BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30817_g1_i1 len=778 path=[756:0-777]

Length=778
                                                                      Score     E

ref|XP_006358367.1|  PREDICTED: putative DNA-binding protein ESCA...    189   3e-54   
ref|XP_009763803.1|  PREDICTED: putative DNA-binding protein ESCA...    186   2e-53   
ref|XP_009763802.1|  PREDICTED: putative DNA-binding protein ESCA...    186   2e-53   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...    187   2e-53   
ref|XP_009613222.1|  PREDICTED: putative DNA-binding protein ESCA...    184   7e-53   
ref|XP_009613223.1|  PREDICTED: putative DNA-binding protein ESCA...    184   8e-53   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...    184   2e-52   
ref|XP_004245690.1|  PREDICTED: putative DNA-binding protein ESCA...    183   2e-52   
ref|XP_010325447.1|  PREDICTED: putative DNA-binding protein ESCA...    183   2e-52   
ref|XP_009621304.1|  PREDICTED: putative DNA-binding protein ESCA...    184   2e-52   
gb|ABL63118.1|  AT-hook DNA-binding protein                             182   4e-52   Catharanthus roseus [chatas]
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg                182   8e-52   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...    182   1e-51   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...    182   1e-51   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...    178   2e-51   
ref|XP_010108102.1|  hypothetical protein L484_023188                   181   2e-51   
ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...    181   3e-51   
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...    180   8e-51   
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-50   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg                179   1e-50   
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg                179   1e-50   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...    176   3e-50   
emb|CBI34813.3|  unnamed protein product                                176   3e-50   
emb|CDP09863.1|  unnamed protein product                                177   6e-50   
ref|XP_011081090.1|  PREDICTED: putative DNA-binding protein ESCA...    175   2e-49   
ref|XP_002281296.1|  PREDICTED: putative DNA-binding protein ESCA...    175   3e-49   Vitis vinifera
gb|KDP28740.1|  hypothetical protein JCGZ_14511                         173   2e-48   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...    173   2e-48   
ref|XP_011029110.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-47   
ref|XP_011033866.1|  PREDICTED: putative DNA-binding protein ESCA...    169   6e-47   
ref|XP_002303540.1|  DNA-binding family protein                         169   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002299584.2|  DNA-binding family protein                         169   6e-47   Populus trichocarpa [western balsam poplar]
emb|CDP17786.1|  unnamed protein product                                169   8e-47   
ref|XP_007040019.1|  AT-hook DNA-binding family protein                 169   1e-46   
ref|XP_006851807.1|  hypothetical protein AMTR_s00041p00025000          169   1e-46   
ref|XP_011014152.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-46   
ref|XP_006440441.1|  hypothetical protein CICLE_v10021296mg             167   8e-46   
ref|XP_010053390.1|  PREDICTED: putative DNA-binding protein ESCA...    166   1e-45   
ref|XP_006477312.1|  PREDICTED: putative DNA-binding protein ESCA...    166   1e-45   
ref|XP_006363907.1|  PREDICTED: putative DNA-binding protein ESCA...    163   2e-45   
ref|XP_002509637.1|  ESC, putative                                      164   6e-45   Ricinus communis
ref|XP_004242015.1|  PREDICTED: putative DNA-binding protein ESCA...    161   8e-45   
ref|XP_007158420.1|  hypothetical protein PHAVU_002G151600g             163   1e-44   
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...    163   1e-44   
ref|XP_007155606.1|  hypothetical protein PHAVU_003G216200g             162   3e-44   
gb|KDP25577.1|  hypothetical protein JCGZ_20733                         161   6e-44   
ref|XP_003525782.1|  PREDICTED: putative DNA-binding protein ESCA...    160   7e-44   
ref|XP_002511734.1|  ESC, putative                                      161   9e-44   Ricinus communis
ref|XP_003517441.1|  PREDICTED: putative DNA-binding protein ESCA...    160   1e-43   
ref|XP_004306909.1|  PREDICTED: putative DNA-binding protein ESCA...    161   1e-43   
ref|XP_010276261.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-43   
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...    159   4e-43   
ref|XP_003516470.1|  PREDICTED: putative DNA-binding protein ESCA...    158   9e-43   
ref|XP_003549894.1|  PREDICTED: putative DNA-binding protein ESCA...    157   3e-42   
ref|XP_004511639.1|  PREDICTED: putative DNA-binding protein ESCA...    155   3e-42   
ref|XP_007052032.1|  AT-hook motif nuclear-localized protein 22         157   4e-42   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...    156   7e-42   
ref|XP_004172826.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    155   1e-41   
ref|XP_004147565.1|  PREDICTED: putative DNA-binding protein ESCA...    155   1e-41   
ref|XP_002320066.1|  DNA-binding family protein                         155   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_008437165.1|  PREDICTED: putative DNA-binding protein ESCA...    155   2e-41   
ref|XP_002301300.1|  DNA-binding family protein                         155   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_004511638.1|  PREDICTED: putative DNA-binding protein ESCA...    155   2e-41   
ref|XP_007134900.1|  hypothetical protein PHAVU_010G085300g             155   2e-41   
ref|XP_011017502.1|  PREDICTED: putative DNA-binding protein ESCA...    154   2e-41   
ref|XP_006445233.1|  hypothetical protein CICLE_v10024070mg             154   4e-41   
ref|XP_003521618.1|  PREDICTED: putative DNA-binding protein ESCA...    154   5e-41   
ref|XP_006851806.1|  hypothetical protein AMTR_s00041p00022450          154   6e-41   
ref|XP_008804006.1|  PREDICTED: putative DNA-binding protein ESCA...    154   8e-41   
ref|XP_002279636.1|  PREDICTED: putative DNA-binding protein ESCA...    153   1e-40   Vitis vinifera
gb|KEH19036.1|  AT hook motif DNA-binding family protein                153   1e-40   
ref|XP_010277406.1|  PREDICTED: putative DNA-binding protein ESCA...    152   1e-40   
ref|XP_004510939.1|  PREDICTED: putative DNA-binding protein ESCA...    149   3e-39   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...    149   5e-39   
ref|XP_009799054.1|  PREDICTED: putative DNA-binding protein ESCA...    148   6e-39   
ref|XP_010940981.1|  PREDICTED: putative DNA-binding protein ESCA...    148   7e-39   
ref|XP_009604907.1|  PREDICTED: putative DNA-binding protein ESCA...    147   1e-38   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...    147   3e-38   
ref|XP_010917984.1|  PREDICTED: putative DNA-binding protein ESCA...    146   4e-38   
ref|XP_010676637.1|  PREDICTED: putative DNA-binding protein ESCA...    146   5e-38   
ref|XP_010540129.1|  PREDICTED: putative DNA-binding protein ESCA...    147   5e-38   
ref|XP_010433987.1|  PREDICTED: putative DNA-binding protein ESCA...    146   5e-38   
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...    145   6e-38   
dbj|BAK03205.1|  predicted protein                                      145   9e-38   
ref|XP_006339443.1|  PREDICTED: putative DNA-binding protein ESCA...    145   1e-37   
gb|EYU30571.1|  hypothetical protein MIMGU_mgv1a010755mg                144   2e-37   
ref|XP_010092850.1|  hypothetical protein L484_022445                   144   3e-37   
ref|XP_011093194.1|  PREDICTED: putative DNA-binding protein ESCA...    143   6e-37   
ref|NP_194012.1|  putative AT-hook DNA-binding family protein           143   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869805.1|  hypothetical protein ARALYDRAFT_492588             143   7e-37   
ref|XP_006289235.1|  hypothetical protein CARUB_v10002691mg             143   1e-36   
ref|XP_004229823.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
ref|XP_010934543.1|  PREDICTED: putative DNA-binding protein ESCA...    143   1e-36   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...    142   1e-36   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050          142   2e-36   Sorghum bicolor [broomcorn]
ref|XP_010439279.1|  PREDICTED: putative DNA-binding protein ESCA...    142   2e-36   
gb|KDO85858.1|  hypothetical protein CISIN_1g047830mg                   142   2e-36   
ref|XP_010448831.1|  PREDICTED: putative DNA-binding protein ESCA...    142   3e-36   
ref|XP_003611214.1|  AT-hook DNA-binding protein                        142   3e-36   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...    140   6e-36   
ref|XP_010538771.1|  PREDICTED: putative DNA-binding protein ESCA...    140   6e-36   
ref|XP_010908279.1|  PREDICTED: putative DNA-binding protein ESCA...    140   6e-36   
gb|KFK37336.1|  hypothetical protein AALP_AA4G243300                    140   7e-36   
dbj|BAF02122.1|  putative DNA binding protein                           140   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141263.1|  hypothetical protein                               140   8e-36   Zea mays [maize]
ref|NP_192942.1|  putative AT-hook DNA-binding family protein           140   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182067.1|  AT-hook motif nuclear-localized protein 22            140   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422173.1|  PREDICTED: putative DNA-binding protein ESCA...    140   1e-35   
ref|XP_010433825.1|  PREDICTED: putative DNA-binding protein ESCA...    140   2e-35   
ref|XP_010455638.1|  PREDICTED: putative DNA-binding protein ESCA...    140   2e-35   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...    137   2e-35   
ref|XP_007220373.1|  hypothetical protein PRUPE_ppa018314mg             139   2e-35   
ref|XP_002874744.1|  hypothetical protein ARALYDRAFT_490024             139   3e-35   
ref|NP_001046754.1|  Os02g0448000                                       139   3e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006396802.1|  hypothetical protein EUTSA_v10029174mg             139   5e-35   
ref|XP_006296351.1|  hypothetical protein CARUB_v10025523mg             138   5e-35   
ref|XP_010692273.1|  PREDICTED: putative DNA-binding protein ESCA...    138   6e-35   
ref|XP_010523691.1|  PREDICTED: putative DNA-binding protein ESCA...    137   7e-35   
ref|XP_008811429.1|  PREDICTED: putative DNA-binding protein ESCA...    137   9e-35   
ref|XP_010508171.1|  PREDICTED: putative DNA-binding protein ESCA...    137   1e-34   
ref|XP_010506485.1|  PREDICTED: putative DNA-binding protein ESCA...    137   1e-34   
ref|XP_006397724.1|  hypothetical protein EUTSA_v10001760mg             136   3e-34   
ref|XP_002880179.1|  hypothetical protein ARALYDRAFT_903987             136   3e-34   
gb|KFK28863.1|  hypothetical protein AALP_AA7G058200                    136   5e-34   
ref|XP_008343156.1|  PREDICTED: putative DNA-binding protein ESCA...    135   6e-34   
ref|NP_001146992.1|  DNA binding protein                                135   7e-34   Zea mays [maize]
ref|XP_009379269.1|  PREDICTED: putative DNA-binding protein ESCA...    135   8e-34   
emb|CDY41289.1|  BnaA01g12500D                                          135   1e-33   
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...    135   1e-33   
ref|XP_008232681.1|  PREDICTED: putative DNA-binding protein ESCA...    134   1e-33   
emb|CDX82978.1|  BnaC01g14280D                                          134   1e-33   
ref|XP_008805810.1|  PREDICTED: putative DNA-binding protein ESCA...    134   2e-33   
ref|XP_010518160.1|  PREDICTED: putative DNA-binding protein ESCA...    134   3e-33   
emb|CDY27387.1|  BnaC04g50180D                                          133   5e-33   
ref|XP_009391843.1|  PREDICTED: putative DNA-binding protein ESCA...    132   6e-33   
ref|XP_009142337.1|  PREDICTED: putative DNA-binding protein ESCA...    132   6e-33   
emb|CDY37040.1|  BnaA04g26180D                                          132   7e-33   
emb|CDY04391.1|  BnaC02g28570D                                          133   7e-33   
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...    132   8e-33   
ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...    130   1e-32   
ref|XP_010053890.1|  PREDICTED: putative DNA-binding protein ESCA...    131   1e-32   
ref|XP_006284928.1|  hypothetical protein CARUB_v10006227mg             132   1e-32   
ref|XP_009411479.1|  PREDICTED: putative DNA-binding protein ESCA...    130   3e-32   
ref|XP_004145056.1|  PREDICTED: putative DNA-binding protein ESCA...    129   4e-32   
ref|XP_006413619.1|  hypothetical protein EUTSA_v10025672mg             130   6e-32   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...    129   6e-32   
gb|KDP40294.1|  hypothetical protein JCGZ_02292                         127   7e-32   
emb|CDX98771.1|  BnaA03g45560D                                          130   8e-32   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...    129   1e-31   
emb|CDP09327.1|  unnamed protein product                                129   1e-31   
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...    128   2e-31   
gb|EPS64135.1|  hypothetical protein M569_10646                         129   2e-31   
emb|CDX94128.1|  BnaC07g37620D                                          129   2e-31   
ref|XP_008467078.1|  PREDICTED: putative DNA-binding protein ESCA...    127   2e-31   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...    128   3e-31   
ref|XP_010262897.1|  PREDICTED: putative DNA-binding protein ESCA...    129   3e-31   
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20         127   3e-31   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...    126   5e-31   
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...    127   6e-31   
ref|XP_002529315.1|  DNA binding protein, putative                      126   9e-31   Ricinus communis
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450          126   1e-30   
ref|XP_002876587.1|  hypothetical protein ARALYDRAFT_486561             125   1e-30   
gb|ABZ89182.1|  putative protein                                        126   1e-30   Coffea canephora [robusta coffee]
gb|EYU41285.1|  hypothetical protein MIMGU_mgv1a025243mg                126   1e-30   
gb|ADY38789.1|  DNA-binding protein                                     126   1e-30   
ref|XP_009344356.1|  PREDICTED: putative DNA-binding protein ESCA...    126   2e-30   
ref|XP_010544659.1|  PREDICTED: putative DNA-binding protein ESCA...    125   2e-30   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g             125   2e-30   Populus trichocarpa [western balsam poplar]
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                     125   2e-30   
gb|KCW60423.1|  hypothetical protein EUGRSUZ_H03144                     122   3e-30   
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg             124   4e-30   
ref|XP_010102152.1|  hypothetical protein L484_021386                   123   7e-30   
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...    123   1e-29   
emb|CBI35166.3|  unnamed protein product                                123   1e-29   
ref|XP_011093448.1|  PREDICTED: putative DNA-binding protein ESCA...    123   1e-29   
gb|EYU18229.1|  hypothetical protein MIMGU_mgv1a020284mg                122   1e-29   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...    123   1e-29   
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g             123   1e-29   Populus trichocarpa [western balsam poplar]
gb|KFK31952.1|  hypothetical protein AALP_AA6G181300                    124   2e-29   
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...    123   2e-29   
emb|CAN61523.1|  hypothetical protein VITISV_016751                     122   2e-29   Vitis vinifera
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...    122   3e-29   
gb|EYU40290.1|  hypothetical protein MIMGU_mgv1a019526mg                122   3e-29   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...    122   4e-29   
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...    122   4e-29   Vitis vinifera
gb|ACU24276.1|  unknown                                                 121   4e-29   Glycine max [soybeans]
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...    121   4e-29   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...    123   4e-29   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841              122   5e-29   
ref|XP_009616004.1|  PREDICTED: putative DNA-binding protein ESCA...    121   5e-29   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g             122   5e-29   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...    122   5e-29   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...    121   5e-29   
ref|XP_004974243.1|  PREDICTED: putative DNA-binding protein ESCA...    120   6e-29   
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg             122   6e-29   
emb|CDP13007.1|  unnamed protein product                                121   6e-29   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...    121   6e-29   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...    120   6e-29   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...    121   6e-29   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...    121   8e-29   
ref|XP_010026866.1|  PREDICTED: putative DNA-binding protein ESCA...    121   8e-29   
ref|XP_003539199.1|  PREDICTED: putative DNA-binding protein ESCA...    120   9e-29   
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940          121   9e-29   Sorghum bicolor [broomcorn]
gb|KDO60958.1|  hypothetical protein CISIN_1g040216mg                   120   9e-29   
emb|CDY18931.1|  BnaC04g04190D                                          121   1e-28   
ref|XP_009394683.1|  PREDICTED: putative DNA-binding protein ESCA...    120   1e-28   
ref|XP_006366237.1|  PREDICTED: putative DNA-binding protein ESCA...    120   1e-28   
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...    119   1e-28   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...    119   1e-28   
ref|XP_002527105.1|  DNA binding protein, putative                      120   1e-28   Ricinus communis
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                   120   2e-28   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...    119   2e-28   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...    119   2e-28   
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                   120   2e-28   
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...    120   2e-28   
ref|XP_007048865.1|  AT-hook DNA-binding family protein                 119   2e-28   
ref|XP_002519826.1|  ESC, putative                                      120   2e-28   Ricinus communis
ref|XP_010104063.1|  hypothetical protein L484_008144                   121   2e-28   
ref|XP_006437176.1|  hypothetical protein CICLE_v10032444mg             119   2e-28   
ref|XP_003552472.1|  PREDICTED: putative DNA-binding protein ESCA...    119   2e-28   
gb|ACU24278.1|  unknown                                                 119   2e-28   Glycine max [soybeans]
gb|KDP46909.1|  hypothetical protein JCGZ_10400                         119   2e-28   
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...    121   3e-28   
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...    119   3e-28   
ref|XP_002279677.2|  PREDICTED: putative DNA-binding protein ESCA...    119   3e-28   Vitis vinifera
ref|XP_004249915.1|  PREDICTED: putative DNA-binding protein ESCA...    119   3e-28   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...    119   3e-28   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...    119   4e-28   
ref|XP_010097716.1|  hypothetical protein L484_023857                   119   4e-28   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...    119   5e-28   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg             119   5e-28   
ref|XP_008356452.1|  PREDICTED: putative DNA-binding protein ESCA...    119   6e-28   
emb|CDO99189.1|  unnamed protein product                                119   6e-28   
ref|XP_010469137.1|  PREDICTED: putative DNA-binding protein ESCA...    118   7e-28   
ref|XP_009143141.1|  PREDICTED: putative DNA-binding protein ESCA...    119   7e-28   
gb|KHN22151.1|  Putative DNA-binding protein ESCAROLA                   116   8e-28   
emb|CDX74739.1|  BnaA05g04850D                                          119   9e-28   
gb|AES80473.2|  AT hook motif DNA-binding family protein                118   9e-28   
gb|AFK38460.1|  unknown                                                 117   9e-28   
ref|XP_006436718.1|  hypothetical protein CICLE_v10032253mg             118   1e-27   
ref|XP_008377132.1|  PREDICTED: putative DNA-binding protein ESCA...    118   1e-27   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...    119   1e-27   
ref|XP_009347388.1|  PREDICTED: putative DNA-binding protein ESCA...    118   1e-27   
ref|XP_007039519.1|  AT-hook DNA-binding family protein                 118   1e-27   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...    117   1e-27   
ref|XP_009377073.1|  PREDICTED: putative DNA-binding protein ESCA...    118   1e-27   
ref|XP_003624255.1|  AT-hook DNA-binding protein                        118   1e-27   
ref|XP_008801621.1|  PREDICTED: putative DNA-binding protein ESCA...    118   1e-27   
ref|XP_006368407.1|  DNA-binding family protein                         117   2e-27   
ref|XP_004509027.1|  PREDICTED: putative DNA-binding protein ESCA...    117   2e-27   
ref|XP_010104316.1|  hypothetical protein L484_023266                   117   2e-27   
gb|KCW71795.1|  hypothetical protein EUGRSUZ_E00284                     117   2e-27   
ref|XP_006847733.1|  hypothetical protein AMTR_s00149p00093420          117   2e-27   
ref|XP_010055327.1|  PREDICTED: putative DNA-binding protein ESCA...    117   2e-27   
ref|XP_003516633.1|  PREDICTED: putative DNA-binding protein ESCA...    116   2e-27   
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...    117   2e-27   
gb|EPS62166.1|  hypothetical protein M569_12627                         115   2e-27   
ref|XP_009776190.1|  PREDICTED: putative DNA-binding protein ESCA...    117   2e-27   
ref|XP_007139682.1|  hypothetical protein PHAVU_008G050100g             117   2e-27   
ref|XP_006606853.1|  PREDICTED: putative DNA-binding protein ESCA...    118   2e-27   
ref|XP_010243718.1|  PREDICTED: putative DNA-binding protein ESCA...    116   3e-27   
ref|XP_006827517.1|  hypothetical protein AMTR_s00009p00189120          116   3e-27   
ref|XP_002444566.1|  hypothetical protein SORBIDRAFT_07g023830          114   3e-27   Sorghum bicolor [broomcorn]
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g             116   3e-27   
ref|XP_008238264.1|  PREDICTED: putative DNA-binding protein ESCA...    116   3e-27   
ref|XP_007210169.1|  hypothetical protein PRUPE_ppa019786mg             116   3e-27   
gb|ABL63119.1|  AT-hook DNA-binding protein                             116   3e-27   Catharanthus roseus [chatas]
gb|KDP22981.1|  hypothetical protein JCGZ_01738                         117   4e-27   
gb|EPS68305.1|  hypothetical protein M569_06465                         114   4e-27   
ref|XP_010035901.1|  PREDICTED: putative DNA-binding protein ESCA...    115   5e-27   
ref|XP_010920512.1|  PREDICTED: putative DNA-binding protein ESCA...    117   5e-27   
ref|XP_006402533.1|  hypothetical protein EUTSA_v10006144mg             116   5e-27   
ref|XP_004300243.1|  PREDICTED: putative DNA-binding protein ESCA...    116   5e-27   
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                     115   6e-27   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...    116   6e-27   
ref|XP_010531743.1|  PREDICTED: putative DNA-binding protein ESCA...    115   7e-27   
ref|XP_009597193.1|  PREDICTED: putative DNA-binding protein ESCA...    116   7e-27   
ref|XP_010053603.1|  PREDICTED: putative DNA-binding protein ESCA...    115   7e-27   
ref|XP_001785561.1|  predicted protein                                  112   7e-27   
ref|XP_011074056.1|  PREDICTED: putative DNA-binding protein ESCA...    116   7e-27   
ref|XP_007156666.1|  hypothetical protein PHAVU_002G006900g             115   8e-27   
ref|XP_006385649.1|  DNA-binding family protein                         115   9e-27   
ref|XP_004229513.1|  PREDICTED: putative DNA-binding protein ESCA...    115   9e-27   
emb|CAN83987.1|  hypothetical protein VITISV_032602                     115   1e-26   
ref|XP_002281411.1|  PREDICTED: putative DNA-binding protein ESCA...    115   1e-26   
ref|XP_004153985.1|  PREDICTED: putative DNA-binding protein ESCA...    114   1e-26   
ref|XP_004145070.1|  PREDICTED: putative DNA-binding protein ESCA...    114   1e-26   
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...    115   1e-26   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...    115   1e-26   
ref|XP_008799381.1|  PREDICTED: putative DNA-binding protein ESCA...    115   1e-26   
ref|XP_011028186.1|  PREDICTED: putative DNA-binding protein ESCA...    115   1e-26   
ref|XP_011018582.1|  PREDICTED: putative DNA-binding protein ESCA...    115   1e-26   
ref|XP_002284519.1|  PREDICTED: putative DNA-binding protein ESCA...    114   1e-26   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...    115   2e-26   
ref|XP_011002630.1|  PREDICTED: putative DNA-binding protein ESCA...    115   2e-26   
ref|XP_011044786.1|  PREDICTED: putative DNA-binding protein ESCA...    114   2e-26   
ref|XP_008370731.1|  PREDICTED: putative DNA-binding protein ESCA...    115   2e-26   
ref|XP_009372143.1|  PREDICTED: putative DNA-binding protein ESCA...    115   2e-26   
ref|XP_010102254.1|  hypothetical protein L484_024535                   114   2e-26   
ref|XP_009364460.1|  PREDICTED: putative DNA-binding protein ESCA...    114   2e-26   
ref|XP_002307550.2|  hypothetical protein POPTR_0005s22440g             114   2e-26   
ref|XP_002510734.1|  DNA binding protein, putative                      114   2e-26   
ref|XP_008460074.1|  PREDICTED: putative DNA-binding protein ESCA...    115   2e-26   
ref|XP_008801301.1|  PREDICTED: putative DNA-binding protein ESCA...    113   3e-26   
ref|XP_007145832.1|  hypothetical protein PHAVU_007G271800g             114   3e-26   
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...    114   3e-26   
ref|XP_008388703.1|  PREDICTED: putative DNA-binding protein ESCA...    114   3e-26   
ref|XP_007030480.1|  AT-hook motif nuclear localized protein 20         114   3e-26   
ref|XP_010509635.1|  PREDICTED: putative DNA-binding protein ESCA...    114   4e-26   
ref|XP_001763021.1|  predicted protein                                  110   4e-26   
ref|XP_010516702.1|  PREDICTED: putative DNA-binding protein ESCA...    114   4e-26   
ref|XP_002315208.2|  hypothetical protein POPTR_0010s20780g             114   4e-26   
ref|XP_004173725.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    113   4e-26   
ref|XP_003617443.1|  hypothetical protein MTR_5g091630                  113   5e-26   
ref|XP_008663461.1|  PREDICTED: putative DNA-binding protein ESCA...    114   5e-26   
emb|CDP06170.1|  unnamed protein product                                113   5e-26   
ref|XP_006296261.1|  hypothetical protein CARUB_v10025435mg             113   5e-26   
ref|XP_001765845.1|  predicted protein                                  110   6e-26   
ref|XP_004491337.1|  PREDICTED: putative DNA-binding protein ESCA...    112   6e-26   
gb|KFK36425.1|  hypothetical protein AALP_AA4G122700                    113   6e-26   
ref|NP_181070.1|  protein GIANT KILLER                                  113   6e-26   
gb|KGN56590.1|  hypothetical protein Csa_3G126060                       112   6e-26   
ref|XP_002879544.1|  hypothetical protein ARALYDRAFT_482492             113   6e-26   
ref|XP_009373988.1|  PREDICTED: putative DNA-binding protein ESCA...    113   7e-26   
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043              112   7e-26   
ref|XP_003608618.1|  AT-hook DNA-binding protein                        112   8e-26   
ref|XP_009384866.1|  PREDICTED: putative DNA-binding protein ESCA...    113   8e-26   
gb|AES90815.2|  AT hook motif DNA-binding family protein                113   9e-26   
ref|XP_006350955.1|  PREDICTED: putative DNA-binding protein ESCA...    113   9e-26   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...    112   9e-26   
ref|XP_009623613.1|  PREDICTED: putative DNA-binding protein ESCA...    112   9e-26   
ref|NP_001062524.1|  Os08g0563200                                       111   1e-25   
ref|XP_009592710.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
ref|XP_007043111.1|  AT-hook DNA-binding family protein, putative       112   1e-25   
ref|XP_010505030.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
gb|KDP23697.1|  hypothetical protein JCGZ_23530                         112   1e-25   
ref|NP_001151240.1|  DNA-binding protein                                112   1e-25   
gb|KDP36737.1|  hypothetical protein JCGZ_08028                         112   1e-25   
gb|EPS65599.1|  hypothetical protein M569_09178                         110   1e-25   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
gb|KEH42696.1|  AT hook motif DNA-binding family protein                113   1e-25   
ref|XP_006655164.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
ref|XP_004133907.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
ref|NP_181822.1|  AT-hook motif nuclear-localized protein 16            111   1e-25   
ref|XP_002881881.1|  DNA-binding family protein                         112   1e-25   
ref|XP_010506133.1|  PREDICTED: putative DNA-binding protein ESCA...    111   1e-25   
ref|XP_006295752.1|  hypothetical protein CARUB_v10024872mg             111   1e-25   
ref|XP_004497856.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
ref|XP_010554616.1|  PREDICTED: putative DNA-binding protein ESCA...    112   1e-25   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...    112   2e-25   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...    112   2e-25   
gb|KFK23205.1|  hypothetical protein AALP_AAs54797U000100               112   2e-25   
ref|XP_009141480.1|  PREDICTED: putative DNA-binding protein ESCA...    112   2e-25   
dbj|BAJ94293.1|  predicted protein                                      112   2e-25   
ref|XP_011091221.1|  PREDICTED: putative DNA-binding protein ESCA...    110   2e-25   
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g             111   2e-25   
emb|CAN75757.1|  hypothetical protein VITISV_028561                     112   2e-25   
emb|CBI31637.3|  unnamed protein product                                112   2e-25   
gb|KFK37136.1|  hypothetical protein AALP_AA4G217700                    111   2e-25   
emb|CDX90445.1|  BnaA03g43360D                                          111   2e-25   
gb|KDO42746.1|  hypothetical protein CISIN_1g040245mg                   111   2e-25   
ref|XP_010940763.1|  PREDICTED: putative DNA-binding protein ESCA...    112   3e-25   
ref|XP_004133943.1|  PREDICTED: putative DNA-binding protein ESCA...    110   3e-25   
ref|XP_009372638.1|  PREDICTED: putative DNA-binding protein ESCA...    112   3e-25   
ref|XP_011100032.1|  PREDICTED: putative DNA-binding protein ESCA...    111   3e-25   
ref|XP_006410687.1|  hypothetical protein EUTSA_v10017027mg             111   3e-25   
gb|ABD65169.1|  hypothetical protein 40.t00056                          111   3e-25   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...    111   3e-25   
ref|XP_002300879.2|  hypothetical protein POPTR_0002s06030g             110   3e-25   
ref|XP_004139388.1|  PREDICTED: putative DNA-binding protein ESCA...    111   3e-25   
ref|XP_008456342.1|  PREDICTED: putative DNA-binding protein ESCA...    111   3e-25   
ref|XP_011026257.1|  PREDICTED: putative DNA-binding protein ESCA...    110   3e-25   
ref|NP_001150826.1|  DNA-binding protein                                110   3e-25   
ref|XP_003568662.1|  PREDICTED: putative DNA-binding protein ESCA...    111   3e-25   
ref|XP_007220428.1|  hypothetical protein PRUPE_ppa009347mg             111   3e-25   
ref|XP_008453469.1|  PREDICTED: putative DNA-binding protein ESCA...    111   4e-25   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...    111   4e-25   
ref|XP_008466998.1|  PREDICTED: putative DNA-binding protein ESCA...    110   4e-25   
ref|XP_011041154.1|  PREDICTED: putative DNA-binding protein ESCA...    111   4e-25   
gb|EAZ06834.1|  hypothetical protein OsI_29071                          110   4e-25   
ref|XP_010658536.1|  PREDICTED: putative DNA-binding protein ESCA...    111   4e-25   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...    110   4e-25   
ref|XP_009373365.1|  PREDICTED: putative DNA-binding protein ESCA...    109   5e-25   
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...    111   5e-25   
ref|XP_009130966.1|  PREDICTED: putative DNA-binding protein ESCA...    110   5e-25   
gb|AFW74083.1|  DNA-binding protein                                     110   5e-25   
ref|XP_004956262.1|  PREDICTED: putative DNA-binding protein ESCA...    110   5e-25   
ref|XP_002319649.1|  DNA-binding family protein                         110   5e-25   
ref|XP_004160444.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    110   5e-25   
ref|XP_002307001.2|  hypothetical protein POPTR_0005s27850g             110   5e-25   
ref|XP_009143684.1|  PREDICTED: putative DNA-binding protein ESCA...    110   5e-25   
emb|CDX78802.1|  BnaA01g08690D                                          110   5e-25   
ref|XP_002868035.1|  hypothetical protein ARALYDRAFT_493093             110   6e-25   
ref|NP_193515.1|  putative AT-hook DNA-binding family protein           110   6e-25   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...    110   6e-25   
dbj|BAK02851.1|  predicted protein                                      110   6e-25   
ref|XP_004495454.1|  PREDICTED: putative DNA-binding protein ESCA...    111   7e-25   
ref|XP_002273442.1|  PREDICTED: putative DNA-binding protein ESCA...    110   7e-25   
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...    109   7e-25   
gb|ABD65635.1|  hypothetical protein 23.t00073                          110   7e-25   
ref|XP_008373356.1|  PREDICTED: putative DNA-binding protein ESCA...    111   7e-25   
emb|CDY54780.1|  BnaAnng13510D                                          110   7e-25   
ref|XP_010435119.1|  PREDICTED: putative DNA-binding protein ESCA...    110   7e-25   
ref|XP_008343481.1|  PREDICTED: putative DNA-binding protein ESCA...    111   7e-25   
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306    111   8e-25   
ref|XP_006285880.1|  hypothetical protein CARUB_v10007383mg             110   9e-25   
ref|XP_010677251.1|  PREDICTED: putative DNA-binding protein ESCA...    110   9e-25   
ref|XP_008803114.1|  PREDICTED: putative DNA-binding protein ESCA...    110   1e-24   
gb|KEH41146.1|  AT hook motif DNA-binding family protein                110   1e-24   
ref|XP_006414185.1|  hypothetical protein EUTSA_v10025859mg             110   1e-24   
dbj|BAK02723.1|  predicted protein                                      110   1e-24   
gb|KEH34733.1|  AT hook motif DNA-binding family protein                110   1e-24   
ref|XP_010440458.1|  PREDICTED: putative DNA-binding protein ESCA...    109   1e-24   
ref|XP_007211085.1|  hypothetical protein PRUPE_ppa016700mg             108   1e-24   
emb|CDX79838.1|  BnaA05g03180D                                          109   1e-24   
emb|CDY53650.1|  BnaC04g52840D                                          109   1e-24   
gb|AGC22550.1|  male sterility related AT-hook DNA binding protein      109   1e-24   
emb|CDX79599.1|  BnaC03g19350D                                          109   1e-24   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g             110   1e-24   
ref|XP_009133171.1|  PREDICTED: putative DNA-binding protein ESCA...    108   1e-24   
ref|XP_009142892.1|  PREDICTED: putative DNA-binding protein ESCA...    108   1e-24   
ref|XP_010935004.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    109   1e-24   
ref|NP_191646.1|  AT-hook motif nuclear-localized protein 18            108   2e-24   
ref|XP_010508503.1|  PREDICTED: putative DNA-binding protein ESCA...    108   2e-24   
ref|XP_010506134.1|  PREDICTED: putative DNA-binding protein ESCA...    108   2e-24   
ref|XP_009133560.1|  PREDICTED: putative DNA-binding protein ESCA...    108   2e-24   
ref|XP_002870310.1|  hypothetical protein ARALYDRAFT_493459             108   2e-24   
ref|XP_010450033.1|  PREDICTED: putative DNA-binding protein ESCA...    108   2e-24   
ref|XP_011033055.1|  PREDICTED: putative DNA-binding protein ESCA...    109   2e-24   
ref|XP_006411566.1|  hypothetical protein EUTSA_v10017103mg             108   3e-24   
ref|XP_008786310.1|  PREDICTED: putative DNA-binding protein ESCA...    108   3e-24   
emb|CDY72485.1|  BnaCnng77890D                                          108   3e-24   
ref|XP_010935866.1|  PREDICTED: putative DNA-binding protein ESCA...    108   3e-24   
ref|XP_010063173.1|  PREDICTED: putative DNA-binding protein ESCA...    108   3e-24   
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...    108   3e-24   
ref|XP_009383960.1|  PREDICTED: putative DNA-binding protein ESCA...    107   4e-24   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...    108   4e-24   
ref|XP_007210817.1|  hypothetical protein PRUPE_ppa020689mg             108   4e-24   
ref|XP_002524209.1|  ESC, putative                                      108   5e-24   
ref|XP_009399398.1|  PREDICTED: putative DNA-binding protein ESCA...    107   5e-24   
ref|XP_009401827.1|  PREDICTED: putative DNA-binding protein ESCA...    107   5e-24   
gb|KCW70368.1|  hypothetical protein EUGRSUZ_F03609                     107   5e-24   
ref|NP_001048546.1|  Os02g0820800                                       107   5e-24   
ref|XP_009791033.1|  PREDICTED: putative DNA-binding protein ESCA...    107   5e-24   
ref|XP_010063174.1|  PREDICTED: putative DNA-binding protein ESCA...    107   6e-24   
ref|XP_003570419.1|  PREDICTED: putative DNA-binding protein ESCA...    107   6e-24   
ref|XP_009136874.1|  PREDICTED: putative DNA-binding protein ESCA...    107   6e-24   
ref|XP_001760962.1|  predicted protein                                  104   7e-24   
ref|NP_001056730.1|  Os06g0136900                                       108   7e-24   
ref|XP_008785537.1|  PREDICTED: putative DNA-binding protein ESCA...    107   8e-24   
ref|XP_008237909.1|  PREDICTED: putative DNA-binding protein ESCA...    107   8e-24   
emb|CDY12779.1|  BnaC04g28620D                                          107   8e-24   
ref|XP_008777391.1|  PREDICTED: putative DNA-binding protein ESCA...    107   9e-24   
emb|CDP00129.1|  unnamed protein product                                107   9e-24   
ref|XP_009399397.1|  PREDICTED: putative DNA-binding protein ESCA...    107   1e-23   
ref|NP_567432.1|  AT-hook motif nuclear-localized protein 20            107   1e-23   
emb|CDP12442.1|  unnamed protein product                                110   1e-23   
ref|XP_008438225.1|  PREDICTED: putative DNA-binding protein ESCA...    106   1e-23   
ref|XP_010552065.1|  PREDICTED: putative DNA-binding protein ESCA...    107   1e-23   
gb|EMS64253.1|  hypothetical protein TRIUR3_00437                       107   1e-23   
ref|XP_002521959.1|  DNA binding protein, putative                      107   1e-23   
ref|XP_001757515.1|  predicted protein                                  103   1e-23   
ref|XP_006342185.1|  PREDICTED: putative DNA-binding protein ESCA...    105   2e-23   
gb|KDP44918.1|  hypothetical protein JCGZ_01418                         107   2e-23   
ref|XP_006414705.1|  hypothetical protein EUTSA_v10025929mg             106   2e-23   
gb|ABL63121.1|  AT-hook DNA-binding protein                             106   2e-23   
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...    107   2e-23   
gb|KHN11964.1|  Putative DNA-binding protein ESCAROLA                   105   2e-23   
ref|XP_007141856.1|  hypothetical protein PHAVU_008G231500g             105   2e-23   
emb|CDY42810.1|  BnaC03g23960D                                          108   2e-23   
ref|XP_003581586.1|  PREDICTED: putative DNA-binding protein ESCA...    107   2e-23   
ref|XP_010907805.1|  PREDICTED: putative DNA-binding protein ESCA...    106   2e-23   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg             107   2e-23   
emb|CDX83510.1|  BnaA03g19960D                                          108   2e-23   
ref|XP_006595755.1|  PREDICTED: putative DNA-binding protein ESCA...    105   2e-23   
ref|XP_010052700.1|  PREDICTED: putative DNA-binding protein ESCA...    105   2e-23   
emb|CDY49327.1|  BnaA05g32890D                                          106   2e-23   
ref|XP_004163877.1|  PREDICTED: putative DNA-binding protein ESCA...    105   2e-23   
ref|XP_008448697.1|  PREDICTED: putative DNA-binding protein ESCA...    105   2e-23   
ref|XP_004148759.1|  PREDICTED: putative DNA-binding protein ESCA...    105   2e-23   
ref|XP_008796294.1|  PREDICTED: putative DNA-binding protein ESCA...    106   2e-23   
ref|XP_006342184.1|  PREDICTED: putative DNA-binding protein ESCA...    105   3e-23   
ref|XP_010525495.1|  PREDICTED: putative DNA-binding protein ESCA...    105   3e-23   
ref|XP_008232226.1|  PREDICTED: putative DNA-binding protein ESCA...    105   3e-23   
ref|XP_011034791.1|  PREDICTED: putative DNA-binding protein ESCA...    105   3e-23   
ref|XP_002969614.1|  hypothetical protein SELMODRAFT_71342              104   4e-23   
ref|XP_004301614.1|  PREDICTED: putative DNA-binding protein ESCA...    105   4e-23   
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...    105   4e-23   
ref|XP_010645606.1|  PREDICTED: putative DNA-binding protein ESCA...    105   5e-23   
ref|XP_009611172.1|  PREDICTED: putative DNA-binding protein ESCA...    105   5e-23   
ref|XP_010096609.1|  hypothetical protein L484_025356                   105   5e-23   
ref|XP_009142094.1|  PREDICTED: putative DNA-binding protein ESCA...    104   5e-23   
ref|XP_008465963.1|  PREDICTED: putative DNA-binding protein ESCA...    105   5e-23   
ref|XP_002301896.2|  hypothetical protein POPTR_0002s00560g             105   5e-23   
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...    105   6e-23   
ref|XP_001752988.1|  predicted protein                                  102   6e-23   
gb|AAM65129.1|  putative DNA-binding protein                            105   6e-23   
ref|XP_006285829.1|  hypothetical protein CARUB_v10007306mg             105   6e-23   
ref|XP_007141404.1|  hypothetical protein PHAVU_008G192600g             104   7e-23   
ref|XP_009384565.1|  PREDICTED: putative DNA-binding protein ESCA...    103   7e-23   



>ref|XP_006358367.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=311

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 11/193 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESVS F+RRRQRGVCIMSGTG V NV LRQPASPGA+ TLHGRFEILSL+
Sbjct  130  MEIADGCDIMESVSNFSRRRQRGVCIMSGTGNVTNVNLRQPASPGAIATLHGRFEILSLA  189

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGG VVG+L+ASGPV++MAASFSNAAYERLPLDE
Sbjct  190  GSFLPPPAPPAASGLTIYLAGGQGQVVGGCVVGSLMASGPVVIMAASFSNAAYERLPLDE  249

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N LP+QGG        +  GGQQQQ          +LADPS+FHGMPPNLLN++QLP
Sbjct  250  DDSNQLPVQGGSLGSPGATIAPGGQQQQ----------LLADPSLFHGMPPNLLNNVQLP  299

Query  237  NDQGFWATGRPPF  199
            + + +WATGRPPF
Sbjct  300  S-EAYWATGRPPF  311



>ref|XP_009763803.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 160/193 (83%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIM+S+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  107  MEIADGCDIMDSISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLA  166

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  167  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEE  226

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE N LP+         GG  G            QQQQ++ADPS+FHGMPPNLLNSIQLP
Sbjct  227  DEQNPLPV-------PGGGTLGSPPGNIGGPGQQQQQQLMADPSLFHGMPPNLLNSIQLP  279

Query  237  NDQGFWATGRPPF  199
             +  +WATGRPPF
Sbjct  280  TEP-YWATGRPPF  291



>ref|XP_009763802.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=294

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 160/193 (83%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIM+S+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  110  MEIADGCDIMDSISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLA  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  170  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEE  229

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE N LP+         GG  G            QQQQ++ADPS+FHGMPPNLLNSIQLP
Sbjct  230  DEQNPLPV-------PGGGTLGSPPGNIGGPGQQQQQQLMADPSLFHGMPPNLLNSIQLP  282

Query  237  NDQGFWATGRPPF  199
             +  +WATGRPPF
Sbjct  283  TEP-YWATGRPPF  294



>ref|XP_010324605.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=319

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 157/193 (81%), Gaps = 10/193 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESVS F+RRRQRGVCIMSGTG V NV LRQPASPGA+ TLHGRFEILSL+
Sbjct  137  MEIADGCDIMESVSNFSRRRQRGVCIMSGTGNVTNVNLRQPASPGAIATLHGRFEILSLA  196

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGG VVG+L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  197  GSFLPPPAPPAASGLTIYLAGGQGQVVGGCVVGSLMASGPVVIMAASFSNAAYERLPLEE  256

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N LP+          G   G          PQ QQ+L DPS+FHGMPPNLLN++QLP
Sbjct  257  DDSNQLPV---------QGGSLGSPGATVAPGGPQHQQLLGDPSLFHGMPPNLLNNVQLP  307

Query  237  NDQGFWATGRPPF  199
            + + +WATGRPPF
Sbjct  308  S-EAYWATGRPPF  319



>ref|XP_009613222.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 160/193 (83%), Gaps = 6/193 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMES+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  113  MEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLA  172

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  173  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEE  232

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N LP+               G    Q +   QQQQ++ADPS+FHGM PNLLNSIQLP
Sbjct  233  DDQNPLPV-----PGGGTLGSPPGNIGGQGRQQQQQQQLMADPSLFHGMQPNLLNSIQLP  287

Query  237  NDQGFWATGRPPF  199
            ++  +WATGRPPF
Sbjct  288  SES-YWATGRPPF  299



>ref|XP_009613223.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
tomentosiformis]
Length=296

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 160/193 (83%), Gaps = 6/193 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMES+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  110  MEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLA  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  170  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEE  229

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N LP+               G    Q +   QQQQ++ADPS+FHGM PNLLNSIQLP
Sbjct  230  DDQNPLPV-----PGGGTLGSPPGNIGGQGRQQQQQQQLMADPSLFHGMQPNLLNSIQLP  284

Query  237  NDQGFWATGRPPF  199
            ++  +WATGRPPF
Sbjct  285  SES-YWATGRPPF  296



>ref|XP_009778295.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=306

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 159/193 (82%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESVS F+RRRQRGVCIMSGTG V NV LRQPASPGA  TLHGRFEILSL+
Sbjct  122  MEIADGCDIMESVSNFSRRRQRGVCIMSGTGNVTNVNLRQPASPGATATLHGRFEILSLA  181

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAPAAASGLTIYLAGGQGQVVGG VVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  182  GSFLPPPAPAAASGLTIYLAGGQGQVVGGCVVGALMASGPVVIMAASFSNAAYERLPLEE  241

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N+LP          G +G         Q   QQQQ+L DPS+FHGMPPNLLN++QLP
Sbjct  242  DDSNSLP-------PQGGSLGSPRAIAPGGQQQQQQQQLLTDPSLFHGMPPNLLNNVQLP  294

Query  237  NDQGFWATGRPPF  199
            + + +WATGRPPF
Sbjct  295  S-EAYWATGRPPF  306



>ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Solanum 
lycopersicum]
Length=292

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 160/194 (82%), Gaps = 11/194 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMES+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  109  MEIADGCDIMESISNFARRRQRGVCIMSGTGVVTNVNLRQPASPGAIVTLHGRFEILSLA  168

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL+E
Sbjct  169  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEE  228

Query  417  DEGN-ALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            D+ N  LP+            GG            QQQQI+ADPS+FHGMPPNLLNSIQL
Sbjct  229  DDQNHPLPI---------VPGGGSLGSPPGNIGQQQQQQIMADPSLFHGMPPNLLNSIQL  279

Query  240  PNDQGFWATGRPPF  199
            P++  +WATGRPPF
Sbjct  280  PSEP-YWATGRPPF  292



>ref|XP_010325447.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Solanum 
lycopersicum]
Length=289

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 160/194 (82%), Gaps = 11/194 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMES+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  106  MEIADGCDIMESISNFARRRQRGVCIMSGTGVVTNVNLRQPASPGAIVTLHGRFEILSLA  165

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL+E
Sbjct  166  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEE  225

Query  417  DEGN-ALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            D+ N  LP+            GG            QQQQI+ADPS+FHGMPPNLLNSIQL
Sbjct  226  DDQNHPLPI---------VPGGGSLGSPPGNIGQQQQQQIMADPSLFHGMPPNLLNSIQL  276

Query  240  PNDQGFWATGRPPF  199
            P++  +WATGRPPF
Sbjct  277  PSEP-YWATGRPPF  289



>ref|XP_009621304.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=307

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 161/193 (83%), Gaps = 9/193 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESVS F+RRRQRGVCIMSGTG V NV LRQPASPGA+ TLHGRFEILSL+
Sbjct  124  MEIADGCDIMESVSNFSRRRQRGVCIMSGTGNVTNVNLRQPASPGAIATLHGRFEILSLA  183

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGG VVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  184  GSFLPPPAPPAASGLTIYLAGGQGQVVGGCVVGALMASGPVVIMAASFSNAAYERLPLEE  243

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N+LP          GG  G  +     +   QQQQ+L DPS+FHGMPPNLLN++QLP
Sbjct  244  DDLNSLP--------PQGGSLGSPRAIAPGERQQQQQQLLIDPSLFHGMPPNLLNNVQLP  295

Query  237  NDQGFWATGRPPF  199
            + +G+WATG+PPF
Sbjct  296  S-EGYWATGQPPF  307



>gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus]
Length=293

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 163/200 (82%), Gaps = 9/200 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESV+ FARRRQRGVCIMSG+GTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  96   MEIADGCDIMESVATFARRRQRGVCIMSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLA  155

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+ LTIYLAGGQGQVVGGSVVGALLASGPV++MAASFSNAAYERLPLDE
Sbjct  156  GSFLPPPAPPAATSLTIYLAGGQGQVVGGSVVGALLASGPVVIMAASFSNAAYERLPLDE  215

Query  417  DEGNALPL------qggggmdspggvggggqqqqqqqpppqqqQILADPS-MFHGMPPNL  259
            +E N++PL         GG     G   G QQQQ  Q   Q      DPS +FHGMPPNL
Sbjct  216  EE-NSIPLQSGGSLGSPGGGGGGNGGVPGQQQQQGGQQQQQLLGGGGDPSALFHGMPPNL  274

Query  258  LNSIQLPNDQGFWATGRPPF  199
            LNSIQLPN + +WATGRPPF
Sbjct  275  LNSIQLPN-EAYWATGRPPF  293



>gb|EYU29016.1| hypothetical protein MIMGU_mgv1a023550mg [Erythranthe guttata]
Length=298

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI+DGCD+M+SV++FAR RQRGVCIMSG+G V NVTLRQPASPGAVVTL GRFEILSLS
Sbjct  110  MEISDGCDVMDSVASFARSRQRGVCIMSGSGNVTNVTLRQPASPGAVVTLQGRFEILSLS  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGG VVG L+ASGPV+VMAASFSNAAYERLPL+E
Sbjct  170  GSFLPPPAPPAATGLTIYLAGGQGQVVGGGVVGPLVASGPVIVMAASFSNAAYERLPLEE  229

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N +    G G        GGG +        QQQQILADPS+F GMPPNLLNSIQ+P
Sbjct  230  DDQNGV---QGQGNSLGSPPQGGGGRAAPPPSLQQQQQILADPSLFQGMPPNLLNSIQMP  286

Query  237  NDQGFWATGRPPF  199
            ND+ FWATGRPPF
Sbjct  287  NDE-FWATGRPPF  298



>ref|XP_008346594.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 167/197 (85%), Gaps = 5/197 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPG++VTLHGRFEILSL+
Sbjct  115  MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSIVTLHGRFEILSLA  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  175  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEE  234

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQIL----ADPSMFHGMPPNLLNS  250
            DEG  LP+QGGGG       G G Q QQQQQ   QQQ +     ++P +FHG+PPNLLNS
Sbjct  235  DEGQ-LPMQGGGGGSLGSPSGVGHQNQQQQQQQQQQQLMAEAANSNPPLFHGLPPNLLNS  293

Query  249  IQLPNDQGFWATGRPPF  199
            +QLP +  +WATGRPPF
Sbjct  294  MQLPAEAAYWATGRPPF  310



>ref|XP_008373872.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=310

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 167/197 (85%), Gaps = 5/197 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPG++VTLHGRFEILSL+
Sbjct  115  MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSIVTLHGRFEILSLA  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  175  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLXASGPVVIMAASFSNAAYERLPLEE  234

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQIL----ADPSMFHGMPPNLLNS  250
            DEG  LP+QGGGG       G G Q QQQQQ   QQQ +     ++P +FHG+PPNLLNS
Sbjct  235  DEGQ-LPMQGGGGGSLGSPSGVGHQNQQQQQQQQQQQLMAEAANSNPPLFHGLPPNLLNS  293

Query  249  IQLPNDQGFWATGRPPF  199
            +QLP +  +WATGRPPF
Sbjct  294  MQLPAEAAYWATGRPPF  310



>ref|XP_009594477.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=219

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 155/193 (80%), Gaps = 14/193 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESVS F+RRRQRGVCIMSGTG V NV L+QPASPG + TLHGRFEILSLS
Sbjct  41   MEIADGCDIMESVSNFSRRRQRGVCIMSGTGNVTNVNLKQPASPGEIATLHGRFEILSLS  100

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP+AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  101  GSFLPPPAPSAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEE  160

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N  P+               G          QQQQ+LAD S+ HGMPPNLLNSIQLP
Sbjct  161  DDQNPHPV-------------APGDSPGATGGHGQQQQLLADGSILHGMPPNLLNSIQLP  207

Query  237  NDQGFWATGRPPF  199
              +G+WATGRPPF
Sbjct  208  -PEGYWATGRPPF  219



>ref|XP_010108102.1| hypothetical protein L484_023188 [Morus notabilis]
 gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis]
Length=302

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESVS FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  112  MEIADGCDIVESVSTFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLA  171

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L+ASGPV+VMAASFSNAAYERLPL+E
Sbjct  172  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIASGPVVVMAASFSNAAYERLPLEE  231

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+   LPLQGGGG       G   Q               A P++FHG+PPNLLNSIQ+P
Sbjct  232  DDQTQLPLQGGGGGVGSPTGGQQQQIMAAAAAAEAANSGGA-PTLFHGLPPNLLNSIQMP  290

Query  237  NDQGFWATGRPPF  199
              + +WA+GRPP+
Sbjct  291  A-EAYWASGRPPY  302



>ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 159/194 (82%), Gaps = 8/194 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMES+S FARRRQRGVCIMSGTG V NV LRQPASPGA+VTLHGRFEILSL+
Sbjct  107  MEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNVNLRQPASPGAIVTLHGRFEILSLA  166

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP   SGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL+E
Sbjct  167  GSFLPPPAPPTTSGLTIYLAGGQGQVVGGSVVGALMASGPVVIMSASFSNAAYERLPLEE  226

Query  417  DEGN-ALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            D  N  LP+         GG  G        Q   QQQQ++ADPS+FHGMPPNLLNSIQL
Sbjct  227  DNQNHPLPV------VPGGGSLGSPPGNIGGQGGQQQQQMMADPSLFHGMPPNLLNSIQL  280

Query  240  PNDQGFWATGRPPF  199
            P++  +WATGRPPF
Sbjct  281  PSEP-YWATGRPPF  293



>ref|XP_004298711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=309

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPA+PG+VVTLHGRFEILSL+
Sbjct  119  MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPATPGSVVTLHGRFEILSLA  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG LLASGPV++MAASFSNAAYERLPL+E
Sbjct  179  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLLASGPVVIMAASFSNAAYERLPLEE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DEG ++P+ GG             QQQQQQQ    +      P +FHG+PPNLLNS+QLP
Sbjct  239  DEG-SMPMPGGSMGSPTAVGQQQHQQQQQQQQLLAEAANTNAP-LFHGLPPNLLNSMQLP  296

Query  237  NDQGFWATGRPPF  199
             +  +WATGRPPF
Sbjct  297  AEAAYWATGRPPF  309



>ref|XP_008238673.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=309

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 6/198 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVT+RQPASPG++VTLHGRFEILSL+
Sbjct  113  MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTIRQPASPGSIVTLHGRFEILSLA  172

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGG GQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  173  GSFLPPPAPPAATGLTIYLAGGGGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  232

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS-----MFHGMPPNLLN  253
            DEG  LP+QGGGG       G G QQQQQ Q   QQQQ+LA+ +     +FHG+PPNLLN
Sbjct  233  DEGQ-LPMQGGGGGSLGSPSGVGHQQQQQHQQQQQQQQLLAEAANTNAPLFHGLPPNLLN  291

Query  252  SIQLPNDQGFWATGRPPF  199
            S+QLP +  +WATGRPP+
Sbjct  292  SMQLPAEAAYWATGRPPY  309



>gb|EYU43510.1| hypothetical protein MIMGU_mgv1a017700mg [Erythranthe guttata]
Length=309

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++DGCDIM+SV++FARRRQRGVC+MSGTG V NVTLRQPA+PGAV+TLHGRFEILSL+
Sbjct  117  MEVSDGCDIMDSVASFARRRQRGVCVMSGTGNVTNVTLRQPAAPGAVMTLHGRFEILSLA  176

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQV+GGSVVG LLASGPV++MAASFSNAAYERLPL+E
Sbjct  177  GSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEE  236

Query  417  DEGNALPLqggg-gmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            DE  A+          S  G   GG     Q P   QQQ+LADPS+F GMPPNL NSIQ+
Sbjct  237  DENAAINNNNNQVPGSSSLGSPPGGLGGSGQPPQNHQQQVLADPSLFQGMPPNLFNSIQM  296

Query  240  PNDQGFWATGRPPF  199
            PN + FWATGRPPF
Sbjct  297  PN-EAFWATGRPPF  309



>gb|EYU40549.1| hypothetical protein MIMGU_mgv1a021038mg [Erythranthe guttata]
Length=310

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++DGCDIM+SV++FARRRQRGVC+MSGTG V NVTLRQPA+PGAV+TLHGRFEILSL+
Sbjct  118  MEVSDGCDIMDSVASFARRRQRGVCVMSGTGNVTNVTLRQPAAPGAVMTLHGRFEILSLA  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQV+GGSVVG LLASGPV++MAASFSNAAYERLPL+E
Sbjct  178  GSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEE  237

Query  417  DEGNALPLqggg-gmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            DE  A+          S  G   GG     Q P   QQQ+LADPS+F GMPPNL NSIQ+
Sbjct  238  DENAAINNNNNQVPGSSSLGSPPGGLGGSGQPPQNHQQQVLADPSLFQGMPPNLFNSIQM  297

Query  240  PNDQGFWATGRPPF  199
            PN + FWATGRPPF
Sbjct  298  PN-EAFWATGRPPF  310



>ref|XP_009788952.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=219

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 154/193 (80%), Gaps = 14/193 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESVS F+RRRQRGVCIMSGTG V NV L+QPASPG + TLHGRFEILSLS
Sbjct  41   MEIADGCDIMESVSNFSRRRQRGVCIMSGTGNVTNVNLKQPASPGEIATLHGRFEILSLS  100

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP+AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASF NAAYERLPL+E
Sbjct  101  GSFLPPPAPSAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFGNAAYERLPLEE  160

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+ N LP+               G          QQQQ+LAD S+ H MPPNLLNSIQLP
Sbjct  161  DDQNPLPV-------------APGGSPGATGGHGQQQQLLADGSILHVMPPNLLNSIQLP  207

Query  237  NDQGFWATGRPPF  199
              +G+WATGRPPF
Sbjct  208  -PEGYWATGRPPF  219



>emb|CBI34813.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 159/195 (82%), Gaps = 17/195 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSLS
Sbjct  61   MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLS  120

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG LLASGPV++MAASFSNAAYERLPL E
Sbjct  121  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPL-E  179

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E  ALP+              GG        P Q QQ+LADP+  +FHG+PPNLLNSIQ
Sbjct  180  EEDPALPM-------------PGGSLGSPGGQPQQPQQLLADPNAPLFHGLPPNLLNSIQ  226

Query  243  LPNDQGFWATGRPPF  199
            LP +  +WATGRPP+
Sbjct  227  LPAE-AYWATGRPPY  240



>emb|CDP09863.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 159/193 (82%), Gaps = 11/193 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDIMESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  110  MEIADGCDIMESVANFARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+ LTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPLDE
Sbjct  170  GSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLDE  229

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE +         +   GG  G       QQ   QQQQ++ADPS+F  MPPNL NS+QLP
Sbjct  230  DESS---------LQMQGGSLGSPGAVGGQQQQQQQQQLMADPSLF-SMPPNLFNSVQLP  279

Query  237  NDQGFWATGRPPF  199
            N + +WATGRPPF
Sbjct  280  N-EAYWATGRPPF  291



>ref|XP_011081090.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=285

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 157/193 (81%), Gaps = 10/193 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI+DGCDIM+ V+ FAR RQRGVCIMSG+G V NVTLRQPASPG VVTLHGRFEILSL+
Sbjct  103  MEISDGCDIMDCVANFARSRQRGVCIMSGSGNVTNVTLRQPASPGQVVTLHGRFEILSLA  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG LLASGPV++MAASFSNAAYERLP++E
Sbjct  163  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLLASGPVMIMAASFSNAAYERLPIEE  222

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +E NA+P+         GG  G            QQQQIL DPS+F GMPPNLLNSIQ+P
Sbjct  223  EE-NAIPV--------QGGSLGSPPPPGSVGGQQQQQQILPDPSLFQGMPPNLLNSIQMP  273

Query  237  NDQGFWATGRPPF  199
            N + FWATGRPPF
Sbjct  274  N-EAFWATGRPPF  285



>ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=302

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 166/195 (85%), Gaps = 8/195 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSLS
Sbjct  114  MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLS  173

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG LLASGPV++MAASFSNAAYERLPL E
Sbjct  174  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAYERLPL-E  232

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E  ALP+       S G  GG GQ Q  QQ P Q QQ+LADP+  +FHG+PPNLLNSIQ
Sbjct  233  EEDPALPM----PGGSLGSPGGVGQHQPPQQQPQQPQQLLADPNAPLFHGLPPNLLNSIQ  288

Query  243  LPNDQGFWATGRPPF  199
            LP  + +WATGRPP+
Sbjct  289  LP-AEAYWATGRPPY  302



>gb|KDP28740.1| hypothetical protein JCGZ_14511 [Jatropha curcas]
Length=308

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCDIMESVS FARRRQRGVCI+SGTGTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  117  MEIANGCDIMESVSTFARRRQRGVCILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLS  176

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  177  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEE  236

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DEG       G             Q QQQQQ   QQ     +PS+F G+PPNLLNS+QLP
Sbjct  237  DEGQVAVAGNGPLGSPGAVGQPQQQPQQQQQTQQQQLMQDPNPSLFQGLPPNLLNSVQLP  296

Query  237  NDQGFWATGRPPF  199
              + +W TGRPP+
Sbjct  297  -AEAYWGTGRPPY  308



>ref|XP_008364289.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=308

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPG+VVTLHGRFEILSL+
Sbjct  115  MEIADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGSVVTLHGRFEILSLA  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  175  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  234

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            DEG  LP+QGGGG        G   QQQQQ    Q     A+ +  +FHG+ PNLLNS++
Sbjct  235  DEGQ-LPMQGGGGSVGSPTGVGHQNQQQQQPQHQQLLAEAANSNAPLFHGLHPNLLNSME  293

Query  243  LPNDQGFWATGRPPF  199
            LP +  +WAT RPPF
Sbjct  294  LPAEAAYWATSRPPF  308



>ref|XP_011029110.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 12/195 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  118  MEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLA  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  178  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGPLTASGPVVIMAASFSNAAYERLPLEE  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            ++   +P+         GG  G      QQQ  PQQ Q++A+P+  +FHG+PPNLLNSIQ
Sbjct  238  EDPQ-MPM--------QGGGMGSPGGVGQQQQQPQQHQVMAEPNAQLFHGLPPNLLNSIQ  288

Query  243  LPNDQGFWATGRPPF  199
            LP  + +WATGRPP+
Sbjct  289  LP-AEAYWATGRPPY  302



>ref|XP_011033866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=303

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 156/193 (81%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  119  MEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLA  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  179  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++   +P+QGG             Q QQQQ    Q      +  +FHG+PPNLLNSIQLP
Sbjct  239  EDPQ-MPMQGGEMGSPGAVGQQQQQPQQQQVMAEQ------NAQLFHGLPPNLLNSIQLP  291

Query  237  NDQGFWATGRPPF  199
              + +WATGRPP+
Sbjct  292  -AEAYWATGRPPY  303



>ref|XP_002303540.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE78519.1| DNA-binding family protein [Populus trichocarpa]
Length=303

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 156/193 (81%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  119  MEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLA  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  179  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++   +P+QGG             Q QQQQ    Q      +  +FHG+PPNLLNSIQLP
Sbjct  239  EDPQ-MPMQGGEMGSPGAVGQQQQQPQQQQVMAEQ------NAQLFHGLPPNLLNSIQLP  291

Query  237  NDQGFWATGRPPF  199
              + +WATGRPP+
Sbjct  292  -AEAYWATGRPPY  303



>ref|XP_002299584.2| DNA-binding family protein [Populus trichocarpa]
 gb|EEE84389.2| DNA-binding family protein [Populus trichocarpa]
Length=302

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 157/193 (81%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  118  MEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLA  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  178  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEE  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++   +P+QGGG     G      Q QQ Q    Q      +  +FHG+PPNLLNSIQLP
Sbjct  238  EDPQ-MPMQGGGMGSPGGVGQQQQQPQQHQVMAEQ------NAQLFHGLPPNLLNSIQLP  290

Query  237  NDQGFWATGRPPF  199
              + +WATGRPP+
Sbjct  291  -AEAYWATGRPPY  302



>emb|CDP17786.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 157/195 (81%), Gaps = 8/195 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ESVS FA RRQRGVCI+SG GTVNNVTLRQPA+PGAVVTLHGRFEILSLS
Sbjct  122  MEIASGCDIQESVSNFATRRQRGVCILSGNGTVNNVTLRQPAAPGAVVTLHGRFEILSLS  181

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAPAAASGLTIYLAGGQGQVVGGSVVG LLA+GPV++MAASF NAAYERLPL++
Sbjct  182  GSFLPPPAPAAASGLTIYLAGGQGQVVGGSVVGPLLAAGPVVIMAASFGNAAYERLPLED  241

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            DE  A+P          G +G  G     QQ P Q QQ+L DP  S+FHGMPPNLLNS Q
Sbjct  242  DETAAVP------PPGSGPLGSPGAGIVGQQQPQQSQQLLPDPSSSLFHGMPPNLLNSCQ  295

Query  243  LPNDQGFWATGRPPF  199
            LP +  +W TGRPPF
Sbjct  296  LPAEAAYWGTGRPPF  310



>ref|XP_007040019.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=302

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 159/195 (82%), Gaps = 13/195 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI DGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPAS GA+VTLHGRFEILSL+
Sbjct  119  MEIGDGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASAGAIVTLHGRFEILSLA  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L+ SGPV++MAASFSNAAYERLPL+E
Sbjct  179  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLICSGPVVIMAASFSNAAYERLPLEE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E   LP+QGG         G   QQQQQQ        +LA+ +  +FHG+PPNLLNSIQ
Sbjct  239  EE--QLPMQGGAIGSPGAIGGQQQQQQQQQ--------VLAESNAPLFHGLPPNLLNSIQ  288

Query  243  LPNDQGFWATGRPPF  199
            LP  + FWATGRPPF
Sbjct  289  LPT-EAFWATGRPPF  302



>ref|XP_006851807.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
 gb|ERN13274.1| hypothetical protein AMTR_s00041p00025000 [Amborella trichopoda]
Length=307

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 154/195 (79%), Gaps = 7/195 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCD+ ESV+ FARRRQRGVCI+SG+GTV NVTLRQPA+PGA+VTLHGRFEILSLS
Sbjct  118  MEVASGCDVGESVANFARRRQRGVCILSGSGTVTNVTLRQPAAPGAIVTLHGRFEILSLS  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASF NAAYERLPLDE
Sbjct  178  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALVASGPVIIMAASFGNAAYERLPLDE  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            DEG              GG  G      Q Q     QQ+L+DP+  +FH +PPNLLNS+Q
Sbjct  238  DEG-----ALQVAGGGGGGGMGSPGGGSQSQSQSGPQQLLSDPNAPLFHSLPPNLLNSVQ  292

Query  243  LPNDQGFWATGRPPF  199
            LP D   WATGRPP+
Sbjct  293  LPPDAYSWATGRPPY  307



>ref|XP_011014152.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=302

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 157/193 (81%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  118  MEVADGCDIVESVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVTLHGRFEILSLA  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  178  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGPLTASGPVVIMAASFSNAAYERLPLEE  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++   +P+QGGG     G      Q QQ Q    Q      +  +FHG+PPNLLNSIQLP
Sbjct  238  EDPQ-MPMQGGGMGSPEGVGQQQQQPQQHQVMAEQ------NAQLFHGLPPNLLNSIQLP  290

Query  237  NDQGFWATGRPPF  199
              + +WATGRPP+
Sbjct  291  -AEAYWATGRPPY  302



>ref|XP_006440441.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
 gb|ESR53681.1| hypothetical protein CICLE_v10021296mg [Citrus clementina]
Length=308

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 161/198 (81%), Gaps = 10/198 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCI+SGTGTV NVTLRQPASPGA+V+LHGRFEILSLS
Sbjct  116  MEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVTLRQPASPGAIVSLHGRFEILSLS  175

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ SGPV++MAASFSNAAYERLPL+E
Sbjct  176  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLMTSGPVVIMAASFSNAAYERLPLEE  235

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS----MFHGMPPNLLNS  250
            +EG  LP+    G       GG G     QQ P QQQ ++ D +    +FHG+PPNLLNS
Sbjct  236  EEGQ-LPM---QGGSIGSPGGGAGAGVVAQQQPQQQQPVMGDANNNGPLFHGLPPNLLNS  291

Query  249  IQLPNDQGFWAT-GRPPF  199
            IQLP  + +WAT GRPP+
Sbjct  292  IQLPT-EAYWATGGRPPY  308



>ref|XP_010053390.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW77667.1| hypothetical protein EUGRSUZ_D01968 [Eucalyptus grandis]
Length=303

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 156/196 (80%), Gaps = 9/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCIMSG+GTV NVTLRQPASPGA+VTLHGRFEILSL+
Sbjct  114  MEIADGCDIVESVATFARRRQRGVCIMSGSGTVTNVTLRQPASPGAIVTLHGRFEILSLA  173

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  174  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  233

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS---MFHGMPPNLLNSI  247
            D+             S G  G G   Q  QQ      Q+L DP+   +FHG+PPNLLNSI
Sbjct  234  DDAG-----IQVQGGSMGSPGSGVGGQTPQQQQQPPPQLLGDPNNAGLFHGLPPNLLNSI  288

Query  246  QLPNDQGFWATGRPPF  199
            Q+P+ + +W+  RPP+
Sbjct  289  QMPS-EAYWSGARPPY  303



>ref|XP_006477312.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO63720.1| hypothetical protein CISIN_1g021751mg [Citrus sinensis]
Length=308

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 161/198 (81%), Gaps = 10/198 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADGCDI+ESV+ FARRRQRGVCI+SGTGTV NVTLRQPASPGA+V+LHGRFEILSLS
Sbjct  116  MEIADGCDIVESVATFARRRQRGVCILSGTGTVTNVTLRQPASPGAIVSLHGRFEILSLS  175

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ SGPV++MAASFSNAAYERLPL+E
Sbjct  176  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLMTSGPVVIMAASFSNAAYERLPLEE  235

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS----MFHGMPPNLLNS  250
            +EG  LP+    G       GG G     QQ P QQQ ++ D +    +FHG+PPNLLNS
Sbjct  236  EEGQ-LPM---QGGSIGSPGGGAGAGVVGQQQPQQQQPLMGDANNNGPLFHGLPPNLLNS  291

Query  249  IQLPNDQGFWAT-GRPPF  199
            IQLP  + +WAT GRPP+
Sbjct  292  IQLPT-EAYWATGGRPPY  308



>ref|XP_006363907.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=221

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 151/195 (77%), Gaps = 16/195 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EIADGCD+MESVS F+RRRQRGVCIMSGTG V NV L+QPAS G +VTLHGRFEILSLS
Sbjct  41   IEIADGCDVMESVSNFSRRRQRGVCIMSGTGNVTNVNLKQPASSGEIVTLHGRFEILSLS  100

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M ASFSNAAYERLPL+E
Sbjct  101  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMGASFSNAAYERLPLEE  160

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGM-PPNLLN-SIQ  244
            D+ N  PL                          QQQ +  DPSMFHG  PPNLLN S+Q
Sbjct  161  DDPNNHPL-------------PMPGGPLGSPGGQQQQLLGGDPSMFHGTPPPNLLNSSMQ  207

Query  243  LPNDQGFWATGRPPF  199
            LP+ +G+W+TGRPPF
Sbjct  208  LPH-EGYWSTGRPPF  221



>ref|XP_002509637.1| ESC, putative [Ricinus communis]
 gb|EEF51024.1| ESC, putative [Ricinus communis]
Length=298

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGV IMSGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  114  MEVADGCDIVESVATFARRRQRGVSIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  173

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  174  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  233

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++   LP+QGG              QQQQQ          A+  +F G+ PNLLNSIQLP
Sbjct  234  EDAQ-LPMQGGAIGSPGAVGQQQQHQQQQQVLGE------ANAQLFQGLQPNLLNSIQLP  286

Query  237  NDQGFWATGRPPF  199
             +  +WATGRPP+
Sbjct  287  AE-AYWATGRPPY  298



>ref|XP_004242015.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=220

 Score =   161 bits (408),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 152/195 (78%), Gaps = 17/195 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EIADGCD+MESVS F+RRRQRGVCIMSGTG V NV L+QPAS G +VTLHGRFEILSLS
Sbjct  41   IEIADGCDVMESVSNFSRRRQRGVCIMSGTGNVTNVNLKQPASSGEIVTLHGRFEILSLS  100

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL+E
Sbjct  101  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALMASGPVVIMAASFSNAAYERLPLEE  160

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGM-PPNLLN-SIQ  244
            D+ N  PL                          QQQ +  DPSMFHG  PPNLLN S+Q
Sbjct  161  DDQNH-PL-------------PMPGGPLGSPGGQQQQLLGGDPSMFHGTPPPNLLNSSMQ  206

Query  243  LPNDQGFWATGRPPF  199
            LP+ +G+W+TGRPPF
Sbjct  207  LPH-EGYWSTGRPPF  220



>ref|XP_007158420.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
 gb|ESW30414.1| hypothetical protein PHAVU_002G151600g [Phaseolus vulgaris]
Length=299

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 156/195 (80%), Gaps = 12/195 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI++SVS FARRRQRGVCIMSGTGTV NVTLRQPAS GAVVTLHGRFEILSL+
Sbjct  115  MEVADGCDIVDSVSTFARRRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLA  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL E
Sbjct  175  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALVASGPVVIMSASFSNAAYERLPL-E  233

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            DE  ++PL         GG  G          P   QQ+L D +  +FHG+ PNLLNS+Q
Sbjct  234  DEDPSMPL--------QGGSIGSPGGGGGVGQPQTPQQLLGDSTAPLFHGLNPNLLNSVQ  285

Query  243  LPNDQGFWATGRPPF  199
            +P++  FWATGR P+
Sbjct  286  MPSET-FWATGRSPY  299



>ref|XP_003538721.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=298

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESVSAFARRRQRGVCIMSGTGTV NVTLRQPAS GAVVTLHGRFEILSL+
Sbjct  110  MEVADGCDIVESVSAFARRRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLA  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  ASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL E
Sbjct  170  GSFLPPPAPPEASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPL-E  228

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS---MFHGMPPNLLNSI  247
            DE  ++ L         GG  G               Q++ D +   +FHG+ PNLLNS+
Sbjct  229  DEEPSIGL-------QGGGSIGSPGGGGGVGQSQAPHQLMGDSTTAPLFHGLNPNLLNSV  281

Query  246  QLPNDQGFWATGRPPF  199
            Q+P+ + FWATGR P+
Sbjct  282  QMPSTETFWATGRSPY  297



>ref|XP_007155606.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
 gb|ESW27600.1| hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris]
Length=284

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 151/193 (78%), Gaps = 11/193 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESVS FAR+RQRGVCIMSGTGTV NVTLRQPAS GAVVTLHGRFEILSLS
Sbjct  103  MEVADGCDIVESVSEFARKRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLS  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++M+ASFSNAAYERLPL E
Sbjct  163  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLVASGPVVIMSASFSNAAYERLPL-E  221

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE  +L +QGG          G  Q               A   +FHG+PPNLLNS+Q+P
Sbjct  222  DEDPSLQMQGGSIGSPGASGVGQSQLLGGGD---------AAAPLFHGLPPNLLNSVQMP  272

Query  237  NDQGFWATGRPPF  199
            ++  FWA+ RPPF
Sbjct  273  SEP-FWASNRPPF  284



>gb|KDP25577.1| hypothetical protein JCGZ_20733 [Jatropha curcas]
Length=295

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 153/194 (79%), Gaps = 11/194 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGV IMSGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  112  MEVADGCDIVESVATFARRRQRGVSIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  171

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVG L ASGPV++MAASFSNAAYERLPL+E
Sbjct  172  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGPVVIMAASFSNAAYERLPLEE  231

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++   LP+QGGG            Q QQ            A+  +FHG+ PNLLNSIQLP
Sbjct  232  ED-PQLPMQGGGIGSPGAVGQQQQQPQQVLGE--------ANAQLFHGLQPNLLNSIQLP  282

Query  237  NDQGFWAT-GRPPF  199
             +  +WAT GRPP+
Sbjct  283  TE-AYWATGGRPPY  295



>ref|XP_003525782.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Glycine max]
 ref|XP_006579618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Glycine max]
 gb|KHN04317.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=283

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 151/193 (78%), Gaps = 11/193 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESVS FAR+RQRGVCIMSGTGTVNNVTLRQPAS G+VVTLHGRFEILSLS
Sbjct  102  MEVADGCDIVESVSEFARKRQRGVCIMSGTGTVNNVTLRQPASSGSVVTLHGRFEILSLS  161

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL E
Sbjct  162  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLVASGPVVIMAASFSNAAYERLPL-E  220

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE  +L +QGG          G  Q               A   +FHG+PPNLLNS+Q+P
Sbjct  221  DEDPSLQMQGGSIGSPGASGVGQSQLLGGD----------ATAPLFHGLPPNLLNSVQMP  270

Query  237  NDQGFWATGRPPF  199
            ++  + A+ RPPF
Sbjct  271  SEPFWAASARPPF  283



>ref|XP_002511734.1| ESC, putative [Ricinus communis]
 gb|EEF50403.1| ESC, putative [Ricinus communis]
Length=299

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 152/193 (79%), Gaps = 8/193 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+G DIMESVS FARRRQRGVCI+SGTGTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  115  MEIANGSDIMESVSTFARRRQRGVCILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLS  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  175  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEE  234

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+G  +P+         G +   G   Q Q   PQQ     +P +F G+PPNLLNS+QLP
Sbjct  235  DDGQ-VPV------PGSGPLDSPGVVGQTQPQQPQQLMQDPNPPLFQGLPPNLLNSVQLP  287

Query  237  NDQGFWATGRPPF  199
              + +W   RPPF
Sbjct  288  A-EAYWGAARPPF  299



>ref|XP_003517441.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=300

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 158/195 (81%), Gaps = 7/195 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI++SVSAFARRRQRGVCIMSGTGTV NVTLRQPAS GAVVTLHGRFEILSL+
Sbjct  111  MEVADGCDIVDSVSAFARRRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLA  170

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL++
Sbjct  171  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLED  230

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            ++    P     G  S G  GGGG            QQ++ D +  +FHG+ PNLLNS+Q
Sbjct  231  ED----PSMALQGGGSIGSPGGGGGGGGGVGQQQPSQQLMGDSTAPLFHGLNPNLLNSVQ  286

Query  243  LPNDQGFWATGRPPF  199
            +P++  FWATGR P+
Sbjct  287  MPSET-FWATGRSPY  300



>ref|XP_004306909.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=325

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 166/201 (83%), Gaps = 9/201 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIM+SVS FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  126  MEVANGCDIMDSVSTFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  185

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  186  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEE  245

Query  417  DEGNAL-PLqggggmdspggvggggqqqqqqqpppqqqQILAD-------PSMFHGMPPN  262
            ++  A+ P+ G G + SPG  GG  QQQ Q Q   QQQQ+L D       PS+FHGM  N
Sbjct  246  EDATAVTPMPGSGPLGSPGIGGGEQQQQSQVQQVQQQQQMLQDANNSSPPPSLFHGMQQN  305

Query  261  LLNSIQLPNDQGFWATGRPPF  199
            LLNS+QLP+ + +W T RPP+
Sbjct  306  LLNSVQLPS-EAYWGTARPPY  325



>ref|XP_010276261.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=295

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 157/195 (81%), Gaps = 11/195 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCD+ ESV+ FARRRQRGVCI+SG+GTV NVTLRQPA+PGA+VTLHGRFEILSLS
Sbjct  110  MEIANGCDVGESVATFARRRQRGVCILSGSGTVTNVTLRQPATPGAIVTLHGRFEILSLS  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASF NAAYERLPL E
Sbjct  170  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALVASGPVVIMAASFGNAAYERLPL-E  228

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLLNSIQ  244
            DE   LP+         GG  G      QQQ   QQQQ+L DP+M  FHG+PPNLL   Q
Sbjct  229  DEEPPLPM-------QSGGPLGSPGMVDQQQQQQQQQQLLPDPNMPLFHGLPPNLLTPCQ  281

Query  243  LPNDQGFWATGRPPF  199
            LP  + +WATGRPPF
Sbjct  282  LPA-EAYWATGRPPF  295



>ref|XP_011034536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 155/196 (79%), Gaps = 9/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDIMESVS FARRRQRGVCI+SGTGTV NVTL+QPASPGAVVTLHGRFEILSLS
Sbjct  111  MEIASGCDIMESVSTFARRRQRGVCILSGTGTVTNVTLKQPASPGAVVTLHGRFEILSLS  170

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLT+YLAGGQGQV+GGSV G LLASGPV+VMAASF NAAYERLPL+E
Sbjct  171  GSFLPPPAPPAASGLTVYLAGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEE  230

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            D  +  P+     + S      G     QQQ   QQQQ++ DP  S+F G+P NLLNS+Q
Sbjct  231  DIESQTPM-----LGSGPLGSPGINNIGQQQQNQQQQQLMQDPKTSLFQGLPQNLLNSVQ  285

Query  243  LPNDQGFWAT-GRPPF  199
            LP  + +W T GRPP+
Sbjct  286  LP-AEAYWGTGGRPPY  300



>ref|XP_003516470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=288

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 156/197 (79%), Gaps = 11/197 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCDIMES++AFARRRQRGVC++SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  99   MEIANGCDIMESITAFARRRQRGVCVLSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  158

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGL IYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  159  GSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEE  218

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            +E             + G    G    QQQ    QQQQ++ DP   S+FHGMP NLLNS+
Sbjct  219  EE------TPVAVAGNGGLGSPGIPGTQQQPQQQQQQQLVGDPNSSSLFHGMPQNLLNSV  272

Query  246  QLPNDQGFW-ATGRPPF  199
            QLP  +G+W  + RPPF
Sbjct  273  QLP-AEGYWGGSARPPF  288



>ref|XP_003549894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=287

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 151/193 (78%), Gaps = 10/193 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADG DI+ESVS FAR+RQRG+CIMSGTGTV NVTLRQPAS G+VVTLHGRFEILSLS
Sbjct  105  MEVADGYDIVESVSEFARKRQRGICIMSGTGTVTNVTLRQPASSGSVVTLHGRFEILSLS  164

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL++
Sbjct  165  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGTLVASGPVVIMAASFSNAAYERLPLED  224

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++ N+L +QGG          G  Q               A   +FHG+PPNLLNS+Q+P
Sbjct  225  EDPNSLQMQGGSIGSPGASGVGQSQLLGGD----------ATAPLFHGLPPNLLNSVQMP  274

Query  237  NDQGFWATGRPPF  199
            ++  + A+ RPPF
Sbjct  275  SEPFWAASTRPPF  287



>ref|XP_004511639.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
Length=241

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 160/201 (80%), Gaps = 18/201 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  51   MEVADGCDIVESVNNFARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  110

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL++
Sbjct  111  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLED  170

Query  417  DEG-NALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPP-----N  262
            D+G N++ L          G GGGG        P QQ Q+L D +  +F  MPP     N
Sbjct  171  DDGSNSMQL---------QGGGGGGSPSGGGGVPQQQTQLLGDATAPLFQAMPPPNPNHN  221

Query  261  LLNSIQLPNDQGFWATGRPPF  199
            +L+S+Q+P++  FW TGR P+
Sbjct  222  ILSSVQMPSET-FWPTGRSPY  241



>ref|XP_007052032.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
 gb|EOX96189.1| AT-hook motif nuclear-localized protein 22 [Theobroma cacao]
Length=326

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 159/195 (82%), Gaps = 6/195 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCDIMES+S FARRRQRGVCI+SG+GTV NVTLRQP +PGAVVTLHGRFEILSLS
Sbjct  136  MEIANGCDIMESISTFARRRQRGVCILSGSGTVTNVTLRQPGAPGAVVTLHGRFEILSLS  195

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  196  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEE  255

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            +E    P+    G    G       QQQQQQ PPQQQQ+L DP  S   G+PPNLLNS+Q
Sbjct  256  EE---QPVAPIPGSGPLGSPSSMVGQQQQQQQPPQQQQLLQDPNGSFVQGLPPNLLNSVQ  312

Query  243  LPNDQGFWATGRPPF  199
            LP  + +W TGRPP+
Sbjct  313  LP-AEAYWGTGRPPY  326



>ref|XP_008791267.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=322

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 4/191 (2%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ESVS FARRRQRGVCI+ G+GTV NVTLRQPASPG+VV LHGRFEILSLS
Sbjct  128  MEIAGGCDIAESVSTFARRRQRGVCILGGSGTVTNVTLRQPASPGSVVALHGRFEILSLS  187

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSV+GAL+ASGPV++MAASF NA YERLPLDE
Sbjct  188  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVLGALIASGPVVIMAASFGNAVYERLPLDE  247

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E   LP+ G  G     G     QQQQQQQ  PQQQQ+L DP+  +FHG+PPNLLN++Q
Sbjct  248  EE--PLPVPGSLGSPGLVGQSPQQQQQQQQQQQPQQQQLLPDPNTHLFHGLPPNLLNNVQ  305

Query  243  LPNDQGFWATG  211
            LP D   WA G
Sbjct  306  LPTDAYGWAAG  316



>ref|XP_004172826.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA-like [Cucumis sativus]
 gb|KGN50183.1| hypothetical protein Csa_5G157420 [Cucumis sativus]
Length=303

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 153/203 (75%), Gaps = 10/203 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ DGCDI++SV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+V LHGRFEILSL+
Sbjct  101  IEVTDGCDIVDSVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVNLHGRFEILSLA  160

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+ LTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  161  GSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  220

Query  417  DEGNALPLqg---------gggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPP  265
            D+   LP              G           QQQQQ Q   QQ     +  +FHG+PP
Sbjct  221  DDQPQLPSLQGGGGIGSPDEVGQSQITAQTAHHQQQQQNQQQQQQLLNDGNAPLFHGLPP  280

Query  264  NLLNSIQL-PNDQGFWATGRPPF  199
            NLLNSIQ+ P++  +WAT RPP+
Sbjct  281  NLLNSIQMPPSESPYWATARPPY  303



>ref|XP_004147565.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=303

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 153/203 (75%), Gaps = 10/203 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ DGCDI++SV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA+V LHGRFEILSL+
Sbjct  101  IEVTDGCDIVDSVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIVNLHGRFEILSLA  160

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+ LTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  161  GSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  220

Query  417  DEGNALPLqg---------gggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPP  265
            D+   LP              G           QQQQQ +   QQ     +  +FHG+PP
Sbjct  221  DDQPQLPSLQGGGGIGSPDEVGQSQITAQTAHHQQQQQNKQQQQQLLNDGNAPLFHGLPP  280

Query  264  NLLNSIQL-PNDQGFWATGRPPF  199
            NLLNSIQ+ P++  +WAT RPP+
Sbjct  281  NLLNSIQMPPSESPYWATARPPY  303



>ref|XP_002320066.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE98381.1| DNA-binding family protein [Populus trichocarpa]
Length=300

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 154/196 (79%), Gaps = 9/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA G DIMESVS FARRRQRGVCI+SGTGTV NVTL+QPASPGAVVTLHGRFEILSLS
Sbjct  111  MEIATGSDIMESVSTFARRRQRGVCILSGTGTVTNVTLKQPASPGAVVTLHGRFEILSLS  170

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLT+YLAGGQGQV+GGSV G LLASGPV+VMAASF NAAYERLPL+E
Sbjct  171  GSFLPPPAPPAASGLTVYLAGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEE  230

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            D  +  P+     + S      G     QQQ   QQQQ++ DP  S+F G+P NLLNS+Q
Sbjct  231  DIESQTPM-----LGSGPLGSPGINNIGQQQQNQQQQQLMQDPKTSLFQGLPQNLLNSVQ  285

Query  243  LPNDQGFWAT-GRPPF  199
            LP  + +W T GRPP+
Sbjct  286  LP-AEAYWGTGGRPPY  300



>ref|XP_008437165.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=303

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 153/203 (75%), Gaps = 10/203 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ DGCDI++SV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGA++ LHGRFEILSL+
Sbjct  101  IEVTDGCDIVDSVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAIINLHGRFEILSLA  160

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+ LTIYLAGGQGQVVGGSVVG L+ASGPV++MAASFSNAAYERLPL+E
Sbjct  161  GSFLPPPAPPAATTLTIYLAGGQGQVVGGSVVGTLIASGPVVIMAASFSNAAYERLPLEE  220

Query  417  DEGNALPLqg---------gggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPP  265
            D+   LP              G           QQQQQ Q   QQ     +  +FHG+PP
Sbjct  221  DDQPPLPSLQGGGGIGSPDEVGQSQITAQTAHHQQQQQNQQQQQQLLNDGNAPLFHGLPP  280

Query  264  NLLNSIQL-PNDQGFWATGRPPF  199
            NLLNSIQ+ P++  +WAT RPP+
Sbjct  281  NLLNSIQMPPSESPYWATARPPY  303



>ref|XP_002301300.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE80573.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 150/196 (77%), Gaps = 12/196 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDIMESVS FARRRQRGVCI+S TGTV NVTL+QPASPGAVVTLHGRFEILSLS
Sbjct  112  MEIATGCDIMESVSTFARRRQRGVCILSATGTVTNVTLKQPASPGAVVTLHGRFEILSLS  171

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  172  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEE  231

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            DE                G  G        Q   QQ Q++ DP  S+F G+P NLLNS+Q
Sbjct  232  DESQT--------PVPGTGPLGSPGVSSIGQQNQQQHQLMQDPNTSLFQGLPQNLLNSVQ  283

Query  243  LPNDQGFWAT-GRPPF  199
            LP+ + +W T GRPP+
Sbjct  284  LPS-EAYWGTGGRPPY  298



>ref|XP_004511638.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
Length=312

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 160/201 (80%), Gaps = 18/201 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCDI+ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  122  MEVADGCDIVESVNNFARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  181

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL++
Sbjct  182  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLED  241

Query  417  DEG-NALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPP-----N  262
            D+G N++ L          G GGGG        P QQ Q+L D +  +F  MPP     N
Sbjct  242  DDGSNSMQL---------QGGGGGGSPSGGGGVPQQQTQLLGDATAPLFQAMPPPNPNHN  292

Query  261  LLNSIQLPNDQGFWATGRPPF  199
            +L+S+Q+P++  FW TGR P+
Sbjct  293  ILSSVQMPSET-FWPTGRSPY  312



>ref|XP_007134900.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
 gb|ESW06894.1| hypothetical protein PHAVU_010G085300g [Phaseolus vulgaris]
Length=310

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 159/197 (81%), Gaps = 9/197 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCDIMESV+AFARRRQRGVC++SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  119  MEIANGCDIMESVTAFARRRQRGVCVLSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGL IYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL E
Sbjct  179  GSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPL-E  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            DE   +P+    G    G  G  G QQQ Q  P Q QQ++ DP   S+FHG+P NLLNS+
Sbjct  238  DEETPVPV---PGTGGLGSPGIAGTQQQSQSQPQQPQQLVGDPNTSSLFHGVPQNLLNSV  294

Query  246  QLPNDQGFW-ATGRPPF  199
            QLP  +G+W  T RP F
Sbjct  295  QLP-AEGYWGGTARPSF  310



>ref|XP_011017502.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 150/196 (77%), Gaps = 12/196 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDIMESVS FA RRQRGVCI+SGTGTV NVTL+QPASPGAVVTLHGRFEILSLS
Sbjct  112  MEIASGCDIMESVSTFAGRRQRGVCILSGTGTVTNVTLKQPASPGAVVTLHGRFEILSLS  171

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  172  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLEE  231

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            DE                G  G        Q   QQ Q++ DP  S+F G+P NLLNS+Q
Sbjct  232  DE--------SQTPVPGTGPLGSPGVNSIGQQNQQQHQLMQDPNTSLFQGLPQNLLNSVQ  283

Query  243  LPNDQGFWAT-GRPPF  199
            LP+ + +W T GRPP+
Sbjct  284  LPS-EAYWGTGGRPPY  298



>ref|XP_006445233.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
 ref|XP_006490941.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR58473.1| hypothetical protein CICLE_v10024070mg [Citrus clementina]
Length=313

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 159/196 (81%), Gaps = 5/196 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCDIM+SVS FARRRQRG+CI+SGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  120  MEIANGCDIMDSVSNFARRRQRGICILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  180  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEE  239

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            +E   +    G        V  G  QQQQQQ    QQQ+L DP  S  HG+PPNLL+S+Q
Sbjct  240  EE-TPVASIPGSRPLGSPEVNVGQPQQQQQQSQSHQQQLLQDPNASFIHGLPPNLLSSVQ  298

Query  243  LPNDQGFWATGRP-PF  199
            LP +  +WATGRP PF
Sbjct  299  LPAEP-YWATGRPAPF  313



>ref|XP_003521618.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=310

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 158/197 (80%), Gaps = 8/197 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI +GCDIMESV+AFARRRQRG+C++SG+GTV NVTLRQPASP AVVTLHGRFEILSLS
Sbjct  118  MEITNGCDIMESVTAFARRRQRGICLLSGSGTVTNVTLRQPASPSAVVTLHGRFEILSLS  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGL IYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  178  GSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEE  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            +E    P+   G          G QQQ Q QP  QQQQ++ DP   S+FHG+P NLLNSI
Sbjct  238  EE---TPVPYHGTEGLGSPGIPGTQQQSQSQPQQQQQQLVGDPNSSSLFHGVPQNLLNSI  294

Query  246  QLPNDQGFW-ATGRPPF  199
            QLP  +G+W  + RPPF
Sbjct  295  QLP-AEGYWGGSARPPF  310



>ref|XP_006851806.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
 gb|ERN13273.1| hypothetical protein AMTR_s00041p00022450 [Amborella trichopoda]
Length=303

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 153/195 (78%), Gaps = 10/195 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI+ESV+ +ARRRQRGVCI+SG+GTV NVTLRQPA+PGA+VTLHGRFEILSLS
Sbjct  117  MEVASGCDIVESVANYARRRQRGVCILSGSGTVTNVTLRQPAAPGAIVTLHGRFEILSLS  176

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPP P AA+GLTIYLAGGQGQVVGG+VVGALLASGPV++MAASF NAA+ERLPLDE
Sbjct  177  GSFLPPPGPPAATGLTIYLAGGQGQVVGGTVVGALLASGPVIIMAASFGNAAFERLPLDE  236

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            DE               GG  GG Q   + Q  PQQQQ+L DP  ++FHG+ PN  NS Q
Sbjct  237  DEA--------VLQFPGGGGMGGSQSSPEAQSQPQQQQMLGDPNGALFHGLLPNFTNSSQ  288

Query  243  LPNDQGFWATGRPPF  199
            LP +   WA GRPP+
Sbjct  289  LPPEAYGWAGGRPPY  303



>ref|XP_008804006.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=314

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 150/197 (76%), Gaps = 13/197 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI E+V+ FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHG FEILSLS
Sbjct  127  MEIAAGCDIAETVATFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGCFEILSLS  186

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPLDE
Sbjct  187  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALIASGPVVIMAASFSNAAYERLPLDE  246

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E   +P               G           QQ Q L DP+  + HG+PPNLLN+IQ
Sbjct  247  EEPVPVP---------GPLDSPGLVGDSPPPLQQQQPQQLLDPNTPLLHGLPPNLLNNIQ  297

Query  243  LPNDQGFWAT--GRPPF  199
            LP +   WAT  GRPP+
Sbjct  298  LPAEAYSWATGGGRPPY  314



>ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
 emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera]
 emb|CBI38865.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 156/195 (80%), Gaps = 10/195 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDIM+S++ FARRRQRG+CI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  114  MEIATGCDIMDSLNTFARRRQRGICILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  173

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL E
Sbjct  174  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPL-E  232

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            DE   +P+         G +G  G   QQ Q   QQQQ+L DP  S+F G+PPNLLNS Q
Sbjct  233  DEEPQVPI------PGSGPLGSPGMVGQQPQQQQQQQQLLPDPNASLFQGLPPNLLNSCQ  286

Query  243  LPNDQGFWATGRPPF  199
            LP  + +W T RPP+
Sbjct  287  LPA-EAYWGTARPPY  300



>gb|KEH19036.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=308

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 157/197 (80%), Gaps = 10/197 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIMESV+ FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  118  MEVANGCDIMESVTVFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGL IYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL++
Sbjct  178  GSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLED  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            +E            +   G  G    QQQQQ   QQQQ++ADP   S+FHG+P NLLNS 
Sbjct  238  EE-----TPVNVPGNGGLGSPGTMGSQQQQQQNQQQQQLVADPNASSLFHGVPQNLLNSC  292

Query  246  QLPNDQGFW-ATGRPPF  199
            QLP  +G+W  + RPPF
Sbjct  293  QLP-AEGYWGGSARPPF  308



>ref|XP_010277406.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=282

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 155/195 (79%), Gaps = 13/195 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCD+ ESV+ FARRRQRGVCI+SG+GTV NVTLRQPA+PGA+VTLHGRFEILSLS
Sbjct  99   MEIANGCDVGESVATFARRRQRGVCILSGSGTVTNVTLRQPAAPGAIVTLHGRFEILSLS  158

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYL+GGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL E
Sbjct  159  GSFLPPPAPPAATGLTIYLSGGQGQVVGGSVVGALVASGPVVIMAASFSNAAYERLPL-E  217

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            DE  +LP+              G   QQQ QP  QQQQ+L DP+  +FHG+PPNLL    
Sbjct  218  DEDPSLPI-----QSGGPLGSPGMVGQQQNQPQQQQQQLLPDPNNPLFHGLPPNLLAPA-  271

Query  243  LPNDQGFWATGRPPF  199
                + FWAT RPPF
Sbjct  272  ----EAFWATARPPF  282



>ref|XP_004510939.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=305

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 154/197 (78%), Gaps = 12/197 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIMESV+ FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  117  MEVANGCDIMESVTVFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  176

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGL IYLAGGQGQVVGGSVVG LLASGPV++MAASF NAAYERLPL++
Sbjct  177  GSFLPPPAPPAASGLAIYLAGGQGQVVGGSVVGPLLASGPVVIMAASFGNAAYERLPLED  236

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            +E           +   GG+G  G    QQQ   QQQ +  DP   S+FHG+P NLLNS 
Sbjct  237  EE-------TPVNVQGSGGLGSPGIVGTQQQQQQQQQLVQQDPNTSSLFHGVPQNLLNSC  289

Query  246  QLPNDQGFWATG-RPPF  199
            QLP  +G+W    RPPF
Sbjct  290  QLP-AEGYWGGSVRPPF  305



>ref|XP_009420779.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=305

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 148/191 (77%), Gaps = 14/191 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI++ V+ FARRRQRGVC++SG+GTV NVTLRQPASPGAVV LHGRFEILSLS
Sbjct  120  MEIAGGCDIVDGVATFARRRQRGVCVLSGSGTVANVTLRQPASPGAVVNLHGRFEILSLS  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQ+VGGSVVG L+ASGPV++MAASF NAAYERLPLD+
Sbjct  180  GSFLPPPAPPAATGLTIYLAGGQGQIVGGSVVGPLIASGPVIIMAASFGNAAYERLPLDD  239

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E    PLQ   G     G+ G     QQQQ          DPS  + HG+PPNLLN++Q
Sbjct  240  EE----PLQAQQGGLGSPGLVGQSPPLQQQQLH--------DPSNPLLHGLPPNLLNNVQ  287

Query  243  LPNDQGFWATG  211
            LP +   WATG
Sbjct  288  LPGEPHGWATG  298



>ref|XP_009799054.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009799060.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
Length=304

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 146/203 (72%), Gaps = 28/203 (14%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ES+S FA RRQRGVCI+SG+GTV NVT+RQPASPGAVVTLHGRFEILSLS
Sbjct  120  MEIASGCDIQESISTFATRRQRGVCILSGSGTVTNVTIRQPASPGAVVTLHGRFEILSLS  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS+LPPPAP AASGLTIYLAGGQGQVVGGSVVG L ASGPV++MAASF NAAYERLPL++
Sbjct  180  GSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLED  239

Query  417  DE-------GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPP  265
            +E         ALP+           +GG                  +DP  ++  G+PP
Sbjct  240  EESPVGQQGSGALPIVNNQQQHQQQIMGGN-----------------SDPNANLLQGLPP  282

Query  264  NLLNSIQLPNDQGFWAT-GRPPF  199
            NLLNS QLP D  +W T GRPP+
Sbjct  283  NLLNSCQLPAD-AYWGTAGRPPY  304



>ref|XP_010940981.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=317

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 153/196 (78%), Gaps = 10/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ESV+ FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHG FEILSLS
Sbjct  129  MEIAGGCDIAESVATFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGCFEILSLS  188

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLT+YLAGGQGQVVGGSVVGAL+ASGPV++MAASFSNAAYERLPL E
Sbjct  189  GSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGALIASGPVVIMAASFSNAAYERLPLGE  248

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNL-LNSIQL  241
            +E   LP+ G        G     QQQQQ Q  P   Q L     FHG+PPNL LN++QL
Sbjct  249  EE--PLPVSGALESPGVVGQSPPQQQQQQPQQLPDPNQPL-----FHGLPPNLVLNNVQL  301

Query  240  PNDQGFWAT--GRPPF  199
            P +   WAT  GRPP+
Sbjct  302  PAEAYGWATGGGRPPY  317



>ref|XP_009604907.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=304

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 146/203 (72%), Gaps = 28/203 (14%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ES+S FA RRQRGVCI+SG+GTV NVT+RQPASPGAVVTLHGRFEILSLS
Sbjct  120  MEIASGCDIQESISTFATRRQRGVCILSGSGTVTNVTIRQPASPGAVVTLHGRFEILSLS  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS+LPPPAP AASGLTIYLAGGQGQVVGGSVVG L ASGPV++MAASF NAAYERLPL++
Sbjct  180  GSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLED  239

Query  417  DE-------GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPP  265
            +E         ALP+           +GG                  +DP  ++  G+PP
Sbjct  240  EESPVGQQGSGALPIVSNQQQHQQQIMGGN-----------------SDPNANLLQGLPP  282

Query  264  NLLNSIQLPNDQGFWAT-GRPPF  199
            NLLNS QLP  + +W T GRPP+
Sbjct  283  NLLNSCQLP-AEAYWGTAGRPPY  304



>ref|XP_009382863.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382873.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 147/191 (77%), Gaps = 15/191 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI+ES++ FA RR RGVCI+SG+GTV NVTLRQPASP AVVTLHGRFEILSLS
Sbjct  125  MEIAGGCDIVESIATFACRRHRGVCILSGSGTVVNVTLRQPASPSAVVTLHGRFEILSLS  184

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQ+VGGSVVGAL+AS PV++MAASF NAAYERLPLDE
Sbjct  185  GSFLPPPAPPAATGLTIYLAGGQGQIVGGSVVGALIASSPVIIMAASFGNAAYERLPLDE  244

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E    PLQ   G     G+ G     QQQ         L DP+  + HG+PPNLLN++Q
Sbjct  245  EE----PLQAQQGGLGSPGLVGQSPPPQQQ---------LLDPNNPLLHGLPPNLLNNVQ  291

Query  243  LPNDQGFWATG  211
            LP +   WATG
Sbjct  292  LPAEAYGWATG  302



>ref|XP_010917984.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=291

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 16/189 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI+ES++ FA RRQRG+CI+SGTG+V NVTLRQPAS GAVVTLHGRFEILSLS
Sbjct  115  MEIAGGCDIVESMATFACRRQRGLCILSGTGSVTNVTLRQPASQGAVVTLHGRFEILSLS  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLT+YLAGGQGQVVGGSVVG L+ASGPV++MAASF+NAAY+RLPL+E
Sbjct  175  GSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGPLMASGPVVIMAASFANAAYDRLPLEE  234

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +E  +LP                G  +       QQQQ L DPS+FHG+ PNLL ++QLP
Sbjct  235  EE--SLP--------------AQGPLESHGLVGQQQQQFLQDPSLFHGLAPNLLGNVQLP  278

Query  237  NDQGFWATG  211
            ++   W TG
Sbjct  279  SEPNNWTTG  287



>ref|XP_010676637.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=315

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 152/205 (74%), Gaps = 17/205 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-------PGAVVTLHGR  619
            ME++DGCDIM+SV+ FAR RQRGVCI+SGTGTV NVT+RQP S       P AVVTLHGR
Sbjct  116  MEVSDGCDIMDSVATFARLRQRGVCILSGTGTVANVTIRQPGSTSTGNGGPPAVVTLHGR  175

Query  618  FEIlslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAY  439
            FEILSL+GSFLPPPAP AA+GL+IYLAGGQGQVVGGSVVG LLASGPV++MAASFSNAAY
Sbjct  176  FEILSLAGSFLPPPAPPAATGLSIYLAGGQGQVVGGSVVGQLLASGPVVIMAASFSNAAY  235

Query  438  ERLPLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP-----SMFHG  274
            ERLPL+ED+       G        G G     + Q    P QQ +  DP     +MF G
Sbjct  236  ERLPLEEDQ----EGGGATMGGGMQGGGSLSGMEHQGMQQPPQQLLGNDPNGGGSAMFQG  291

Query  273  MPPNLLNSIQLPNDQGFWATGRPPF  199
            MPPNLLNS+Q+P+ +G+W TGRP F
Sbjct  292  MPPNLLNSVQMPS-EGYWGTGRPSF  315



>ref|XP_010540129.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
 ref|XP_010540136.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=333

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 151/196 (77%), Gaps = 8/196 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            MEI DGCDI++S++ FARRRQRGVC+MSGTG V NVT+RQP S PG+VV+LHGRFEILSL
Sbjct  143  MEIGDGCDIVDSMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPPGSVVSLHGRFEILSL  202

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG L+ +GPV+VMAASFSNAAYERLPL+
Sbjct  203  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLVCAGPVVVMAASFSNAAYERLPLE  262

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            E+E   +     GG     G G  G      Q    QQ  LA  +M  G+PPNLL S+QL
Sbjct  263  EEE---MQTPVHGGGGGGSGGGVMGSPPMMGQQSSNQQAGLA--AMAGGLPPNLLGSVQL  317

Query  240  --PNDQGFWATGRPPF  199
              P+DQ +WATGRPPF
Sbjct  318  PPPHDQPYWATGRPPF  333



>ref|XP_010433987.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=324

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 148/198 (75%), Gaps = 14/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  136  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  195

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  196  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  255

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L+EDE    P+ GGGG            QQ Q Q            S  HG+PPNLL S+
Sbjct  256  LEEDEMQT-PVHGGGGGGGSMESPPMMGQQLQHQQQAM--------SGHHGLPPNLLGSV  306

Query  246  QL--PNDQGFWATGRPPF  199
            QL   +DQ +W+TGRPP+
Sbjct  307  QLQQQHDQSYWSTGRPPY  324



>ref|XP_011090893.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 151/198 (76%), Gaps = 18/198 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDI ES+S FA RRQRGVCI+SG GTV NVTLRQPA+PGAVVTLHGRFEILSLS
Sbjct  123  MEVANGCDIQESISTFATRRQRGVCILSGNGTVTNVTLRQPAAPGAVVTLHGRFEILSLS  182

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AAS LTIYLAGGQGQV+GG+VVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  183  GSFLPPPAPPAASALTIYLAGGQGQVMGGTVVGPLLASGPVVIMAASFGNAAYERLPLEE  242

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHG-MPP-NLLNS  250
            +E             + GGV  GGQ         Q QQ++ DP  +MF G MPP N+LNS
Sbjct  243  EE------------TAVGGVSSGGQMGSPGMVGQQGQQLMNDPNTNMFQGTMPPQNMLNS  290

Query  249  I-QLPNDQGFWATGRPPF  199
              QLP +  +W TGRPPF
Sbjct  291  CGQLPAE-AYWGTGRPPF  307



>dbj|BAK03205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 145/199 (73%), Gaps = 16/199 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ES++AFARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  121  MEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  180

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGG+GQVVGG+VVG+L A+GPV++MAASF+NA YERLPL+E
Sbjct  181  GSFLPPPAPPEATGLTVYLAGGKGQVVGGTVVGSLTAAGPVVIMAASFANAVYERLPLEE  240

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE           + + G     G      Q   Q      DPS+F G+PPNLL ++QLP
Sbjct  241  DE----------LLAAQGQADSNGMLLAAGQQASQMAGGDVDPSLFEGLPPNLLGNVQLP  290

Query  237  NDQGF-W----ATGRP-PF  199
             + G+ W    A GRP PF
Sbjct  291  PEAGYRWNPGTAGGRPSPF  309



>ref|XP_006339443.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=308

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 142/204 (70%), Gaps = 28/204 (14%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ES+S FA RRQRGVCI+SG+GTV NVT+RQP SPGAVVTLHGRFEILSLS
Sbjct  122  MEIASGCDIQESISNFATRRQRGVCILSGSGTVTNVTIRQPTSPGAVVTLHGRFEILSLS  181

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS+LPPPAP AASGLTIYLAGGQGQVVGGSVVG L ASGPV++MAASF NAAYERLPL++
Sbjct  182  GSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLED  241

Query  417  DE--------GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMP  268
            +E        G  LP                            QQ +  DP  ++  G+P
Sbjct  242  EESPVGQQGNGGNLP-----------------TSSGIVSTNQAQQIMGTDPNANLLQGLP  284

Query  267  PNLLNSIQLPNDQGFW-ATGRPPF  199
             NLLNS QLP  + +W A GRPP+
Sbjct  285  QNLLNSCQLPPAEAYWGAGGRPPY  308



>gb|EYU30571.1| hypothetical protein MIMGU_mgv1a010755mg [Erythranthe guttata]
Length=302

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 145/195 (74%), Gaps = 17/195 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCD+ +S+S FA RRQRGVCI+SGTGTV NVTLRQPA+PG+V+TLHGRFEILSLS
Sbjct  123  MEVANGCDVQDSISTFATRRQRGVCILSGTGTVTNVTLRQPAAPGSVLTLHGRFEILSLS  182

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAG QGQVVGG+VVG LLASGPV++MAASF NAAYERLPL++
Sbjct  183  GSFLPPPAPPAASGLTIYLAGAQGQVVGGAVVGPLLASGPVVIMAASFGNAAYERLPLED  242

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLLNSIQ  244
            +E  A+               GGGQ           QQ++ DP+   F G   N+LNS+Q
Sbjct  243  EEAAAV--------------SGGGQLGSPGISGGGGQQLMPDPNTNPFQGAAQNMLNSVQ  288

Query  243  LPNDQGFWATGRPPF  199
            LP D  +W   RPPF
Sbjct  289  LPAD-AYWGAARPPF  302



>ref|XP_010092850.1| hypothetical protein L484_022445 [Morus notabilis]
 gb|EXB52668.1| hypothetical protein L484_022445 [Morus notabilis]
Length=326

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 161/200 (81%), Gaps = 8/200 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+ CD+M+S+SAFARRRQRG+C++SGTGTV NVTLRQPASPGAVV+LHGRFEILSLS
Sbjct  128  MEIANACDVMDSMSAFARRRQRGICVLSGTGTVTNVTLRQPASPGAVVSLHGRFEILSLS  187

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  188  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEE  247

Query  417  -DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPP--NLL  256
             D+ N        G     G    GQQQQQQQPP QQ+Q+L DP   +++HG+P   NLL
Sbjct  248  EDQANNQVSMQVSGGLGSPGSLNVGQQQQQQQPPQQQEQMLQDPNTSTLYHGVPAAQNLL  307

Query  255  NSIQLPNDQGFWAT-GRPPF  199
            NS  LP+D  +W T  RPP+
Sbjct  308  NSCNLPSD-AYWGTAARPPY  326



>ref|XP_011093194.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=297

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 141/195 (72%), Gaps = 16/195 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDI ESVS FA RRQRGVCI+SG+GTV NVTLRQPA+PGAV+TLHGRFEILSLS
Sbjct  117  MEVANGCDIQESVSNFATRRQRGVCILSGSGTVTNVTLRQPAAPGAVLTLHGRFEILSLS  176

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AAS LTIYLAG QGQVVGG+VVG LLASGPV++MAASF NAAYERLPL++
Sbjct  177  GSFLPPPAPPAASSLTIYLAGAQGQVVGGTVVGPLLASGPVMIMAASFGNAAYERLPLED  236

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
                                       Q + P    QQ++ DP  +MF GMP N+LNS+ 
Sbjct  237  -----------EEQQQQQPPAAVPGSGQLESPGISGQQLMNDPNTNMFQGMPQNMLNSLP  285

Query  243  LPNDQGFWATGRPPF  199
                + +W TGRPPF
Sbjct  286  A---EAYWGTGRPPF  297



>ref|NP_194012.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAA16566.1| putative DNA binding protein [Arabidopsis thaliana]
 emb|CAB79236.1| putative DNA binding protein [Arabidopsis thaliana]
 dbj|BAF01184.1| putative DNA binding protein [Arabidopsis thaliana]
 tpd|FAA00295.1| TPA: AT-hook motif nuclear localized protein 24 [Arabidopsis 
thaliana]
 dbj|BAH30531.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84660.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=324

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 150/198 (76%), Gaps = 15/198 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  137  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  196

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  197  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  256

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L+EDE    P+ GGGG  S       GQQ Q QQ            S   G+PPNLL S+
Sbjct  257  LEEDEMQT-PVHGGGGGGSLESPPMMGQQLQHQQQAM---------SGHQGLPPNLLGSV  306

Query  246  QL--PNDQGFWATGRPPF  199
            QL   +DQ +W+TGRPP+
Sbjct  307  QLQQQHDQSYWSTGRPPY  324



>ref|XP_002869805.1| hypothetical protein ARALYDRAFT_492588 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46064.1| hypothetical protein ARALYDRAFT_492588 [Arabidopsis lyrata subsp. 
lyrata]
Length=319

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 146/198 (74%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  130  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  189

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  190  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  249

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L+EDE    P+ GGGG             QQ Q             S   G+PPNLL S+
Sbjct  250  LEEDEMQT-PVHGGGGGGGGSMESPPMMGQQLQHQQQAM-------SGHQGLPPNLLGSV  301

Query  246  QL--PNDQGFWATGRPPF  199
            QL   +DQ +W+TGRPP+
Sbjct  302  QLQQQHDQSYWSTGRPPY  319



>ref|XP_006289235.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
 gb|EOA22133.1| hypothetical protein CARUB_v10002691mg [Capsella rubella]
Length=340

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 154/198 (78%), Gaps = 8/198 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG VNNVT+RQP SP G+VV+LHGRFEILSL
Sbjct  146  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVNNVTIRQPGSPAGSVVSLHGRFEILSL  205

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  206  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  265

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE   +     GG    GG GGGG       P   QQQ +A  +   G+PPNLL S+QL
Sbjct  266  EDE---MQTPVQGGGGGGGGGGGGGSGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQL  322

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W+TGRPP+
Sbjct  323  PPQQQNDQQYWSTGRPPY  340



>ref|XP_004229823.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=302

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 142/197 (72%), Gaps = 14/197 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ES+S FA RRQRGVCI+S +GTV NVT+RQPASPGAVVTLHGRFEILSLS
Sbjct  116  MEIATGCDIQESISNFATRRQRGVCILSASGTVTNVTIRQPASPGAVVTLHGRFEILSLS  175

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS+LPPPAP AASGLTIYLAGGQGQVVGGSVVG L ASGPV++MAASF NAAYERLPL++
Sbjct  176  GSYLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLNASGPVVIMAASFGNAAYERLPLED  235

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            +E                G GG       Q     QQ +  DP   ++  G+P NLLNS 
Sbjct  236  EE----------SPVGQQGSGGNLGTSTNQGAAAAQQIMGTDPNANNLLQGLPQNLLNSC  285

Query  246  QLPNDQGFWATG-RPPF  199
            QLP  + +W  G RPP+
Sbjct  286  QLPPAEAYWGPGARPPY  302



>ref|XP_010934543.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=319

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 146/192 (76%), Gaps = 12/192 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI +SV+ FAR RQRGVCI+ G+GTV NVTLRQPA+PG+VV LHGRFEILSLS
Sbjct  131  MEIASGCDIADSVATFARHRQRGVCILGGSGTVTNVTLRQPATPGSVVALHGRFEILSLS  190

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQVVGGSVVGAL+ASGPV++MAASF NA YERLPLDE
Sbjct  191  GSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALIASGPVVIMAASFGNAVYERLPLDE  250

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNL-LNSI  247
            +E   +P               G   Q   Q   QQQQ+L DP+  +FHG+PPNL LN++
Sbjct  251  EEPLPVP---------GPLGSPGLVGQSPPQQQQQQQQLLPDPNAPLFHGLPPNLVLNNV  301

Query  246  QLPNDQGFWATG  211
            QLP D   WA G
Sbjct  302  QLPADPYGWAAG  313



>ref|XP_004952401.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=318

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 139/199 (70%), Gaps = 18/199 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ES++AFARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  132  MEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  191

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV++MAASF+NA YERLPL+E
Sbjct  192  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEE  251

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+                                 Q     DPS+F G+PPNLL ++QLP
Sbjct  252  DD------------MLAAQAQADSAGILAGAQQAAQLAGSVDPSLFQGLPPNLLGNVQLP  299

Query  237  NDQGF-W----ATGRP-PF  199
             +  + W    A GRP PF
Sbjct  300  PESAYGWNPGAAGGRPAPF  318



>ref|XP_002451872.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
 gb|EES04848.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
Length=327

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 143/199 (72%), Gaps = 16/199 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ES++AFARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  139  MEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  198

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV++MAASF+NA YERLPL+E
Sbjct  199  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEE  258

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+           + +       G     QQ          DPS+F G+PPNLL ++QLP
Sbjct  259  DD----------MLAAQAQADSAGILAGAQQAAQLAAAGAVDPSLFQGLPPNLLGNVQLP  308

Query  237  NDQGF-W----ATGRP-PF  199
             +  + W    A GRP PF
Sbjct  309  PEAAYGWNPGAAGGRPAPF  327



>ref|XP_010439279.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=328

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 147/198 (74%), Gaps = 14/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  140  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  199

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  200  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  259

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L++DE    P+ GGGG            QQ Q Q            S   G+PPNLL S+
Sbjct  260  LEDDEMQT-PVHGGGGGGGSMESPPMMGQQLQHQQQAM--------SGHQGLPPNLLGSV  310

Query  246  QL--PNDQGFWATGRPPF  199
            QL   +DQ +W+TGRPP+
Sbjct  311  QLQQQHDQSYWSTGRPPY  328



>gb|KDO85858.1| hypothetical protein CISIN_1g047830mg [Citrus sinensis]
Length=313

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 159/196 (81%), Gaps = 5/196 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCDIM+SVS FARRRQRG+CI+SGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  120  MEIANGCDIMDSVSNFARRRQRGICILSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  180  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLVASGPVVIMAASFGNAAYERLPLEE  239

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP--SMFHGMPPNLLNSIQ  244
            +E     +  G        V  G  QQQQQQ    QQQ+L DP  S  HG+PPNLL+S+Q
Sbjct  240  EETPEASI-PGSRPLGSPEVNVGQPQQQQQQSQSHQQQLLQDPNASFIHGLPPNLLSSVQ  298

Query  243  LPNDQGFWATGRP-PF  199
            LP +  +WATGRP PF
Sbjct  299  LPAEP-YWATGRPAPF  313



>ref|XP_010448831.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=328

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 146/198 (74%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  139  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  198

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  199  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  258

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L++DE    P+ GGGG             QQ Q             S   G+PPNLL S+
Sbjct  259  LEDDEMQT-PVHGGGGGGGGSMESPPMMGQQLQHQQQAM-------SGHQGLPPNLLGSV  310

Query  246  QL--PNDQGFWATGRPPF  199
            QL   +DQ +W+TGRPP+
Sbjct  311  QLQQQHDQSYWSTGRPPY  328



>ref|XP_003611214.1| AT-hook DNA-binding protein [Medicago truncatula]
 gb|AES94172.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=325

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADGCD++ESV+ FARRRQRGVCIMSGTGTV NVTLRQPASPGAVVTLHGRFEILSL+
Sbjct  132  MEVADGCDVVESVNNFARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLA  191

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVGAL+ASGPV++M+ASFSNAAYERLPL++
Sbjct  192  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLED  251

Query  417  DEGNAL  400
            D+G+++
Sbjct  252  DDGSSI  257



>ref|XP_009393002.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 146/191 (76%), Gaps = 11/191 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI+ESV++FA RRQRGVCI+SG GTV NV LRQPAS  AVV L GRFEILSLS
Sbjct  119  MEIASGCDIVESVASFACRRQRGVCILSGNGTVTNVNLRQPASSSAVVNLRGRFEILSLS  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQ+VGGSVVGAL+ASGPV++MAASF NAAYERLPLDE
Sbjct  179  GSFLPPPAPPAASGLTIYLAGGQGQIVGGSVVGALIASGPVIIMAASFGNAAYERLPLDE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +E    PL         G +G  G   Q   P   QQQ L DP+  + HG+PPNLLN++Q
Sbjct  239  EE----PL-----QAQQGALGSPGLVGQSTPPQQPQQQQLLDPNNPLLHGIPPNLLNNLQ  289

Query  243  LPNDQGFWATG  211
            LP +   WATG
Sbjct  290  LPAEAYSWATG  300



>ref|XP_010538771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=307

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 144/196 (73%), Gaps = 18/196 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            ME+ADGCDI+ES+S FARRRQRGVC+MSGTG V NVT+RQP S PG+VV+LHGRFEILSL
Sbjct  127  MEVADGCDIVESMSVFARRRQRGVCVMSGTGNVTNVTIRQPGSPPGSVVSLHGRFEILSL  186

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YL+GGQGQVVGGSVVG L+ +GPV+VMAASFSNAAYERLP++
Sbjct  187  SGSFLPPPAPPAATGLSVYLSGGQGQVVGGSVVGPLVCAGPVVVMAASFSNAAYERLPME  246

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            E+E    P+ GGG     G      Q                      G+PPNLL S QL
Sbjct  247  EEEMQT-PVHGGGAGGPMGSPPHQQQGLAAMAAS--------------GLPPNLLGSGQL  291

Query  240  --PNDQGFWATGRPPF  199
              P+D  +WATGRPPF
Sbjct  292  PPPHDPPYWATGRPPF  307



>ref|XP_010908279.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=296

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 149/195 (76%), Gaps = 18/195 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            M++A GCDI+ESV+ FARRRQ+GVCI+SGTGTV NVTL+QPAS G +VTLHGRFEILSLS
Sbjct  118  MDVAGGCDIVESVANFARRRQQGVCILSGTGTVTNVTLQQPASLGGIVTLHGRFEILSLS  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLT+YLAGGQGQVVGGSVVG L ASG V++MAASFSNAAYE+LPL+E
Sbjct  178  GSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGPLTASGHVVIMAASFSNAAYEKLPLEE  237

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +E  +LP                G  Q       +QQQ+L +P++FHG+ PNLLNS+ LP
Sbjct  238  EE--SLP--------------PQGPVQTHGLVGQEQQQLLQEPNLFHGLAPNLLNSVHLP  281

Query  237  NDQGFW--ATGRPPF  199
            ++   W    GRPP+
Sbjct  282  SEPYSWTMGAGRPPY  296



>gb|KFK37336.1| hypothetical protein AALP_AA4G243300 [Arabis alpina]
Length=314

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRGVC++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  118  MEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  177

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  178  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  237

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLLN  253
            PL+ED+       G  G ++            Q     QQQQ++ DPS F  G+PPNL+N
Sbjct  238  PLEEDDQEEQQTGGAVGNNNNIDGNATLGGGTQTPQTQQQQQLMQDPSSFIQGLPPNLMN  297

Query  252  SIQLPNDQGFWATGRPPF  199
            S+QLP+ + +W   RP F
Sbjct  298  SVQLPS-EAYWGAPRPSF  314



>dbj|BAF02122.1| putative DNA binding protein [Arabidopsis thaliana]
Length=324

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 15/198 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  137  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  196

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  197  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  256

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L+E E    P+ GGGG  S       GQQ Q QQ            S   G+PPNLL S+
Sbjct  257  LEEGEMQT-PVHGGGGGGSLESPPMMGQQLQHQQQAM---------SGHQGLPPNLLGSV  306

Query  246  QL--PNDQGFWATGRPPF  199
            QL   +DQ +W+TGRPP+
Sbjct  307  QLQQQHDQSYWSTGRPPY  324



>ref|NP_001141263.1| hypothetical protein [Zea mays]
 gb|ACF85898.1| unknown [Zea mays]
 gb|ACF88117.1| unknown [Zea mays]
 gb|AFW71087.1| hypothetical protein ZEAMMB73_730676 [Zea mays]
Length=309

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 141/199 (71%), Gaps = 22/199 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ES++AFARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  127  MEVASGCDISESITAFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  186

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV++MAASF+NA YERLPL+E
Sbjct  187  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLEE  246

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+                 +    Q          Q     DPS+F G+PPNL+ ++Q+P
Sbjct  247  DD----------------MLAAQAQADSAGILAGAQLAGAVDPSLFQGLPPNLMCNVQMP  290

Query  237  NDQGF-W----ATGRP-PF  199
             +  + W    A GRP PF
Sbjct  291  PEAAYGWSPGAAGGRPAPF  309



>ref|NP_192942.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 emb|CAB40946.1| putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB78248.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAP88365.1| At4g12050 [Arabidopsis thaliana]
 dbj|BAF00128.1| putative DNA-binding protein [Arabidopsis thaliana]
 tpd|FAA00297.1| TPA: AT-hook motif nuclear localized protein 26 [Arabidopsis 
thaliana]
 dbj|BAH30517.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83091.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=339

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 151/198 (76%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG+V NVT+RQP S PG+VV+LHGRFEILSL
Sbjct  150  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGSVTNVTIRQPGSPPGSVVSLHGRFEILSL  209

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  210  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  269

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE               GG GGGG       P   QQQ +A  +   G+PPNLL S+QL
Sbjct  270  EDE--------MQTPVQGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQL  321

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W+TGRPP+
Sbjct  322  PPPQQNDQQYWSTGRPPY  339



>ref|NP_182067.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
 gb|AAB82621.1| putative AT-hook DNA-binding protein [Arabidopsis thaliana]
 gb|AAT70431.1| At2g45430 [Arabidopsis thaliana]
 gb|AAV74244.1| At2g45430 [Arabidopsis thaliana]
 tpd|FAA00293.1| TPA: AT-hook motif nuclear localized protein 22 [Arabidopsis 
thaliana]
 dbj|BAH30430.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10552.1| AT-hook motif nuclear-localized protein 22 [Arabidopsis thaliana]
Length=317

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 150/198 (76%), Gaps = 6/198 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  121  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  180

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  181  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  240

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLLN  253
            PL+ED+                   GGG Q Q Q    QQQQ++ DP+ F  G+PPNL+N
Sbjct  241  PLEEDDQEEQTAGAVANNIDGNATMGGGTQTQTQTQQQQQQQLMQDPTSFIQGLPPNLMN  300

Query  252  SIQLPNDQGFWATGRPPF  199
            S+QLP  + +W T RP F
Sbjct  301  SVQLPA-EAYWGTPRPSF  317



>ref|XP_010422173.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 151/198 (76%), Gaps = 12/198 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG V NVT+RQP SP G+VV+LHGRFEILSL
Sbjct  147  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPAGSVVSLHGRFEILSL  206

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  207  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  266

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE           +   GG GGGG       P   QQQ +A  +   G+PPNLL S+QL
Sbjct  267  EDE-------MQTPVQGGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQL  319

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W+TGRPP+
Sbjct  320  PLPQQNDQQYWSTGRPPY  337



>ref|XP_010433825.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=336

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 150/198 (76%), Gaps = 11/198 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG V NVT+RQP SP G+VV+LHGRFEILSL
Sbjct  145  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPAGSVVSLHGRFEILSL  204

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  205  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  264

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE               GG GGGG       P   QQQ +A  +   G+PPNLL S+QL
Sbjct  265  EDE------MQTPVQGGNGGGGGGGGGGMGSSPMMGQQQAMAAMAAAQGLPPNLLGSVQL  318

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W+TGRPP+
Sbjct  319  PPPQQNDQQYWSTGRPPY  336



>ref|XP_010455638.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=337

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 150/198 (76%), Gaps = 11/198 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG V NVT+RQP SP G+VV+LHGRFEILSL
Sbjct  146  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPAGSVVSLHGRFEILSL  205

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  206  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  265

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE               GG GGGG       P   QQQ +A  +   G+PPNLL S+QL
Sbjct  266  EDE------MQTPVQGGGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQL  319

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W+TGRPP+
Sbjct  320  PPPQQNDQQYWSTGRPPY  337



>ref|XP_011070911.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=255

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI+DGCDIM+ V+ FARRRQRGVCIMSGTG+V NVTLRQPA+PGAVVTLHGRFEILSL+
Sbjct  106  MEISDGCDIMDGVANFARRRQRGVCIMSGTGSVTNVTLRQPAAPGAVVTLHGRFEILSLA  165

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLTIYLAGGQGQV+GGSVVG LLASGPV++MAASFSNAAYERLPL+E
Sbjct  166  GSFLPPPAPPAATGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEE  225

Query  417  DE  412
            +E
Sbjct  226  EE  227



>ref|XP_007220373.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
 gb|EMJ21572.1| hypothetical protein PRUPE_ppa018314mg [Prunus persica]
Length=312

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 154/194 (79%), Gaps = 2/194 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIM+SVS FARRRQRGVCI+SG+GTV NVT+RQPASPG+VVTLHGRFEILSLS
Sbjct  120  MEVANGCDIMDSVSTFARRRQRGVCILSGSGTVTNVTIRQPASPGSVVTLHGRFEILSLS  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAG QGQVVGG VVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  180  GSFLPPPAPPAASGLTIYLAGVQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEE  239

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILAD-PSMFHGMPPNLLNSIQL  241
            +E  A     G G     GVGG   QQQ  Q   QQ     + PS+FHGMP +LLNS QL
Sbjct  240  EEPAAAGQVQGSGPLGSPGVGGQEHQQQSIQQQQQQLLQDPNAPSLFHGMPQSLLNSCQL  299

Query  240  PNDQGFWATGRPPF  199
            P  +G+W T RPP+
Sbjct  300  P-AEGYWGTARPPY  312



>ref|XP_002874744.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51003.1| hypothetical protein ARALYDRAFT_490024 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG V NVT+RQP S PG+VV+LHGRFEILSL
Sbjct  142  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPPGSVVSLHGRFEILSL  201

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  202  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  261

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE               GG GGG        P   QQQ +A  +   G+PPNLL S+QL
Sbjct  262  EDE--------MQTPVHGGGGGGGEGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQL  313

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W+TGRPP+
Sbjct  314  PPPQQNDQQYWSTGRPPY  331



>ref|NP_001046754.1| Os02g0448000 [Oryza sativa Japonica Group]
 dbj|BAD28974.1| putative DNA-binding protein AT-hook 2 [Oryza sativa Japonica 
Group]
 dbj|BAF08668.1| Os02g0448000 [Oryza sativa Japonica Group]
 gb|EAY85693.1| hypothetical protein OsI_07061 [Oryza sativa Indica Group]
 gb|EAZ22891.1| hypothetical protein OsJ_06576 [Oryza sativa Japonica Group]
Length=316

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 137/190 (72%), Gaps = 12/190 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ES++ FARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  129  MEVAGGCDISESITTFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  188

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV++MAASF+NA YERLPL++
Sbjct  189  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLED  248

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE           + +  G           Q   Q      DPS+F G+PPNLL ++QLP
Sbjct  249  DE-----------LLAAQGQADSAGLLAAGQQAAQLAGGAVDPSLFQGLPPNLLGNVQLP  297

Query  237  NDQGF-WATG  211
             +  + W  G
Sbjct  298  PEAAYGWNPG  307



>ref|XP_006396802.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
 gb|ESQ38255.1| hypothetical protein EUTSA_v10029174mg [Eutrema salsugineum]
Length=342

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 155/199 (78%), Gaps = 6/199 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG V NVT+RQP S PG+VV+LHGRFEILSL
Sbjct  144  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPPGSVVSLHGRFEILSL  203

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  204  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  263

Query  420  EDE-GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQ  244
            EDE    +   GGGG    GG GGGG       P   QQQ +A  +   G+PPNLL S+Q
Sbjct  264  EDEMQTPVHGGGGGGGGGSGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQ  323

Query  243  LP----NDQGFWATGRPPF  199
            LP    NDQ +W+TGRPP+
Sbjct  324  LPPQQQNDQPYWSTGRPPY  342



>ref|XP_006296351.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
 gb|EOA29249.1| hypothetical protein CARUB_v10025523mg [Capsella rubella]
Length=316

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 154/201 (77%), Gaps = 9/201 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  117  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  176

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  177  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  236

Query  429  PLDED---EGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPN  262
            PL+ED   E  A  +      ++  G G   Q Q Q Q   QQQQ++ DP+ F  G+PPN
Sbjct  237  PLEEDDQEEQTAGAVANNIDGNAAMGGGTPTQTQPQNQTQQQQQQLMQDPTSFIQGLPPN  296

Query  261  LLNSIQLPNDQGFWATGRPPF  199
            L+NS+QLP  + +W T RP F
Sbjct  297  LMNSVQLPA-EAYWGTPRPSF  316



>ref|XP_010692273.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 140/199 (70%), Gaps = 9/199 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIMES++ FARRRQRGVCI++GTGTV NVTLRQP +PGAVVTLHGRFEILSLS
Sbjct  139  MEVANGCDIMESITNFARRRQRGVCILNGTGTVANVTLRQPGAPGAVVTLHGRFEILSLS  198

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGG VVG LLASGPV+VMAASF NAAYERLPLDE
Sbjct  199  GSFLPPPAPPAASGLTIYLAGGQGQVVGGGVVGPLLASGPVVVMAASFGNAAYERLPLDE  258

Query  417  D-EGNALPLqggggmdspggvggggqqqqqq----qpppqqqQILADPSMFHGMPPNLLN  253
            D EG   P+ G        G    G    Q                   +  G+PPNLLN
Sbjct  259  DQEGPGAPMPGVTSGGGALGSPPPGGVPGQVIDPGTNGSGGGSGSGSGGLLQGLPPNLLN  318

Query  252  SIQLPNDQGFWAT-GRPPF  199
            S+     + FW T  R P+
Sbjct  319  SLP---PEAFWGTPNRTPY  334



>ref|XP_010523691.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=297

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 141/193 (73%), Gaps = 10/193 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCD+MESV+ FARRRQRGVC++SG G V NVT+RQP S GAVV LHGRFEILSLS
Sbjct  115  MEIANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVTIRQP-SGGAVVNLHGRFEILSLS  173

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  174  GSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERLPLEE  233

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++                 V               QQQ++ +PS   G+ P+L+NS+QLP
Sbjct  234  ED--------EEHAAVVAAVDANANLGSAGGGTQTQQQLMQEPSFIQGLNPSLINSVQLP  285

Query  237  NDQGFWATGRPPF  199
            ++  +W T RP F
Sbjct  286  SES-YWGTPRPSF  297



>ref|XP_008811429.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=294

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 141/189 (75%), Gaps = 17/189 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI+E ++AFA RRQRG+CI+SGTGTV NV LRQPAS GAVVTLHG FEILSLS
Sbjct  119  MEVAGGCDIVEGMAAFACRRQRGMCILSGTGTVTNVRLRQPASQGAVVTLHGYFEILSLS  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLT+YLAGGQGQVVGGSVVG L+ASGPV++MAASF+NAAY+RLPL+E
Sbjct  179  GSFLPPPAPPAATGLTVYLAGGQGQVVGGSVVGPLMASGPVVIMAASFANAAYDRLPLEE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +E                         +      QQQQ   DP++FHG+ PNLL+++QLP
Sbjct  239  EE-----------------SLQAQGPLESHGLLGQQQQFPQDPNLFHGLAPNLLSNVQLP  281

Query  237  NDQGFWATG  211
            ++   W TG
Sbjct  282  SEPHSWTTG  290



>ref|XP_010508171.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 153/203 (75%), Gaps = 11/203 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  121  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  180

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  181  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  240

Query  429  PLDEDE-----GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMP  268
            PL+ED+       A+     G     GG     Q Q Q Q   QQQQ++ DP+ F  G+P
Sbjct  241  PLEEDDQEEQTAGAVANNIDGNAAMGGGTQTPTQTQNQTQQQQQQQQLMQDPTSFIQGLP  300

Query  267  PNLLNSIQLPNDQGFWATGRPPF  199
            PNL+NS+QLP  + +W T RP F
Sbjct  301  PNLMNSVQLPA-EAYWGTPRPSF  322



>ref|XP_010506485.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=322

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 153/203 (75%), Gaps = 11/203 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  121  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  180

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  181  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  240

Query  429  PLDEDE-----GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMP  268
            PL+ED+       A+     G     GG     Q Q Q Q   QQQQ++ DP+ F  G+P
Sbjct  241  PLEEDDQEEQTAGAVANNIDGNAAMGGGTQTPTQTQNQTQQQQQQQQLMQDPTSFIQGLP  300

Query  267  PNLLNSIQLPNDQGFWATGRPPF  199
            PNL+NS+QLP  + +W T RP F
Sbjct  301  PNLMNSVQLPA-EAYWGTPRPSF  322



>ref|XP_006397724.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
 gb|ESQ39177.1| hypothetical protein EUTSA_v10001760mg [Eutrema salsugineum]
Length=319

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 150/201 (75%), Gaps = 9/201 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  120  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  179

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  180  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  239

Query  429  PLDED---EGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPN  262
            PL+ED   E             +    GG   Q Q Q    QQQQ++ DP+ F  G+PPN
Sbjct  240  PLEEDDQEEQQTAGAVANNIDGNASMGGGTQTQTQSQTQTQQQQQLMQDPTSFIQGLPPN  299

Query  261  LLNSIQLPNDQGFWATGRPPF  199
            L+NS+QLP  + +W T RP F
Sbjct  300  LMNSVQLPA-EAYWGTPRPSF  319



>ref|XP_002880179.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56438.1| hypothetical protein ARALYDRAFT_903987 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 151/200 (76%), Gaps = 8/200 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  120  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  179

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  180  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  239

Query  429  PLDED--EGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNL  259
            PL+ED  E             +    GG   Q Q QQ   QQQQ++ DP+ F  G+PPNL
Sbjct  240  PLEEDDQEEQTAGAVANNIDGNATMGGGTQTQTQTQQQQQQQQQLMQDPTSFIQGLPPNL  299

Query  258  LNSIQLPNDQGFWATGRPPF  199
            +NS+QLP  + +W T RP F
Sbjct  300  MNSVQLPA-EAYWGTPRPSF  318



>gb|KFK28863.1| hypothetical protein AALP_AA7G058200 [Arabis alpina]
Length=324

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 17/200 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  135  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVINVTIRQPGSAPSPGSVVSLHGRFEIL  194

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  195  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  254

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L+EDE    P+ GGGG         G QQ Q QQ            S   G+PPNLL S+
Sbjct  255  LEEDE-MQTPVHGGGGGSMESPPMMGQQQLQHQQQAM---------SGHQGLPPNLLGSV  304

Query  246  QLP----NDQGFWATGRPPF  199
            QL     ++Q +W+TGRP +
Sbjct  305  QLQQPQHDNQSYWSTGRPTY  324



>ref|XP_008343156.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=317

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 160/198 (81%), Gaps = 8/198 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIMESVS FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  123  MEVANGCDIMESVSTFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  182

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AAS LTIYLAGGQGQVVGG VVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  183  GSFLPPPAPPAASCLTIYLAGGQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEE  242

Query  417  DEGNAL--PLqggggmdspggvggggqqqqqqqpppqqqQILAD---PSMFHGMPPNLLN  253
            +E  A+   +QG GG     G+GG   QQQ  Q   QQQQ+L D   PS+FHGMP +LLN
Sbjct  243  EEEPAVAGQVQGSGGSLGSPGIGGQEHQQQSLQQQQQQQQLLQDPNAPSLFHGMPQSLLN  302

Query  252  SIQLPNDQGFWATGRPPF  199
              QLP D  +W T RPP+
Sbjct  303  --QLPAD-AYWGTARPPY  317



>ref|NP_001146992.1| DNA binding protein [Zea mays]
 gb|ACG24948.1| DNA binding protein [Zea mays]
 gb|AFW65915.1| DNA binding protein [Zea mays]
Length=320

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 133/187 (71%), Gaps = 14/187 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ESV+AFARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  133  MEVAGGCDISESVTAFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  192

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV+VMAASF+NA YERLPL++
Sbjct  193  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVVMAASFANAVYERLPLED  252

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+                       Q        Q      DP++F G+PPNLL  +Q+P
Sbjct  253  DD-------------LLAAHQAPQAQADGVLAAAQLAAGSVDPTLFQGLPPNLLGDVQMP  299

Query  237  NDQGF-W  220
             +  + W
Sbjct  300  PEPAYGW  306



>ref|XP_009379269.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=320

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 156/201 (78%), Gaps = 11/201 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIMESVS FARRRQRGVCI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  123  MEVANGCDIMESVSTFARRRQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  182

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AAS LTIYLAGGQGQ VGG VVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  183  GSFLPPPAPPAASCLTIYLAGGQGQGVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEE  242

Query  417  DEGNALPLqgg-----ggmdspggvggggqqqqqqqpppqqqQILADPS---MFHGMPPN  262
            +E  A+ +Q        G    GG     Q  QQQQ   QQQQ+L DP+   +FHGMP +
Sbjct  243  EEEPAVAVQVQGSGGSLGSPGIGGQEHQQQSLQQQQQQQQQQQLLQDPNAPSLFHGMPQS  302

Query  261  LLNSIQLPNDQGFWATGRPPF  199
            LLN  QLP D  +W T RPP+
Sbjct  303  LLN--QLPAD-AYWGTARPPY  320



>emb|CDY41289.1| BnaA01g12500D [Brassica napus]
Length=315

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 145/199 (73%), Gaps = 16/199 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  127  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVMNVTIRQPGSPSPGSVVSLHGRFEILS  186

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLPL
Sbjct  187  LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  246

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQ  244
            +EDE    P+ GGGG  S       G     QQ            S   G+PPNLL    
Sbjct  247  EEDEMQT-PVHGGGGGGSMEPPPMMGGPMPHQQQAM---------SAHQGLPPNLLGPAH  296

Query  243  --LP--NDQGFWATGRPPF  199
              LP  ++Q +W+TGRPP+
Sbjct  297  QGLPQHDNQSYWSTGRPPY  315



>ref|XP_009136213.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=326

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 140/199 (70%), Gaps = 15/199 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  137  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVMNVTIRQPGSPSPGSVVSLHGRFEILS  196

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGS  G LL +GPV+VMAASFSNAAYERLPL
Sbjct  197  LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSGGGPLLCAGPVVVMAASFSNAAYERLPL  256

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQ  244
            +EDE    P+ GGGG                 Q            S   G+PPNLL    
Sbjct  257  EEDEMQT-PVHGGGGGGGSMEPPPMMGGPMPHQQQAM--------SAHQGLPPNLLGPTH  307

Query  243  --LP--NDQGFWATGRPPF  199
              LP  ++Q +W+TGRPP+
Sbjct  308  QGLPQHDNQSYWSTGRPPY  326



>ref|XP_008232681.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=315

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 160/197 (81%), Gaps = 5/197 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIM+SVS FAR RQRGVCI+SG+GTV NVT+RQPASPG+VVTLHGRFEILSLS
Sbjct  120  MEVANGCDIMDSVSTFARIRQRGVCILSGSGTVTNVTIRQPASPGSVVTLHGRFEILSLS  179

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAG QGQVVGG VVG LLASGPV++MAASF NAAYERLPL+E
Sbjct  180  GSFLPPPAPPAASGLTIYLAGVQGQVVGGGVVGPLLASGPVVIMAASFGNAAYERLPLEE  239

Query  417  DEGNAL-PLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNS  250
            +E  A   + G G + SPG  G   QQQ  QQ   QQQQ+L DP   S+FHGMP +LLNS
Sbjct  240  EEPAAAGQVPGSGPLGSPGVGGQEHQQQSIQQQQQQQQQLLQDPNAPSLFHGMPQSLLNS  299

Query  249  IQLPNDQGFWATGRPPF  199
             QLP  +G+W T RPP+
Sbjct  300  CQLP-AEGYWGTARPPY  315



>emb|CDX82978.1| BnaC01g14280D [Brassica napus]
Length=315

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 146/199 (73%), Gaps = 17/199 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  128  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVMNVTIRQPGSPSPGSVVSLHGRFEILS  187

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLPL
Sbjct  188  LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  247

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQ  244
            +EDE    P+ GGGG         GG    QQQ            S   G+PPNLL    
Sbjct  248  EEDEMQT-PVHGGGGGSMEPPPMMGGPMPHQQQAM----------SAHQGLPPNLLGPAH  296

Query  243  --LP--NDQGFWATGRPPF  199
              LP  ++Q +W+TGRPP+
Sbjct  297  QGLPQHDNQSYWSTGRPPY  315



>ref|XP_008805810.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=297

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 143/196 (73%), Gaps = 19/196 (10%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+ADG DI+ESV+ FAR RQRGVCI+SGTGTV NVTL+QP S GA++TLHGRFEILSLS
Sbjct  118  MEVADGGDIVESVANFARLRQRGVCILSGTGTVTNVTLQQPGSQGAILTLHGRFEILSLS  177

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvga-llasGPVLVMAASFSNAAYERLPLD  421
            GSF+PPPAP AA+GLTIYLAGGQGQVV G  V   L ASG V++MAASFSNAAYERLPL+
Sbjct  178  GSFVPPPAPPAATGLTIYLAGGQGQVVVGGSVVGPLTASGHVVIMAASFSNAAYERLPLE  237

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            E+E +A P                   +       +QQQ+L +P++FH + PNLLN++QL
Sbjct  238  EEE-SAPP---------------QRLVESHGLVGQEQQQLLQEPNLFHALAPNLLNNVQL  281

Query  240  PNDQGFW--ATGRPPF  199
            P++   W    GRPP+
Sbjct  282  PSEPYSWTAGAGRPPY  297



>ref|XP_010518160.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=321

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 147/202 (73%), Gaps = 10/202 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  121  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  180

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  181  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  240

Query  429  PLDEDEGNALPLqggggmdspggv----ggggqqqqqqqpppqqqQILADPSMF-HGMPP  265
            PL+ED+                           Q Q Q    QQQQ++ DP+ F  G+PP
Sbjct  241  PLEEDDQEEQTAGAVANNIDGNAAMGGGTQTPTQTQNQMQQQQQQQLMQDPTSFIQGLPP  300

Query  264  NLLNSIQLPNDQGFWATGRPPF  199
            NL+NS+QLP  + +W T RP F
Sbjct  301  NLMNSVQLPA-EAYWGTPRPSF  321



>emb|CDY27387.1| BnaC04g50180D [Brassica napus]
Length=312

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 144/198 (73%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  123  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  182

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  183  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  242

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLLN  253
            PL+ED+ +                   G          Q QQ++ DP+ F  G+PP+L+N
Sbjct  243  PLEEDDQDE------QQTAGAVANNMDGNATMGGGTQTQPQQLMQDPTSFIQGLPPSLMN  296

Query  252  SIQLPNDQGFWATGRPPF  199
            S QLP  + +W T RP F
Sbjct  297  S-QLPA-EAYWGTPRPSF  312



>ref|XP_009391843.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 142/197 (72%), Gaps = 17/197 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA GCDI ESV+ FARRRQRGVCI+ GTGTV NVTLRQ ASPGAVVTL GRFEILS+S
Sbjct  130  MEIAGGCDICESVATFARRRQRGVCILGGTGTVINVTLRQSASPGAVVTLRGRFEILSIS  189

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+G+TIYL+GGQGQVVGGSVVG L+A GP+++MAASF +AAYERLPL E
Sbjct  190  GSFLPPPAPPAATGMTIYLSGGQGQVVGGSVVGPLIALGPIIIMAASFGSAAYERLPLPE  249

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLNSIQ  244
            +EG                 G  G      Q P  QQQ+L DP+  +FH + P+LLN++Q
Sbjct  250  EEG-------------LQAQGPLGSPDFVGQSPQAQQQLLPDPNNPLFHNLSPSLLNNMQ  296

Query  243  LPNDQGFWATG--RPPF  199
             P D   W  G  RP +
Sbjct  297  SPADAYGWGAGGVRPAY  313



>ref|XP_009142337.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 144/198 (73%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  119  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  178

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  179  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  238

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLLN  253
            PL+ED+ +                   G          Q QQ++ DP+ F  G+PP+L+N
Sbjct  239  PLEEDDQDE------QQTAGAVANNIDGNATMGGGTQTQPQQLMQDPTSFIQGLPPSLMN  292

Query  252  SIQLPNDQGFWATGRPPF  199
            S QLP  + +W T RP F
Sbjct  293  S-QLPA-EAYWGTPRPSF  308



>emb|CDY37040.1| BnaA04g26180D [Brassica napus]
Length=308

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 144/198 (73%), Gaps = 13/198 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRG+C++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  119  MEVANGCDVMESVTVFARRRQRGICVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  178

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  179  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  238

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLLN  253
            PL+ED+ +                   G          + QQ++ DP+ F  G+PP+L+N
Sbjct  239  PLEEDDQDE------QQTAGAVANNIDGNATMGGGTQTRPQQLMQDPTSFIQGLPPSLMN  292

Query  252  SIQLPNDQGFWATGRPPF  199
            S QLP  + +W T RP F
Sbjct  293  S-QLPA-EAYWGTPRPSF  308



>emb|CDY04391.1| BnaC02g28570D [Brassica napus]
Length=327

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 140/198 (71%), Gaps = 20/198 (10%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARR QRGVC+MSGTG+V NVT+RQ  S PG+V++LHGRFEILSL
Sbjct  145  MEIGDGCDIVDCMATFARRHQRGVCVMSGTGSVTNVTIRQSGSPPGSVISLHGRFEILSL  204

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAY+RLPL+
Sbjct  205  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYQRLPLE  264

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            EDE                   GGG         P         +   G+PPNLL S+QL
Sbjct  265  EDE---------------MQTPGGGGGGGGGMGSPPMMGQQQAMAAAQGLPPNLLGSVQL  309

Query  240  P----NDQGFWATGRPPF  199
            P    NDQ +W TGRPP+
Sbjct  310  PPQQQNDQPYWPTGRPPY  327



>ref|XP_003573204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=312

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 130/180 (72%), Gaps = 19/180 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A GCDI ES++AFARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  129  MEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  188

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV++MAASF+NA YERLPL++
Sbjct  189  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAASFANAVYERLPLED  248

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            ++                      Q                DP++F G+PPNLL ++QLP
Sbjct  249  ED-------------------LLAQGGDSGAGMLPGAGGQMDPNLFQGLPPNLLGNVQLP  289



>ref|XP_010262258.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=255

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 139/196 (71%), Gaps = 9/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  66   MEVAGGADVAESVAQFARRRQRGVCVLSGSGAVANVTLRQPAAPGAVVALHGRFEILSLT  125

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG L+A+GPV+V+AA+F+NA YERLPL+E
Sbjct  126  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLVAAGPVMVIAATFANATYERLPLEE  185

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            +E  A               GG G          QQQ  L DPS    + +PPNL+ N  
Sbjct  186  EEDEAG------SGGQGQLAGGAGSSPPAIGSSAQQQSGLPDPSSLPIYNLPPNLIPNGG  239

Query  246  QLPNDQGFWATGRPPF  199
            QL +D   WA  RPPF
Sbjct  240  QLNHDAFAWAHARPPF  255



>ref|XP_010053890.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW78264.1| hypothetical protein EUGRSUZ_D02447 [Eucalyptus grandis]
Length=304

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 140/192 (73%), Gaps = 8/192 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+A G DI+ES+S FARRRQRGVCI+SG+GTV NV LRQPASPGAVVTLHGRFEILSLS
Sbjct  119  VEVASGADIVESMSTFARRRQRGVCILSGSGTVTNVALRQPASPGAVVTLHGRFEILSLS  178

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP A SGLT+YLAGGQGQVVGG+V G L+ASGPV++MAASF NAAYERLPL+E
Sbjct  179  GSILPPPAPPALSGLTVYLAGGQGQVVGGNVAGPLMASGPVVIMAASFGNAAYERLPLEE  238

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +E        G     P G   G     QQQ   Q   + A+ ++ HG  PNLLNS  LP
Sbjct  239  EE-------AGAAAPVPSGGQLGSPGMGQQQQQQQIMPVDANGALLHGFAPNLLNSCNLP  291

Query  237  NDQGFWATGRPP  202
             +  +W   RPP
Sbjct  292  GET-YWGAARPP  302



>ref|XP_006284928.1| hypothetical protein CARUB_v10006227mg [Capsella rubella]
 gb|EOA17826.1| hypothetical protein CARUB_v10006227mg [Capsella rubella]
Length=330

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 145/199 (73%), Gaps = 14/199 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA---SPGAVVTLHGRFEIl  607
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP    SPG+VV+LHGRFEIL
Sbjct  140  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSHPSPGSVVSLHGRFEIL  199

Query  606  slsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLP  427
            SLSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLP
Sbjct  200  SLSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLP  259

Query  426  LDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI  247
            L+EDE    P+ GGGG             QQ Q             S   G+PPNLL S+
Sbjct  260  LEEDEMQT-PVHGGGGGGGGSMESPPMMGQQLQHQQQAM-------SGHQGLPPNLLGSV  311

Query  246  ---QLPNDQGFWATGRPPF  199
               Q  +DQ +W+TGRPP+
Sbjct  312  QLQQQQHDQSYWSTGRPPY  330



>ref|XP_009411479.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 139/195 (71%), Gaps = 14/195 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIADG DI ESV+ FA RRQRGVC++SG+GTV NVTL QPASPGAVVTLHGRFEILSLS
Sbjct  125  MEIADGYDICESVATFACRRQRGVCVLSGSGTVTNVTLHQPASPGAVVTLHGRFEILSLS  184

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GL IYLAGGQGQVVGGSVVG L+ASGPV+++AASF  AAYERLPL  
Sbjct  185  GSFLPPPAPPAATGLAIYLAGGQGQVVGGSVVGPLIASGPVIIIAASFGTAAYERLPLAA  244

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +EG  +                G      Q PPPQ      +  +FH +PPNLLN++Q+P
Sbjct  245  EEGLQM------------QGTLGSPDLIGQSPPPQLLPPDPNNLLFHSLPPNLLNNVQVP  292

Query  237  NDQGFWATGR--PPF  199
             D   W   R  PP+
Sbjct  293  ADAHGWDGSRDPPPY  307



>ref|XP_004145056.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004153892.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004172845.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN46234.1| hypothetical protein Csa_6G076820 [Cucumis sativus]
Length=282

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 143/199 (72%), Gaps = 21/199 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI+   DI++S++ FARRRQRGVCI+S TGTV NVTLRQP+SPGAV+TL GRFEILSLS
Sbjct  99   IEISTASDIVDSLATFARRRQRGVCILSATGTVANVTLRQPSSPGAVITLPGRFEILSLS  158

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL-D  421
            GSFLPPPAP AASGLT+YLAGGQGQVVGG+V+G L ASGPV++MAASF NAAYERLP+ D
Sbjct  159  GSFLPPPAPPAASGLTVYLAGGQGQVVGGNVIGPLSASGPVIIMAASFGNAAYERLPIDD  218

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLN-S  250
            EDE +  P                    QQ    P   Q+L DP+  +FHGM  N++N S
Sbjct  219  EDETSPAP---------------DQMAGQQAAAAPPPPQLLGDPNGGLFHGMAQNVVNSS  263

Query  249  IQLPND--QGFWATGRPPF  199
             QLP +    FW  GRPP+
Sbjct  264  CQLPGEAAAAFWGGGRPPY  282



>ref|XP_006413619.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
 gb|ESQ55072.1| hypothetical protein EUTSA_v10025672mg [Eutrema salsugineum]
Length=333

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 15/199 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD++ESV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  144  MEIGDGCDLVESVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPGSVVSLHGRFEILS  203

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLPL
Sbjct  204  LSGSFLPPPAPPTATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  263

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQ  244
            ++DE    P+ GGGG             Q   Q            S   G+PPNLL    
Sbjct  264  EDDEMQT-PVHGGGGGGGSMESPPMMGGQLPHQQQAM--------SGHQGLPPNLLGPAH  314

Query  243  --LP--NDQGFWATGRPPF  199
              LP  ++Q +W+TGRP +
Sbjct  315  QGLPQHDNQSYWSTGRPSY  333



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 141/196 (72%), Gaps = 13/196 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+G DI ESV+ FARRRQRGVC++SG+GTV NVTLRQP +PGAV+ LHGRFEILSL+
Sbjct  96   MEIANGADIAESVAQFARRRQRGVCVLSGSGTVTNVTLRQPTAPGAVMALHGRFEILSLT  155

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+AA+FSNA YERLPL+E
Sbjct  156  GAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLEE  215

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            DE             S  G  G G          QQQ  +ADPS    + +PPNLL N  
Sbjct  216  DE----------EAGSGQGQLGSGSPPGIGGGGGQQQGGMADPSSMPVYNLPPNLLPNGG  265

Query  246  QLPNDQGFWATGRPPF  199
            QL ++   W  GRP +
Sbjct  266  QLNHEAYGWTHGRPTY  281



>gb|KDP40294.1| hypothetical protein JCGZ_02292 [Jatropha curcas]
Length=189

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 137/196 (70%), Gaps = 10/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+  G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  1    MEVVGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  60

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  61   GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLED  120

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            DE  A     G                 QQ         L DPS    + +PPNL+ N  
Sbjct  121  DEEAAGSGGQGQIQGGANNSPPPIGNSGQQSG-------LPDPSALPVYNLPPNLMPNGA  173

Query  246  QLPNDQGFWATGRPPF  199
            QL +D   WA  RPP+
Sbjct  174  QLGHDAFAWAHTRPPY  189



>emb|CDX98771.1| BnaA03g45560D [Brassica napus]
Length=317

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 14/200 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD+++SV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  125  MEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPGSVVSLHGRFEILS  184

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLPL
Sbjct  185  LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  244

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLL----  256
            +EDE    P+ GGGG    G +        Q     Q        S   G+PPNLL    
Sbjct  245  EEDEMQT-PVHGGGGGGGGGSMESPPMMGGQMPHQQQAM------SAHQGLPPNLLGGSA  297

Query  255  -NSIQLPNDQGFWATGRPPF  199
               +   ++Q +W+TGRP F
Sbjct  298  HQGLPQHDNQPYWSTGRPSF  317



>ref|XP_009137280.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=327

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 14/200 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD+++SV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  135  MEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPGSVVSLHGRFEILS  194

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLPL
Sbjct  195  LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  254

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLL----  256
            +EDE    P+ GGGG    G +        Q     Q        S   G+PPNLL    
Sbjct  255  EEDEMQT-PVHGGGGGGGGGSMESPPMMGGQMPHQQQAM------SAHQGLPPNLLGGSA  307

Query  255  -NSIQLPNDQGFWATGRPPF  199
               +   ++Q +W+TGRP F
Sbjct  308  HQGLPQHDNQPYWSTGRPSF  327



>emb|CDP09327.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 150/199 (75%), Gaps = 11/199 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ESV+ +AR+RQRG+CI+SG+GTVNNV+LRQPA+ G+VVTLHGRFEILSLS
Sbjct  99   LEVSSGCDVFESVATYARKRQRGICILSGSGTVNNVSLRQPAAAGSVVTLHGRFEILSLS  158

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGG+VVGAL+ASGPV+V+AASF+N AYERLPLDE
Sbjct  159  GSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIAASFTNVAYERLPLDE  218

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM---FHGMPPNLLNSI  247
            D+ ++L +Q      + GG GG G           Q    +DPS+   F  +P N+ NS 
Sbjct  219  DD-HSLQMQPPAASQTSGGGGGSGGSGAGAGGSNNQ---FSDPSLGLPFFNLPINMPNS-  273

Query  246  QLPNDQGFW---ATGRPPF  199
            QLP + G W   +TGRP +
Sbjct  274  QLPMEGGGWTGNSTGRPQY  292



>ref|XP_004305833.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=266

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 131/190 (69%), Gaps = 21/190 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  93   MEVSSGCDVSESLTNFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  152

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  153  GSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  212

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE  A                       Q Q     +    D S F+G+PPNLL +  +P
Sbjct  213  DEVAA---------------------ALQNQQYQNGRHHHLDMSDFYGLPPNLLTNGNVP  251

Query  237  NDQGFWATGR  208
             +   WA+GR
Sbjct  252  PEVYSWASGR  261



>gb|EPS64135.1| hypothetical protein M569_10646 [Genlisea aurea]
Length=318

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+A GCDI ESVS FA RRQRGVCI+SGTGTV NVT+RQP SPGAV+TL GRFEILSL+
Sbjct  127  IEVATGCDIQESVSTFATRRQRGVCILSGTGTVTNVTIRQPTSPGAVLTLQGRFEILSLT  186

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AAS LTIYLAG QGQV+GG++VG L+ASGPV++MAASF NAAYERLPL+E
Sbjct  187  GSFLPPPAPPAASSLTIYLAGSQGQVMGGTIVGPLIASGPVVIMAASFGNAAYERLPLEE  246

Query  417  DEGNA  403
            +EG +
Sbjct  247  EEGQS  251



>emb|CDX94128.1| BnaC07g37620D [Brassica napus]
Length=327

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 14/200 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPA--SPGAVVTLHGRFEIls  604
            MEI DGCD+++SV+ FARRRQRGVC+MSGTG V NVT+RQP   SPG+VV+LHGRFEILS
Sbjct  135  MEIGDGCDLVDSVATFARRRQRGVCVMSGTGNVTNVTIRQPGSPSPGSVVSLHGRFEILS  194

Query  603  lsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            LSGSFLPPPAP  A+GL++YLAGGQGQVVGGSVVG LL +GPV+VMAASFSNAAYERLPL
Sbjct  195  LSGSFLPPPAPPNATGLSVYLAGGQGQVVGGSVVGPLLCAGPVVVMAASFSNAAYERLPL  254

Query  423  DEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLL----  256
            +EDE    P+ GGGG    G +        Q     Q        S   G+PPNLL    
Sbjct  255  EEDEMQT-PVHGGGGGGGGGSMESPPMMGGQLPHQQQAM------SAHQGLPPNLLGGSA  307

Query  255  -NSIQLPNDQGFWATGRPPF  199
               +   ++Q +W+TGRP F
Sbjct  308  HQGLPQHDNQPYWSTGRPSF  327



>ref|XP_008467078.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
 ref|XP_008467079.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=282

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 139/198 (70%), Gaps = 19/198 (10%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI+   DI++S++ FARRRQRGVCI+S TGTV NVTLRQPASPGAV+TL GRFEILSLS
Sbjct  99   IEISTASDIVDSLATFARRRQRGVCILSATGTVANVTLRQPASPGAVITLPGRFEILSLS  158

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLT+YLAGGQGQVVGG+V+G L ASGPV++MAASF NAAYERLP+D 
Sbjct  159  GSFLPPPAPPAASGLTVYLAGGQGQVVGGNVIGPLSASGPVIIMAASFGNAAYERLPID-  217

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNLLN-SI  247
            DE    P                    QQ        Q+L DP+  +FHGM  N +N S 
Sbjct  218  DEDETSPA-------------ADQMAGQQAAAAAPPPQLLGDPNGGLFHGMAQNAVNSSC  264

Query  246  QLPND--QGFWATGRPPF  199
            QLP +    FW  GRPP+
Sbjct  265  QLPGEAAAAFWGGGRPPY  282



>ref|XP_006647239.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=323

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 138/199 (69%), Gaps = 16/199 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G  I  S+  FARRRQRGVC++SG GTV NVTLRQPAS GAVV LHGRFEILSLS
Sbjct  135  MEVAGGGGISASIQTFARRRQRGVCVLSGAGTVTNVTLRQPASQGAVVALHGRFEILSLS  194

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+GLT+YLAGGQGQVVGGSVVGAL A+GPV++MAA F+NA YERLPL++
Sbjct  195  GSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALTAAGPVVIMAAPFANAVYERLPLED  254

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE           + + G     G     QQ          DPS+F G+PPNLL ++QLP
Sbjct  255  DE----------LLAAQGQADSAGLLAAGQQAAQLAGAGAVDPSLFQGLPPNLLGNVQLP  304

Query  237  NDQGF-W----ATGRP-PF  199
             +  + W    A GRP PF
Sbjct  305  PEAAYGWNPGAAGGRPAPF  323



>ref|XP_010262897.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=360

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 143/195 (73%), Gaps = 15/195 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI+ G D++ES++ FARRRQRGVC++SG+G V NVTLRQPA+ GAV+TLHGRFEILSLS
Sbjct  175  LEISSGSDVVESIATFARRRQRGVCVLSGSGVVTNVTLRQPAASGAVITLHGRFEILSLS  234

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL-D  421
            G+FLP P+P  ASGLT+YLAGGQGQVVGGSVVGAL+ASGPV+V+AA+F+NA YERLP+ D
Sbjct  235  GAFLPAPSPPGASGLTVYLAGGQGQVVGGSVVGALMASGPVMVIAATFANATYERLPIKD  294

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLLNSI  247
            E  G  + LQ   G++S        Q             +L DPS    + +PPNLL + 
Sbjct  295  EPAGEGMQLQQTSGVNSGTSGISASQSH-----------VLPDPSSLPIYNLPPNLLTNG  343

Query  246  QLPNDQGFWATGRPP  202
            Q+P+D  FWA  RPP
Sbjct  344  QMPHDV-FWAPPRPP  357



>ref|XP_007035040.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY05966.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=273

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 141/196 (72%), Gaps = 10/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ES++ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  85   MEVASGTDVAESIAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  144

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLP+++
Sbjct  145  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPIED  204

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            DE         G     G + GG             Q  L DPS    + +PPNLL N  
Sbjct  205  DE-------EAGSGGHGGQIQGGAGNSPPAIGSSGPQTGLPDPSSLPIYNLPPNLLANGG  257

Query  246  QLPNDQGFWATGRPPF  199
            QL ++   WA GRPP+
Sbjct  258  QLGHEAYAWAHGRPPY  273



>ref|XP_008229461.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=266

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 131/190 (69%), Gaps = 21/190 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  93   MEVSSGCDVSESLTNFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  152

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGGSVVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  153  GSILPPPAPPGITGLTIYLAGAQGQVVGGSVVGALIASGPVVIMAASFMNATFDRLPLDE  212

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE  A                       Q Q     +    D S  +G+PPNLL +  +P
Sbjct  213  DEVAA---------------------ALQNQQYQNGRHHHLDISDLYGLPPNLLTNGNVP  251

Query  237  NDQGFWATGR  208
             +   WA+GR
Sbjct  252  PEVYSWASGR  261



>ref|XP_011029905.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=292

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 140/197 (71%), Gaps = 12/197 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  104  MEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  163

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  164  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLED  223

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLL--NS  250
            DE          G    G +  G            QQ  L DPS    + +PPNL+   +
Sbjct  224  DE--------EAGSGGQGQIQSGANNSPPAIGSSGQQAGLPDPSAMPIYNLPPNLIPNGA  275

Query  249  IQLPNDQGFWATGRPPF  199
             QL +D   WA  RPP+
Sbjct  276  HQLGHDAYAWAHARPPY  292



>ref|XP_002529315.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33084.1| DNA binding protein, putative [Ricinus communis]
Length=301

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 140/196 (71%), Gaps = 11/196 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+  G D+ E V+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  113  MEVVGGADVAECVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  172

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  173  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLED  232

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            DE  A            G + GG            QQ  L DPS    + +PPNL+ N  
Sbjct  233  DEEAA--------SAGQGHIQGGSNNSPPPIGSTGQQPGLPDPSALPVYNLPPNLIPNGG  284

Query  246  QLPNDQGFWATGRPPF  199
            QL +D   WA GRPP+
Sbjct  285  QLGHDAYAWAHGRPPY  300



>ref|XP_006846339.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
 gb|ERN08014.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
Length=284

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 140/198 (71%), Gaps = 20/198 (10%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+A G D+ ESV+AFARRRQRGVC++SG+G V NVTLRQPA+PGAVVTLHGRFEILSLS
Sbjct  102  LEVAGGADVAESVAAFARRRQRGVCVLSGSGVVANVTLRQPAAPGAVVTLHGRFEILSLS  161

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP P+P AA+GLT+YLAGGQGQVVGGSVVGAL+ASGPV+V+AA+FSNA YERLPLD+
Sbjct  162  GAFLPAPSPPAATGLTVYLAGGQGQVVGGSVVGALVASGPVMVIAATFSNATYERLPLDD  221

Query  417  D-----EGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLN  253
            D     +G   P   GG   S    G  G               L      + +PPNL+ 
Sbjct  222  DAESSAQGQLTPAAHGGEQGSSVVPGSMG---------------LQSEMPVYNLPPNLMP  266

Query  252  SIQLPNDQGFWATGRPPF  199
            + QLP+D  +    RPP+
Sbjct  267  NGQLPHDVYWTPPPRPPY  284



>ref|XP_002876587.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52846.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 138/200 (69%), Gaps = 32/200 (16%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI +GCD+MES++ FARRRQRGVC+++G G V NVT+RQP   G VV+LHGRFEILSLS
Sbjct  90   MEITNGCDVMESLAVFARRRQRGVCVLTGNGAVTNVTVRQPG--GGVVSLHGRFEILSLS  147

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AA+GLT+YLAGGQGQV+GGS+VG L+ASGPV++MAASF NAAYERL L+E
Sbjct  148  GSFLPPPAPPAATGLTVYLAGGQGQVIGGSLVGPLMASGPVVIMAASFGNAAYERLQLEE  207

Query  417  DE------GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNL  259
            +E      GNA                              Q+Q++ D + F  G P NL
Sbjct  208  EETDREIDGNA----------------------SMAVGTQTQKQLMHDATSFVQGSPSNL  245

Query  258  LNSIQLPNDQGFWATGRPPF  199
            +NS+ LP+ + +W T RP F
Sbjct  246  INSVSLPS-EAYWGTQRPSF  264



>gb|ABZ89182.1| putative protein [Coffea canephora]
 gb|ADZ55300.1| DNA-binding protein [Coffea arabica]
 emb|CDO99972.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 142/196 (72%), Gaps = 12/196 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+G DI ES++ FARRRQRGVC++S +GTV NVTLRQP++PGAV+ LHGRFEILSL+
Sbjct  103  MEVANGSDIAESIAQFARRRQRGVCVLSASGTVTNVTLRQPSAPGAVMALHGRFEILSLT  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  A+GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+A++FSNA YERLP++E
Sbjct  163  GAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPIEE  222

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            DE          G  +  G  GG            QQ  L DPS    + +PPNL+ N  
Sbjct  223  DE---------EGGGAAQGQLGGNGSPPLGSGGAPQQGGLGDPSSMPVYNLPPNLMPNGG  273

Query  246  QLPNDQGFWATGRPPF  199
            QL ++   WA GRPP+
Sbjct  274  QLNHEAFAWAHGRPPY  289



>gb|EYU41285.1| hypothetical protein MIMGU_mgv1a025243mg [Erythranthe guttata]
Length=293

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 137/190 (72%), Gaps = 19/190 (10%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+  GCD+ E+V+ +ARRRQRGVCI+SGTGTVNNV+LRQPA+ G+V TLHGRFEILSLS
Sbjct  109  LEVGSGCDVFEAVATYARRRQRGVCILSGTGTVNNVSLRQPAAAGSVATLHGRFEILSLS  168

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGG+VVGAL+ASGPV+++AASF+N AYERLPLDE
Sbjct  169  GSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIIVAASFTNVAYERLPLDE  228

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM---FHGMPPNLLNSI  247
            +E   +P  GGGG    G  G                    DPS+   F  +P N+ N+ 
Sbjct  229  EEAPQMPPSGGGGGSGGGNGGNQ----------------FPDPSLGLPFLNLPLNMPNNG  272

Query  246  QLPNDQGFWA  217
            QL  D G WA
Sbjct  273  QLQMDDGAWA  282



>gb|ADY38789.1| DNA-binding protein [Coffea arabica]
Length=289

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 142/196 (72%), Gaps = 12/196 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+G DI ES++ FARRRQRGVC++S +GTV NVTLRQP++PGAV+ LHGRFEILSL+
Sbjct  103  MEVANGSDIAESIAQFARRRQRGVCVLSASGTVTNVTLRQPSAPGAVMALHGRFEILSLT  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  A+GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+A++FSNA YERLP++E
Sbjct  163  GAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPIEE  222

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            DE          G  +  G  GG            QQ  L DPS    + +PPNL+ N  
Sbjct  223  DE---------EGGGAAQGQLGGNGSPPLGSGGAPQQGGLGDPSSMPVYSLPPNLMPNGG  273

Query  246  QLPNDQGFWATGRPPF  199
            QL ++   WA GRPP+
Sbjct  274  QLNHEAFAWAHGRPPY  289



>ref|XP_009344356.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
 ref|XP_009344357.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=312

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 145/196 (74%), Gaps = 8/196 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+GCDIM+SVS FARR+QRGVCI+SG+GTV NVTLRQPASPGAVVTLHGRFEILSLS
Sbjct  122  MEVANGCDIMDSVSTFARRKQRGVCILSGSGTVTNVTLRQPASPGAVVTLHGRFEILSLS  181

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP A SGLTIYLAGGQGQVVGG VVG LLASGPV++MA SF NAAYER  L  
Sbjct  182  GSFLPPPAPPATSGLTIYLAGGQGQVVGGPVVGPLLASGPVVIMAGSFGNAAYER--LPL  239

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP---SMFHGMPPNLLNSI  247
            +E   L   G        G   G      Q+   QQQQ+L DP   S+FHGMP +LLN  
Sbjct  240  EEEEELAAAGQVQGIQGSGRSLGSPGVGGQEHQQQQQQLLQDPNAPSLFHGMPQSLLN--  297

Query  246  QLPNDQGFWATGRPPF  199
            QLP D  +W T RP +
Sbjct  298  QLPAD-AYWGTARPAY  312



>ref|XP_010544659.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=281

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 133/193 (69%), Gaps = 16/193 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+GCD+MES++ FARRRQ GVC++SG G V NVT+ QP+  G+VV LHGRF+I+SLS
Sbjct  105  MEIANGCDVMESITVFARRRQLGVCVLSGNGAVTNVTIDQPSG-GSVVNLHGRFDIVSLS  163

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLTIYLAGGQGQV+GG   G L ASGPV++MAASF NA+YERLP++E
Sbjct  164  GSFLPPPAPPAASGLTIYLAGGQGQVIGGGGGGPLTASGPVVIMAASFGNASYERLPVEE  223

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
                A+               G    +        QQQ++ DP    G+ P+L NS QLP
Sbjct  224  QSEAAV--------------DGNPTLRSGADGTQTQQQLMQDPLFIQGLNPSLTNSAQLP  269

Query  237  NDQGFWATGRPPF  199
              + +W T RPPF
Sbjct  270  A-EAYWVTPRPPF  281



>ref|XP_002312579.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
 gb|EEE89946.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
Length=291

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 140/197 (71%), Gaps = 12/197 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  103  MEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  163  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLED  222

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLL--NS  250
            D+          G    G +  G            QQ  L DPS    + +PPNL+   +
Sbjct  223  DD--------EAGSGGQGQIQSGANNSPPAIGSSGQQAGLPDPSAMPIYNLPPNLIPNGA  274

Query  249  IQLPNDQGFWATGRPPF  199
             QL +D   WA  RPP+
Sbjct  275  HQLGHDAYAWAHARPPY  291



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+G DI ESV+ FARRRQRGVC++SG+GTV NVTLRQP +PGAV+ LHGRFEILSL+
Sbjct  96   MEIANGADIAESVAQFARRRQRGVCVLSGSGTVTNVTLRQPTAPGAVMALHGRFEILSLT  155

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+AA+FSNA YERLPL+E
Sbjct  156  GAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLEE  215

Query  417  DE  412
            DE
Sbjct  216  DE  217



>gb|KCW60423.1| hypothetical protein EUGRSUZ_H03144 [Eucalyptus grandis]
Length=199

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 139/197 (71%), Gaps = 7/197 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ E ++ FARRRQRGVC++SG+GTV NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  6    MEVASGADVAECLAQFARRRQRGVCVLSGSGTVANVTLRQPAAPGAVVALHGRFEILSLT  65

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP P+P  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+ A+F+NA YERLPLDE
Sbjct  66   GTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIGATFANATYERLPLDE  125

Query  417  DE-GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNL-LNS  250
            +E GN      GGG     G GG             QQ + ADPS  + + +PP+  +N 
Sbjct  126  EEDGNT---ANGGGQGQLSGSGGSPPTAVSNGNNQSQQGLAADPSTLLLYNLPPSFHVNG  182

Query  249  IQLPNDQGFWATGRPPF  199
                 D   W   RPPF
Sbjct  183  THTNQDAHAWTHVRPPF  199



>ref|XP_006420137.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
 gb|ESR33377.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
Length=276

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 138/195 (71%), Gaps = 5/195 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  84   MEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  143

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP P+P  ++GLT+YLAGGQGQVVGGSVVG L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  144  GAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQLVAAGPVMVIAATFANATYERLPLED  203

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP-SMFHGMPPNLL-NSIQ  244
            DE   +    G    +           Q           L DP S+ + +PPNL+ N  Q
Sbjct  204  DE--EVTGTQGQIQSTGAAANNNNSPPQIGSSGQPSSAGLPDPSSLTYNLPPNLIPNGGQ  261

Query  243  LPNDQGFWATGRPPF  199
            L ++   WA  RPP+
Sbjct  262  L-HEAYAWAHARPPY  275



>ref|XP_010102152.1| hypothetical protein L484_021386 [Morus notabilis]
 gb|EXB92402.1| hypothetical protein L484_021386 [Morus notabilis]
Length=267

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 128/191 (67%), Gaps = 21/191 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQP S GA+VTLHGRFEILSL 
Sbjct  93   MEVSSGCDVSESLANFARRKQRGICILSGSGCVTNVTLRQPTSSGAIVTLHGRFEILSLL  152

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGGSVVG L+ASGPV++MAASF NA ++RLPLDE
Sbjct  153  GSVLPPPAPPGITGLTIYLAGAQGQVVGGSVVGTLVASGPVVIMAASFMNATFDRLPLDE  212

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE  A                       Q Q     +    D S  +GMP NLL +  +P
Sbjct  213  DEVTA---------------------ALQNQHYQNARHHPLDVSDLYGMPHNLLTNGNMP  251

Query  237  NDQGFWATGRP  205
             +   WA+ RP
Sbjct  252  PEMYSWASCRP  262



>ref|XP_011086333.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=279

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ E+V+ +AR+RQRG+C++SGTGTVNNV+LRQPA+ G+VVTLHGRFEILSLS
Sbjct  92   LEVSSGCDVFEAVATYARKRQRGICVLSGTGTVNNVSLRQPAAAGSVVTLHGRFEILSLS  151

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGG+VVGAL+ASGPV+++AASF+N AYERLPLDE
Sbjct  152  GSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIIIAASFTNVAYERLPLDE  211

Query  417  DE  412
            +E
Sbjct  212  EE  213



>emb|CBI35166.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 137/197 (70%), Gaps = 24/197 (12%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            ME+A+G DI ES++ FARRRQRGVC++S +GTV NVTLRQP++P GAV+ LHGRFEILSL
Sbjct  99   MEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVTLRQPSAPGGAVMALHGRFEILSL  158

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            +G+FLP PAP  ++GLTIYLAGGQ QVVGGSVVG+L+A+GPV+V+AA+FSNA YERLPL+
Sbjct  159  TGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLE  218

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NS  250
            ++E                          Q+Q        +ADPS    + +PPNLL N 
Sbjct  219  DEE--------------------EAGSAAQEQLAGGGGGGMADPSSMPVYNLPPNLLPNG  258

Query  249  IQLPNDQGFWATGRPPF  199
             QL +D   WA GR P+
Sbjct  259  GQLNHDAYGWAHGRQPY  275



>ref|XP_011093448.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=281

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+  GCD+ E+V+ +AR+RQRG+C++SGTGTVNNV+LRQPA+ G+VVTLHGRFEILSLS
Sbjct  98   LEVGSGCDVFEAVATYARKRQRGICVLSGTGTVNNVSLRQPAAAGSVVTLHGRFEILSLS  157

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGG+V+GAL+ASGPV+++AASF+N AYERLPLDE
Sbjct  158  GSFLPPPAPPGATSLTIYLAGGQGQVVGGNVMGALIASGPVIIIAASFTNVAYERLPLDE  217

Query  417  DEG  409
            ++G
Sbjct  218  EDG  220



>gb|EYU18229.1| hypothetical protein MIMGU_mgv1a020284mg [Erythranthe guttata]
Length=240

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 128/195 (66%), Gaps = 9/195 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+  GCD+ ES++ FARR+QRG+C++S TG V NVTLRQP+S G+VVTLHGRFEILSL 
Sbjct  55   MEVTSGCDVGESLTTFARRKQRGICVLSATGCVTNVTLRQPSSAGSVVTLHGRFEILSLL  114

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GL +YLAG QGQVVGGSVVG L+ASGPV++MAA+F NA ++RLPLDE
Sbjct  115  GSILPPPAPPGVAGLAVYLAGAQGQVVGGSVVGPLVASGPVVIMAATFMNATFDRLPLDE  174

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            D+G    L         G      +++               P   +G+P NLL +  L 
Sbjct  175  DDGGDEMLAAAVSGGGGGQQYQNNRRRHHVDHV---------PDHVYGIPQNLLANGTLG  225

Query  237  NDQGFWATGRPPF*P  193
             D   WA+GR P  P
Sbjct  226  TDGYTWASGRAPSKP  240



>ref|XP_009762421.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=272

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI +GCD+ E VS +ARRRQRG+CI+SG+GTV NVT+RQPA+ G+VVTLHGRFEILSLS
Sbjct  93   LEIGNGCDVFECVSTYARRRQRGICILSGSGTVTNVTIRQPAAAGSVVTLHGRFEILSLS  152

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L+ASGPV+V+A+SF+N AYERLPL+E
Sbjct  153  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELIASGPVIVIASSFTNVAYERLPLEE  212

Query  417  DEGN  406
            DEG+
Sbjct  213  DEGS  216



>ref|XP_002314642.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
 gb|EEF00813.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
Length=289

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 137/197 (70%), Gaps = 26/197 (13%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  115  MEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  174

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  175  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLED  234

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP-SMFHGMPPNLLNS--I  247
            DE                      +          QQ  L DP SM   +PPNL+ S   
Sbjct  235  DE----------------------EAGSGAIGSSGQQAGLPDPSSMPVYLPPNLMQSGAQ  272

Query  246  QLPNDQGFWA-TGRPPF  199
            QL +D   WA   RPP+
Sbjct  273  QLGHDAYAWAHAARPPY  289



>gb|KFK31952.1| hypothetical protein AALP_AA6G181300 [Arabis alpina]
Length=335

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 149/199 (75%), Gaps = 13/199 (7%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            MEI DGCDI++ ++ FARRRQRGVC+MSGTG V NVT+RQP S PG+VV+LHGRFEILSL
Sbjct  144  MEIGDGCDIVDCMATFARRRQRGVCVMSGTGNVTNVTIRQPGSPPGSVVSLHGRFEILSL  203

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP AA+GL++YLAGGQGQVVGGSVVG LL SGPV+VMAASFSNAAYERLPL+
Sbjct  204  SGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLE  263

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSI--  247
            EDE           +   GG GGGG       P   QQQ +A  +   G+PPNLL S+  
Sbjct  264  EDE-------MQTPVHGGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQL  316

Query  246  ---QLPNDQGFWATGRPPF  199
               Q  NDQ +W+TGRPP+
Sbjct  317  PPPQQQNDQPYWSTGRPPY  335



>ref|XP_004302076.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=306

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+G DI ESV+ FAR RQRGVC+MSG+GTV NVTLRQP++PGAV+ LHGRFEILSL+
Sbjct  116  MEIANGADIAESVAQFARARQRGVCVMSGSGTVTNVTLRQPSAPGAVMALHGRFEILSLT  175

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  A+G+TIYLAGGQGQVVGGSVVG L+ASGPV+V+AA+FSNA YERLPLD+
Sbjct  176  GAFLPGPAPPGATGMTIYLAGGQGQVVGGSVVGPLVASGPVMVIAATFSNATYERLPLDQ  235

Query  417  DEGNALP  397
            +E +  P
Sbjct  236  EEDDQPP  242



>emb|CAN61523.1| hypothetical protein VITISV_016751 [Vitis vinifera]
Length=259

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 146/199 (73%), Gaps = 12/199 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            ME+A+G DI ES++ FARRRQRGVC++S +GTV NVTLRQP++P GAV+ LHGRFEILSL
Sbjct  67   MEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVTLRQPSAPGGAVMALHGRFEILSL  126

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            +G+FLP PAP  ++GLTIYLAGGQ QVVGGSVVG+L+A+GPV+V+AA+FSNA YERLPL+
Sbjct  127  TGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLE  186

Query  420  EDE--GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-  256
            ++E  G+A            GG GGGG          QQQ  +ADPS    + +PPNLL 
Sbjct  187  DEEEAGSA------AQEQLAGGGGGGGSPPGIGGSGGQQQAGMADPSSMPVYNLPPNLLP  240

Query  255  NSIQLPNDQGFWATGRPPF  199
            N  QL +D   WA GR P+
Sbjct  241  NGGQLNHDAYGWAHGRQPY  259



>ref|XP_008668970.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
Length=309

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            +E+A GCD+ ESVS +ARRRQRGVC++SG+G V NVTLRQP++P GAVVTLHGRFEILSL
Sbjct  116  LEVASGCDVFESVSTYARRRQRGVCVLSGSGVVTNVTLRQPSAPAGAVVTLHGRFEILSL  175

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP  A+ LTI+LAGGQGQVVGG+VVGAL A+GPV+V+AASF+N AYERLPL+
Sbjct  176  SGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLE  235

Query  420  EDEGNALP  397
            E+E  A P
Sbjct  236  EEEAQAAP  243



>gb|EYU40290.1| hypothetical protein MIMGU_mgv1a019526mg [Erythranthe guttata]
Length=292

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+  GCD+ E+V+ +AR+RQRG+CI+SGTGTV NV+LRQPA+ G+VVTLHGRFEILSLS
Sbjct  103  LEVGSGCDVFEAVATYARKRQRGICILSGTGTVTNVSLRQPAAAGSVVTLHGRFEILSLS  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGG+VVGAL+A+GPV+++AASF+N AYERLPLDE
Sbjct  163  GSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALIAAGPVIIIAASFTNVAYERLPLDE  222

Query  417  DEG  409
            +EG
Sbjct  223  EEG  225



>ref|XP_006487869.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO35907.1| hypothetical protein CISIN_1g022331mg [Citrus sinensis]
Length=299

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+G D+ E+++ FARRRQRGVC++SG+GTV NVTLRQP+ P AV+ +HGRFEILSL+
Sbjct  106  MEIANGADVAETLANFARRRQRGVCVLSGSGTVTNVTLRQPSDPSAVMAIHGRFEILSLT  165

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+AA+FSNA YERLPLDE
Sbjct  166  GAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLDE  225

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS---MFHGMPPNLL-NS  250
            +E       G  G    GG GG G               + DPS   +++ +PPNL+ N 
Sbjct  226  EEEGGA---GAQGPLGGGGGGGSGSSGGGGGGAGGGGGGIGDPSGMGVYNNLPPNLVANG  282

Query  249  IQLPNDQGFWATGRPPF  199
             QL ++   WA GRP F
Sbjct  283  GQLSHEAYGWAHGRPAF  299



>ref|XP_002271606.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=291

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 146/199 (73%), Gaps = 12/199 (6%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            ME+A+G DI ES++ FARRRQRGVC++S +GTV NVTLRQP++P GAV+ LHGRFEILSL
Sbjct  99   MEVANGSDITESIAQFARRRQRGVCVLSASGTVMNVTLRQPSAPGGAVMALHGRFEILSL  158

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            +G+FLP PAP  ++GLTIYLAGGQ QVVGGSVVG+L+A+GPV+V+AA+FSNA YERLPL+
Sbjct  159  TGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLE  218

Query  420  EDE--GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-  256
            ++E  G+A            GG GGGG          QQQ  +ADPS    + +PPNLL 
Sbjct  219  DEEEAGSA------AQEQLAGGGGGGGSPPGIGGSGGQQQAGMADPSSMPVYNLPPNLLP  272

Query  255  NSIQLPNDQGFWATGRPPF  199
            N  QL +D   WA GR P+
Sbjct  273  NGGQLNHDAYGWAHGRQPY  291



>gb|ACU24276.1| unknown [Glycine max]
Length=254

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ESV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  88   LEVSTGCDVFESVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  147

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LT++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  148  GSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  207

Query  417  DE  412
            DE
Sbjct  208  DE  209



>ref|XP_004296621.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=277

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 142/196 (72%), Gaps = 5/196 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSLS
Sbjct  84   MEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLS  143

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL+E
Sbjct  144  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVVAATFANATYERLPLEE  203

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLL-NSI  247
            D+  A    GGG   S     G G     Q  PP     L DPS    +G+PPNL+ N  
Sbjct  204  DDEAA--SVGGGHGASGSSPTGVGSSGGPQVLPPGHGGQLPDPSSLPLYGLPPNLIPNGG  261

Query  246  QLPNDQGFWATGRPPF  199
             L +D   W   R P+
Sbjct  262  PLGHDAYPWPHSRAPY  277



>ref|XP_006477506.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 ref|XP_006489611.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
Length=350

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 138/195 (71%), Gaps = 5/195 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  158  MEVAGGADVAESVALFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  217

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP P+P  ++GLT+YLAGGQGQVVGGSVVG L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  218  GAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQLVAAGPVMVIAATFANATYERLPLED  277

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADP-SMFHGMPPNLL-NSIQ  244
            DE   +    G    +           Q           L DP S+ + +PPNL+ N  Q
Sbjct  278  DE--EVTGTQGQIQSTGAATNNNNSPPQIGSSGQPPSAGLPDPSSLTYNLPPNLIPNGGQ  335

Query  243  LPNDQGFWATGRPPF  199
            L ++   WA  RPP+
Sbjct  336  L-HEAYAWAHARPPY  349



>tpg|DAA36260.1| TPA: hypothetical protein ZEAMMB73_652841 [Zea mays]
Length=347

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            +E+A GCD+ ESVS +ARRRQRGVC++SG+G V NVTLRQP++P GAVVTLHGRFEILSL
Sbjct  116  LEVASGCDVFESVSTYARRRQRGVCVLSGSGVVTNVTLRQPSAPAGAVVTLHGRFEILSL  175

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP  A+ LTI+LAGGQGQVVGG+VVGAL A+GPV+V+AASF+N AYERLPL+
Sbjct  176  SGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLE  235

Query  420  EDEGNALP  397
            E+E  A P
Sbjct  236  EEEAQAAP  243



>ref|XP_009616004.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=269

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI +GCD+ E VS +ARRRQRG+CI+SG+GTV NV++RQPA+ G+VVTLHGRFEILSLS
Sbjct  92   LEIGNGCDVFECVSTYARRRQRGICILSGSGTVTNVSIRQPAAAGSVVTLHGRFEILSLS  151

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L+ASGPV+V+A+SF+N AYERLPL+E
Sbjct  152  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELIASGPVIVIASSFTNVAYERLPLEE  211

Query  417  DEGN  406
            DEG+
Sbjct  212  DEGS  215



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI  G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  123  MEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  182

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQV+GGSVVG L+A+GPV+V+AA+F+NA YERLPLDE
Sbjct  183  GTFLPGPAPPGSTGLTVYLAGGQGQVLGGSVVGPLVATGPVMVIAATFANATYERLPLDE  242

Query  417  DE  412
            D+
Sbjct  243  DD  244



>ref|XP_010274873.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Nelumbo 
nucifera]
Length=352

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 138/196 (70%), Gaps = 9/196 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA G D+ + V+ FARRRQRGVC++SG+G V N+TLRQPA+PGAVV LHGRFEILSL+
Sbjct  163  MEIAGGADVADCVAQFARRRQRGVCVLSGSGAVANITLRQPAAPGAVVALHGRFEILSLT  222

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG L+A+GPV+V+AA+F+ A +ERLPLDE
Sbjct  223  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIAAGPVMVIAATFATATFERLPLDE  282

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLL-NSI  247
            +E      + G G       G G           QQQ  L DPS      +PPNLL N+ 
Sbjct  283  EE------EAGSGGQGQLPGGAGSSPPAIGSSSGQQQPGLPDPSSLPVFNLPPNLLPNAG  336

Query  246  QLPNDQGFWATGRPPF  199
            QL +D   WA  RPPF
Sbjct  337  QLNHDAFAWAHARPPF  352



>ref|XP_011030530.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=289

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  101  MEIAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  160

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL++
Sbjct  161  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLED  220

Query  417  DE  412
            DE
Sbjct  221  DE  222



>ref|XP_004974243.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Setaria italica]
 ref|XP_004974244.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Setaria italica]
 ref|XP_004974245.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Setaria italica]
 ref|XP_004974246.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X4 [Setaria italica]
Length=260

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 134/203 (66%), Gaps = 25/203 (12%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ES++ FARRRQRGVC++SG GTV +V LRQPA+PGAVV L GRFEILSL+
Sbjct  70   MEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVALRQPAAPGAVVALRGRFEILSLT  129

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG L A+GPV+V+A++F+NA YERLPLDE
Sbjct  130  GTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTAAGPVMVIASTFANATYERLPLDE  189

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS---MFHGMPPNLL---  256
             E  +               G   Q        P     +ADPS   MF G+PPNL+   
Sbjct  190  AEEES--------------AGQAAQLPPGPGGGPPLMGGMADPSAMPMFGGVPPNLMPGG  235

Query  255  -----NSIQLPNDQGFWATGRPP  202
                   +QL +D   WA  RPP
Sbjct  236  GGASGAGLQLGHDGLAWAHARPP  258



>ref|XP_006442718.1| hypothetical protein CICLE_v10023369mg [Citrus clementina]
 gb|ESR55958.1| hypothetical protein CICLE_v10023369mg [Citrus clementina]
Length=299

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEIA+G D+ E+++ FARRRQRGVC++SG+GTV NVTLRQP+ P A++ +HGRFEILSL+
Sbjct  106  MEIANGADVAETLANFARRRQRGVCVLSGSGTVTNVTLRQPSDPSAIMAIHGRFEILSLT  165

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+AA+FSNA YERLPLDE
Sbjct  166  GAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLDE  225

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS---MFHGMPPNLL-NS  250
            +E       G  G    GG GG G               + DPS   +++ +PPNL+ N 
Sbjct  226  EEEGGA---GAQGPLGGGGGGGSGSSGGGGGGAGGGGGGIGDPSGMGVYNNLPPNLVANG  282

Query  249  IQLPNDQGFWATGRPPF  199
             QL ++   WA GRP F
Sbjct  283  GQLSHEAYGWAHGRPAF  299



>emb|CDP13007.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCDI + VS++ARRRQRG+CI+SG+GTV NV+LRQPA+ G++VTLHGRFEILSLS
Sbjct  108  LEVGNGCDIFDCVSSYARRRQRGICILSGSGTVTNVSLRQPAAAGSIVTLHGRFEILSLS  167

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A+GPV+V+AASF+N AYERLPLDE
Sbjct  168  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDE  227

Query  417  DE  412
            DE
Sbjct  228  DE  229



>ref|XP_009379018.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=288

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSLS
Sbjct  85   MEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLS  144

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL+E
Sbjct  145  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVVAATFANATYERLPLEE  204

Query  417  DE  412
            DE
Sbjct  205  DE  206



>ref|XP_009377422.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=245

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  90   MEVSSGCDVSESLTHFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  149

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  150  GSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  209

Query  417  DE  412
            DE
Sbjct  210  DE  211



>ref|XP_003534486.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Glycine max]
 ref|XP_006587787.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Glycine max]
 ref|XP_006587788.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Glycine max]
Length=270

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ESV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  88   LEVSTGCDVFESVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  147

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LT++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  148  GSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  207

Query  417  DE  412
            DE
Sbjct  208  DE  209



>ref|XP_004976643.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=310

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            +E+  GCD+ ESVS +ARRRQRGVC++SG+G V NVTLRQP++P GAVVTLHGRFEILSL
Sbjct  118  LEVGSGCDVFESVSTYARRRQRGVCVLSGSGVVTNVTLRQPSAPTGAVVTLHGRFEILSL  177

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP  A+ LTI+LAGGQGQVVGG+VVGAL A+GPV+V+AASF+N AYERLPL+
Sbjct  178  SGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLE  237

Query  420  EDEGNALP  397
            E+E  A P
Sbjct  238  EEEAQAAP  245



>ref|XP_010026866.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Eucalyptus 
grandis]
Length=303

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 139/197 (71%), Gaps = 7/197 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ E ++ FARRRQRGVC++SG+GTV NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  110  MEVASGADVAECLAQFARRRQRGVCVLSGSGTVANVTLRQPAAPGAVVALHGRFEILSLT  169

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP P+P  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+ A+F+NA YERLPLDE
Sbjct  170  GTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIGATFANATYERLPLDE  229

Query  417  DE-GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPS--MFHGMPPNL-LNS  250
            +E GN      GGG     G GG             QQ + ADPS  + + +PP+  +N 
Sbjct  230  EEDGNT---ANGGGQGQLSGSGGSPPTAVSNGNNQSQQGLAADPSTLLLYNLPPSFHVNG  286

Query  249  IQLPNDQGFWATGRPPF  199
                 D   W   RPPF
Sbjct  287  THTNQDAHAWTHVRPPF  303



>ref|XP_003539199.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+A+GCD+ ESV+++ARRRQRG+CI+SG+GTV NV+LRQPAS GAVVTLHGRFEILSL+
Sbjct  80   LEVANGCDVFESVASYARRRQRGICILSGSGTVTNVSLRQPASAGAVVTLHGRFEILSLT  139

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL  424
            GSFLPPPAP  A+ L+IYLAGGQGQVVGGSVVG L+A+GPV+VMAASF+N AYERLPL
Sbjct  140  GSFLPPPAPPGATSLSIYLAGGQGQVVGGSVVGELIAAGPVIVMAASFTNVAYERLPL  197



>ref|XP_002448423.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
 gb|EES12751.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
Length=312

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASP-GAVVTLHGRFEIlsl  601
            +E+  GCD+ ESVS +ARRRQRGVC++SG+G V NVTLRQP++P GAVVTLHGRFEILSL
Sbjct  119  LEVGSGCDVFESVSTYARRRQRGVCVLSGSGVVTNVTLRQPSAPTGAVVTLHGRFEILSL  178

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SGSFLPPPAP  A+ LTI+LAGGQGQVVGG+VVGAL A+GPV+V+AASF+N AYERLPL+
Sbjct  179  SGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLE  238

Query  420  EDEGNALP  397
            E+E  A P
Sbjct  239  EEEAQAAP  246



>gb|KDO60958.1| hypothetical protein CISIN_1g040216mg [Citrus sinensis]
Length=265

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 129/192 (67%), Gaps = 22/192 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPA+ G++VTLHGRFEILSL 
Sbjct  91   MEVSSGCDVSESLANFARRKQRGICILSGSGCVTNVTLRQPATSGSIVTLHGRFEILSLL  150

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLD+
Sbjct  151  GSILPPPAPPGITGLTIYLAGAQGQVVGGVVVGALIASGPVVIMAASFMNATFDRLPLDD  210

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPP-NLLNSIQL  241
            DE                          Q Q     +    D S  HG+PP NLL +  +
Sbjct  211  DE---------------------LAAAMQNQHYQNSRHHHLDISDLHGLPPQNLLTNGTM  249

Query  240  PNDQGFWATGRP  205
            P +   WA G+P
Sbjct  250  PPEIYAWAPGKP  261



>emb|CDY18931.1| BnaC04g04190D [Brassica napus]
Length=309

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 8/199 (4%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRGVC++SG G V NVT+RQPAS PG   +VV LHGRFEI
Sbjct  113  MEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVTIRQPASVPGGGSSVVNLHGRFEI  172

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  173  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  232

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLLN  253
            PL+E++        G  +++    G G      Q   PQQQQ++ DP+ F  G+ PNL++
Sbjct  233  PLEEEDQEEQ-QTSGAVVNNNNIDGNGTMGGGTQTQQPQQQQLMQDPTSFIQGLQPNLMS  291

Query  252  S-IQLPNDQGFWATGRPPF  199
            S +QLP  + +W T RP F
Sbjct  292  SSVQLPG-EAYWGTPRPSF  309



>ref|XP_009394683.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 141/200 (71%), Gaps = 23/200 (12%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G DI ES++ FARR+QRGVC++SG+GTV NVTLRQPASPGAVV LHGRFEILSL+
Sbjct  83   MEVAGGADIAESIAHFARRKQRGVCVLSGSGTVANVTLRQPASPGAVVALHGRFEILSLT  142

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP P+P   +GLT+YLAGGQGQVVGGSVVG+L+A+G V+V+A++F+NA YERLPL+E
Sbjct  143  GTFLPGPSPPGTTGLTVYLAGGQGQVVGGSVVGSLIAAGTVMVLASTFANATYERLPLEE  202

Query  417  DE---GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF--HGMPPNLLN  253
             E   G  LP+Q  GG+ S     GG                L DPS    + +PPNL +
Sbjct  203  AEESVGGGLPVQLHGGVASLMPGAGG----------------LPDPSALPIYNLPPNLAH  246

Query  252  S--IQLPNDQGFWATGRPPF  199
            +   Q+ +D   WA  R PF
Sbjct  247  NGGGQMGHDAFEWAHARAPF  266



>ref|XP_006366237.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=265

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI +GCD+ E VS +ARRRQRG+CI+SG+GTV NV++RQPA+ G+VVTLHGRFEILSLS
Sbjct  90   LEIGNGCDVFECVSTYARRRQRGICILSGSGTVTNVSIRQPAAAGSVVTLHGRFEILSLS  149

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI++AGGQGQVVGGSVVG L+ASGPV+V+A+SF+N AYERLPL+E
Sbjct  150  GSFLPPPAPPGATSLTIFVAGGQGQVVGGSVVGELIASGPVIVIASSFTNVAYERLPLEE  209

Query  417  DEG  409
            DEG
Sbjct  210  DEG  212



>ref|XP_008342359.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=245

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ E+++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  90   MEVSSGCDVSETLTHFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  149

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  150  GSILPPPAPPGITGLTIYLAGPQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  209

Query  417  DE  412
            DE
Sbjct  210  DE  211



>ref|XP_008362336.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=245

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ E+++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  90   MEVSSGCDVSETLTHFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  149

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  150  GSILPPPAPPGITGLTIYLAGPQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  209

Query  417  DE  412
            DE
Sbjct  210  DE  211



>ref|XP_002527105.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF35268.1| DNA binding protein, putative [Ricinus communis]
Length=279

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARRRQRG+C++SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  92   MEVSSGCDVSESLANFARRRQRGICVLSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  151

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  152  GSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  211

Query  417  DE  412
            DE
Sbjct  212  DE  213



>gb|KHN30735.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=290

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 134/195 (69%), Gaps = 6/195 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI  G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQP++PGAVV LHGRFEILSL+
Sbjct  100  MEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPSAPGAVVALHGRFEILSLT  159

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPLDE
Sbjct  160  GTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLDE  219

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLLNSIQ  244
            D+               GG               Q Q  + DPS    + +PPN     Q
Sbjct  220  DDEGP----SSMVGAQGGGGSPPLPLGIGSSGGGQLQGGIPDPSSLPLYNLPPNGGGGGQ  275

Query  243  LPNDQGFWATGRPPF  199
            + ++   WA GR PF
Sbjct  276  VGHEALAWAHGRAPF  290



>ref|XP_008353637.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=245

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ E+++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  90   MEVSSGCDVSETLTHFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  149

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  150  GSILPPPAPPGITGLTIYLAGPQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  209

Query  417  DE  412
            DE
Sbjct  210  DE  211



>ref|XP_006588553.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=230

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQP++PGAVV LHGRFEILSL+
Sbjct  73   MEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPSAPGAVVALHGRFEILSLT  132

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  A+GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL+E
Sbjct  133  GAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLEE  192

Query  417  DE  412
            +E
Sbjct  193  EE  194



>gb|KHN01050.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=295

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+  G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQP++PGAVV LHGRFEILSL+
Sbjct  106  MEVTGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPSAPGAVVALHGRFEILSLT  165

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YL GGQGQ+VGGSVVG+L+A+GPV+V+AA+F+NA YERLPLDE
Sbjct  166  GTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSLVAAGPVMVIAATFANATYERLPLDE  225

Query  417  DE  412
            D+
Sbjct  226  DD  227



>ref|XP_006589299.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Glycine max]
Length=316

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 134/195 (69%), Gaps = 6/195 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI  G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQP++PGAVV LHGRFEILSL+
Sbjct  126  MEITGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPSAPGAVVALHGRFEILSLT  185

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPLDE
Sbjct  186  GTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLDE  245

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLLNSIQ  244
            D+               GG               Q Q  + DPS    + +PPN     Q
Sbjct  246  DDEGP----SSMVGAQGGGGSPPLPLGIGSSGGGQLQGGIPDPSSLPLYNLPPNGGGGGQ  301

Query  243  LPNDQGFWATGRPPF  199
            + ++   WA GR PF
Sbjct  302  VGHEALAWAHGRAPF  316



>ref|XP_007048865.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOX93022.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=257

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 128/191 (67%), Gaps = 23/191 (12%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ES++ FARR+QRG+C++SG+G V NVTLRQPAS GA+VTLHGR+EILSL 
Sbjct  84   LEVSSGCDVNESLANFARRKQRGICVLSGSGCVTNVTLRQPASSGAIVTLHGRYEILSLL  143

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPVLVMAASF NA ++RLPLD+
Sbjct  144  GSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVLVMAASFMNATFDRLPLDD  203

Query  417  DE-GNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQL  241
            DE   A+P Q                                D S  +GMP NL+ +  +
Sbjct  204  DEVAAAMPNQYHQNARHHHL----------------------DISDLYGMPQNLITNGTM  241

Query  240  PNDQGFWATGR  208
            P +   WA GR
Sbjct  242  PPEIYSWAPGR  252



>ref|XP_002519826.1| ESC, putative [Ricinus communis]
 gb|EEF42430.1| ESC, putative [Ricinus communis]
Length=289

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ E +S +ARRRQRG+CI+SG GTV NV++RQPA+ GAVVTLHGRFEILSLS
Sbjct  105  LEVGNGCDVFECISNYARRRQRGICILSGAGTVTNVSIRQPAAAGAVVTLHGRFEILSLS  164

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A+GPV+V+AASF+N AYERLPLDE
Sbjct  165  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDE  224

Query  417  DE  412
            DE
Sbjct  225  DE  226



>ref|XP_010104063.1| hypothetical protein L484_008144 [Morus notabilis]
 gb|EXB98164.1| hypothetical protein L484_008144 [Morus notabilis]
Length=340

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQP++PGAVV LHGRFEILSL+
Sbjct  147  MEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPSAPGAVVALHGRFEILSLT  206

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLAGGQGQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPLD+
Sbjct  207  GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIAATFANATYERLPLDD  266

Query  417  DE  412
            DE
Sbjct  267  DE  268



>ref|XP_006437176.1| hypothetical protein CICLE_v10032444mg [Citrus clementina]
 ref|XP_006484853.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR50416.1| hypothetical protein CICLE_v10032444mg [Citrus clementina]
Length=265

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 129/192 (67%), Gaps = 22/192 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPA+ G++VTLHGRFEILSL 
Sbjct  91   MEVSSGCDVSESLANFARRKQRGMCILSGSGCVTNVTLRQPATSGSIVTLHGRFEILSLL  150

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLD+
Sbjct  151  GSILPPPAPPGITGLTIYLAGAQGQVVGGVVVGALIASGPVVIMAASFMNATFDRLPLDD  210

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPP-NLLNSIQL  241
            DE                          Q Q     +    D S  HG+PP NLL +  +
Sbjct  211  DE---------------------LAAAMQNQHYQNSRHHHLDISDLHGLPPQNLLTNGTM  249

Query  240  PNDQGFWATGRP  205
            P +   WA G+P
Sbjct  250  PPEIYAWAPGKP  261



>ref|XP_003552472.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=268

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ESV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  88   LEVSSGCDVFESVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  147

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LT++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  148  GSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  207

Query  417  DE  412
            +E
Sbjct  208  EE  209



>gb|ACU24278.1| unknown [Glycine max]
Length=268

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ESV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  88   LEVSSGCDVFESVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  147

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LT++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  148  GSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  207

Query  417  DE  412
            +E
Sbjct  208  EE  209



>gb|KDP46909.1| hypothetical protein JCGZ_10400 [Jatropha curcas]
Length=254

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 127/190 (67%), Gaps = 17/190 (9%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES+  FARR+QRG+C++SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  77   MEVSSGCDVSESLLNFARRKQRGICVLSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  136

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV++MAASF NA ++RLPLDE
Sbjct  137  GSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVVIMAASFMNATFDRLPLDE  196

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE  A                   Q Q  Q           D S  +G+P NLL +  +P
Sbjct  197  DEIAA-----------------AVQNQHYQNGRHNHHHHHLDISDLYGVPQNLLTNGSVP  239

Query  237  NDQGFWATGR  208
             +   WA GR
Sbjct  240  PEIYSWAPGR  249



>ref|XP_010257112.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=395

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 15/195 (8%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +EI+ G D+ ES++ FARRRQRGVC++SG+G V NVTLRQPA+PGAVV+LHGRFEILSLS
Sbjct  211  LEISSGSDVAESIATFARRRQRGVCVLSGSGIVTNVTLRQPAAPGAVVSLHGRFEILSLS  270

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPL-D  421
            G+FLP P+P  A+GLT+YL+GGQGQVVGGSVVGAL+ASGPV+V+AA+F+NA YERLP+ D
Sbjct  271  GAFLPAPSPPGATGLTVYLSGGQGQVVGGSVVGALVASGPVMVIAATFTNATYERLPIED  330

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM--FHGMPPNLLNSI  247
            E  G  + L               G           Q   L D S    + +PPNLL + 
Sbjct  331  EPAGEGIQL-----------QQSSGVNSGSTGISASQPHTLPDSSSMPIYNLPPNLLPNG  379

Query  246  QLPNDQGFWATGRPP  202
            Q+P+D  FWA   PP
Sbjct  380  QMPHDV-FWAPRPPP  393



>ref|XP_008391057.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=281

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRG+CI+SG+G+V NVTLRQPA+PGAVV LHGRFEILSLS
Sbjct  84   MEVASGTDVAESVAQFARRRQRGMCILSGSGSVANVTLRQPAAPGAVVXLHGRFEILSLS  143

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP   +GLT+YLAGGQGQVVGGSV+G+L+A+GPV+V AA+F+NA YERLPL+E
Sbjct  144  GAFLPGPAPPGFTGLTVYLAGGQGQVVGGSVMGSLVAAGPVMVXAATFANATYERLPLEE  203

Query  417  DE  412
            DE
Sbjct  204  DE  205



>ref|XP_002279677.2| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=268

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 126/191 (66%), Gaps = 23/191 (12%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  95   MEVSSGCDVSESLANFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  154

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQVVGG VVGAL+ASGPV VMAASF NA ++RLPLD+
Sbjct  155  GSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALIASGPVFVMAASFMNATFDRLPLDD  214

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLL-NSIQL  241
            DE                          Q Q     +    D S  +G+PPNLL N   L
Sbjct  215  DE---------------------VTTAVQSQHYQNGRHHHIDMSDLYGIPPNLLTNGTML  253

Query  240  PNDQGFWATGR  208
            P     WA GR
Sbjct  254  PEIYS-WAPGR  263



>ref|XP_004249915.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=294

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 142/198 (72%), Gaps = 5/198 (3%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A+G D+ ES++ FAR+RQRGVC++S TGTV NVTLRQP++PGAV+ LHGRFEILSL+
Sbjct  97   MEVANGADVAESIAQFARKRQRGVCVLSATGTVTNVTLRQPSAPGAVMALHGRFEILSLT  156

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLTIYLAGGQGQVVGGSVVG+L+ASGPV+V+A++FSNA YERLPL+E
Sbjct  157  GAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIASTFSNATYERLPLEE  216

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILAD-PSM---FHGMPPNLL-N  253
            +E    P   G      G   G G     QQ        + D PS     + +PPNLL N
Sbjct  217  EEEGGGPAAQGQLGGGGGSPPGMGGSGGGQQQQGGGGGGMGDIPSSNMPVYNLPPNLLPN  276

Query  252  SIQLPNDQGFWATGRPPF  199
              Q+ ++   WA GRPPF
Sbjct  277  GGQMNHEAFGWAHGRPPF  294



>ref|XP_009356620.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=263

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 128/190 (67%), Gaps = 21/190 (11%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME++ GCD+ ES++ FARR+QRG+CI+SG+G V NVTLRQPAS GA+VTLHGRFEILSL 
Sbjct  90   MEVSSGCDVSESLTNFARRKQRGICILSGSGCVTNVTLRQPASSGAIVTLHGRFEILSLL  149

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GS LPPPAP   +GLTIYLAG QGQV+GG VVGAL+ASGPV++MAASF N  ++RLPLDE
Sbjct  150  GSILPPPAPPGITGLTIYLAGAQGQVMGGGVVGALIASGPVVIMAASFMNVTFDRLPLDE  209

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            +E  A                       Q Q     +    D S  +G+P NL+ +  +P
Sbjct  210  EEVAA---------------------ALQNQQHQNGRHHHLDISDLYGLPQNLITNGNVP  248

Query  237  NDQGFWATGR  208
             +   WA+GR
Sbjct  249  PEVYSWASGR  258



>ref|XP_010269998.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=280

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+  GCD+ + V+ +ARRRQRG+CI+SG+GTV NV+LRQPA+ GA+VTLHGRFEILSLS
Sbjct  96   LEVGSGCDVFDCVATYARRRQRGICILSGSGTVTNVSLRQPAAAGAIVTLHGRFEILSLS  155

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGGSVVGAL+ASGPV+V+AASF+N AYERLPLDE
Sbjct  156  GSFLPPPAPPGATSLTIYLAGGQGQVVGGSVVGALIASGPVIVIAASFTNVAYERLPLDE  215

Query  417  DE  412
            +E
Sbjct  216  EE  217



>ref|XP_010097716.1| hypothetical protein L484_023857 [Morus notabilis]
 gb|EXB70671.1| hypothetical protein L484_023857 [Morus notabilis]
Length=308

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ +SV+A+AR+RQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  108  LEVSGGCDVFDSVAAYARKRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  167

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LT++LAGGQGQVVGG+VVGAL+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  168  GSFLPPPAPPGATSLTVFLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLDE  227

Query  417  DE  412
            +E
Sbjct  228  EE  229



>ref|XP_008224392.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=285

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV L GRFEILSLS
Sbjct  83   MEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALQGRFEILSLS  142

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLA G GQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL+E
Sbjct  143  GAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSLVAAGPVMVVAATFANATYERLPLEE  202

Query  417  DE  412
            DE
Sbjct  203  DE  204



>ref|XP_007226723.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
 gb|EMJ27922.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
Length=285

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQPA+PGAVV L GRFEILSLS
Sbjct  83   MEVAGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALQGRFEILSLS  142

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YLA G GQVVGGSVVG+L+A+GPV+V+AA+F+NA YERLPL+E
Sbjct  143  GAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSLVAAGPVMVVAATFANATYERLPLEE  202

Query  417  DE  412
            DE
Sbjct  203  DE  204



>ref|XP_008356452.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=290

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  103  LEVGNGCDVFDCVATYARRRQRGICILSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A+GPV+V+A+SF+N AYERLPLDE
Sbjct  163  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDE  222

Query  417  DE  412
            +E
Sbjct  223  EE  224



>emb|CDO99189.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+A G D+ ES++ FAR+RQRGVC++SG+G+V NVTLRQPA+PGAVV LHGRFEILSL+
Sbjct  111  MEVAGGSDVAESIAQFARKRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  170

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  A+GLT+YLAGGQGQVVGGSVVG+L+A+GPVLV+AA+F+NA YERLPL++
Sbjct  171  GAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSLVAAGPVLVIAATFANATYERLPLED  230

Query  417  DE  412
            DE
Sbjct  231  DE  232



>ref|XP_010469137.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=267

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 126/193 (65%), Gaps = 24/193 (12%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            MEI +GCD+MES++ FARRRQRGVC+++G G V NV +RQP   G VV+LHGR +ILSLS
Sbjct  96   MEITNGCDVMESLAVFARRRQRGVCVLTGNGAVTNVNVRQPG--GGVVSLHGRLDILSLS  153

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP AASGLT+YLAGGQGQVVGG+VVG L+ SGPV++MAASF N AYERLPL+E
Sbjct  154  GSFLPPPAPPAASGLTVYLAGGQGQVVGGNVVGPLMTSGPVVIMAASFGNTAYERLPLEE  213

Query  417  DEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMFHGMPPNLLNSIQLP  238
            DE    P +                                      G P NL+NS+ LP
Sbjct  214  DE--VEPQREIDANADRAVGTQTQ-------------------KQLMGSPSNLINSVSLP  252

Query  237  NDQGFWATGRPPF  199
             D+ +W T RP F
Sbjct  253  -DEAYWGTQRPCF  264



>ref|XP_009143141.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=308

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 148/199 (74%), Gaps = 9/199 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRGVC++SG G V NVT+RQPA+ PG   +VV LHGRFEI
Sbjct  113  MEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVTIRQPATVPGGGSSVVNLHGRFEI  172

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  173  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVMIMAASFGNAAYERL  232

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLL-  256
            PL+E++      Q  G + +      G           QQQQ++ DP+ F  G+ PNL+ 
Sbjct  233  PLEEEDQEE--QQTSGAVVNNNNNIDGNGTMGGGTQTQQQQQLMQDPTSFIQGLQPNLMS  290

Query  255  NSIQLPNDQGFWATGRPPF  199
            +S+QLP  + +W T RP F
Sbjct  291  SSVQLPG-EAYWGTPRPSF  308



>gb|KHN22151.1| Putative DNA-binding protein ESCAROLA, partial [Glycine soja]
Length=207

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ ESV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  88   LEVSTGCDVFESVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  147

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LT++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  148  GSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  207



>emb|CDX74739.1| BnaA05g04850D [Brassica napus]
Length=310

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PG---AVVTLHGRFEI  610
            ME+A+GCD+MESV+ FARRRQRGVC++SG G V NVT+RQPA+ PG   +VV LHGRFEI
Sbjct  116  MEVANGCDVMESVTVFARRRQRGVCVLSGNGAVTNVTIRQPATVPGGGSSVVNLHGRFEI  175

Query  609  lslsgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERL  430
            LSLSGSFLPPPAP AASGLTIYLAGGQGQVVGGSVVG L+ASGPV++MAASF NAAYERL
Sbjct  176  LSLSGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGPLMASGPVVIMAASFGNAAYERL  235

Query  429  PLDEDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSMF-HGMPPNLL-  256
            PL+E++          G         G           QQQQ++ DP+ F  G+ PNL+ 
Sbjct  236  PLEEEDQEEQ---QTSGAVVNNNNIDGNGTMGGGTQTQQQQQLMQDPTSFIQGLQPNLMS  292

Query  255  NSIQLPNDQGFWATGRPPF  199
            +S+QLP  + +W T RP F
Sbjct  293  SSVQLPG-EAYWGTPRPSF  310



>gb|AES80473.2| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=269

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ +SV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ G+VVTLHGRFEILSLS
Sbjct  89   LEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGSVVTLHGRFEILSLS  148

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ L+++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  149  GSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  208

Query  417  DE  412
            DE
Sbjct  209  DE  210



>gb|AFK38460.1| unknown [Medicago truncatula]
Length=269

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ +SV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ G+VVTLHGRFEILSLS
Sbjct  89   LEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGSVVTLHGRFEILSLS  148

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ L+++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  149  GSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  208

Query  417  DE  412
            DE
Sbjct  209  DE  210



>ref|XP_006436718.1| hypothetical protein CICLE_v10032253mg [Citrus clementina]
 ref|XP_006485575.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR49958.1| hypothetical protein CICLE_v10032253mg [Citrus clementina]
 gb|KDO40054.1| hypothetical protein CISIN_1g022380mg [Citrus sinensis]
Length=298

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NV++RQPA+ GA+VTLHGRFEILSLS
Sbjct  113  LEVGNGCDVFDCVANYARRRQRGICILSGSGTVTNVSIRQPAAAGAIVTLHGRFEILSLS  172

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A+GPV+V+AASF+N AYERLPLDE
Sbjct  173  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDE  232

Query  417  DE  412
            DE
Sbjct  233  DE  234



>ref|XP_008377132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=293

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  103  LEVGNGCDVFDCVATYARRRQRGICILSGSGTVTNVTLRQPAAVGAVVTLHGRFEILSLS  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L  +GPV+V+A+SF+N AYERLPLDE
Sbjct  163  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTTAGPVIVIASSFTNVAYERLPLDE  222

Query  417  DE  412
            +E
Sbjct  223  EE  224



>ref|XP_006606925.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=385

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            ME+  G D+ ESV+ FARRRQRGVC++SG+G+V NVTLRQP++PGAVV LHGRFEILSL+
Sbjct  196  MEVTGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPSAPGAVVALHGRFEILSLT  255

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            G+FLP PAP  ++GLT+YL GGQGQ+VGGSVVG+L+A+GPV+V+AA+F+NA YERLPLDE
Sbjct  256  GTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSLVAAGPVMVIAATFANATYERLPLDE  315

Query  417  DE  412
            D+
Sbjct  316  DD  317



>ref|XP_009347388.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  103  LEVGNGCDVFDCVATYARRRQRGICILSGSGTVTNVTLRQPAAVGAVVTLHGRFEILSLS  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A+GPV+V+A+SF+N AYERLPLDE
Sbjct  163  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDE  222

Query  417  DE  412
            +E
Sbjct  223  EE  224



>ref|XP_007039519.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24020.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=292

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NV++RQPA+ GA+VTLHGRFEILSLS
Sbjct  111  LEVGNGCDVFDCVANYARRRQRGICILSGSGTVTNVSIRQPAAAGAIVTLHGRFEILSLS  170

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L+A+GPV+V+AASF+N AYERLPLDE
Sbjct  171  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELMAAGPVIVIAASFTNVAYERLPLDE  230

Query  417  DE  412
            DE
Sbjct  231  DE  232



>ref|XP_010275243.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=285

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NV+LRQPA+ GA+VTLHGRFEILSLS
Sbjct  97   LEVGNGCDVFDCVATYARRRQRGICILSGSGTVTNVSLRQPAAAGAIVTLHGRFEILSLS  156

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVGAL+A+GPV+V+AASF+N AYERLPLDE
Sbjct  157  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGALIAAGPVIVIAASFTNVAYERLPLDE  216

Query  417  DE  412
            +E
Sbjct  217  EE  218



>ref|XP_009377073.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ + V+ +ARRRQRG+CI+SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  103  LEVGNGCDVFDCVATYARRRQRGICILSGSGTVTNVTLRQPAAVGAVVTLHGRFEILSLS  162

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A GPV+V+A+SF+N AYERLPLDE
Sbjct  163  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAVGPVIVIASSFTNVAYERLPLDE  222

Query  417  DE  412
            +E
Sbjct  223  EE  224



>ref|XP_003624255.1| AT-hook DNA-binding protein [Medicago truncatula]
Length=316

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E++ GCD+ +SV+ +AR+RQRG+C++SG+GTV NVTLRQPA+ G+VVTLHGRFEILSLS
Sbjct  136  LEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVTLRQPAAAGSVVTLHGRFEILSLS  195

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ L+++L GGQGQVVGG+VVG L+ASGPV+V+A+SF+N AYERLPLDE
Sbjct  196  GSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  255

Query  417  DE  412
            DE
Sbjct  256  DE  257



>ref|XP_008801621.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801622.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801623.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=320

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPAS-PGAVVTLHGRFEIlsl  601
            +EIA G DIM++V+ FARRRQRGV I+SG+G V NVTLRQPA+ PGAVVTLHGRFEILSL
Sbjct  122  LEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTLRQPAAPPGAVVTLHGRFEILSL  181

Query  600  sgsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLD  421
            SG+FLPPP+P  ASGLT+YLAGGQGQVVGGSVVG L+ASGPV+V+AA+F+NA YERLPL 
Sbjct  182  SGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVASGPVMVIAATFTNATYERLPLG  241

Query  420  EDEGNALPLqggggmdspggvggggqqqqqqqpppqqqQILADPSM---FHGMPPNLLNS  250
            ++E  A              +                  + ADP      + +PPNLL +
Sbjct  242  DEESEA---AAAPPGSEGMPLQQSPGGNGGSSSQQSHGGMGADPGSMPPLYNLPPNLLPN  298

Query  249  IQLPNDQ-GFWATG--RPP  202
             QLP+D  G WA+   RPP
Sbjct  299  GQLPHDVFGVWASTAPRPP  317



>ref|XP_006368407.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP64976.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+ +GCD+ E V+ +ARRRQRG+CI+SG GTV NV++RQPA+ GA+VTLHGRFEILSLS
Sbjct  113  LEVGNGCDVFECVANYARRRQRGICILSGAGTVTNVSIRQPAAAGAIVTLHGRFEILSLS  172

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTI+LAGGQGQVVGGSVVG L A+GPV+V+AASF+N AYERLPLDE
Sbjct  173  GSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDE  232

Query  417  DE  412
            D+
Sbjct  233  DD  234



>ref|XP_004509027.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=300

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  777  MEIADGCDIMESVSAFARRRQRGVCIMSGTGTVNNVTLRQPASPGAVVTLHGRFEIlsls  598
            +E+A G D+ E V+ +ARRRQRG+C++SG+GTV NVTLRQPA+ GAVVTLHGRFEILSLS
Sbjct  109  LEVASGSDVFECVTNYARRRQRGICVLSGSGTVTNVTLRQPAAAGAVVTLHGRFEILSLS  168

Query  597  gsflpppapaaasgLTIYlaggqgqvvggsvvgallasGPVLVMAASFSNAAYERLPLDE  418
            GSFLPPPAP  A+ LTIYLAGGQGQVVGGSVVG L A+GPV+V+AASF+N AYERLPL+E
Sbjct  169  GSFLPPPAPPGATSLTIYLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  228

Query  417  DE  412
            +E
Sbjct  229  EE  230



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1422033592588