY+
Sbjct  513  SINDFEKLKPKMIQAVDDMLGHDIPELLKNFRNPYE  548



>ref|XP_002985697.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
 gb|EFJ13275.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
Length=558

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL GHDDKI+VVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  342  HKLDISDEFKRVIGSLHGHDDKIKVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  401

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE    GPIG+ELFEKEQ D+L DL DIP++ACDR++NEFVKRAR+AKI
Sbjct  402  VYIGSFNDKPLNEKL--GPIGKELFEKEQSDILIDLMDIPRKACDRKVNEFVKRARAAKI  459

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+II+HL+KEMP+M+GK K QQRL+ NL DEF KVQ+E HLPAGD PN D+F+E L+ Y
Sbjct  460  HAHIIAHLKKEMPAMVGKNKAQQRLMVNLEDEFAKVQRELHLPAGDMPNPDKFREILARY  519

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE  KPK+IQ V+ ML  DIPDLL  F NPYD
Sbjct  520  NIDKFEKYKPKLIQAVETMLAQDIPDLLNKFHNPYD  555



>ref|XP_009769722.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana sylvestris]
Length=548

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  334  HKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  393

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  G  G++LFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  394  VYIGSFNDKPVNEEAV-GLTGKDLFEKEQDDLLDDLIDIPKKACDRRINEFVKRARAAKI  452

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H+YIISHL+KEMP++MGK+K QQ+LI NL + F+KVQKE+ LPAGDFP+VD F+E LS Y
Sbjct  453  HSYIISHLKKEMPALMGKSKTQQKLIQNLDNVFEKVQKEFRLPAGDFPSVDHFREVLSHY  512

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             I+ FE LKPKMIQ VDDMLG+DIP+LLK+FRNPY+
Sbjct  513  SINDFEKLKPKMIQAVDDMLGHDIPELLKNFRNPYE  548



>ref|XP_004250246.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GP+G+ LFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNEEAV-GPMGKGLFEKEQDDLLDDLIDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+ HL+KEMP++MGK+K QQ+LI NL +EF+KVQK + LPAGDFP+VD F+E L  Y
Sbjct  452  HAYIMGHLKKEMPALMGKSKTQQKLIQNLENEFEKVQKAFRLPAGDFPSVDHFREVLGHY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             I  FE LKP+MIQ VDDML +DIP+LLKSFRNPY+
Sbjct  512  NITDFEKLKPRMIQAVDDMLSHDIPELLKSFRNPYE  547



>ref|XP_002974220.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
 gb|EFJ24442.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
Length=540

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SL GHDDKI+VVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  324  HKLDISDEFKRVIGSLHGHDDKIKVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  383

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N+    GPIG+ELFEKEQ D+L DL DIP++ACDR++NEFVKRAR+AKI
Sbjct  384  VYIGSFNDKPLNDKL--GPIGKELFEKEQSDILIDLMDIPRKACDRKVNEFVKRARAAKI  441

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+II+HL+KEMP+M+GK K QQRL+ NL DEF KVQ+E HLPAGD PN D+F+E L+ Y
Sbjct  442  HAHIIAHLKKEMPAMVGKNKAQQRLMVNLEDEFAKVQRELHLPAGDMPNPDKFREILARY  501

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE  KPK+IQ V+ ML  DIPDLL  F NPYD
Sbjct  502  NIDKFEKYKPKLIQAVETMLAQDIPDLLNKFHNPYD  537



>ref|XP_006352380.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=547

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  333  HKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVR  392

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  G +G+ LFEKEQ+DLL+DL DIPK+ACDRRINEFVKRAR+AKI
Sbjct  393  VYIGSFNDKPVNEEAI-GSMGKGLFEKEQDDLLDDLIDIPKKACDRRINEFVKRARAAKI  451

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMP++MGK+K QQ+LI NL +EF+KVQK + LPAGDFP+VD F+E L  Y
Sbjct  452  HAYIMSHLKKEMPALMGKSKTQQKLIQNLDNEFEKVQKAFRLPAGDFPSVDHFREVLGHY  511

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             I  FE LKP+MIQ VDDML +DIP+LLK+FRNPY+
Sbjct  512  NITDFEKLKPRMIQAVDDMLSHDIPELLKNFRNPYE  547



>gb|KCW77036.1| hypothetical protein EUGRSUZ_D01382 [Eucalyptus grandis]
Length=459

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 189/216 (88%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFK VI+SLR HD+KIRVVLNKADQVD+QQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  245  HKLDISDEFKHVITSLRRHDNKIRVVLNKADQVDSQQLMRVYGALMWSLGKVLNTPEVVR  304

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+   GPIGR+LF+KEQ+DLL D++DIPK+ACDR+I+E+VKRA +AK+
Sbjct  305  VYIGSFNDKPVNEDIV-GPIGRDLFKKEQDDLLADVRDIPKKACDRQISEYVKRACAAKV  363

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP +MGKA  +QRLI+NL DEF KVQ+ YHLP  DFPNV QFKE L G+
Sbjct  364  HAYIISHLKNEMPLIMGKAMARQRLINNLEDEFLKVQRMYHLPKCDFPNVHQFKEVLRGH  423

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             I  FE LKPKMI+ VD+ML ++IP+LLK+ + PY+
Sbjct  424  NIGNFEKLKPKMIEAVDEMLRHEIPELLKNSKYPYE  459



>ref|XP_010054613.1| PREDICTED: EH domain-containing protein 1-like [Eucalyptus grandis]
Length=528

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 189/216 (88%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFK VI+SLR HD+KIRVVLNKADQVD+QQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  314  HKLDISDEFKHVITSLRRHDNKIRVVLNKADQVDSQQLMRVYGALMWSLGKVLNTPEVVR  373

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE+   GPIGR+LF+KEQ+DLL D++DIPK+ACDR+I+E+VKRA +AK+
Sbjct  374  VYIGSFNDKPVNEDIV-GPIGRDLFKKEQDDLLADVRDIPKKACDRQISEYVKRACAAKV  432

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+ EMP +MGKA  +QRLI+NL DEF KVQ+ YHLP  DFPNV QFKE L G+
Sbjct  433  HAYIISHLKNEMPLIMGKAMARQRLINNLEDEFLKVQRMYHLPKCDFPNVHQFKEVLRGH  492

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             I  FE LKPKMI+ VD+ML ++IP+LLK+ + PY+
Sbjct  493  NIGNFEKLKPKMIEAVDEMLRHEIPELLKNSKYPYE  528



>emb|CDO98110.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 181/217 (83%), Gaps = 13/217 (6%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKL+ISDEFK              VVLNKADQVDTQQLMRVYGALMWSLGK+LNTPEV+R
Sbjct  332  HKLEISDEFKHT-----------HVVLNKADQVDTQQLMRVYGALMWSLGKILNTPEVVR  380

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+NE A  GPIG++ FEKEQE+LL DL DIPK+A DRRINE VKRAR+AKI
Sbjct  381  VYIGSFNDKPVNEEAA-GPIGKDFFEKEQENLLMDLMDIPKKASDRRINELVKRARAAKI  439

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETL-SG  538
            HAYI+SHL+KEMPS+MGKAK QQRLIDNL D F KVQ+E+HLPAGDFP V+ F+E L SG
Sbjct  440  HAYIMSHLKKEMPSLMGKAKTQQRLIDNLEDVFSKVQREFHLPAGDFPRVEHFREVLKSG  499

Query  539  YKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            YKID FE  KPK+IQ VDDML  DIP+LLK+FRNPY+
Sbjct  500  YKIDDFEKTKPKLIQAVDDMLSCDIPELLKNFRNPYE  536



>ref|XP_002298819.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
 gb|EEE83624.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
Length=512

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 172/216 (80%), Gaps = 34/216 (16%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLD+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR
Sbjct  331  HKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDKP+N                                   INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKPVNA----------------------------------INEFVKRARAAKI  416

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRL+DNLA+EF KVQ+E+HLP GDFPNV+QF+E LSGY
Sbjct  417  HAYIISHLKKEMPAMMGKAKAQQRLLDNLAEEFGKVQREFHLPPGDFPNVEQFREVLSGY  476

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              D+FE LKPKMIQ VDDMLGYDIPDLLK+FRNPYD
Sbjct  477  NFDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  512



>ref|NP_001170407.1| uncharacterized protein LOC100384394 [Zea mays]
 gb|ACN36917.1| unknown [Zea mays]
Length=177

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = +2

Query  116  MRVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKD  295
            MRVYGALMWSLGKVLNTPEV RVYIGSFNDKP+NE+A  GP+G+ELFE+EQ+DLL+DLKD
Sbjct  1    MRVYGALMWSLGKVLNTPEVSRVYIGSFNDKPVNESAV-GPLGKELFEREQDDLLSDLKD  59

Query  296  IPKRACDRRINEFVKRARSAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQK  475
            IPK+ACDRRINEFVKRAR+AKIHAYII HL+KEMP+MMGKAK QQRLIDNL DEF KVQ+
Sbjct  60   IPKKACDRRINEFVKRARAAKIHAYIIGHLKKEMPTMMGKAKAQQRLIDNLPDEFAKVQR  119

Query  476  EYHLPAGDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            EYHLP+GDFP V+ FKE LSGY  D+FE +KPKM+Q VDDMLGYDIP+LLK+FRNPY+
Sbjct  120  EYHLPSGDFPYVEHFKEVLSGYSFDKFEKVKPKMVQAVDDMLGYDIPELLKNFRNPYE  177



>ref|XP_009779289.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana sylvestris]
Length=177

 Score =   308 bits (790),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = +2

Query  116  MRVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKD  295
            MRVYGALMWSLG+VLNTPEV RVYIGSFND+PINE A  GP+G+ELFEKEQ+DLL+DLK+
Sbjct  1    MRVYGALMWSLGRVLNTPEVTRVYIGSFNDRPINE-APTGPVGKELFEKEQDDLLSDLKN  59

Query  296  IPKRACDRRINEFVKRARSAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQK  475
            IPK+ACDRRINEFVKRAR+AKIHAYIISHL+KEMP+MMGKAK Q+RLIDNL DEF K+QK
Sbjct  60   IPKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQK  119

Query  476  EYHLPAGDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            E+HLPAGDFPNV+ F+E LSGY ID+FE LKPK+IQ VDDMLGYDIP+LLK+F NPYD
Sbjct  120  EHHLPAGDFPNVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  177



>ref|XP_010042271.1| PREDICTED: EH domain-containing protein 1-like, partial [Eucalyptus 
grandis]
Length=305

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +2

Query  110  QLMRVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDL  289
            QLMRVYGALMWSLGKVLNTPEV RVYIGSFNDKP+N+    GPIGR+LFEKEQ+DLL DL
Sbjct  127  QLMRVYGALMWSLGKVLNTPEVARVYIGSFNDKPVNDGIV-GPIGRDLFEKEQDDLLADL  185

Query  290  KDIPKRACDRRINEFVKRARSAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKV  469
             DIPK+ACDRRINEFVKRAR+AKIHAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KV
Sbjct  186  IDIPKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKV  245

Query  470  QKEYHLPAGDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            Q++YHLPAGDFP+VD F+E LSGY ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY+
Sbjct  246  QRDYHLPAGDFPSVDHFREVLSGYNIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  305



>gb|EMT24958.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=457

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 173/216 (80%), Gaps = 17/216 (8%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+WSLGKVLNTPE   
Sbjct  259  HKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLWSLGKVLNTPETAA  318

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
                             GP+G ELF +EQEDLL+DL DIPK+AC RRINEFVKRARSAK+
Sbjct  319  -----------------GPLGSELFVREQEDLLSDLNDIPKKACGRRINEFVKRARSAKV  361

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA+I+ HL+ +MP++MGKAK QQ+L++ L ++F KVQKE HLP GDFP+VD++++TLS Y
Sbjct  362  HAHIVGHLKNQMPALMGKAKAQQKLLETLDEQFAKVQKEMHLPPGDFPSVDEYRDTLSAY  421

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
              DRFE L  KM++ VDDML YDIPDLLK FRNPY+
Sbjct  422  NFDRFERLHTKMVKDVDDMLAYDIPDLLKQFRNPYE  457



>ref|XP_007026229.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
 gb|EOY28851.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
Length=511

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 171/216 (79%), Gaps = 35/216 (16%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMWSLGKVLNTPEV+R
Sbjct  331  HKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMWSLGKVLNTPEVVR  390

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSFNDK +                                   +INEFVKRAR+AKI
Sbjct  391  VYIGSFNDKLL-----------------------------------KINEFVKRARAAKI  415

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMP+MMGKAK QQRLIDNL DEF KVQ+++HLPAGDFP+V+ ++E L+GY
Sbjct  416  HAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFPSVEHYREVLNGY  475

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
             ID+FE LKPKMIQ VDDMLGY+IP+LLK+FRNPY+
Sbjct  476  SIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  511



>gb|ABR16762.1| unknown [Picea sitchensis]
Length=170

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = +2

Query  137  MWSLGKVLNTPEVMRVYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACD  316
            MWSLGKVLNTPEV RVYIGSFNDKPIN+ A  GPIG++LFEKEQEDLL+DLKDIP++ACD
Sbjct  1    MWSLGKVLNTPEVNRVYIGSFNDKPINDVAI-GPIGKDLFEKEQEDLLSDLKDIPRKACD  59

Query  317  RRINEFVKRARSAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAG  496
            RRINEFVKRAR+AKIHAYIISHL+KEMP+MMGKAK QQRLIDNL +EF KVQ+EYHLPAG
Sbjct  60   RRINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLDEEFAKVQREYHLPAG  119

Query  497  DFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            DFP+++ FKE LSGY  D+FE +K KMIQ+VDDMLGYDIP+LL+ FRNPYD
Sbjct  120  DFPSIEHFKEVLSGYNFDKFEKIKLKMIQSVDDMLGYDIPELLRKFRNPYD  170



>ref|XP_005643284.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18740.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
Length=540

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 168/215 (78%), Gaps = 3/215 (1%)
 Frame = +2

Query  5    KLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMRV  184
            KLDISDE K VI SL+GHDDK+RVVLNKADQVD QQLMRVYGALMWSLGKV  +PEV +V
Sbjct  327  KLDISDEMKEVIQSLKGHDDKVRVVLNKADQVDMQQLMRVYGALMWSLGKVFKSPEVCKV  386

Query  185  YIGSFN-DKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            YIGSFN DKPI  +    P G ELFEKEQ DLL DL DIP+RACDR++NEFVKR R+AKI
Sbjct  387  YIGSFNADKPIRTDL--NPAGLELFEKEQADLLQDLFDIPQRACDRKVNEFVKRVRAAKI  444

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            H  II HLRK+MP+MMGK K Q++L+ +L   F  VQ+E+HLPAGDFP+V+++++ L GY
Sbjct  445  HTLIIGHLRKQMPAMMGKQKAQEKLLRDLPTHFAHVQREHHLPAGDFPDVNRYRDILGGY  504

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             +  F  LK K ++ ++D L  DIP L+K F NPY
Sbjct  505  DLSTFPKLKEKDVKALEDALSLDIPSLVKQFDNPY  539



>ref|XP_002966377.1| hypothetical protein SELMODRAFT_85478, partial [Selaginella moellendorffii]
 gb|EFJ32404.1| hypothetical protein SELMODRAFT_85478, partial [Selaginella moellendorffii]
Length=385

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 166/215 (77%), Gaps = 13/215 (6%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDE KRVI SLRG+DDKIRV+LNK D +D QQLMRVYGALMWSLGKV+NTPEVMR
Sbjct  177  HKLDISDELKRVIESLRGNDDKIRVLLNKVDGIDAQQLMRVYGALMWSLGKVVNTPEVMR  236

Query  182  VYIGSFNDKPINENAYDGP----IGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRAR  349
            VYIGSF         YD P    + ++LF+ E++DLL +L ++PKR+CDRRI+EFVKRA 
Sbjct  237  VYIGSF---------YDNPQKIILSKDLFDLEKKDLLRELSELPKRSCDRRISEFVKRAH  287

Query  350  SAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKET  529
            +AK+HAY+I HL+++MP + GKA  Q+ L+ NL DEF KVQ  YHLP GD PN+D F+  
Sbjct  288  AAKVHAYLIGHLKQQMPILWGKADAQESLVVNLEDEFVKVQSLYHLPKGDLPNIDTFRRV  347

Query  530  LSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
            L+ + ID F  L+P MIQ+VDDML +DIP LL ++
Sbjct  348  LAVHNIDSFHRLRPSMIQSVDDMLTHDIPKLLSNY  382



>ref|XP_002978188.1| hypothetical protein SELMODRAFT_108442, partial [Selaginella 
moellendorffii]
 gb|EFJ20845.1| hypothetical protein SELMODRAFT_108442, partial [Selaginella 
moellendorffii]
Length=385

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 165/211 (78%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDE KRVI SLRG+DDKIRV+LNK D +D QQLMRVYGALMWSLGKV+NTPEVMR
Sbjct  177  HKLDISDELKRVIESLRGNDDKIRVLLNKVDGIDAQQLMRVYGALMWSLGKVVNTPEVMR  236

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF D P         + ++LF+ E++DLL +L ++PKR+CDRRI+EFVKRA +AK+
Sbjct  237  VYIGSFYDNPQKII-----LSKDLFDLEKKDLLRELSELPKRSCDRRISEFVKRAHAAKV  291

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAY+I HL+++MP + GKA  Q+ L+ NL DEF KVQ  YHLP GD PN+D F+  L+ +
Sbjct  292  HAYLIGHLKQQMPILWGKADAQESLVVNLEDEFVKVQSLYHLPKGDLPNIDTFRRVLAVH  351

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
             ID F  L+P MIQ+VDDML +DIP LL ++
Sbjct  352  NIDSFHRLRPSMIQSVDDMLTHDIPKLLSNY  382



>ref|XP_009402015.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 173/217 (80%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVL-NTPEVM  178
            HK+DISDEF  VI SL GH+DKIRVVLNKADQVDT+QL+RV  AL+WSL KVL N PEVM
Sbjct  290  HKIDISDEFNNVIRSLHGHEDKIRVVLNKADQVDTEQLIRVNRALIWSLAKVLPNRPEVM  349

Query  179  RVYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAK  358
            R+Y GSFNDKP N    D PI +++FE++Q DLL+D++DIP   CD +I  FV+RA++AK
Sbjct  350  RIYNGSFNDKPSNNVVVD-PILKKVFERDQNDLLSDVRDIPNNVCDLKIRAFVRRAKAAK  408

Query  359  IHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSG  538
            +HAYIISHL+ +MP ++GKA  Q+RLIDNL +EF +VQ++Y+LP GDFP+V +FKE LS 
Sbjct  409  VHAYIISHLKNKMPLILGKATAQRRLIDNLENEFVEVQRKYNLPLGDFPDVQRFKEALSC  468

Query  539  YKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPYD  649
            + ID F+ LKPK+I+ VD ML  DIP LL++F N Y+
Sbjct  469  HNIDEFKKLKPKLIRAVDVMLTCDIPQLLRTFGNSYE  505



>gb|AAD48968.1|AF147263_10 contains similarity to Pfam family PF00036 - EF hand; score=11.7, 
E=0.66,N=1 [Arabidopsis thaliana]
 emb|CAB81094.1| AT4g05520 [Arabidopsis thaliana]
Length=514

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 6/167 (4%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQ-----LMRVYGALMWSLGKVLNT  166
            HKLDISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQ     LMRVYGALMWSLGKVLNT
Sbjct  348  HKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQPLFLKLMRVYGALMWSLGKVLNT  407

Query  167  PEVMRVYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRA  346
            PEV+RVYIGSFNDKPINE A  GPIG+ELFEKEQ DLL DL D+PK+ACDR+INEFVKRA
Sbjct  408  PEVVRVYIGSFNDKPINEVAV-GPIGKELFEKEQNDLLADLMDVPKKACDRKINEFVKRA  466

Query  347  RSAKIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHL  487
            RSAKI+AYI+SHL+KEMP+MMGK+K QQRL+DNL +EF KV+K  HL
Sbjct  467  RSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVRKISHL  513



>gb|KDD73486.1| hypothetical protein H632_c2126p0 [Helicosporidium sp. ATCC 50920]
Length=376

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 163/216 (75%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF+ VI+SL+GH+DK+RVVLNKAD VD QQL+RVYGALMWSLG+V+ +PEV R
Sbjct  163  HKLDISDEFREVIASLKGHEDKMRVVLNKADSVDAQQLLRVYGALMWSLGRVVGSPEVAR  222

Query  182  VYIGSFN-DKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAK  358
            VY+GSFN   P+ E+    P G+ LFEKE EDLL+DL  IP RACDR++NEFVKR R+A+
Sbjct  223  VYVGSFNAGHPVREDV--NPEGKALFEKEHEDLLHDLYAIPARACDRKVNEFVKRVRAAR  280

Query  359  IHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSG  538
            +H  I++HLR+++P   G+ K Q++L+  L   F ++Q+E+HL AGDFP+V ++++ LS 
Sbjct  281  MHCLILAHLRRQLP-YFGQKKAQEKLLRELPQHFAQLQREHHLHAGDFPDVQRYRDMLSA  339

Query  539  YKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
            + I RF  L    ++ +DD L  DIP L++   NPY
Sbjct  340  FDISRFPKLDKGALKQLDDALSVDIPRLVQLMGNPY  375



>ref|XP_002499973.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61231.1| predicted protein [Micromonas sp. RCC299]
Length=427

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFK VI+SLRGHDDK+RVVLNKADQV  QQLMRVYGALMWSLGKV NTPEV +
Sbjct  215  HKLDISDEFKSVIASLRGHDDKVRVVLNKADQVSAQQLMRVYGALMWSLGKVFNTPEVCK  274

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VY+GSFND+P+N    +  +G ELFEKEQ DL  DL DIP+R+CDR++NEFVKR R+   
Sbjct  275  VYVGSFNDQPLNTE--NNQLGAELFEKEQSDLKRDLLDIPQRSCDRKVNEFVKRVRACVT  332

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA I++HLR +MP M G    Q++L+  L  EF++    + +P GD PN  +F E   G 
Sbjct  333  HAKIMTHLRGKMPLMAGHESKQKKLLGRLDKEFEECVHTHQIPKGDLPNERRFAEICKGM  392

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             I +   +  K ++ ++++L  DIP++++ F NP+
Sbjct  393  PIWKMPKVDKKQMKALEEVLSVDIPEVMRRFDNPF  427



>gb|KFM29283.1| EH domain-containing protein 1 [Auxenochlorella protothecoides]
Length=598

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 166/231 (72%), Gaps = 19/231 (8%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            +KLDISDEFK VIS+LRGHDDK+R+VLNKAD VD QQLMRVYGALMWSLGKV  +PEV R
Sbjct  370  YKLDISDEFKEVISTLRGHDDKVRIVLNKADSVDQQQLMRVYGALMWSLGKVFRSPEVCR  429

Query  182  VYIGSFN-DKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAK  358
            VYIGSFN   PI ++    P  + LFEKEQEDLL+DL DIP R+CDR++NEFVKR R+AK
Sbjct  430  VYIGSFNASNPIRDDV--NPTCKPLFEKEQEDLLHDLYDIPARSCDRKVNEFVKRVRAAK  487

Query  359  IHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEY----HLP-----------A  493
            IH  I+ HLRK+MP   G+ K Q++L+DNLA+EF++  +      H P           A
Sbjct  488  IHCLIMGHLRKQMP-YFGQKKAQEKLMDNLANEFRQGLRSCIWIQHPPDAIANVIHPADA  546

Query  494  GDFPNVDQFKETLSGYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
            GDFP+V+++++ LS + I +F  L   MI+ +DD L  DIP L++   NPY
Sbjct  547  GDFPDVNRYRDILSAFDISKFTKLDKSMIKQIDDSLSIDIPQLVRQMDNPY  597



>gb|EIE86499.1| hypothetical protein RO3G_11210 [Rhizopus delemar RA 99-880]
Length=533

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 169/232 (73%), Gaps = 16/232 (7%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDIS+EFK  I SL+G ++K+RVVLNK+D V+ QQLMRVYGA+MWSLGKV+ TPEVMR
Sbjct  202  HKLDISNEFKMAIHSLKGQEEKVRVVLNKSDMVNQQQLMRVYGAMMWSLGKVVQTPEVMR  261

Query  182  VYIGSF-NDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAK  358
            VY+ SF  +KP   N ++    REL E E +DLL DLK++ + A  R+INE +KRAR A+
Sbjct  262  VYLSSFWTEKP--PNCFED--CRELIEAESKDLLRDLKELRRNAAIRKINEIIKRARLAR  317

Query  359  IHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSG  538
            +HA IISHL+KEMPSM GK K Q+ L++NLA EF K+Q++YHLPAGDFPN D+F++ L+ 
Sbjct  318  VHALIISHLKKEMPSMFGKKKKQEALLNNLAAEFGKIQQKYHLPAGDFPNPDRFRQNLAH  377

Query  539  YKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF-----------RNPYD*RML  661
            Y +D+F+ LK  +++ VDD L  D+P L+  F           RNP+   +L
Sbjct  378  YDMDKFKTLKEDLVERVDDALSADLPQLMSQFPTVNRELSQSERNPFQESLL  429



>gb|ELT99462.1| hypothetical protein CAPTEDRAFT_108382 [Capitella teleta]
Length=538

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF+RVI S++G+DDKIR+VLNKAD +D QQLMRVYGALMWSLGKVLNTPEV R
Sbjct  192  HKLDISDEFRRVIQSMKGYDDKIRIVLNKADMIDHQQLMRVYGALMWSLGKVLNTPEVSR  251

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF D+P++ +     + R+LFE E++DL ND++ +P+ A  R++N+ +KRAR AK+
Sbjct  252  VYIGSFWDQPLHHD-----MNRKLFELEEQDLFNDIQSLPRNAALRKLNDLIKRARLAKV  306

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+SHL+KEMPSM GK   ++ LI+NL D F  +Q+E+ +  GDFPN+++ KE L  +
Sbjct  307  HAYIMSHLKKEMPSMFGKDAKKKELINNLGDTFALIQREHQISPGDFPNLERMKEQLQHH  366

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLK  628
               +F  +KP++++TVD ML  DI  L++
Sbjct  367  DFTKFHPIKPQLLKTVDQMLANDIARLMQ  395



>emb|CCI42136.1| unnamed protein product [Albugo candida]
Length=549

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 162/213 (76%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF+RVI  L+GHDDKIR VLNKADQ+D Q+LMRVYGALMWS+GKVL TPEV+R
Sbjct  215  HKLDISDEFQRVIEVLKGHDDKIRCVLNKADQIDRQRLMRVYGALMWSMGKVLKTPEVLR  274

Query  182  VYIGSFNDKPI--NENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSA  355
            V+IGSF D+P+   +NA       ELFE E+ DLL +L+++P+ A  R+INEFVKRAR A
Sbjct  275  VFIGSFWDQPMVFTDNA-------ELFEAEENDLLTELRNLPQNAAIRKINEFVKRARLA  327

Query  356  KIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLS  535
            K+H ++I  LR +MP+M+GK K Q+ LI+NL + F++VQ+ YHLP GDFP +D+F++ L 
Sbjct  328  KVHCFLIGVLRDKMPAMIGKEKKQKALIENLGETFREVQRRYHLPPGDFPQLDEFQKKLV  387

Query  536  GYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
             +K  +F  L  K IQ +D++L  DIP L+ + 
Sbjct  388  DHKFQKFATLNVKGIQEIDELLSKDIPKLMAAL  420



>gb|ABI13180.1| hypothetical protein [Emiliania huxleyi]
Length=417

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 152/211 (72%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFK  I +L+GHDDKIRVVLNKAD VD+Q+L+R+YGALMWSLGKV+ TPE MR
Sbjct  185  HKLDISDEFKEAIEALKGHDDKIRVVLNKADAVDSQKLLRIYGALMWSLGKVIKTPECMR  244

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF D+P+  + +     R+LFE E  DLL DLK++PK A  R++NE VKR R AK 
Sbjct  245  VYIGSFWDQPLRGSEWS----RQLFEMEMRDLLTDLKNVPKNAAVRKVNELVKRVRLAKA  300

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+ HL+KEMPS  G  K Q +L+ N+ + F KV + + LP GDFP+V +F+  + G+
Sbjct  301  HAYIVGHLKKEMPSYFGAQKAQAKLLANIEEHFLKVHRAHSLPVGDFPDVAKFRAVMEGH  360

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
             + +F  L  K I  ++ +L ++IP L+  F
Sbjct  361  DLTKFPKLDTKAIAAMEHVLAHEIPKLMAQF  391



>ref|XP_003055188.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60440.1| predicted protein [Micromonas pusilla CCMP1545]
Length=526

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 158/216 (73%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFK VISSLRGHDDK+RVVLNKADQV  QQLMRVYGALMWSLGKV  TPEV +
Sbjct  314  HKLDISDEFKAVISSLRGHDDKVRVVLNKADQVSAQQLMRVYGALMWSLGKVFMTPEVCK  373

Query  182  VYIGSFNDKP-INENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAK  358
            VY+GSFNDKP +  N     +G ELF KE E L  DL DIP+R+CDR++NEFVKR R+A 
Sbjct  374  VYVGSFNDKPPVTTNNV---LGEELFMKEHEALKKDLLDIPQRSCDRKVNEFVKRVRAAL  430

Query  359  IHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSG  538
             HA I++HL+K+MP+MMG    Q++L+  + +EF K   EY +  GD PN  +F++ +  
Sbjct  431  THARIVTHLKKQMPAMMGHESKQKKLLGRIEEEFTKCVHEYTIARGDLPNPKRFRDIMKD  490

Query  539  YKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFRNPY  646
             +I +F  +  K ++ ++++L  DIP ++K F NP+
Sbjct  491  MEIWKFPKIDKKAMKALEEVLTVDIPAVMKKFDNPF  526



>ref|XP_004365433.1| past-1 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW40037.1| hypothetical protein CAOG_00562 [Capsaspora owczarzaki ATCC 30864]
Length=534

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 162/211 (77%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEFKRVI+SL+GHDDKIR+VLNKAD +  QQLMRVYGALMWSLGKV+ TPEVMR
Sbjct  191  HKLDISDEFKRVITSLKGHDDKIRLVLNKADMITGQQLMRVYGALMWSLGKVIQTPEVMR  250

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF D+P++ +       + LF+ EQ DLL+DL+ +P+ +  R+INE VKRAR AK+
Sbjct  251  VYIGSFWDQPLHNDE-----NKRLFDAEQRDLLSDLRALPRNSAVRKINELVKRARLAKV  305

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HA IISHL+ EMP+M GK+  Q  LI NL +E  K+Q+++ +P GDFP++++ KE LS +
Sbjct  306  HALIISHLKNEMPAMFGKSAKQAELIANLEEECVKIQRQHGIPPGDFPDLNRMKELLSVH  365

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
               +F  L  ++I+++D++L  DIP L++ F
Sbjct  366  DFGKFPKLDKRIIESMDEVLANDIPALMRKF  396



>ref|XP_010016866.1| PREDICTED: EH domain-containing protein 4, partial [Nestor notabilis]
Length=462

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 152/212 (72%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  116  HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  175

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  176  VYIGSFWSNPLRNTE-----NRRLFEAEAQDLFKDIQGLPQKAAVRKLNDLIKRARLAKV  230

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIIS+L+KEMPS+ GK   ++ LI  L + + ++Q+EYH+ AGDFP V + +E L  Y
Sbjct  231  HAYIISYLKKEMPSVFGKENKKKELISRLPEIYTQLQREYHISAGDFPEVKKMQELLENY  290

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  291  DFTKFHSLKPKLIEAVDNMLANKIASLMNLIR  322



>gb|KFQ44554.1| EH domain-containing protein 4, partial [Nestor notabilis]
Length=463

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 152/212 (72%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  117  HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  176

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  177  VYIGSFWSNPLRNTE-----NRRLFEAEAQDLFKDIQGLPQKAAVRKLNDLIKRARLAKV  231

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIIS+L+KEMPS+ GK   ++ LI  L + + ++Q+EYH+ AGDFP V + +E L  Y
Sbjct  232  HAYIISYLKKEMPSVFGKENKKKELISRLPEIYTQLQREYHISAGDFPEVKKMQELLENY  291

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  292  DFTKFHSLKPKLIEAVDNMLANKIASLMNLIR  323



>ref|XP_010078610.1| PREDICTED: EH domain-containing protein 4, partial [Pterocles 
gutturalis]
Length=403

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 151/212 (71%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  57   HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  116

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  117  VYIGSFWAHPLRNTE-----NRRLFEAEAQDLFKDIQSLPQKAAVRKLNDLIKRARLAKV  171

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIIS+L+KEMPSM GK   ++ LI  L + + ++Q+EYH+ AGDFP V + +E L   
Sbjct  172  HAYIISYLKKEMPSMFGKENKKKELISRLPEIYIQLQREYHISAGDFPEVKKMQELLETC  231

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  232  DFTKFHSLKPKLIEAVDNMLANKIASLMSLIR  263



>gb|KFV12676.1| EH domain-containing protein 4, partial [Pterocles gutturalis]
Length=404

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 151/212 (71%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  58   HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  117

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  118  VYIGSFWAHPLRNTE-----NRRLFEAEAQDLFKDIQSLPQKAAVRKLNDLIKRARLAKV  172

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIIS+L+KEMPSM GK   ++ LI  L + + ++Q+EYH+ AGDFP V + +E L   
Sbjct  173  HAYIISYLKKEMPSMFGKENKKKELISRLPEIYIQLQREYHISAGDFPEVKKMQELLETC  232

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  233  DFTKFHSLKPKLIEAVDNMLANKIASLMSLIR  264



>ref|XP_008870165.1| hypothetical protein H310_06767 [Aphanomyces invadans]
 gb|ETW01167.1| hypothetical protein H310_06767 [Aphanomyces invadans]
Length=509

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 159/213 (75%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF+RVI  L+GHDDKIR VLNK+DQ+D Q+LMRVYGALMWS+GKV+ TPEVMR
Sbjct  186  HKLDISDEFQRVIEVLKGHDDKIRCVLNKSDQIDQQKLMRVYGALMWSMGKVMKTPEVMR  245

Query  182  VYIGSFNDKPI--NENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSA  355
            V+IGSF D+P+   ENA        LFEKE+ DL+++L+ +P  +  R++NE VKR R A
Sbjct  246  VFIGSFWDQPLMYTENA-------ALFEKERNDLMSELRKLPSNSAVRKVNELVKRTRLA  298

Query  356  KIHAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLS  535
            K+HAY+I HL+++MP MMGK K Q  LI  L   F++VQK+Y+LP GDFPN+++F++ L 
Sbjct  299  KVHAYLIGHLKEQMPLMMGKEKKQAELIAALPSVFREVQKKYNLPPGDFPNLEEFQKKLE  358

Query  536  GYKIDRFEYLKPKMIQTVDDMLGYDIPDLLKSF  634
              K D F  L  KMIQ VD+++  DIP L+ S 
Sbjct  359  ERKFDLFSKLNLKMIQDVDELMARDIPKLMMSL  391



>ref|XP_007115392.1| PREDICTED: EH domain-containing protein 4 [Physeter catodon]
Length=389

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 150/208 (72%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I + RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  43   HKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  102

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF  +P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  103  VYIGSFWAQPLQNTD-----NRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKV  157

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPS+ GK   ++ LI  L + + ++Q+EY + AGDFP V   +E L  Y
Sbjct  158  HAYIISHLKKEMPSVFGKENKKRELISRLPEIYTQLQREYQISAGDFPEVKAMQEQLENY  217

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLL  625
               +F  LKPK+I+ VD+ML   I  L+
Sbjct  218  DFTKFHSLKPKLIEAVDNMLSNKISSLM  245



>ref|XP_010194597.1| PREDICTED: EH domain-containing protein 4, partial [Colius striatus]
Length=480

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  134  HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  193

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  194  VYIGSFWAHPLQNTE-----NRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKV  248

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPS+ G+   ++ LI+ L + + ++Q+EYH+ AGDFP V + +E L   
Sbjct  249  HAYIISHLKKEMPSVFGRENKKKELINRLPEIYTQLQREYHISAGDFPEVKKMQELLETC  308

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  309  DFTKFHSLKPKLIEAVDNMLANKIASLMSMIR  340



>gb|KFP29463.1| EH domain-containing protein 4, partial [Colius striatus]
Length=463

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  117  HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  176

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  177  VYIGSFWAHPLQNTE-----NRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKV  231

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIISHL+KEMPS+ G+   ++ LI+ L + + ++Q+EYH+ AGDFP V + +E L   
Sbjct  232  HAYIISHLKKEMPSVFGRENKKKELINRLPEIYTQLQREYHISAGDFPEVKKMQELLETC  291

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  292  DFTKFHSLKPKLIEAVDNMLANKIASLMSMIR  323



>ref|XP_009997919.1| PREDICTED: EH domain-containing protein 4 [Chaetura pelagica]
Length=465

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 153/212 (72%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF   I S RG DDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV+NTPEV+R
Sbjct  119  HKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLR  178

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF   P+          R LFE E +DL  D++ +P++A  R++N+ +KRAR AK+
Sbjct  179  VYIGSFWAHPLRNTE-----NRRLFEAEAQDLFKDIQSLPQKAAVRKLNDLIKRARLAKV  233

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYIIS+L+KEMPS+ GK   ++ LI+NL + + ++Q+EYH+ AGDFP V + +E L   
Sbjct  234  HAYIISYLKKEMPSVFGKENKKKELINNLPEIYIQLQREYHISAGDFPEVKKMQELLENC  293

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLLKSFR  637
               +F  LKPK+I+ VD+ML   I  L+   R
Sbjct  294  DFTKFHSLKPKLIEAVDNMLANKIASLMSLIR  325



>gb|EHJ75206.1| past-1 [Danaus plexippus]
Length=431

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 155/208 (75%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    HKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVMR  181
            HKLDISDEF+R I +LRGHDDKIR+VLNKAD +D QQLMRVYGALMWSLGKVL TPEV R
Sbjct  189  HKLDISDEFRRSIEALRGHDDKIRIVLNKADMIDHQQLMRVYGALMWSLGKVLQTPEVAR  248

Query  182  VYIGSFNDKPINENAYDGPIGRELFEKEQEDLLNDLKDIPKRACDRRINEFVKRARSAKI  361
            VYIGSF D+P+    YD  + R LFE E++DL  D++ +P+ A  R++N+ +KRAR AK+
Sbjct  249  VYIGSFWDQPLR---YD--VNRRLFEDEEQDLFRDMQSLPRNAALRKLNDLIKRARLAKV  303

Query  362  HAYIISHLRKEMPSMMGKAKVQQRLIDNLADEFQKVQKEYHLPAGDFPNVDQFKETLSGY  541
            HAYI+S LRKEMPSM GK   ++ LI NL   + ++QKE  +  GDFP++ + +ETL+ +
Sbjct  304  HAYIVSELRKEMPSMFGKDGKKKELIKNLGQVYDRIQKEMQISPGDFPDIKKMQETLANH  363

Query  542  KIDRFEYLKPKMIQTVDDMLGYDIPDLL  625
               +F  LKPK+++ VD ML  DI  L+
Sbjct  364  DFTKFHPLKPKLLEVVDHMLATDIARLM  391



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1434617960664