BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30687_g1_i1 len=2095 path=[2073:0-2094]

Length=2095
                                                                      Score     E

ref|XP_009594617.1|  PREDICTED: methyltransferase-like protein 2 ...    565   0.0      
ref|XP_004238224.1|  PREDICTED: methyltransferase-like protein 2        564   0.0      
gb|EYU32804.1|  hypothetical protein MIMGU_mgv1a018718mg                562   0.0      
ref|XP_006367297.1|  PREDICTED: methyltransferase-like protein 2-...    561   0.0      
ref|XP_011074502.1|  PREDICTED: methyltransferase-like protein 2 ...    559   0.0      
ref|XP_009766187.1|  PREDICTED: methyltransferase-like protein 2        555   0.0      
ref|XP_011074499.1|  PREDICTED: methyltransferase-like protein 2 ...    550   0.0      
ref|XP_006367298.1|  PREDICTED: methyltransferase-like protein 2-...    549   0.0      
ref|XP_002281794.2|  PREDICTED: methyltransferase-like protein 2        543   0.0      Vitis vinifera
emb|CBI19648.3|  unnamed protein product                                541   0.0      
emb|CDP07562.1|  unnamed protein product                                523   1e-176   
ref|XP_008220758.1|  PREDICTED: methyltransferase-like protein 2        516   8e-174   
ref|XP_009334519.1|  PREDICTED: methyltransferase-like protein 2        513   8e-173   
ref|XP_010246995.1|  PREDICTED: methyltransferase-like protein 2 ...    504   4e-169   
ref|XP_007224950.1|  hypothetical protein PRUPE_ppa021480mg             503   4e-168   
ref|XP_003544427.1|  PREDICTED: methyltransferase-like protein 2-...    499   5e-167   
ref|XP_006434935.1|  hypothetical protein CICLE_v10001360mg             496   2e-166   
ref|XP_006473460.1|  PREDICTED: methyltransferase-like protein 2-...    496   2e-166   
ref|XP_009594619.1|  PREDICTED: methyltransferase-like protein 2 ...    492   5e-165   
ref|XP_006473458.1|  PREDICTED: methyltransferase-like protein 2-...    493   5e-165   
ref|XP_009594621.1|  PREDICTED: methyltransferase-like protein 2 ...    491   1e-164   
gb|KDP38467.1|  hypothetical protein JCGZ_04392                         492   2e-164   
ref|XP_004291901.1|  PREDICTED: methyltransferase-like protein 2-...    490   4e-164   
ref|XP_009594622.1|  PREDICTED: methyltransferase-like protein 2 ...    488   2e-163   
ref|XP_011031456.1|  PREDICTED: methyltransferase-like protein 2        488   3e-163   
ref|XP_006595943.1|  PREDICTED: methyltransferase-like protein 2-...    480   5e-160   
ref|XP_010060916.1|  PREDICTED: methyltransferase-like protein 2 ...    479   1e-159   
gb|EPS60488.1|  hypothetical protein M569_14315                         478   3e-159   
ref|XP_010685196.1|  PREDICTED: methyltransferase-like protein 2 ...    478   8e-159   
ref|XP_008444687.1|  PREDICTED: methyltransferase-like protein 2        476   3e-158   
ref|XP_002890329.1|  hypothetical protein ARALYDRAFT_472157             471   2e-156   
ref|XP_007160783.1|  hypothetical protein PHAVU_001G016200g             467   1e-154   
ref|XP_004499129.1|  PREDICTED: methyltransferase-like protein 2-...    467   1e-154   
gb|AAM61513.1|  unknown                                                 466   2e-154   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564080.1|  methyltransferase-like protein 2                      465   4e-154   Arabidopsis thaliana [mouse-ear cress]
gb|KGN62578.1|  hypothetical protein Csa_2G361440                       461   9e-153   
gb|KEH40098.1|  methyltransferase-like protein                          461   1e-152   
ref|XP_004152710.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    460   4e-152   
ref|XP_010498348.1|  PREDICTED: methyltransferase-like protein 2        456   1e-150   
ref|XP_010533242.1|  PREDICTED: methyltransferase-like protein 2        451   1e-148   
ref|XP_010477143.1|  PREDICTED: methyltransferase-like protein 2 ...    448   2e-147   
gb|KFK44069.1|  hypothetical protein AALP_AA1G212000                    446   8e-147   
ref|XP_010943156.1|  PREDICTED: methyltransferase-like protein 2 ...    446   1e-146   
ref|XP_010459600.1|  PREDICTED: methyltransferase-like protein 2        446   1e-146   
ref|XP_006307629.1|  hypothetical protein CARUB_v10009255mg             445   4e-146   
ref|XP_009395619.1|  PREDICTED: methyltransferase-like protein 2 ...    442   4e-145   
ref|XP_010943155.1|  PREDICTED: methyltransferase-like protein 2 ...    441   7e-145   
emb|CDY50575.1|  BnaA06g13610D                                          440   2e-144   
ref|XP_010246997.1|  PREDICTED: methyltransferase-like protein 2 ...    437   8e-144   
ref|XP_007050710.1|  Methyltransferase MT-A70 family protein            436   2e-142   
gb|AAF79421.1|AC025808_3  F18O14.6                                      434   3e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510345.1|  S-adenosylmethionine-dependent methyltransfe...    431   2e-141   Ricinus communis
ref|XP_009149415.1|  PREDICTED: methyltransferase-like protein 2        427   2e-139   
ref|XP_006856096.1|  hypothetical protein AMTR_s00059p00131310          427   4e-139   
ref|XP_006375069.1|  hypothetical protein POPTR_0014s04090g             420   3e-137   
ref|XP_006416515.1|  hypothetical protein EUTSA_v10007768mg             416   3e-135   
emb|CDY26677.1|  BnaA06g13450D                                          412   1e-133   
ref|XP_010685197.1|  PREDICTED: methyltransferase-like protein 2 ...    401   7e-130   
ref|XP_006473461.1|  PREDICTED: methyltransferase-like protein 2-...    395   2e-128   
ref|XP_008669718.1|  PREDICTED: uncharacterized protein LOC100275...    397   7e-128   
ref|XP_003558576.1|  PREDICTED: methyltransferase-like protein 2 ...    395   4e-127   
ref|XP_010229027.1|  PREDICTED: methyltransferase-like protein 2 ...    395   6e-127   
ref|XP_006651137.1|  PREDICTED: methyltransferase-like protein 2-...    389   2e-124   
ref|XP_010229028.1|  PREDICTED: methyltransferase-like protein 2 ...    387   6e-124   
ref|XP_009395621.1|  PREDICTED: methyltransferase-like protein 2 ...    372   2e-118   
ref|XP_004985323.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    369   4e-117   
ref|XP_001758385.1|  predicted protein                                  359   6e-113   
ref|XP_010477144.1|  PREDICTED: methyltransferase-like protein 2 ...    355   1e-112   
ref|XP_010106033.1|  Methyltransferase-like protein 2                   351   1e-110   
ref|XP_010060917.1|  PREDICTED: methyltransferase-like protein 2 ...    330   2e-103   
dbj|BAC42388.1|  unknown protein                                        314   1e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EEE58513.1|  hypothetical protein OsJ_09794                          311   5e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369490.1|  PREDICTED: methyltransferase-like protein 2        301   4e-93    
gb|EMT20927.1|  Methyltransferase-like protein 2                        311   6e-91    
gb|KHG14750.1|  hypothetical protein F383_18060                         302   3e-85    
ref|NP_001143136.1|  uncharacterized protein LOC100275615               268   4e-81    Zea mays [maize]
ref|XP_008355576.1|  PREDICTED: methyltransferase-like protein 2 ...    247   1e-72    
gb|EEC74694.1|  hypothetical protein OsI_10399                          250   1e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_004160055.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    241   3e-71    
gb|ACU22910.1|  unknown                                                 228   2e-65    Glycine max [soybeans]
ref|XP_010060918.1|  PREDICTED: methyltransferase-like protein 2 ...    226   2e-64    
ref|XP_002981617.1|  hypothetical protein SELMODRAFT_114834             221   2e-63    
ref|XP_002963171.1|  hypothetical protein SELMODRAFT_80323              217   2e-62    
ref|XP_002465694.1|  hypothetical protein SORBIDRAFT_01g043900          223   8e-60    Sorghum bicolor [broomcorn]
ref|XP_008355577.1|  PREDICTED: methyltransferase-like protein 2 ...    196   8e-54    
ref|XP_005647981.1|  MT-A70                                             192   6e-53    
ref|XP_005798616.1|  PREDICTED: methyltransferase-like protein 4-...    188   1e-49    
ref|XP_689178.3|  PREDICTED: methyltransferase-like protein 4 iso...    191   1e-49    Danio rerio [leopard danio]
gb|KDO84448.1|  hypothetical protein CISIN_1g031322mg                   178   1e-48    
ref|XP_007555737.1|  PREDICTED: methyltransferase-like protein 4        186   2e-48    
ref|XP_002158431.2|  PREDICTED: methyltransferase-like protein 4-...    178   3e-47    
ref|XP_004606060.1|  PREDICTED: methyltransferase-like protein 4        183   5e-47    
ref|NP_001254806.1|  methyltransferase-like protein 4                   182   1e-46    
emb|CDS08180.1|  hypothetical protein LRAMOSA02128                      181   1e-46    
ref|XP_005697124.1|  PREDICTED: methyltransferase-like protein 4        182   2e-46    
ref|XP_008072956.1|  PREDICTED: methyltransferase-like protein 4        181   2e-46    
ref|XP_002938955.1|  PREDICTED: methyltransferase like 4                180   3e-46    
ref|XP_006058716.1|  PREDICTED: methyltransferase-like protein 4 ...    181   3e-46    
ref|XP_005974118.1|  PREDICTED: methyltransferase-like protein 4        180   5e-46    
emb|CDH52371.1|  methyltransferase-like protein 4                       178   7e-46    
ref|XP_006761927.1|  PREDICTED: methyltransferase-like protein 4 ...    179   9e-46    
ref|XP_005868808.1|  PREDICTED: methyltransferase-like protein 4 ...    179   1e-45    
ref|XP_003464466.1|  PREDICTED: methyltransferase-like protein 4        179   1e-45    
ref|XP_005868807.1|  PREDICTED: methyltransferase-like protein 4 ...    179   1e-45    
ref|XP_006089315.1|  PREDICTED: methyltransferase-like protein 4        179   1e-45    
ref|XP_005893715.1|  PREDICTED: methyltransferase-like protein 4        178   3e-45    
gb|ELR57869.1|  Methyltransferase-like protein 4                        178   3e-45    
ref|XP_007121907.1|  PREDICTED: methyltransferase-like protein 4-...    178   3e-45    
ref|XP_006205189.1|  PREDICTED: methyltransferase-like protein 4 ...    177   5e-45    
ref|XP_003507964.1|  PREDICTED: methyltransferase-like protein 4 ...    177   5e-45    
ref|XP_006205188.1|  PREDICTED: methyltransferase-like protein 4 ...    177   6e-45    
ref|XP_004683825.1|  PREDICTED: methyltransferase-like protein 4        177   6e-45    
ref|XP_010817139.1|  PREDICTED: methyltransferase-like protein 4 ...    177   8e-45    
ref|NP_001192812.1|  methyltransferase-like protein 4                   177   9e-45    
ref|XP_007456615.1|  PREDICTED: methyltransferase-like protein 4        176   1e-44    
ref|XP_004909635.1|  PREDICTED: methyltransferase-like protein 4        176   1e-44    
ref|XP_010831031.1|  PREDICTED: methyltransferase-like protein 4 ...    176   1e-44    
ref|XP_010831029.1|  PREDICTED: methyltransferase-like protein 4 ...    176   1e-44    
ref|XP_004853241.1|  PREDICTED: methyltransferase-like protein 4 ...    176   1e-44    
ref|XP_007191658.1|  PREDICTED: methyltransferase-like protein 4 ...    176   2e-44    
ref|XP_008938680.1|  PREDICTED: methyltransferase-like protein 4        172   2e-44    
ref|XP_005372719.1|  PREDICTED: methyltransferase-like protein 4 ...    175   3e-44    
ref|XP_010974853.1|  PREDICTED: methyltransferase-like protein 4        175   3e-44    
gb|KFQ18653.1|  Methyltransferase-like 4                                172   3e-44    
ref|XP_010742406.1|  PREDICTED: methyltransferase-like protein 4 ...    174   4e-44    
ref|XP_007238967.1|  PREDICTED: methyltransferase-like protein 4 ...    174   4e-44    
ref|XP_007646692.1|  PREDICTED: methyltransferase-like protein 4 ...    174   4e-44    
ref|XP_010742404.1|  PREDICTED: methyltransferase-like protein 4 ...    174   4e-44    
gb|ERE83553.1|  methyltransferase-like protein 4                        174   5e-44    
emb|CAG10214.1|  unnamed protein product                                170   5e-44    Tetraodon nigroviridis
ref|XP_004320794.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    174   5e-44    
ref|XP_010956376.1|  PREDICTED: methyltransferase-like protein 4        174   6e-44    
ref|XP_004412396.1|  PREDICTED: methyltransferase-like protein 4 ...    174   7e-44    
emb|CEG74880.1|  hypothetical protein RMATCC62417_10014                 172   7e-44    
ref|XP_004412395.1|  PREDICTED: methyltransferase-like protein 4 ...    174   9e-44    
ref|NP_001178743.1|  methyltransferase-like protein 4                   174   9e-44    
emb|CEI88870.1|  hypothetical protein RMCBS344292_03246                 171   1e-43    
ref|XP_003406424.2|  PREDICTED: methyltransferase-like protein 4        174   1e-43    
ref|XP_002926112.1|  PREDICTED: methyltransferase-like protein 4-...    173   1e-43    
ref|XP_006972308.1|  PREDICTED: methyltransferase-like protein 4 ...    173   1e-43    
ref|XP_006245720.1|  PREDICTED: methyltransferase-like protein 4 ...    173   2e-43    
ref|NP_795891.2|  methyltransferase-like protein 4                      173   2e-43    Mus musculus [mouse]
ref|XP_006727841.1|  PREDICTED: methyltransferase-like protein 4 ...    173   2e-43    
ref|XP_006867338.1|  PREDICTED: methyltransferase-like protein 4        173   2e-43    
emb|CEI87299.1|  hypothetical protein RMCBS344292_01716                 171   2e-43    
ref|XP_005367603.1|  PREDICTED: methyltransferase-like protein 4 ...    172   2e-43    
ref|XP_008306488.1|  PREDICTED: methyltransferase-like protein 4 ...    172   2e-43    
ref|XP_001493724.2|  PREDICTED: methyltransferase like 4 isoform X1     173   2e-43    Equus caballus [domestic horse]
ref|XP_008688633.1|  PREDICTED: methyltransferase-like protein 4 ...    173   2e-43    
ref|XP_006727840.1|  PREDICTED: methyltransferase-like protein 4 ...    173   2e-43    
ref|XP_004275969.1|  PREDICTED: methyltransferase-like protein 4        172   2e-43    
ref|XP_006245723.1|  PREDICTED: methyltransferase-like protein 4 ...    172   3e-43    
ref|XP_005367602.1|  PREDICTED: methyltransferase-like protein 4 ...    172   3e-43    
ref|XP_008688625.1|  PREDICTED: methyltransferase-like protein 4 ...    172   3e-43    
emb|CBN82076.1|  Methyltransferase-like protein 4                       169   3e-43    
ref|XP_007519944.1|  PREDICTED: methyltransferase-like protein 4        173   4e-43    
ref|XP_008832831.1|  PREDICTED: methyltransferase-like protein 4        172   4e-43    
ref|XP_008159733.1|  PREDICTED: methyltransferase-like protein 4        172   4e-43    
ref|XP_004853240.1|  PREDICTED: methyltransferase-like protein 4 ...    172   4e-43    
emb|CEG78239.1|  hypothetical protein RMATCC62417_12876                 169   5e-43    
gb|KFO27103.1|  Methyltransferase-like protein 4                        172   5e-43    
ref|XP_008259344.1|  PREDICTED: methyltransferase-like protein 4 ...    171   5e-43    
ref|XP_008298782.1|  PREDICTED: methyltransferase-like protein 4        171   5e-43    
ref|XP_008259343.1|  PREDICTED: methyltransferase-like protein 4 ...    172   6e-43    
ref|XP_004421082.1|  PREDICTED: methyltransferase-like protein 4        172   6e-43    
ref|XP_006972309.1|  PREDICTED: methyltransferase-like protein 4 ...    171   6e-43    
ref|XP_003219728.1|  PREDICTED: methyltransferase-like protein 4        171   7e-43    
ref|XP_006525170.1|  PREDICTED: methyltransferase like 4 isoform X3     171   7e-43    
ref|XP_003439404.1|  PREDICTED: methyltransferase-like protein 4-...    168   8e-43    
ref|XP_008306489.1|  PREDICTED: methyltransferase-like protein 4 ...    167   1e-42    
ref|XP_005922561.1|  PREDICTED: methyltransferase-like protein 4-...    169   1e-42    
ref|XP_005738879.1|  PREDICTED: methyltransferase-like protein 4-...    169   2e-42    
ref|XP_010883762.1|  PREDICTED: methyltransferase-like protein 4        167   2e-42    
ref|XP_007933801.1|  PREDICTED: methyltransferase-like protein 4        170   2e-42    
ref|XP_547656.2|  PREDICTED: methyltransferase like 4 isoform X3        169   2e-42    Canis lupus familiaris [dogs]
ref|XP_005372720.1|  PREDICTED: methyltransferase-like protein 4 ...    169   3e-42    
ref|XP_001368706.1|  PREDICTED: methyltransferase-like protein 4 ...    169   3e-42    Monodelphis domestica
ref|XP_005449018.1|  PREDICTED: methyltransferase-like protein 4-...    168   4e-42    
ref|XP_005337179.1|  PREDICTED: methyltransferase-like protein 4        169   4e-42    
ref|XP_007089564.1|  PREDICTED: methyltransferase-like protein 4        169   7e-42    
ref|XP_004546965.1|  PREDICTED: methyltransferase-like protein 4-...    167   8e-42    
ref|XP_010636988.1|  PREDICTED: methyltransferase-like protein 4 ...    169   8e-42    
ref|XP_006795091.1|  PREDICTED: methyltransferase-like protein 4-...    167   9e-42    
ref|XP_007064951.1|  PREDICTED: methyltransferase-like protein 4        168   1e-41    
ref|XP_006030171.1|  PREDICTED: methyltransferase-like protein 4-...    166   1e-41    
ref|XP_006146543.1|  PREDICTED: methyltransferase-like protein 4 ...    167   1e-41    
gb|EMP31059.1|  Methyltransferase-like protein 4                        168   2e-41    
ref|XP_009506032.1|  PREDICTED: methyltransferase-like protein 4        163   2e-41    
ref|XP_004742852.1|  PREDICTED: methyltransferase-like protein 4 ...    167   2e-41    
ref|XP_002193317.1|  PREDICTED: methyltransferase-like protein 4        167   3e-41    Taeniopygia guttata
ref|XP_008173218.1|  PREDICTED: methyltransferase-like protein 4 ...    167   3e-41    
ref|XP_006920111.1|  PREDICTED: methyltransferase-like protein 4 ...    166   3e-41    
ref|XP_006891448.1|  PREDICTED: methyltransferase-like protein 4        166   4e-41    
ref|XP_007433048.1|  PREDICTED: methyltransferase-like protein 4        166   4e-41    
gb|ELW67706.1|  Methyltransferase-like protein 4                        166   5e-41    
ref|XP_004081180.1|  PREDICTED: methyltransferase-like protein 4-...    165   5e-41    
ref|XP_008567383.1|  PREDICTED: methyltransferase-like protein 4        166   6e-41    
ref|XP_004702945.1|  PREDICTED: methyltransferase-like protein 4        166   6e-41    
ref|XP_010005148.1|  PREDICTED: methyltransferase-like protein 4        166   7e-41    
ref|XP_003968138.1|  PREDICTED: methyltransferase-like protein 4-...    163   1e-40    
ref|XP_010394657.1|  PREDICTED: methyltransferase-like protein 4 ...    165   1e-40    
ref|XP_002587280.1|  hypothetical protein BRAFLDRAFT_237642             159   1e-40    Branchiostoma floridae
gb|KFU96576.1|  Methyltransferase-like 4                                164   1e-40    
ref|XP_005042001.1|  PREDICTED: methyltransferase-like protein 4 ...    164   2e-40    
ref|XP_009982376.1|  PREDICTED: methyltransferase-like protein 4        164   2e-40    
gb|KFO61558.1|  Methyltransferase-like 4                                164   2e-40    
ref|XP_001636434.1|  predicted protein                                  158   2e-40    Nematostella vectensis
ref|XP_008635040.1|  PREDICTED: methyltransferase-like protein 4        164   2e-40    
gb|AAH56270.2|  METTL4 protein                                          161   2e-40    
ref|XP_005258190.1|  PREDICTED: methyltransferase-like protein 4 ...    160   3e-40    
gb|KFV52568.1|  Methyltransferase-like 4                                164   3e-40    
ref|XP_009705438.1|  PREDICTED: methyltransferase-like protein 4        163   3e-40    
emb|CAD38969.1|  hypothetical protein                                   157   3e-40    
ref|XP_009966397.1|  PREDICTED: methyltransferase-like protein 4        164   3e-40    
ref|XP_009665385.1|  PREDICTED: methyltransferase-like protein 4 ...    163   4e-40    
gb|KFV01404.1|  Methyltransferase-like 4                                163   4e-40    
gb|KFP31185.1|  Methyltransferase-like 4                                162   5e-40    
ref|XP_005438465.1|  PREDICTED: methyltransferase-like protein 4        163   5e-40    
ref|XP_006634415.1|  PREDICTED: methyltransferase-like protein 4-...    162   5e-40    
emb|CDQ74599.1|  unnamed protein product                                162   5e-40    
ref|XP_005418334.1|  PREDICTED: methyltransferase-like protein 4        162   6e-40    
ref|XP_005009442.1|  PREDICTED: methyltransferase-like protein 4 ...    162   7e-40    
ref|XP_009250550.1|  PREDICTED: methyltransferase-like protein 4 ...    161   7e-40    
ref|XP_005517288.1|  PREDICTED: methyltransferase-like protein 4        162   7e-40    
ref|XP_010198940.1|  PREDICTED: methyltransferase-like protein 4        162   7e-40    
ref|XP_007972696.1|  PREDICTED: methyltransferase-like protein 4 ...    162   8e-40    
gb|EOB08778.1|  Methyltransferase-like protein 4                        162   8e-40    
ref|XP_006139095.1|  PREDICTED: methyltransferase-like protein 4 ...    162   9e-40    
gb|KFP37226.1|  Methyltransferase-like 4                                162   1e-39    
ref|XP_006269582.1|  PREDICTED: methyltransferase-like protein 4        162   1e-39    
ref|XP_010220649.1|  PREDICTED: methyltransferase-like protein 4        162   1e-39    
gb|KGL82546.1|  Methyltransferase-like 4                                161   1e-39    
ref|XP_010125038.1|  PREDICTED: methyltransferase-like protein 4        162   1e-39    
ref|XP_010333827.1|  PREDICTED: methyltransferase-like protein 4        161   1e-39    
ref|XP_419143.3|  PREDICTED: methyltransferase like 4 isoform X2        161   2e-39    Gallus gallus [bantam]
ref|XP_003817933.1|  PREDICTED: methyltransferase-like protein 4        161   2e-39    
ref|XP_004059173.1|  PREDICTED: methyltransferase-like protein 4        161   2e-39    
ref|NP_073751.3|  methyltransferase-like protein 4                      161   2e-39    Homo sapiens [man]
ref|XP_523876.1|  PREDICTED: methyltransferase-like protein 4 iso...    161   2e-39    Pan troglodytes
ref|XP_002828133.1|  PREDICTED: methyltransferase-like protein 4 ...    161   2e-39    
ref|XP_003262069.1|  PREDICTED: methyltransferase-like protein 4        161   2e-39    
ref|XP_009100625.1|  PREDICTED: methyltransferase-like protein 4        161   2e-39    
ref|XP_010132511.1|  PREDICTED: methyltransferase-like protein 4        159   2e-39    
gb|KFW92652.1|  Methyltransferase-like 4                                157   2e-39    
gb|KFV98904.1|  Methyltransferase-like 4                                160   3e-39    
gb|AAI11021.1|  Methyltransferase like 4                                160   3e-39    
ref|XP_010158885.1|  PREDICTED: methyltransferase-like protein 4        160   3e-39    
gb|KFV77164.1|  Methyltransferase-like 4                                160   3e-39    
ref|XP_010394662.1|  PREDICTED: methyltransferase-like protein 4 ...    160   3e-39    
ref|XP_010308137.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    160   4e-39    
gb|KFO06229.1|  Methyltransferase-like 4                                160   4e-39    
ref|XP_005587140.1|  PREDICTED: methyltransferase-like protein 4 ...    160   4e-39    
ref|XP_009578913.1|  PREDICTED: methyltransferase-like protein 4        160   4e-39    
ref|XP_005042002.1|  PREDICTED: methyltransferase-like protein 4 ...    160   5e-39    
gb|EHH29200.1|  Methyltransferase-like protein 4                        160   5e-39    
ref|XP_010351488.1|  PREDICTED: methyltransferase-like protein 4        160   6e-39    
ref|XP_005997941.1|  PREDICTED: methyltransferase-like protein 4        157   7e-39    
gb|KFW07431.1|  Methyltransferase-like 4                                159   8e-39    
ref|XP_009807922.1|  PREDICTED: methyltransferase-like protein 4        159   8e-39    
gb|KFQ87134.1|  Methyltransferase-like 4                                159   8e-39    
ref|XP_001087322.1|  PREDICTED: methyltransferase like 4 isoform 2      159   9e-39    Macaca mulatta [rhesus macaque]
ref|XP_009469503.1|  PREDICTED: methyltransferase-like protein 4        159   1e-38    
gb|KFV41856.1|  Methyltransferase-like 4                                159   1e-38    
ref|XP_009929748.1|  PREDICTED: methyltransferase-like protein 4        159   1e-38    
gb|KFZ68547.1|  Methyltransferase-like 4                                159   1e-38    
ref|XP_008977819.1|  PREDICTED: methyltransferase-like protein 4 ...    158   1e-38    
gb|KFR03980.1|  Methyltransferase-like 4                                158   2e-38    
gb|KFR06418.1|  Methyltransferase-like 4                                158   2e-38    
ref|XP_005009443.1|  PREDICTED: methyltransferase-like protein 4 ...    158   2e-38    
ref|XP_010071488.1|  PREDICTED: methyltransferase-like protein 4        158   3e-38    
ref|XP_002757142.1|  PREDICTED: methyltransferase-like protein 4 ...    157   3e-38    Callithrix jacchus [common marmoset]
ref|XP_005082637.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    156   3e-38    
ref|XP_008495859.1|  PREDICTED: methyltransferase-like protein 4        157   4e-38    
ref|XP_009884924.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    157   6e-38    
dbj|BAF82690.1|  unnamed protein product                                156   8e-38    Homo sapiens [man]
gb|KFZ60382.1|  Methyltransferase-like 4                                155   2e-37    
ref|XP_010168507.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    155   2e-37    
ref|XP_005153558.1|  PREDICTED: methyltransferase-like protein 4        155   3e-37    
ref|XP_009323245.1|  PREDICTED: methyltransferase-like protein 4        155   3e-37    
gb|KFW61305.1|  Methyltransferase-like 4                                154   3e-37    
ref|XP_009282399.1|  PREDICTED: methyltransferase-like protein 4        155   3e-37    
ref|XP_008923774.1|  PREDICTED: methyltransferase-like protein 4        154   5e-37    
gb|ETE61789.1|  Methyltransferase-like protein 4                        154   6e-37    
gb|KFH67615.1|  hypothetical protein MVEG_06347                         154   6e-37    
ref|XP_002127115.1|  PREDICTED: methyltransferase-like protein 4        152   8e-37    
gb|KFW82304.1|  Methyltransferase-like 4                                153   1e-36    
ref|XP_005236566.1|  PREDICTED: methyltransferase-like protein 4        153   1e-36    
gb|KFQ16612.1|  Methyltransferase-like 4                                152   2e-36    
gb|EPB85613.1|  hypothetical protein HMPREF1544_07606                   151   2e-36    
ref|XP_010583179.1|  PREDICTED: methyltransferase-like protein 4 ...    152   3e-36    
ref|XP_009917954.1|  PREDICTED: methyltransferase-like protein 4 ...    152   3e-36    
ref|XP_009958354.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    152   4e-36    
ref|XP_010009336.1|  PREDICTED: methyltransferase-like protein 4        152   4e-36    
ref|XP_005500024.1|  PREDICTED: methyltransferase-like protein 4        154   4e-36    
ref|XP_009056957.1|  hypothetical protein LOTGIDRAFT_121106             145   4e-36    
gb|KFP94304.1|  Methyltransferase-like 4                                151   6e-36    
gb|ELU04918.1|  hypothetical protein CAPTEDRAFT_94532                   145   9e-36    
gb|KFQ46767.1|  Methyltransferase-like 4                                150   9e-36    
gb|KFM75515.1|  Methyltransferase-like protein 4                        146   1e-35    
ref|XP_009079858.1|  PREDICTED: methyltransferase-like protein 4        142   2e-35    
ref|XP_007664594.1|  PREDICTED: methyltransferase-like protein 4        149   3e-35    
ref|XP_008394907.1|  PREDICTED: methyltransferase-like protein 4        147   7e-35    
gb|KFO81365.1|  Methyltransferase-like 4                                147   1e-34    
gb|KFM27948.1|  Methyltransferase-like protein 4                        145   1e-34    
ref|XP_009566301.1|  PREDICTED: methyltransferase-like protein 4        146   2e-34    
ref|XP_011058994.1|  PREDICTED: methyltransferase-like protein 4        144   5e-34    
ref|XP_009645951.1|  PREDICTED: methyltransferase-like protein 4        144   6e-34    
ref|XP_003383815.1|  PREDICTED: methyltransferase-like protein 4-...    142   3e-33    
gb|EFN63770.1|  Methyltransferase-like protein 4                        141   4e-33    
ref|XP_005095785.1|  PREDICTED: methyltransferase-like protein 4-...    143   4e-33    
gb|EFN78587.1|  Methyltransferase-like protein 4                        136   5e-32    
ref|XP_006679791.1|  hypothetical protein BATDEDRAFT_12305              133   5e-32    
ref|XP_009824229.1|  hypothetical protein H257_02340                    137   6e-32    
ref|XP_008864115.1|  hypothetical protein H310_02398                    136   2e-31    
ref|XP_007646693.1|  PREDICTED: methyltransferase-like protein 4 ...    137   2e-31    
ref|XP_010774357.1|  PREDICTED: methyltransferase-like protein 4        134   1e-30    
ref|XP_007238968.1|  PREDICTED: methyltransferase-like protein 4 ...    134   1e-30    
gb|EZA61219.1|  Methyltransferase-like protein                          134   2e-30    
ref|XP_009028822.1|  hypothetical protein HELRODRAFT_69400              130   3e-30    
ref|XP_008916001.1|  hypothetical protein PPTG_19354                    133   3e-30    
gb|ETP52296.1|  hypothetical protein F442_02656                         133   3e-30    
gb|EFZ19213.1|  hypothetical protein SINV_06005                         132   6e-30    
gb|ETK94365.1|  hypothetical protein L915_02567                         132   7e-30    
ref|XP_007191660.1|  PREDICTED: methyltransferase-like protein 4 ...    132   1e-29    
ref|XP_004455924.1|  PREDICTED: methyltransferase-like protein 4        129   1e-28    
ref|XP_005310443.1|  PREDICTED: methyltransferase-like protein 4 ...    130   2e-28    
ref|XP_006194704.1|  PREDICTED: methyltransferase-like protein 4-...    123   2e-28    
gb|EPY54086.1|  mRNA (N6-adenosine)-methyltransferase                   128   2e-28    
gb|ETI54484.1|  hypothetical protein F443_02692                         127   2e-28    
gb|ETM54024.1|  hypothetical protein L914_02562                         127   2e-28    
ref|XP_008173217.1|  PREDICTED: methyltransferase-like protein 4 ...    128   5e-28    
ref|XP_009525795.1|  hypothetical protein PHYSODRAFT_382739             122   5e-28    
ref|XP_008173219.1|  PREDICTED: methyltransferase-like protein 4 ...    127   6e-28    
ref|XP_003707014.1|  PREDICTED: methyltransferase-like protein 4-...    126   8e-28    
ref|XP_008688637.1|  PREDICTED: methyltransferase-like protein 4 ...    127   9e-28    
gb|KFP89149.1|  Methyltransferase-like 4                                126   1e-27    
ref|XP_009868088.1|  PREDICTED: methyltransferase-like protein 4        126   1e-27    
ref|XP_010394663.1|  PREDICTED: methyltransferase-like protein 4 ...    126   1e-27    
ref|XP_010394665.1|  PREDICTED: methyltransferase-like protein 4 ...    126   2e-27    
gb|EKC32049.1|  Methyltransferase-like protein 4                        125   2e-27    
ref|XP_010394664.1|  PREDICTED: methyltransferase-like protein 4 ...    125   3e-27    
ref|XP_002428998.1|  conserved hypothetical protein                     122   6e-27    
ref|XP_003488422.1|  PREDICTED: methyltransferase-like protein 4-...    123   6e-27    
ref|XP_003250790.2|  PREDICTED: methyltransferase-like protein 4-...    122   9e-27    
gb|KDO84449.1|  hypothetical protein CISIN_1g031322mg                   116   1e-26    
ref|XP_003697350.1|  PREDICTED: methyltransferase-like protein 4-...    120   1e-26    
ref|XP_006622598.1|  PREDICTED: methyltransferase-like protein 4-...    122   2e-26    
ref|XP_008173220.1|  PREDICTED: methyltransferase-like protein 4 ...    122   2e-26    
ref|XP_009665386.1|  PREDICTED: methyltransferase-like protein 4 ...    123   2e-26    
ref|XP_007487713.1|  PREDICTED: methyltransferase-like protein 4 ...    122   2e-26    
ref|XP_004635883.1|  PREDICTED: methyltransferase-like protein 4        124   2e-26    
ref|XP_003995099.1|  PREDICTED: methyltransferase like 4                123   2e-26    
ref|XP_007972697.1|  PREDICTED: methyltransferase-like protein 4 ...    122   2e-26    
ref|XP_009665383.1|  PREDICTED: methyltransferase-like protein 4 ...    123   3e-26    
ref|XP_008621775.1|  hypothetical protein SDRG_17312                    121   3e-26    
ref|XP_003914253.2|  PREDICTED: methyltransferase-like protein 4        121   5e-26    
ref|XP_008544272.1|  PREDICTED: methyltransferase-like protein 4        120   5e-26    
ref|XP_004939811.1|  PREDICTED: methyltransferase like 4 isoform X3     121   6e-26    
gb|EPX74547.1|  mRNA (N6-adenosine)-methyltransferase                   120   9e-26    
ref|XP_010583181.1|  PREDICTED: methyltransferase-like protein 4 ...    119   1e-25    
ref|XP_011113934.1|  hypothetical protein H072_8210                     119   2e-25    
ref|NP_593056.2|  mRNA (2'-O-methyladenosine-N(6)-)-methyltransfe...    119   2e-25    
gb|KDO33611.1|  hypothetical protein SPRG_19239                         118   2e-25    
ref|XP_004388992.1|  PREDICTED: methyltransferase-like protein 4        119   2e-25    
ref|XP_009301909.1|  PREDICTED: methyltransferase-like protein 4 ...    117   2e-25    
ref|XP_010288105.1|  PREDICTED: methyltransferase-like protein 4        119   3e-25    
ref|XP_010583177.1|  PREDICTED: methyltransferase-like protein 4 ...    119   3e-25    
ref|XP_009917953.1|  PREDICTED: methyltransferase-like protein 4 ...    119   3e-25    
ref|XP_010583180.1|  PREDICTED: methyltransferase-like protein 4 ...    119   4e-25    
ref|XP_009917955.1|  PREDICTED: methyltransferase-like protein 4 ...    119   4e-25    
ref|XP_010583175.1|  PREDICTED: methyltransferase-like protein 4 ...    119   4e-25    
gb|KFP51791.1|  Methyltransferase-like 4                                115   4e-25    
ref|XP_010707080.1|  PREDICTED: methyltransferase-like protein 4        114   5e-25    
gb|ETS06210.1|  MT-A70-domain-containing protein                        117   1e-24    
gb|KDR10555.1|  Methyltransferase-like protein 4                        116   1e-24    
gb|KFP03859.1|  Methyltransferase-like 4                                117   1e-24    
ref|XP_005623084.1|  PREDICTED: methyltransferase like 4 isoform X2     117   1e-24    
ref|XP_008716678.1|  hypothetical protein HMPREF1541_04110              116   1e-24    
ref|XP_006961530.1|  predicted protein                                  116   2e-24    
ref|XP_006139097.1|  PREDICTED: methyltransferase-like protein 4 ...    117   2e-24    
ref|XP_010180006.1|  PREDICTED: methyltransferase-like protein 4        116   2e-24    
ref|XP_009894700.1|  PREDICTED: methyltransferase-like protein 4        116   2e-24    
ref|XP_007874788.1|  hypothetical protein PNEG_02757                    115   2e-24    
gb|KFQ21777.1|  Methyltransferase-like 4                                115   3e-24    
ref|XP_009488828.1|  PREDICTED: methyltransferase-like protein 4        115   3e-24    
ref|XP_004160054.1|  PREDICTED: methyltransferase-like protein 2-...    111   3e-24    
ref|XP_006139096.1|  PREDICTED: methyltransferase-like protein 4 ...    115   4e-24    
gb|EXK32128.1|  hypothetical protein FOMG_12431                         114   4e-24    
gb|AEE61800.1|  unknown                                                 114   5e-24    
ref|XP_003246632.1|  PREDICTED: methyltransferase-like protein 4        114   5e-24    
gb|EXA48274.1|  hypothetical protein FOVG_05078                         114   6e-24    
gb|ENH69098.1|  hypothetical protein FOC1_g10010274                     114   7e-24    
ref|XP_003299487.1|  hypothetical protein PTT_10488                     115   8e-24    
gb|EWZ41463.1|  hypothetical protein FOZG_06751                         113   9e-24    
emb|CCU74347.1|  MT-A70/Methyltransferase                               114   9e-24    
emb|CBY24576.1|  unnamed protein product                                113   1e-23    
gb|EXM00131.1|  hypothetical protein FOIG_08166                         112   1e-23    
ref|XP_005844948.1|  hypothetical protein CHLNCDRAFT_36694              108   2e-23    
gb|EWY96704.1|  hypothetical protein FOYG_05311                         112   3e-23    
ref|XP_007972698.1|  PREDICTED: methyltransferase-like protein 4 ...    112   3e-23    
ref|XP_003350004.1|  hypothetical protein SMAC_00894                    112   3e-23    
gb|EGU85686.1|  hypothetical protein FOXB_03832                         111   3e-23    
ref|XP_001797065.1|  hypothetical protein SNOG_06702                    113   4e-23    
gb|EPQ61487.1|  hypothetical protein BGT96224_3553                      112   4e-23    
gb|ERL89623.1|  hypothetical protein D910_06988                         114   4e-23    
gb|KIE02271.1|  MT-A70 family                                           111   5e-23    
ref|XP_008077867.1|  hypothetical protein GLAREA_10575                  111   5e-23    
gb|EMS20334.1|  methyltransferase like 4                                112   5e-23    
ref|XP_011117499.1|  hypothetical protein AOL_s00004g548                111   6e-23    
ref|XP_003045927.1|  hypothetical protein NECHADRAFT_33914              110   9e-23    
ref|XP_006722402.1|  PREDICTED: methyltransferase-like protein 4 ...    111   9e-23    
ref|XP_009250551.1|  PREDICTED: methyltransferase-like protein 4 ...    111   1e-22    
ref|XP_009432032.1|  PREDICTED: methyltransferase-like protein 4 ...    111   1e-22    
gb|KEQ58752.1|  MT-A70-domain-containing protein                        111   1e-22    
gb|KID92065.1|  MT-A70 family                                           110   2e-22    
gb|EWG45375.1|  hypothetical protein FVEG_15818                         109   2e-22    
dbj|BAB01687.1|  unnamed protein product                                110   2e-22    
ref|XP_007822505.1|  MT-A70 family                                      109   2e-22    
ref|XP_005587141.1|  PREDICTED: methyltransferase-like protein 4 ...    110   2e-22    
ref|XP_001087209.1|  PREDICTED: methyltransferase like 4 isoform 1      110   2e-22    
ref|XP_001652470.1|  hypothetical protein AaeL_AAEL006991               107   3e-22    
gb|KID79254.1|  MT-A70 family                                           109   3e-22    
gb|KFG83587.1|  MT-A70 family                                           109   3e-22    
ref|XP_007930506.1|  hypothetical protein MYCFIDRAFT_36864              110   3e-22    
gb|KFH43710.1|  Methyltransferase-like protein-like protein             108   3e-22    
gb|KEF52998.1|  hypothetical protein A1O9_10906                         109   4e-22    
ref|XP_003714455.1|  hypothetical protein MGG_01492                     108   5e-22    
emb|CCT63905.1|  uncharacterized protein FFUJ_04923                     107   6e-22    
gb|KFA65167.1|  hypothetical protein S40285_01505                       107   7e-22    
ref|XP_007705801.1|  hypothetical protein COCSADRAFT_41887              109   8e-22    
gb|KHJ31427.1|  putative mt-a70 family                                  108   9e-22    
ref|XP_009253979.1|  hypothetical protein FPSE_02585                    107   9e-22    
gb|KDE09033.1|  hypothetical protein MVLG_00752                         109   9e-22    
ref|XP_007714144.1|  hypothetical protein COCCADRAFT_6567               108   9e-22    
gb|EUN22647.1|  hypothetical protein COCVIDRAFT_110867                  108   1e-21    
gb|EYB33252.1|  hypothetical protein FG05_06225                         107   1e-21    
ref|XP_386401.1|  hypothetical protein FG06225.1                        107   1e-21    
ref|XP_008030194.1|  hypothetical protein SETTUDRAFT_181133             108   2e-21    
gb|EMT60590.1|  Methyltransferase-like protein 4                        105   2e-21    
ref|XP_007800025.1|  hypothetical protein EPUS_02002                    107   3e-21    
ref|XP_007807634.1|  MT-A70 family                                      107   3e-21    
gb|KEQ87632.1|  MT-A70-domain-containing protein                        107   3e-21    
gb|EAA33305.2|  hypothetical protein NCU08328                           106   3e-21    
tpg|DAA43957.1|  TPA: hypothetical protein ZEAMMB73_591151              102   4e-21    
ref|XP_004933442.1|  PREDICTED: methyltransferase-like protein 4-...    104   4e-21    
ref|XP_002053444.1|  GJ23883                                            105   4e-21    
gb|EHK48181.1|  hypothetical protein TRIATDRAFT_272036                  105   5e-21    
ref|XP_002041178.1|  GM15414                                            104   8e-21    
gb|KHN97053.1|  MT-A70 family                                           104   8e-21    
ref|XP_007680926.1|  hypothetical protein BAUCODRAFT_38978              105   8e-21    
ref|XP_006058718.1|  PREDICTED: methyltransferase-like protein 4 ...    104   1e-20    
gb|EHK24888.1|  hypothetical protein TRIVIDRAFT_24655                   103   1e-20    
gb|EPE08669.1|  mt-a70 family                                           104   1e-20    
gb|KER00574.1|  hypothetical protein AUEXF2481DRAFT_34797               105   1e-20    
dbj|GAA98219.1|  hypothetical protein E5Q_04902                         105   1e-20    
gb|KEY74281.1|  hypothetical protein S7711_00439                        103   1e-20    
ref|XP_009153535.1|  hypothetical protein HMPREF1120_01275              104   2e-20    
ref|XP_007721819.1|  hypothetical protein A1O1_02719                    103   2e-20    
ref|XP_007792415.1|  putative mt-a70 family protein                     103   2e-20    
ref|XP_004351573.1|  MTA70 family                                       100   2e-20    
gb|EGU12871.1|  Lipoyl synthase                                         106   3e-20    
ref|XP_007740890.1|  hypothetical protein A1O5_02084                    103   3e-20    
ref|XP_003835700.1|  similar to MT-A70 family                           104   3e-20    
ref|XP_008195262.1|  PREDICTED: methyltransferase-like protein 4        102   3e-20    
gb|KFX98565.1|  hypothetical protein V490_02242                         103   4e-20    
gb|EYB85276.1|  hypothetical protein Y032_0301g1824                     103   4e-20    
gb|EYB85275.1|  hypothetical protein Y032_0301g1824                     103   4e-20    
gb|EMF09302.1|  MT-A70-domain-containing protein                        103   5e-20    
gb|KHG20881.1|  hypothetical protein F383_27186                       96.3    5e-20    
gb|KEQ70270.1|  MT-A70-domain-containing protein                        103   6e-20    
gb|ERG84344.1|  methyltransferase-like protein 4                        102   8e-20    
ref|XP_007292201.1|  MT-A70 family                                      102   9e-20    
gb|EKG19184.1|  MT-A70 domain-containing protein                        103   9e-20    
gb|KFY33778.1|  hypothetical protein V494_07324                         102   1e-19    
ref|XP_004519609.1|  PREDICTED: methyltransferase-like protein 4-...    101   1e-19    
gb|KIH55394.1|  MT-A70 protein                                          100   1e-19    
ref|XP_007692632.1|  hypothetical protein COCMIDRAFT_9344               102   1e-19    
ref|XP_002072913.1|  GK13858                                            100   2e-19    
ref|XP_314764.4|  AGAP008665-PA                                       98.6    2e-19    
ref|NP_495127.1|  Protein C18A3.1                                       100   2e-19    
ref|XP_003849528.1|  hypothetical protein MYCGRDRAFT_75907              101   2e-19    
ref|XP_007598183.1|  hypothetical protein CFIO01_11689                  100   2e-19    
emb|CCE28153.1|  uncharacterized protein CPUR_01627                     100   3e-19    
ref|XP_003009214.1|  MT-A70 family                                    99.8    3e-19    
ref|XP_010831032.1|  PREDICTED: methyltransferase-like protein 4 ...    100   3e-19    
ref|XP_001979837.1|  GG16815                                          99.8    3e-19    
ref|XP_007782725.1|  hypothetical protein W97_06661                     100   4e-19    
ref|XP_006672396.1|  MT-A70 family                                    99.4    5e-19    
emb|CEJ87998.1|  hypothetical protein VHEMI04580                      99.0    6e-19    
gb|KHN81297.1|  Methyltransferase-like protein 4                      99.4    6e-19    
emb|CCF47652.1|  hypothetical protein CH063_04229                     99.0    6e-19    
ref|XP_004992757.1|  hypothetical protein PTSG_05864                    100   6e-19    
gb|EHJ63799.1|  hypothetical protein KGM_20328                        97.4    9e-19    
ref|XP_008729679.1|  hypothetical protein G647_07140                  98.6    9e-19    
ref|XP_007733617.1|  hypothetical protein A1O3_05302                  98.6    1e-18    
ref|XP_003234379.1|  hypothetical protein TERG_04971                  99.0    1e-18    
ref|NP_650573.1|  CG14906                                             98.2    1e-18    
ref|XP_001585310.1|  hypothetical protein SS1G_13879                  98.6    2e-18    
gb|EFX88307.1|  hypothetical protein DAPPUDRAFT_25900                 95.5    2e-18    
gb|EQB57259.1|  hypothetical protein CGLO_02640                       97.4    2e-18    



>ref|XP_009594617.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009594618.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=422

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/419 (68%), Positives = 340/419 (81%), Gaps = 10/419 (2%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST  255
             M+++QL  F +SGIY+L S NAFFIDPVR++NRSYTR+RVSPS YYSRFFDS+   +   
Sbjct  1     MKNNQLQLFSESGIYQLTS-NAFFIDPVRILNRSYTRFRVSPSTYYSRFFDSSNSTQVPK  59

Query  256   ESRKRKRNEKKTI----SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S   ++ ++K      SLNERE++A++RHQEV+PLLLKAHEAL+ AT+LLKV+RNLR +
Sbjct  60    ASEDSRKRKRKQKKKPQSLNEREQIADRRHQEVKPLLLKAHEALIEATDLLKVLRNLRND  119

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VI  591
              C   E +ELS++S ELSF++LGSVWQAPLYEIVLNY + D    N GS L Q     V 
Sbjct  120   GCAVGECKELSEESSELSFMELGSVWQAPLYEIVLNYYQDDKTFHNGGSVLAQSIEQSVT  179

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLV N+GS D EAE  NHKYIIP  SCFYMSD+R+I NLIPADSD GFN+IVIDPP
Sbjct  180   PVFNNLVANEGSCDIEAELFNHKYIIPIRSCFYMSDLRQIENLIPADSDCGFNLIVIDPP  239

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SAHQK RY TLPNR++LSLP+KQL HT+G+LVALWVTNREKLR FVE +LFP WGV
Sbjct  240   WENGSAHQKLRYPTLPNRYYLSLPVKQLCHTSGSLVALWVTNREKLRGFVENDLFPKWGV  299

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSD-FSKLNAIPNNQVFM  1128
             KY  SFYWLKVKANG +  ELDLFHHRPYECLLLGY +GK+  SD   +LN IP+N+VF+
Sbjct  300   KYAASFYWLKVKANGMMTGELDLFHHRPYECLLLGYCEGKETDSDNIKRLNPIPDNRVFV  359

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             SVPGDYSRKPPIGELLL+Y+ G++ AHCIELF+RE+ AGWTSWGNEPLHFQ S+YFV+K
Sbjct  360   SVPGDYSRKPPIGELLLDYVPGSRPAHCIELFAREMIAGWTSWGNEPLHFQDSRYFVTK  418



>ref|XP_004238224.1| PREDICTED: methyltransferase-like protein 2 [Solanum lycopersicum]
Length=419

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/422 (67%), Positives = 337/422 (80%), Gaps = 13/422 (3%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST  255
             ME++QL   + SG+ +L S NAFFIDPVR++NRSYTR+RVSPS YYSRFFDS    ++  
Sbjct  1     MEENQL---MDSGVSQLNS-NAFFIDPVRILNRSYTRFRVSPSTYYSRFFDSLNSAQSPK  56

Query  256   ESRK----RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S      +++ +KK  SLNERE++A++RHQEV+P LLKAHEALL AT+LLKV+RNLR +
Sbjct  57    ASEDFRKRKRKRKKKIQSLNEREQIADRRHQEVKPFLLKAHEALLEATDLLKVLRNLRND  116

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV----I  591
              C   E +ELSQ++ ELSF++LG VWQAPLYEIVLNYQ+ D  ++N GS L Q +     
Sbjct  117   GCAVGECKELSQETSELSFMELGGVWQAPLYEIVLNYQQDDKTLQNGGSPLAQSIEQRET  176

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLV N+GS D EAE  NHKYIIPK SCFYMSD+++I +LIPA SD GFN+IVIDPP
Sbjct  177   PVFNNLVANEGSYDIEAEIFNHKYIIPKRSCFYMSDMQQIDSLIPAGSDCGFNLIVIDPP  236

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SA QK RY TLP+R+FLSLP+KQL HTAGALVALWVTNREKLR FVE +LFP WGV
Sbjct  237   WENGSARQKVRYPTLPSRYFLSLPVKQLCHTAGALVALWVTNREKLRDFVENDLFPKWGV  296

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS-DFSKLNAIPNNQVFM  1128
              Y  SFYWLKVKANG L  ELDLFHHRPYECLLLGY DGKD  S + ++ N IP+N+VF+
Sbjct  297   TYAASFYWLKVKANGMLTGELDLFHHRPYECLLLGYCDGKDTHSGNLTRSNPIPDNRVFI  356

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             SVPGDYSRKPPIGELLL+Y+ G+  A CIELFSRE+ AGWTSWGNEPLHFQ S+YFVSK 
Sbjct  357   SVPGDYSRKPPIGELLLDYVPGSMPARCIELFSREMIAGWTSWGNEPLHFQDSRYFVSKT  416

Query  1309  RQ  1314
              +
Sbjct  417   TE  418



>gb|EYU32804.1| hypothetical protein MIMGU_mgv1a018718mg [Erythranthe guttata]
Length=433

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/429 (65%), Positives = 334/429 (78%), Gaps = 14/429 (3%)
 Frame = +1

Query  46    PVQPEITGSGMEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFF  225
             P  P +T S + DD+L +FLKSGIY+L +ANAFFIDPVRV+NR YTR+RVSPS YYSRFF
Sbjct  4     PPSPAMTVSEV-DDRLVAFLKSGIYQLDNANAFFIDPVRVLNRCYTRFRVSPSTYYSRFF  62

Query  226   DSTEKLETSTESRKRKRNEKKTI---------SLNEREKVAEQRHQEVRPLLLKAHEALL  378
              +             K + K+           +LN RE++A++RH+EVR  LL+AHEALL
Sbjct  63    PTLNNSSAENPQNASKISRKRKRRDKEKKKDQALNLREQMADRRHKEVRLALLEAHEALL  122

Query  379   GATELLKVVRNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIE  558
             GA +LL+ +RNLR +   +     +SQ+S EL FV+LGSVWQAPLYEI+L   E D  +E
Sbjct  123   GANQLLETLRNLRNDGEKNNGGS-ISQES-ELDFVELGSVWQAPLYEIILKVHEDDTAVE  180

Query  559   NEG-SHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADS  735
             N G     + V P FDNLV N G+ D EAE L+HKYI+PK+SCFYMSD+R+IH L+PA+S
Sbjct  181   NAGVESYSRRVAPVFDNLVANDGNSDIEAELLDHKYILPKQSCFYMSDLRQIHTLVPAES  240

Query  736   DSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRS  915
             D GFN+IVIDPPWENSSAHQK +YQTLPNR+FLSLPIKQLTH+AGALVALWVTNREKLR+
Sbjct  241   DCGFNVIVIDPPWENSSAHQKLKYQTLPNRYFLSLPIKQLTHSAGALVALWVTNREKLRN  300

Query  916   FVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-NTSDFS  1092
             FVE ELFP WGVK+  +FYWLKVKA+G LISELDLFHHRPYECLLLG+S GK+ N     
Sbjct  301   FVENELFPKWGVKHAATFYWLKVKADGVLISELDLFHHRPYECLLLGFSQGKEMNCEQLL  360

Query  1093  KLNAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPL  1272
             +LN+IP+NQVF+SVPGDYSRKPPIGELLLEY  G K A CIELFSRE+ AGWTSWGNEPL
Sbjct  361   RLNSIPDNQVFVSVPGDYSRKPPIGELLLEYAPGLKPARCIELFSREMMAGWTSWGNEPL  420

Query  1273  HFQASKYFV  1299
             HFQ S+YF+
Sbjct  421   HFQDSRYFL  429



>ref|XP_006367297.1| PREDICTED: methyltransferase-like protein 2-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/422 (68%), Positives = 340/422 (81%), Gaps = 13/422 (3%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLET--  249
             ME++QL   ++SG+  L S NAFFIDPVR++N SYTR+RVSPS YYSRFFDS    ++  
Sbjct  1     MEENQL---MESGVSELNS-NAFFIDPVRILNHSYTRFRVSPSTYYSRFFDSLNSAQSPK  56

Query  250   -STESRKRKRNEKKTI-SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S +SRK KR  KK I SLNERE++A++RHQEV+P LLKAHEALL AT+LLKV+RNLR +
Sbjct  57    ASEDSRKGKRKRKKKIQSLNEREQIADRRHQEVKPFLLKAHEALLEATDLLKVLRNLRND  116

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VI  591
              C+  E +ELSQ+S ELSF++LG VWQAPL EIVLNYQ+ D  ++N G  L Q     V 
Sbjct  117   VCSVGECKELSQESSELSFMELGGVWQAPLCEIVLNYQQDDKTLQNGGFPLAQSIEQKVT  176

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             PAF+NLV N+GS D EAE  NHKYIIPK SCFYMSD+++I +LIPA SD GFN+IVIDPP
Sbjct  177   PAFNNLVANEGSYDIEAELFNHKYIIPKRSCFYMSDMQQIDSLIPAGSDCGFNLIVIDPP  236

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SA QK RY TLPNR+FLSLP+KQL HT+GALVALWVTNREKLR FVE +LFP WGV
Sbjct  237   WENGSARQKVRYPTLPNRYFLSLPVKQLCHTSGALVALWVTNREKLRDFVENDLFPKWGV  296

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS-DFSKLNAIPNNQVFM  1128
              Y  SFYWLKVKANG L  ELDLFHHRPYECLLLGY DGKD  S + ++LN IP+N+VF+
Sbjct  297   TYAASFYWLKVKANGMLTGELDLFHHRPYECLLLGYCDGKDTHSGNSTRLNPIPDNRVFI  356

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             SVPGDYSRKPPIGELLL+Y+ G+  A C+ELF+RE+ AGWTSWGNEPLHFQ S+YFVSK 
Sbjct  357   SVPGDYSRKPPIGELLLDYVPGSMPARCVELFAREMIAGWTSWGNEPLHFQDSRYFVSKT  416

Query  1309  RQ  1314
              +
Sbjct  417   ME  418



>ref|XP_011074502.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Sesamum 
indicum]
Length=423

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/419 (67%), Positives = 334/419 (80%), Gaps = 12/419 (3%)
 Frame = +1

Query  82    DDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST--------E  237
             DD+LS+F KSGIYR   ANAFF+DPVRV+NR YTR+RVSPSAYYSRFF S+         
Sbjct  7     DDRLSAFSKSGIYRFDDANAFFVDPVRVLNRCYTRFRVSPSAYYSRFFPSSIFSTGNYNN  66

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
               + S + ++R++ +KK+ +LN RE++A++RHQEVR  LLKAHEALLGA+++L+ +RNLR
Sbjct  67    VPKNSGKRKRREKEKKKSQALNLREQMADRRHQEVRVALLKAHEALLGASQVLETLRNLR  126

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSH-LGQDVIP  594
              +         L +   EL FV LGSVWQAP YEIVL   E +A +EN G     Q V+P
Sbjct  127   DDVEERGGDSILREN--ELDFVGLGSVWQAPFYEIVLKVNEDEAAVENAGGESYYQKVVP  184

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F+  V N+ S D EAE L+HKYI+PK SCFYMSD+R+IHNLIPA+SD GFN+I+IDPPW
Sbjct  185   LFETHVANEASNDMEAELLDHKYILPKNSCFYMSDLRQIHNLIPAESDCGFNLILIDPPW  244

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             ENSSAHQK +Y TLPNR+FLSLPIKQLTHTAGALVALWVTNREKLR+FVE ELFP WGVK
Sbjct  245   ENSSAHQKLKYPTLPNRYFLSLPIKQLTHTAGALVALWVTNREKLRNFVENELFPKWGVK  304

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-NTSDFSKLNAIPNNQVFMS  1131
             Y T+FYWLKVKA+GSLISELDLFHHRPYECLLLG+S GK+ N+    + N +P+NQVF+S
Sbjct  305   YATTFYWLKVKADGSLISELDLFHHRPYECLLLGFSHGKEMNSEQLLRPNHLPDNQVFIS  364

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             VPGDYSRKPPIGE+LL+Y+ G KHA CIELFSRE+ AGWTSWGNEPLHFQ SKYF+  N
Sbjct  365   VPGDYSRKPPIGEILLDYVPGFKHARCIELFSREMIAGWTSWGNEPLHFQDSKYFLKYN  423



>ref|XP_009766187.1| PREDICTED: methyltransferase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009766188.1| PREDICTED: methyltransferase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009766189.1| PREDICTED: methyltransferase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009766190.1| PREDICTED: methyltransferase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009766191.1| PREDICTED: methyltransferase-like protein 2 [Nicotiana sylvestris]
Length=422

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 335/419 (80%), Gaps = 10/419 (2%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST  255
             ME++QL  F +SGIY+L S NAFFIDPVR++NRSYTR+RVSPS YYSRFFDS+   +   
Sbjct  1     MENNQLQLFSESGIYQLTS-NAFFIDPVRILNRSYTRFRVSPSTYYSRFFDSSNSKQVPK  59

Query  256   ESRKRKRNEKKTI----SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S   ++ ++K      SLNERE++A++RHQEV+PLLLKAH+ LL A +LLKV+RNLR +
Sbjct  60    ASEDSRKRKRKQKKKPQSLNEREQIADRRHQEVKPLLLKAHKTLLEAPDLLKVLRNLRND  119

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VI  591
              C   E +ELS++S ELSF++LGSVWQAPLYEI LNY + D    N GS L Q     V 
Sbjct  120   GCAVGECKELSEESSELSFMELGSVWQAPLYEIALNYHQDDKTFHNGGSTLVQSIEQRVT  179

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLV N+GS D EAE  NHK+IIPK SCFYMSD+R+I NLIPADSD GFN+IVIDPP
Sbjct  180   PVFNNLVANEGSCDIEAELFNHKFIIPKRSCFYMSDLRQIENLIPADSDCGFNLIVIDPP  239

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SAHQK RY TLPNR+FLSLP+KQL HT GALVALWVTNREKLR FVE +LFP WGV
Sbjct  240   WENGSAHQKLRYPTLPNRYFLSLPVKQLCHTYGALVALWVTNREKLRGFVENDLFPKWGV  299

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSD-FSKLNAIPNNQVFM  1128
             KY  SFYWLKVKANG +  ELDLFHHRPYECLLLGY DGK+  SD  ++LN IP+N+VF+
Sbjct  300   KYAASFYWLKVKANGMMTGELDLFHHRPYECLLLGYCDGKETDSDNVTRLNPIPDNRVFV  359

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             S+PGDYSRK P+GELLL+Y+ G++ A CIELF+RE+  GWTSWGNEPLHFQ S+YFV+K
Sbjct  360   SIPGDYSRKTPLGELLLDYVPGSRPARCIELFAREMIPGWTSWGNEPLHFQDSRYFVTK  418



>ref|XP_011074499.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Sesamum 
indicum]
 ref|XP_011074500.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Sesamum 
indicum]
 ref|XP_011074501.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Sesamum 
indicum]
Length=432

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/428 (65%), Positives = 334/428 (78%), Gaps = 21/428 (5%)
 Frame = +1

Query  82    DDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST--------E  237
             DD+LS+F KSGIYR   ANAFF+DPVRV+NR YTR+RVSPSAYYSRFF S+         
Sbjct  7     DDRLSAFSKSGIYRFDDANAFFVDPVRVLNRCYTRFRVSPSAYYSRFFPSSIFSTGNYNN  66

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
               + S + ++R++ +KK+ +LN RE++A++RHQEVR  LLKAHEALLGA+++L+ +RNLR
Sbjct  67    VPKNSGKRKRREKEKKKSQALNLREQMADRRHQEVRVALLKAHEALLGASQVLETLRNLR  126

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSH-LGQDVIP  594
              +         L +   EL FV LGSVWQAP YEIVL   E +A +EN G     Q V+P
Sbjct  127   DDVEERGGDSILREN--ELDFVGLGSVWQAPFYEIVLKVNEDEAAVENAGGESYYQKVVP  184

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYM---------SDVRKIHNLIPADSDSGF  747
              F+  V N+ S D EAE L+HKYI+PK SCFYM         SD+R+IHNLIPA+SD GF
Sbjct  185   LFETHVANEASNDMEAELLDHKYILPKNSCFYMVWIENLFRKSDLRQIHNLIPAESDCGF  244

Query  748   NIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEK  927
             N+I+IDPPWENSSAHQK +Y TLPNR+FLSLPIKQLTHTAGALVALWVTNREKLR+FVE 
Sbjct  245   NLILIDPPWENSSAHQKLKYPTLPNRYFLSLPIKQLTHTAGALVALWVTNREKLRNFVEN  304

Query  928   ELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-NTSDFSKLNA  1104
             ELFP WGVKY T+FYWLKVKA+GSLISELDLFHHRPYECLLLG+S GK+ N+    + N 
Sbjct  305   ELFPKWGVKYATTFYWLKVKADGSLISELDLFHHRPYECLLLGFSHGKEMNSEQLLRPNH  364

Query  1105  IPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
             +P+NQVF+SVPGDYSRKPPIGE+LL+Y+ G KHA CIELFSRE+ AGWTSWGNEPLHFQ 
Sbjct  365   LPDNQVFISVPGDYSRKPPIGEILLDYVPGFKHARCIELFSREMIAGWTSWGNEPLHFQD  424

Query  1285  SKYFVSKN  1308
             SKYF+  N
Sbjct  425   SKYFLKYN  432



>ref|XP_006367298.1| PREDICTED: methyltransferase-like protein 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/422 (68%), Positives = 335/422 (79%), Gaps = 18/422 (4%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLET--  249
             ME++QL   ++SG+  L S NAFFIDPVR++N SYTR+RVSPS YYSRFFDS    ++  
Sbjct  1     MEENQL---MESGVSELNS-NAFFIDPVRILNHSYTRFRVSPSTYYSRFFDSLNSAQSPK  56

Query  250   -STESRKRKRNEKKTI-SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S +SRK KR  KK I SLNERE++A++RHQEV+P LLKAHEALL AT+LLKV+RNLR +
Sbjct  57    ASEDSRKGKRKRKKKIQSLNEREQIADRRHQEVKPFLLKAHEALLEATDLLKVLRNLRND  116

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VI  591
              C+  E +ELSQ+S ELSF++LG VWQAPL EIVLNYQ+ D  ++N G  L Q     V 
Sbjct  117   VCSVGECKELSQESSELSFMELGGVWQAPLCEIVLNYQQDDKTLQNGGFPLAQSIEQKVT  176

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             PAF+NLV N+GS D EAE  NHKYIIPK SCFYM     I +LIPA SD GFN+IVIDPP
Sbjct  177   PAFNNLVANEGSYDIEAELFNHKYIIPKRSCFYM-----IDSLIPAGSDCGFNLIVIDPP  231

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SA QK RY TLPNR+FLSLP+KQL HT+GALVALWVTNREKLR FVE +LFP WGV
Sbjct  232   WENGSARQKVRYPTLPNRYFLSLPVKQLCHTSGALVALWVTNREKLRDFVENDLFPKWGV  291

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS-DFSKLNAIPNNQVFM  1128
              Y  SFYWLKVKANG L  ELDLFHHRPYECLLLGY DGKD  S + ++LN IP+N+VF+
Sbjct  292   TYAASFYWLKVKANGMLTGELDLFHHRPYECLLLGYCDGKDTHSGNSTRLNPIPDNRVFI  351

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             SVPGDYSRKPPIGELLL+Y+ G+  A C+ELF+RE+ AGWTSWGNEPLHFQ S+YFVSK 
Sbjct  352   SVPGDYSRKPPIGELLLDYVPGSMPARCVELFAREMIAGWTSWGNEPLHFQDSRYFVSKT  411

Query  1309  RQ  1314
              +
Sbjct  412   ME  413



>ref|XP_002281794.2| PREDICTED: methyltransferase-like protein 2 [Vitis vinifera]
Length=447

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/413 (65%), Positives = 330/413 (80%), Gaps = 11/413 (3%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETS---T  255
             D+LS+FL SGIYRL+S NA FIDPVRV+NRSY+R+RVSPS YYSRFFDS  + + S   +
Sbjct  30    DRLSAFLSSGIYRLESCNAVFIDPVRVLNRSYSRFRVSPSMYYSRFFDSKHEDQESRFSS  89

Query  256   ESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectd  435
              SRKRKR EK+  +LNERE+ A++RHQE RPLLLKAHE+LL AT+LL V+ NLR + C+ 
Sbjct  90    NSRKRKRKEKQPHALNERERSADERHQEARPLLLKAHESLLEATDLLSVICNLRNDVCSL  149

Query  436   eerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS-----HLGQDVIPAF  600
              E  E S    E SFV+LG VWQAPLYEI+L++ +   +   +GS     +  + VIP F
Sbjct  150   TESEE-SLPIVEQSFVELGRVWQAPLYEIILHFHQ-HCNPSGDGSSPLIRYKEERVIPIF  207

Query  601   DNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWEN  780
             +NLVVN+ S + EAEFLN +Y+IP+ESCFYMSD+R+IHNLIPA+SD GF++IV+DPPWEN
Sbjct  208   NNLVVNETSDNVEAEFLNSRYVIPRESCFYMSDLRQIHNLIPAESDCGFSLIVVDPPWEN  267

Query  781   SSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYV  960
              SA QK  Y TLPNR+FLSLPIK+LTHT GAL+ALWVTNREKLR FVEKELFPAWGV Y 
Sbjct  268   KSASQKLVYSTLPNRYFLSLPIKKLTHTEGALIALWVTNREKLRGFVEKELFPAWGVSYA  327

Query  961   TSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDF-SKLNAIPNNQVFMSVP  1137
              +FYWLKVK++GSLIS+LDLFHHRPYECLLLGY  G+   S++ S+L  + +NQV +S+P
Sbjct  328   ATFYWLKVKSDGSLISDLDLFHHRPYECLLLGYCHGEGMDSEYQSRLKPLQDNQVIISIP  387

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             GDYSRKPPIGELL+EY+   K A CIELF+RE+ AGW SWGNEPLHFQ  +YF
Sbjct  388   GDYSRKPPIGELLMEYVPELKPARCIELFAREMQAGWISWGNEPLHFQELRYF  440



>emb|CBI19648.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/413 (65%), Positives = 330/413 (80%), Gaps = 11/413 (3%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETS---T  255
             D+LS+FL SGIYRL+S NA FIDPVRV+NRSY+R+RVSPS YYSRFFDS  + + S   +
Sbjct  8     DRLSAFLSSGIYRLESCNAVFIDPVRVLNRSYSRFRVSPSMYYSRFFDSKHEDQESRFSS  67

Query  256   ESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectd  435
              SRKRKR EK+  +LNERE+ A++RHQE RPLLLKAHE+LL AT+LL V+ NLR + C+ 
Sbjct  68    NSRKRKRKEKQPHALNERERSADERHQEARPLLLKAHESLLEATDLLSVICNLRNDVCSL  127

Query  436   eerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS-----HLGQDVIPAF  600
              E  E S    E SFV+LG VWQAPLYEI+L++ +   +   +GS     +  + VIP F
Sbjct  128   TESEE-SLPIVEQSFVELGRVWQAPLYEIILHFHQ-HCNPSGDGSSPLIRYKEERVIPIF  185

Query  601   DNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWEN  780
             +NLVVN+ S + EAEFLN +Y+IP+ESCFYMSD+R+IHNLIPA+SD GF++IV+DPPWEN
Sbjct  186   NNLVVNETSDNVEAEFLNSRYVIPRESCFYMSDLRQIHNLIPAESDCGFSLIVVDPPWEN  245

Query  781   SSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYV  960
              SA QK  Y TLPNR+FLSLPIK+LTHT GAL+ALWVTNREKLR FVEKELFPAWGV Y 
Sbjct  246   KSASQKLVYSTLPNRYFLSLPIKKLTHTEGALIALWVTNREKLRGFVEKELFPAWGVSYA  305

Query  961   TSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDF-SKLNAIPNNQVFMSVP  1137
              +FYWLKVK++GSLIS+LDLFHHRPYECLLLGY  G+   S++ S+L  + +NQV +S+P
Sbjct  306   ATFYWLKVKSDGSLISDLDLFHHRPYECLLLGYCHGEGMDSEYQSRLKPLQDNQVIISIP  365

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             GDYSRKPPIGELL+EY+   K A CIELF+RE+ AGW SWGNEPLHFQ  +YF
Sbjct  366   GDYSRKPPIGELLMEYVPELKPARCIELFAREMQAGWISWGNEPLHFQELRYF  418



>emb|CDP07562.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   523 bits (1347),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 317/422 (75%), Gaps = 16/422 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             ++LS FLKSGIYR +++ A FIDPVRV+NR YTR+RVSP+AYYSRFFD  +    S E  
Sbjct  8     ERLSRFLKSGIYRFENSTAIFIDPVRVLNRFYTRFRVSPTAYYSRFFDDDDHNGNSKEET  67

Query  265   KRKRNEKKTIS---------LNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
                  + +            LNE E +A++RHQEVRPLLLKAHE LLGATELL  ++ LR
Sbjct  68    PEAPPDSRKRKRKKEKKPRPLNETELIAQRRHQEVRPLLLKAHETLLGATELLAALKGLR  127

Query  418   ce---ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV  588
              +      +     L +++ EL+FV+LG VWQ+PLYEI LN+ +     ++ G  +    
Sbjct  128   SDGHFTDEECRGSALKREANELNFVELGRVWQSPLYEISLNFDQDQNFTQHGGDQIS---  184

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
             +P F+N VVN G  D EAE LN  YIIP++SCFYMSD+++IHNL+P + +SGFN+I+IDP
Sbjct  185   VPVFNNFVVNNGDNDVEAELLNRNYIIPRKSCFYMSDLKEIHNLVPVECESGFNLILIDP  244

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWENSSAHQK +Y+TLPNR+FLSLPI+QLTHT+GALVALWVTNREKLR FVE ELFP+WG
Sbjct  245   PWENSSAHQKLKYRTLPNRYFLSLPIEQLTHTSGALVALWVTNREKLRRFVENELFPSWG  304

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-NTSDFSKLNAIPNNQVF  1125
             VKY  +FYWLKVKA+G LIS+LDLFHHRPYECL+LGYS  KD +  + S    IP+NQVF
Sbjct  305   VKYAATFYWLKVKADGQLISQLDLFHHRPYECLVLGYSSQKDVDVVELSGHVPIPDNQVF  364

Query  1126  MSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             +SVPGDYSRKPPIG+LLLEY+ G+K  H +ELF+REL AGW  WGNEPLHFQ +KY + +
Sbjct  365   ISVPGDYSRKPPIGDLLLEYVPGSKDCHRLELFARELGAGWNCWGNEPLHFQDTKYILKR  424

Query  1306  NR  1311
              R
Sbjct  425   RR  426



>ref|XP_008220758.1| PREDICTED: methyltransferase-like protein 2 [Prunus mume]
Length=418

 Score =   516 bits (1328),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 267/421 (63%), Positives = 317/421 (75%), Gaps = 18/421 (4%)
 Frame = +1

Query  76    MED----DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST---  234
             MED    D+LS FL+SG+YRL+ +NA FIDPVRV+NRSYTR+RVSPSAYYSR FDS    
Sbjct  1     MEDSKTSDKLSEFLESGVYRLEDSNAVFIDPVRVLNRSYTRFRVSPSAYYSRSFDSKHAG  60

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             ++   S+  RKRKR EKK   LN+RE+ A+QRHQEVRP LLKAHE+L+ ATELL+VV NL
Sbjct  61    QEARVSSNFRKRKRKEKKPQPLNDRERAADQRHQEVRPFLLKAHESLVRATELLEVVSNL  120

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS----HLGQ  582
             +            S    E S V+LG VWQAPLYEI LN+   D+  E+ G+    +  Q
Sbjct  121   KGNLGPST-----SSPGAEQSLVELGRVWQAPLYEITLNFHPNDSAREDGGAPTIQYCEQ  175

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
                P F+NLVVN+ S D EAE LN +YI+P ES FYMSD+ +IHNLIPA+SD GFN+IVI
Sbjct  176   RAFPVFNNLVVNETSEDVEAELLNSRYILPPESSFYMSDLGQIHNLIPAESDCGFNLIVI  235

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN SA QKQRY TLPNR+FLSLP+KQ+ HT GALVALWVTNREKLR FVEKELFPA
Sbjct  236   DPPWENGSARQKQRYSTLPNRYFLSLPVKQICHTDGALVALWVTNREKLRGFVEKELFPA  295

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAI-PNN  1116
             WGVKYV +F+WLKVKA+GSLIS+LDLFHHRPYECLLLG   GK  ++   S    I P+N
Sbjct  296   WGVKYVATFFWLKVKADGSLISDLDLFHHRPYECLLLGLVHGKVTDSKQLSNTKPILPDN  355

Query  1117  QVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             Q+ +S+PGDYSRKPPI  LL EY    +   CIELF+RE++AGW SWGNEPLHFQ S+ F
Sbjct  356   QIMLSIPGDYSRKPPIAGLLHEYAPRLQRGRCIELFAREMTAGWISWGNEPLHFQESRNF  415

Query  1297  V  1299
             +
Sbjct  416   M  416



>ref|XP_009334519.1| PREDICTED: methyltransferase-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009334546.1| PREDICTED: methyltransferase-like protein 2 [Pyrus x bretschneideri]
Length=412

 Score =   513 bits (1320),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 256/417 (61%), Positives = 307/417 (74%), Gaps = 16/417 (4%)
 Frame = +1

Query  76    MEDDQ----LSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS-TEK  240
             MED +    LS+FL SG+YR + + A FIDPVRV+NRSYTR+RVSPSAYYSR F S  ++
Sbjct  1     MEDSKPAGKLSTFLDSGVYRFEDSTAVFIDPVRVLNRSYTRFRVSPSAYYSRSFKSKIQE  60

Query  241   LETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
                 + SRKR R EKK  +LN+RE+ A+QRHQE RP LLKAH++LL +TELL+VV NLR 
Sbjct  61    PRVCSNSRKRMRKEKKPQTLNDRERAADQRHQEARPFLLKAHKSLLRSTELLEVVSNLRD  120

Query  421   eectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS----HLGQDV  588
             +          +Q     S V+LG VWQAPLYEI LN Q  D   E+ GS    +  Q  
Sbjct  121   DFDNSASSPSTTQ-----SLVELGRVWQAPLYEITLNSQSHDNASEDGGSPVMEYCKQRA  175

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
             +P F+NLV+N+ S D EAE L  +YI+P ES FYMSD+ +IHNLIP +SD GFN+IV+DP
Sbjct  176   VPVFNNLVINETSEDVEAELLGSRYILPPESSFYMSDLGQIHNLIP-ESDCGFNLIVVDP  234

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN SA QK RY TLPNR+FLSLPIKQL HT GALVALWVTNREKLR FVEKELFPAWG
Sbjct  235   PWENGSARQKLRYSTLPNRYFLSLPIKQLCHTNGALVALWVTNREKLRGFVEKELFPAWG  294

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFM  1128
             V+Y  +FYWLKVKA+GSLI +LDLFHHRPYECLLLG   GK  T D S+   IP+NQ+ +
Sbjct  295   VEYAATFYWLKVKADGSLIGDLDLFHHRPYECLLLGLCPGK-ATDDNSRSKPIPDNQIML  353

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             S+PGDYSRKPP+   L EY  G + + C+ELF+RE++AG  SWGNEPLHFQ S  F 
Sbjct  354   SIPGDYSRKPPVARFLQEYSPGLQRSRCVELFAREMTAGCVSWGNEPLHFQESGNFT  410



>ref|XP_010246995.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246996.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Nelumbo 
nucifera]
Length=420

 Score =   504 bits (1297),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 258/426 (61%), Positives = 316/426 (74%), Gaps = 20/426 (5%)
 Frame = +1

Query  49    VQPEITGSGMEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD  228
             V+PE      ++++L  FL SGIYR +S+NA FIDPVR++N SYTR+RVSP+AYYSR F+
Sbjct  2     VEPE------KNEELFLFLDSGIYRFRSSNAIFIDPVRILNSSYTRFRVSPAAYYSRSFE  55

Query  229   STEKLET---STESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLK  399
               ++ ET   S  SRKRKR + K++  NE E+ A QRH   RPLLL+AHEALLG  +LL 
Sbjct  56    HIKREETPLASPSSRKRKRKQSKSLPRNETEESAHQRHLAARPLLLRAHEALLGVKDLLS  115

Query  400   VVRNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG  579
              + +++ +  +  E +EL      L FV+LG VWQAPLYE+ L ++  D   E+ G  L 
Sbjct  116   CLCDIKNDGRSSVESKEL------LPFVELGKVWQAPLYEMSLYFRPHDKQTEDGGMPLI  169

Query  580   Q----DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGF  747
             Q    +V+P F+NLVVNK S D EAEF    YIIP+ESCFYMSD+ +IHNLIP  SD GF
Sbjct  170   QCGEREVVPIFNNLVVNKTSDDLEAEFHTRWYIIPRESCFYMSDLGQIHNLIPDQSDHGF  229

Query  748   NIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEK  927
             N+IVIDPPWEN SA+QK  Y  LPNR+FLSLPIKQL+HT GALVALW+TNREKL+ FVEK
Sbjct  230   NLIVIDPPWENKSAYQKSVYSVLPNRYFLSLPIKQLSHTEGALVALWITNREKLQVFVEK  289

Query  928   ELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAI  1107
             ELFP WGV+YV   YWLKVK +GSLI +LDLFHHRPYECLLLGYS+ ++  SD       
Sbjct  290   ELFPIWGVRYVARLYWLKVKLDGSLIGDLDLFHHRPYECLLLGYSNVQEVASDHHSAFKR  349

Query  1108  P-NNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
             P +NQV +SVPGDYSRKPPIG+LLL+Y  G K A CIELF+REL AGWTSWGNE LHFQ 
Sbjct  350   PQDNQVIISVPGDYSRKPPIGKLLLDYAPGPKPARCIELFARELFAGWTSWGNETLHFQD  409

Query  1285  SKYFVS  1302
             S+YF++
Sbjct  410   SRYFLN  415



>ref|XP_007224950.1| hypothetical protein PRUPE_ppa021480mg [Prunus persica]
 gb|EMJ26149.1| hypothetical protein PRUPE_ppa021480mg [Prunus persica]
Length=460

 Score =   503 bits (1294),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 313/422 (74%), Gaps = 25/422 (6%)
 Frame = +1

Query  76    MED----DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST---  234
             MED    D+LS FL+SG+YRL+ +NA FIDPVRV+NRSYTR+RVSPSAYYSR FDS    
Sbjct  1     MEDSKTSDKLSEFLESGVYRLEDSNAVFIDPVRVLNRSYTRFRVSPSAYYSRSFDSKHAG  60

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             ++   S+  RKRKR EKK   LN+RE+ A+QRHQEVRP LLKAHE+L+ ATELL+VV NL
Sbjct  61    QEARVSSNFRKRKRKEKKPQPLNDRERAADQRHQEVRPFLLKAHESLVRATELLEVVSNL  120

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS----HLGQ  582
             +   C        S    E S V+LG VWQAPLYEI LN+   D   E+ G+    +  Q
Sbjct  121   KGNLCPST-----SSPGAEQSLVELGRVWQAPLYEITLNFHPNDNAREDGGAPTIQYDEQ  175

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
                P F+NLVVN+ S D EAE LN +YI+P ES FYMSD+ +IHNLIPA+SD GFN+IVI
Sbjct  176   RAFPVFNNLVVNETSEDVEAELLNSRYILPPESSFYMSDLGQIHNLIPAESDCGFNLIVI  235

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN SA QKQRY TLPNR+FLSLP+KQ+ HT GALVALWVTNREKLR FVEKELFPA
Sbjct  236   DPPWENGSARQKQRYSTLPNRYFLSLPVKQICHTDGALVALWVTNREKLRGFVEKELFPA  295

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNA------  1104
             WGVKYV +F+WLKVKA+GSLIS+LDLFHHRPYECLLLG   GK +    S +++      
Sbjct  296   WGVKYVATFFWLKVKADGSLISDLDLFHHRPYECLLLGLVHGKVSYCHCSIMDSKQLSST  355

Query  1105  ---IPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLH  1275
                + +NQ+ +S+PG YSRKPPI  LL EY    +   CIELF+RE++AGW SWGNEPLH
Sbjct  356   KPILLDNQIMLSIPGGYSRKPPIAGLLHEYAPRLQRGRCIELFAREMTAGWISWGNEPLH  415

Query  1276  FQ  1281
             FQ
Sbjct  416   FQ  417



>ref|XP_003544427.1| PREDICTED: methyltransferase-like protein 2-like isoform X1 [Glycine 
max]
 gb|KHN20998.1| Methyltransferase-like protein 2 [Glycine soja]
Length=428

 Score =   499 bits (1284),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 257/431 (60%), Positives = 311/431 (72%), Gaps = 22/431 (5%)
 Frame = +1

Query  73    GMEDD--QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLE  246
             G  DD  +LS F +SGIY    +NA F+DPVRV+NRSY R+ VSPS YYSRFF S     
Sbjct  3     GEHDDSQKLSLFYESGIYYFDDSNAVFVDPVRVLNRSYHRFTVSPSTYYSRFFKSPTTPN  62

Query  247   TSTES-----RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRN  411
             + + +     RKRKR  K+   LNERE +A QRHQE RPLLL AHE LL +TELL V++ 
Sbjct  63    SVSSTVSSSLRKRKRKPKEPPPLNERELIALQRHQEARPLLLAAHECLLKSTELLNVLKT  122

Query  412   LrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG----  579
             L+ E    ++  E  QQ    SFVDLG    +P  E+ L+ +  DA      + L     
Sbjct  123   LKSESRCSKKECEGGQQH---SFVDLGR--GSPQLEVTLSLRVSDADTHLPPNELEDSLS  177

Query  580   -----QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSG  744
                  Q V+PAF+NLV N    DA AE L++ YI+P+ESCFYMSD+ +I NLIPA +DSG
Sbjct  178   VQCCEQKVLPAFNNLVANDTKDDAVAEILDNCYIVPRESCFYMSDLGQIRNLIPAHADSG  237

Query  745   FNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVE  924
             FN+IV+DPPWEN+SAHQK RY TLPNR+FLSLPIKQLTHT GA+VALWVTNREKLRSFVE
Sbjct  238   FNLIVVDPPWENASAHQKSRYATLPNRYFLSLPIKQLTHTEGAIVALWVTNREKLRSFVE  297

Query  925   KELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLN  1101
             +ELFPAWGV Y  +FYWLKVK NGS I +LDLFHHRPYECL+LGYS GK +NT + SK  
Sbjct  298   RELFPAWGVSYAATFYWLKVKQNGSWICDLDLFHHRPYECLILGYSPGKVNNTDNQSKFK  357

Query  1102  AIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
              + N++V MS+PGD+SRKPPIG+LLLEY+ G K + CIELF+RE+ AGW +WGNEPL+FQ
Sbjct  358   PVKNDRVIMSIPGDFSRKPPIGDLLLEYVPGLKPSRCIELFAREIMAGWVAWGNEPLYFQ  417

Query  1282  ASKYFVSKNRQ  1314
              SKYFV K  Q
Sbjct  418   DSKYFVKKMDQ  428



>ref|XP_006434935.1| hypothetical protein CICLE_v10001360mg [Citrus clementina]
 gb|ESR48175.1| hypothetical protein CICLE_v10001360mg [Citrus clementina]
Length=403

 Score =   496 bits (1278),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/411 (63%), Positives = 308/411 (75%), Gaps = 27/411 (7%)
 Frame = +1

Query  88    QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRK  267
             +LS FL SGIYR +++NA FIDPVRV+NRSYTR++VSPSAYY RFF++       + S+K
Sbjct  11    ELSKFLDSGIYRFENSNAVFIDPVRVLNRSYTRFKVSPSAYYCRFFETN----VCSNSKK  66

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RKR +KK   LNERE  A+QRH+EV+PLLL AHEALL A +LL  V  L  +        
Sbjct  67    RKRKQKKAHMLNERELAADQRHREVKPLLLIAHEALLAAIDLLNFVGKLNGDFG------  120

Query  448   eLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVIPAFDNL  609
               S   C  E SF++LG VWQAP+YEI LN+        N+ S + Q     V+P F+NL
Sbjct  121   --SSMKCGVEESFIELGRVWQAPMYEITLNF--------NQCSVIDQFREPRVLPLFNNL  170

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             V N+   D EAE L+  YI+P+ESCF+MSD+ +IHNLIPADSD GFN+IVIDPPWEN SA
Sbjct  171   VANETGDDVEAEILDRTYILPRESCFFMSDLGQIHNLIPADSDCGFNLIVIDPPWENGSA  230

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
              QK  Y TLPNR+FLSLPIKQLTH+ GALVALW+TNREKLR FVEKELFP WGVKYV +F
Sbjct  231   RQKSVYPTLPNRYFLSLPIKQLTHSEGALVALWMTNREKLRDFVEKELFPTWGVKYVATF  290

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDF-SKLNAIPNNQVFMSVPGDY  1146
             YWLKVK +GSLIS+LDLFHHRPYE LLLGY  G   +S+  S L A+  NQV +S+PGDY
Sbjct  291   YWLKVKLDGSLISDLDLFHHRPYEYLLLGYCSGVVASSEHNSTLQAVKGNQVIISIPGDY  350

Query  1147  SRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             SRKPPI ELLLE++ G K A CIELF+RE++AGW SWGNEPLHFQ S+YF+
Sbjct  351   SRKPPIRELLLEHVPGPKPARCIELFAREMTAGWCSWGNEPLHFQESRYFL  401



>ref|XP_006473460.1| PREDICTED: methyltransferase-like protein 2-like isoform X3 [Citrus 
sinensis]
Length=403

 Score =   496 bits (1277),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/411 (63%), Positives = 306/411 (74%), Gaps = 27/411 (7%)
 Frame = +1

Query  88    QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRK  267
             +LS FL SGIYR +++N  FIDPVRV+NRSYTR+RVSPSAYY RFF++       +  +K
Sbjct  11    ELSKFLDSGIYRFENSNTVFIDPVRVLNRSYTRFRVSPSAYYCRFFETN----VCSNPKK  66

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RKR +KKT  LNERE  A+QRHQEV+PLLL AHEALL A +LL  V  L  +        
Sbjct  67    RKRKQKKTHMLNERELAADQRHQEVKPLLLIAHEALLAAIDLLNFVGKLNGDFG------  120

Query  448   eLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVIPAFDNL  609
               S   C  E SF++LG VWQAP+YEI LN+        N+ S + Q     V+P F+NL
Sbjct  121   --SSMKCGVEESFIELGRVWQAPMYEITLNF--------NQCSVIDQFREPRVLPLFNNL  170

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             V N+   D EAE L+  YI+P+ESCF+MSD+ +IHNLIPADSD GFN+IVIDPPWEN SA
Sbjct  171   VANETGDDVEAEILDRTYILPRESCFFMSDLGQIHNLIPADSDCGFNLIVIDPPWENGSA  230

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
              QK  Y TLPNR+FLSLPIKQLTH+ GALVALW+TNREKLR FVEKELFP WGVKYV + 
Sbjct  231   RQKSVYPTLPNRYFLSLPIKQLTHSEGALVALWMTNREKLRDFVEKELFPTWGVKYVATI  290

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDF-SKLNAIPNNQVFMSVPGDY  1146
             YWLKVK +GSLIS+LDLFHHRPYE LLLGY  G   +S+  S L A+  NQV +S+PGDY
Sbjct  291   YWLKVKLDGSLISDLDLFHHRPYEYLLLGYCSGVVASSEHNSTLQAVKGNQVIISIPGDY  350

Query  1147  SRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             SRKPPI ELLLE++ G K A CIELF+RE++AGW SWGNEPLHFQ S+YF+
Sbjct  351   SRKPPIRELLLEHVPGPKTARCIELFAREMTAGWCSWGNEPLHFQESRYFL  401



>ref|XP_009594619.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=390

 Score =   492 bits (1266),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 310/419 (74%), Gaps = 42/419 (10%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST  255
             M+++QL  F +SGIY+L S NAFFIDPVR++NRSYTR+RVSPS YYSRFFDS+   +   
Sbjct  1     MKNNQLQLFSESGIYQLTS-NAFFIDPVRILNRSYTRFRVSPSTYYSRFFDSSNSTQVPK  59

Query  256   ESRKRKRNEKKTI----SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S   ++ ++K      SLNERE++A++RHQEV+PLLLKAHEAL+ AT+LLKV+RNLR +
Sbjct  60    ASEDSRKRKRKQKKKPQSLNEREQIADRRHQEVKPLLLKAHEALIEATDLLKVLRNLRND  119

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG----QDVI  591
              C   E +ELS++S ELSF++LGSVWQAPLYEIVLNY + D    N GS L     Q V 
Sbjct  120   GCAVGECKELSEESSELSFMELGSVWQAPLYEIVLNYYQDDKTFHNGGSVLAQSIEQSVT  179

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLV N+GS D EAE  NHKYIIP  SCFYMSD+R+I NLIPADSD GFN+IVIDPP
Sbjct  180   PVFNNLVANEGSCDIEAELFNHKYIIPIRSCFYMSDLRQIENLIPADSDCGFNLIVIDPP  239

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SAHQK                                 REKLR FVE +LFP WGV
Sbjct  240   WENGSAHQKL--------------------------------REKLRGFVENDLFPKWGV  267

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSD-FSKLNAIPNNQVFM  1128
             KY  SFYWLKVKANG +  ELDLFHHRPYECLLLGY +GK+  SD   +LN IP+N+VF+
Sbjct  268   KYAASFYWLKVKANGMMTGELDLFHHRPYECLLLGYCEGKETDSDNIKRLNPIPDNRVFV  327

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             SVPGDYSRKPPIGELLL+Y+ G++ AHCIELF+RE+ AGWTSWGNEPLHFQ S+YFV+K
Sbjct  328   SVPGDYSRKPPIGELLLDYVPGSRPAHCIELFAREMIAGWTSWGNEPLHFQDSRYFVTK  386



>ref|XP_006473458.1| PREDICTED: methyltransferase-like protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006473459.1| PREDICTED: methyltransferase-like protein 2-like isoform X2 [Citrus 
sinensis]
Length=408

 Score =   493 bits (1268),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 256/416 (62%), Positives = 305/416 (73%), Gaps = 32/416 (8%)
 Frame = +1

Query  88    QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRK  267
             +LS FL SGIYR +++N  FIDPVRV+NRSYTR+RVSPSAYY RFF++       +  +K
Sbjct  11    ELSKFLDSGIYRFENSNTVFIDPVRVLNRSYTRFRVSPSAYYCRFFETN----VCSNPKK  66

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RKR +KKT  LNERE  A+QRHQEV+PLLL AHEALL A +LL  V  L  +        
Sbjct  67    RKRKQKKTHMLNERELAADQRHQEVKPLLLIAHEALLAAIDLLNFVGKLNGDFG------  120

Query  448   eLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVIPAFDNL  609
               S   C  E SF++LG VWQAP+YEI LN+        N+ S + Q     V+P F+NL
Sbjct  121   --SSMKCGVEESFIELGRVWQAPMYEITLNF--------NQCSVIDQFREPRVLPLFNNL  170

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             V N+   D EAE L+  YI+P+ESCF+MSD+ +IHNLIPADSD GFN+IVIDPPWEN SA
Sbjct  171   VANETGDDVEAEILDRTYILPRESCFFMSDLGQIHNLIPADSDCGFNLIVIDPPWENGSA  230

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
              QK  Y TLPNR+FLSLPIKQLTH+ GALVALW+TNREKLR FVEKELFP WGVKYV + 
Sbjct  231   RQKSVYPTLPNRYFLSLPIKQLTHSEGALVALWMTNREKLRDFVEKELFPTWGVKYVATI  290

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYSDG------KDNTSDFSKLNAIPNNQVFMS  1131
             YWLKVK +GSLIS+LDLFHHRPYE LLLGY  G        ++   S L A+  NQV +S
Sbjct  291   YWLKVKLDGSLISDLDLFHHRPYEYLLLGYCSGVVSLTVVASSEHNSTLQAVKGNQVIIS  350

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             +PGDYSRKPPI ELLLE++ G K A CIELF+RE++AGW SWGNEPLHFQ S+YF+
Sbjct  351   IPGDYSRKPPIRELLLEHVPGPKTARCIELFAREMTAGWCSWGNEPLHFQESRYFL  406



>ref|XP_009594621.1| PREDICTED: methyltransferase-like protein 2 isoform X3 [Nicotiana 
tomentosiformis]
Length=385

 Score =   491 bits (1263),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 253/377 (67%), Positives = 301/377 (80%), Gaps = 10/377 (3%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST  255
             M+++QL  F +SGIY+L S NAFFIDPVR++NRSYTR+RVSPS YYSRFFDS+   +   
Sbjct  1     MKNNQLQLFSESGIYQLTS-NAFFIDPVRILNRSYTRFRVSPSTYYSRFFDSSNSTQVPK  59

Query  256   ESRKRKRNEKKTI----SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S   ++ ++K      SLNERE++A++RHQEV+PLLLKAHEAL+ AT+LLKV+RNLR +
Sbjct  60    ASEDSRKRKRKQKKKPQSLNEREQIADRRHQEVKPLLLKAHEALIEATDLLKVLRNLRND  119

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VI  591
              C   E +ELS++S ELSF++LGSVWQAPLYEIVLNY + D    N GS L Q     V 
Sbjct  120   GCAVGECKELSEESSELSFMELGSVWQAPLYEIVLNYYQDDKTFHNGGSVLAQSIEQSVT  179

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLV N+GS D EAE  NHKYIIP  SCFYMSD+R+I NLIPADSD GFN+IVIDPP
Sbjct  180   PVFNNLVANEGSCDIEAELFNHKYIIPIRSCFYMSDLRQIENLIPADSDCGFNLIVIDPP  239

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SAHQK RY TLPNR++LSLP+KQL HT+G+LVALWVTNREKLR FVE +LFP WGV
Sbjct  240   WENGSAHQKLRYPTLPNRYYLSLPVKQLCHTSGSLVALWVTNREKLRGFVENDLFPKWGV  299

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSD-FSKLNAIPNNQVFM  1128
             KY  SFYWLKVKANG +  ELDLFHHRPYECLLLGY +GK+  SD   +LN IP+N+VF+
Sbjct  300   KYAASFYWLKVKANGMMTGELDLFHHRPYECLLLGYCEGKETDSDNIKRLNPIPDNRVFV  359

Query  1129  SVPGDYSRKPPIGELLL  1179
             SVPGDYSRKPPIGE+ L
Sbjct  360   SVPGDYSRKPPIGEISL  376



>gb|KDP38467.1| hypothetical protein JCGZ_04392 [Jatropha curcas]
Length=424

 Score =   492 bits (1266),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 313/419 (75%), Gaps = 12/419 (3%)
 Frame = +1

Query  82    DDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTES  261
             +D+LS+FL SGIYR +S+NA FIDPVR++N SY R+RVSPS YYSRFFD     +   E+
Sbjct  7     NDRLSTFLDSGIYRFESSNAVFIDPVRMLNSSYARFRVSPSTYYSRFFDPKRADQGRDET  66

Query  262   R------KRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
             +      KRKR  K++ SLNERE+ A+QRH +VRP+L+KA E L+ AT+LL ++R+LR +
Sbjct  67    KLPSSSKKRKRKVKRSHSLNERERAADQRHVQVRPMLMKALEFLMAATDLLAIMRDLRSD  126

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVI  591
              C+ + R  +     E SF++LG +WQAPLYEI L +       ++  +   Q     ++
Sbjct  127   FCSSQRRE-VPLPGSEQSFIELGRIWQAPLYEITLKFPHHHEPSKDADTLPDQCSWRRIL  185

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLVVN+   D EAEFLN KY++P++SCFYMSD+ +I NLIP +SD GFN+IV+DPP
Sbjct  186   PVFNNLVVNETCDDVEAEFLNGKYVLPRQSCFYMSDLGQIRNLIPDESDCGFNLIVVDPP  245

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN+SA QK  Y TLPNR+FLSLPIKQLTHT GALVALWVTNREKLR FVEKELFP WGV
Sbjct  246   WENASASQKLLYPTLPNRYFLSLPIKQLTHTDGALVALWVTNREKLRDFVEKELFPTWGV  305

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAIPNNQVFM  1128
              Y  SFYWLKVKA+GSLI++LDLFHHRPYECLLLGY   +  N+   S   AI +N++ +
Sbjct  306   NYAASFYWLKVKADGSLITDLDLFHHRPYECLLLGYCRREGTNSEQMSSWRAIEHNEIII  365

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             S+PGDYSRKPPIGELLLE++ G K   CIELF+RE+  GWTSWGNEPL FQ   YF+ +
Sbjct  366   SIPGDYSRKPPIGELLLEHVPGPKPVRCIELFAREMIGGWTSWGNEPLRFQGLNYFIER  424



>ref|XP_004291901.1| PREDICTED: methyltransferase-like protein 2-like [Fragaria vesca 
subsp. vesca]
Length=410

 Score =   490 bits (1262),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 252/415 (61%), Positives = 313/415 (75%), Gaps = 24/415 (6%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+L+ FLKSGIYR + +NA FIDP+RV+NRSY+R+RVSPSAYY R F+ST   E +  S 
Sbjct  8     DKLTEFLKSGIYRFEDSNAVFIDPIRVLNRSYSRFRVSPSAYYCRRFESTCPPEPTVASS  67

Query  265   KRKRNEKKTI---SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectd  435
              RKR  K+     +LN+RE+VA++RHQEVR LL+KAHE+L+ ++E+L+V+ NLR  E   
Sbjct  68    SRKRKRKEKKKPQALNDREQVADRRHQEVRALLVKAHESLMRSSEVLEVMSNLRGSETW-  126

Query  436   eerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VIPAFD  603
                        E SFV+L  VWQAPLYEI LNY+ G    E+ GSH  QD    V+P F+
Sbjct  127   -------SPGVEQSFVELALVWQAPLYEISLNYKAG----EDGGSHATQDCEQCVLPVFN  175

Query  604   NLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENS  783
             NLVVN+ S D EAE L  +YI+P +S FYMSD+ +I NLIPA+SD GF++IV+DPPWEN 
Sbjct  176   NLVVNESSNDVEAEVLKSRYILPPKSSFYMSDMGQIRNLIPAESDCGFSVIVVDPPWENG  235

Query  784   SAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVT  963
             SA QK RY+TLPN +FLS+PIKQL+HT GALVALWVTNREKLR FVEKELFPAWGV +V 
Sbjct  236   SARQKLRYKTLPNHYFLSIPIKQLSHTDGALVALWVTNREKLRDFVEKELFPAWGVTHVA  295

Query  964   SFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKL---NAIPNNQVFMSV  1134
             +F+WLKVKA+GSLI +LDLFHHRPYECLL+G   GK    +F +L   + IP+NQ+ +SV
Sbjct  296   TFFWLKVKADGSLICDLDLFHHRPYECLLVGIYHGK--VMNFEQLLGSDHIPDNQIILSV  353

Query  1135  PGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             PGDYSRKPPIG LL E+    K   CIELF+RE+++GW SWGNEPLHFQ S+ FV
Sbjct  354   PGDYSRKPPIGGLLQEFAPRLKGGRCIELFAREMTSGWVSWGNEPLHFQESRNFV  408



>ref|XP_009594622.1| PREDICTED: methyltransferase-like protein 2 isoform X4 [Nicotiana 
tomentosiformis]
Length=385

 Score =   488 bits (1255),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 251/373 (67%), Positives = 298/373 (80%), Gaps = 10/373 (3%)
 Frame = +1

Query  76    MEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST  255
             M+++QL  F +SGIY+L S NAFFIDPVR++NRSYTR+RVSPS YYSRFFDS+   +   
Sbjct  1     MKNNQLQLFSESGIYQLTS-NAFFIDPVRILNRSYTRFRVSPSTYYSRFFDSSNSTQVPK  59

Query  256   ESRKRKRNEKKTI----SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
              S   ++ ++K      SLNERE++A++RHQEV+PLLLKAHEAL+ AT+LLKV+RNLR +
Sbjct  60    ASEDSRKRKRKQKKKPQSLNEREQIADRRHQEVKPLLLKAHEALIEATDLLKVLRNLRND  119

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD----VI  591
              C   E +ELS++S ELSF++LGSVWQAPLYEIVLNY + D    N GS L Q     V 
Sbjct  120   GCAVGECKELSEESSELSFMELGSVWQAPLYEIVLNYYQDDKTFHNGGSVLAQSIEQSVT  179

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F+NLV N+GS D EAE  NHKYIIP  SCFYMSD+R+I NLIPADSD GFN+IVIDPP
Sbjct  180   PVFNNLVANEGSCDIEAELFNHKYIIPIRSCFYMSDLRQIENLIPADSDCGFNLIVIDPP  239

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SAHQK RY TLPNR++LSLP+KQL HT+G+LVALWVTNREKLR FVE +LFP WGV
Sbjct  240   WENGSAHQKLRYPTLPNRYYLSLPVKQLCHTSGSLVALWVTNREKLRGFVENDLFPKWGV  299

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSD-FSKLNAIPNNQVFM  1128
             KY  SFYWLKVKANG +  ELDLFHHRPYECLLLGY +GK+  SD   +LN IP+N+VF+
Sbjct  300   KYAASFYWLKVKANGMMTGELDLFHHRPYECLLLGYCEGKETDSDNIKRLNPIPDNRVFV  359

Query  1129  SVPGDYSRKPPIG  1167
             SVPGDYSRKPPIG
Sbjct  360   SVPGDYSRKPPIG  372



>ref|XP_011031456.1| PREDICTED: methyltransferase-like protein 2 [Populus euphratica]
 ref|XP_011031463.1| PREDICTED: methyltransferase-like protein 2 [Populus euphratica]
Length=406

 Score =   488 bits (1256),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/407 (60%), Positives = 315/407 (77%), Gaps = 18/407 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+L +FL+SGIYR +++N  FIDPVR++NRSYTR+R SPSAYYSRFFDS E + TS   +
Sbjct  8     DKLPAFLESGIYRFENSNVVFIDPVRMLNRSYTRFRSSPSAYYSRFFDSKETIATSDSKK  67

Query  265   KRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeer  444
             ++++ +KK   LNERE+ A  RHQ+VRP+LLKAH  L+ AT+LL ++++LR +       
Sbjct  68    RKRKEKKKPHDLNEREQAATLRHQQVRPMLLKAHVFLMEATDLLAIMKDLRGDSNICSST  127

Query  445   reLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG-QDVIPAFDNLVVNK  621
               LS+Q    SF++LG VWQAP YEI+L           +G+  G + V+P F+NLVVN+
Sbjct  128   E-LSEQH---SFIELGKVWQAPFYEIIL-----------KGAWKGLERVVPVFNNLVVNE  172

Query  622   GSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQ  801
              S D EAEFLN+KYI+P+ESCFYMSD+ ++HNLI  + + GFN+IVIDPPWEN SA QK 
Sbjct  173   TSDDMEAEFLNNKYILPRESCFYMSDLGQVHNLI-HECNVGFNLIVIDPPWENGSARQKL  231

Query  802   RYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLK  981
             RY+TLPNR+FLSLPIKQL H  GALVALW+TNREKL +FV+KELFP+WGV +  ++YWLK
Sbjct  232   RYRTLPNRYFLSLPIKQLAHPDGALVALWMTNREKLHNFVQKELFPSWGVSHEATYYWLK  291

Query  982   VKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAIPNNQVFMSVPGDYSRKP  1158
             VKA+GSLIS+LDLFHHRPYECLLLGY  G+  N+    +L  I ++Q+ +S+PG+YSRKP
Sbjct  292   VKADGSLISDLDLFHHRPYECLLLGYFHGQGTNSKQPPRLRPIKHDQIIISIPGEYSRKP  351

Query  1159  PIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             PIGELLLE +   K A CIELF+RE++AGWTSWGNEPLHFQ S +FV
Sbjct  352   PIGELLLEDVPDFKPARCIELFAREMTAGWTSWGNEPLHFQQSTFFV  398



>ref|XP_006595943.1| PREDICTED: methyltransferase-like protein 2-like isoform X2 [Glycine 
max]
Length=421

 Score =   480 bits (1236),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 252/431 (58%), Positives = 305/431 (71%), Gaps = 29/431 (7%)
 Frame = +1

Query  73    GMEDD--QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLE  246
             G  DD  +LS F +SGIY    +NA F+DPVRV+NRSY R+ VSPS YYSRFF S     
Sbjct  3     GEHDDSQKLSLFYESGIYYFDDSNAVFVDPVRVLNRSYHRFTVSPSTYYSRFFKSPTTPN  62

Query  247   TSTES-----RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRN  411
             + + +     RKRKR  K+   LNERE +A QRHQE RPLLL AHE LL +TELL V++ 
Sbjct  63    SVSSTVSSSLRKRKRKPKEPPPLNERELIALQRHQEARPLLLAAHECLLKSTELLNVLKT  122

Query  412   LrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG----  579
             L+ E    ++  E  QQ    SFVDLG    +P  E+ L+ +  DA      + L     
Sbjct  123   LKSESRCSKKECEGGQQH---SFVDLGR--GSPQLEVTLSLRVSDADTHLPPNELEDSLS  177

Query  580   -----QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSG  744
                  Q V+PAF+NLV N    DA AE L++ YI+P+ESCFYMSD+ +I NLIPA +DSG
Sbjct  178   VQCCEQKVLPAFNNLVANDTKDDAVAEILDNCYIVPRESCFYMSDLGQIRNLIPAHADSG  237

Query  745   FNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVE  924
             FN+IV+DPPWEN+SAHQK RY       FLSLPIKQLTHT GA+VALWVTNREKLRSFVE
Sbjct  238   FNLIVVDPPWENASAHQKSRY-------FLSLPIKQLTHTEGAIVALWVTNREKLRSFVE  290

Query  925   KELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLN  1101
             +ELFPAWGV Y  +FYWLKVK NGS I +LDLFHHRPYECL+LGYS GK +NT + SK  
Sbjct  291   RELFPAWGVSYAATFYWLKVKQNGSWICDLDLFHHRPYECLILGYSPGKVNNTDNQSKFK  350

Query  1102  AIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
              + N++V MS+PGD+SRKPPIG+LLLEY+ G K + CIELF+RE+ AGW +WGNEPL+FQ
Sbjct  351   PVKNDRVIMSIPGDFSRKPPIGDLLLEYVPGLKPSRCIELFAREIMAGWVAWGNEPLYFQ  410

Query  1282  ASKYFVSKNRQ  1314
              SKYFV K  Q
Sbjct  411   DSKYFVKKMDQ  421



>ref|XP_010060916.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67811.1| hypothetical protein EUGRSUZ_F01540 [Eucalyptus grandis]
Length=427

 Score =   479 bits (1234),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 244/424 (58%), Positives = 317/424 (75%), Gaps = 9/424 (2%)
 Frame = +1

Query  61    ITGSGMEDDQ-LSSFLKSGIYRLQ-SANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS-  231
             + G G E  + LS FL+SG+YRL+ S  A F+DPVRV+NR+  R+ +SPSAYYSRFF+  
Sbjct  1     MGGDGSEPRRSLSLFLESGVYRLEGSGGAVFVDPVRVLNRALARFSISPSAYYSRFFEPG  60

Query  232   -TEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
              +E     +  RKRKR  +K + LN+RE+VA QRHQE RP L+KAHEAL+GATEL  ++ 
Sbjct  61    PSEADRGGSNGRKRKRRARKPLVLNDRERVAAQRHQEARPFLVKAHEALVGATELRSLML  120

Query  409   NLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG---  579
              ++ E  T E+R+ L+      SF++LG +WQAPLYEI LN+ +     +   S +    
Sbjct  121   KMKGEVATAEDRK-LAPPGVPPSFIELGRLWQAPLYEITLNFLQEKPTGDGGPSIIHSKE  179

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             Q VIP F+NLV N    D EAEFL  +Y+IP+ESCFYMSD+++IH +IP + D+ F+ IV
Sbjct  180   QKVIPIFNNLVHNGTKDDLEAEFLGSQYVIPRESCFYMSDLQQIHRMIPVEGDAHFHFIV  239

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPWEN SA QK RY TLPN++FLSLP++QL H  GALVALWVTNREKLR+FVEKELFP
Sbjct  240   IDPPWENGSAQQKSRYPTLPNKYFLSLPVQQLAHREGALVALWVTNREKLRNFVEKELFP  299

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-NTSDFSKLNAIPNN  1116
             AWGVK++ +FYWLKVK++GSLI +LDLFHHRPYEC+LLG+ D +  +  D S+L+ I + 
Sbjct  300   AWGVKFLATFYWLKVKSDGSLICDLDLFHHRPYECILLGFCDKEGMDPRDLSRLSTIQDK  359

Query  1117  QVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             +V MSVPGDYSRKPP+ EL+LEY+ GTK A C+ELF+R++ AGW SWGNEPLHFQ  +YF
Sbjct  360   RVLMSVPGDYSRKPPLEELVLEYIPGTKPARCVELFARDMRAGWYSWGNEPLHFQEMRYF  419

Query  1297  VSKN  1308
               ++
Sbjct  420   QKRD  423



>gb|EPS60488.1| hypothetical protein M569_14315, partial [Genlisea aurea]
Length=417

 Score =   478 bits (1231),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 246/416 (59%), Positives = 307/416 (74%), Gaps = 13/416 (3%)
 Frame = +1

Query  82    DDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETST--  255
             D+ +  F++SGI+RL  ANAFF+DPVR++NRS+TR+RVSP AYYSR F  +++ E ++  
Sbjct  5     DEGVEGFMESGIFRLDEANAFFVDPVRILNRSHTRFRVSPHAYYSRSFSHSDRSEGNSVG  64

Query  256   ---ESRKRKRN--EKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
                 SRKRK    +KK I+ N RE++AEQRHQ+VR LLLKAHEA L A     ++  L+ 
Sbjct  65    SLENSRKRKSRGMDKKKIT-NSREQMAEQRHQDVRLLLLKAHEAFLAANREFGILHYLKS  123

Query  421   eectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLN-YQEGDAHIENEGSHLGQD-VIP  594
             E     E   L Q+S  + FV+LGS +QAPLY+IVL  ++E +   EN G  +  + V+P
Sbjct  124   EIGEFSEESVLQQKSG-VDFVELGSTFQAPLYDIVLKVHEEEETSTENGGQLVCNERVLP  182

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F+NLV N+ + D EA  + + + +PK S FYMSD+R IHNL+PA SD GFN+IVIDPPW
Sbjct  183   LFNNLVSNENNEDIEAVIMGNTFFLPKRSSFYMSDLRDIHNLVPAKSDEGFNLIVIDPPW  242

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             ENSSAHQK +Y+TLPNR+FLSLPI +L HT GALVALWVTNREKLR FVE ELFP WG K
Sbjct  243   ENSSAHQKMKYRTLPNRYFLSLPINRLAHTDGALVALWVTNREKLRIFVETELFPKWGTK  302

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGY-SDGKDNTSDFSKLNAIPNNQVFMS  1131
             +V + YWLKVK +GSLISELDLFHHRPYECLLLG+ S G+   S   + + I +NQ+F+S
Sbjct  303   HVATSYWLKVKPDGSLISELDLFHHRPYECLLLGFCSGGEGEKSHDPETSIIRHNQIFIS  362

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             +PGDYSRKPPIG LL EYM   K   CIELFSREL +GWT WGNEPLHFQ S YF+
Sbjct  363   IPGDYSRKPPIGALLAEYMK-PKTMRCIELFSRELISGWTCWGNEPLHFQHSNYFL  417



>ref|XP_010685196.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=441

 Score =   478 bits (1230),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 239/423 (57%), Positives = 304/423 (72%), Gaps = 23/423 (5%)
 Frame = +1

Query  100   FLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRKRKR-  276
             FL+SGIYR  +++ FFIDPVR +NR+YT++RVSPS+YY RFF + E+ +   E  +  + 
Sbjct  13    FLESGIYRFPASSTFFIDPVRTLNRNYTQFRVSPSSYYPRFF-TEEQQQNHDEGVQEDKC  71

Query  277   ------------NEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
                          + +  +LNE+E +A+QRHQE+RPLL+KAHE LL   ELL V+  L+C
Sbjct  72    SSRKRKRNQKNKKKHQCYTLNEKELLADQRHQEIRPLLVKAHEELLKVKELLDVMCELQC  131

Query  421   eectdeerreLSQQSC---ELSFVDLGSVWQAPLYEIVLNYQEGDAH-IENEGS----HL  576
             E+   E   +L        E+SF +LG VWQAPLYEI L++ + + H IEN GS    H 
Sbjct  132   EDEGWERCVDLDCGGIKEEEVSFFELGKVWQAPLYEIALDFAQANKHVIENGGSPDTQHD  191

Query  577   GQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNII  756
              Q + P F+NLV N+   D  AEF    YI+PK+SCFYMS++ +IH  +PADSD GFN I
Sbjct  192   DQTLFPLFNNLVSNETDNDMVAEFQTSLYILPKDSCFYMSELEQIHTFVPADSDCGFNFI  251

Query  757   VIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELF  936
             ++DPPWEN SA+QK +Y TLPNR FLSLPIKQLTHT+GALVALWVTNREKLR FVE ELF
Sbjct  252   MVDPPWENRSAYQKSKYPTLPNRHFLSLPIKQLTHTSGALVALWVTNREKLRKFVEDELF  311

Query  937   PAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNN  1116
             PAWGV+Y  + YWLKVKANGSLI +LDLFHHRPYECLLLGY+      S+   ++ +  +
Sbjct  312   PAWGVRYAATLYWLKVKANGSLICDLDLFHHRPYECLLLGYTGSHGIESELLSVSNL-KD  370

Query  1117  QVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             QV +++PGDYSRKPP+ ELLLEY+ G+K A C+ELF+RE+  GWTSWGNEPLHFQ  +YF
Sbjct  371   QVVITIPGDYSRKPPVEELLLEYVPGSKPARCLELFAREMMGGWTSWGNEPLHFQEKRYF  430

Query  1297  VSK  1305
               K
Sbjct  431   SRK  433



>ref|XP_008444687.1| PREDICTED: methyltransferase-like protein 2 [Cucumis melo]
Length=420

 Score =   476 bits (1225),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 243/410 (59%), Positives = 304/410 (74%), Gaps = 6/410 (1%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEK-LETST--  255
             D+LS FL+SGIYR   +   F+DPVRV+NR Y+R+RVSP+ YYSRFF+   K LE     
Sbjct  10    DELSVFLESGIYRFVDSRFIFVDPVRVLNRLYSRFRVSPAGYYSRFFECERKGLENKDCL  69

Query  256   -ESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
                +KRKR EKK   LNE+E  A++RHQ  +PLLLKA+E+LL AT+LL V R+L  E   
Sbjct  70    LYGKKRKRKEKKLRCLNEKECAADRRHQVAKPLLLKAYESLLQATDLLSVTRSLNRESGC  129

Query  433   deerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLV  612
              E R+     S   S ++ G VWQAPLYEI L   E D   E  GS     V+P F+NLV
Sbjct  130   SEGRKLFDLPSDHQSLIEHGRVWQAPLYEITLKLPEHDQSSEVGGSSFKDRVVPLFNNLV  189

Query  613   VNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAH  792
             VN+ S + EAEFL+H+YI+P+ESCFYMSD+R +HNLIPA++ SGF++I+IDPPWEN SA 
Sbjct  190   VNETSDEVEAEFLDHQYILPRESCFYMSDLRLVHNLIPAEASSGFSLILIDPPWENGSAQ  249

Query  793   QKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFY  972
             QK +Y TLPNR FL+LPIK+L+H  GALVALWVTNREK   F++ ELFPAWGV +++++Y
Sbjct  250   QKSKYPTLPNRHFLALPIKKLSHGKGALVALWVTNREKFHRFIDLELFPAWGVIHISTYY  309

Query  973   WLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKL-NAIPNNQVFMSVPGDYS  1149
             WLKVKA+GSLIS+LDLFHHRPYECLLLGY  G+D   D   L   +P ++V +S+PGDYS
Sbjct  310   WLKVKADGSLISDLDLFHHRPYECLLLGYCYGED-VKDVKLLEQTLPKDRVIISIPGDYS  368

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             RKPPI ELL EY+ G K   CIELF+RE++ GW SWGNEPLHFQ S+YF+
Sbjct  369   RKPPIAELLQEYVPGPKPGRCIELFAREMNPGWLSWGNEPLHFQESQYFI  418



>ref|XP_002890329.1| hypothetical protein ARALYDRAFT_472157 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66588.1| hypothetical protein ARALYDRAFT_472157 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   471 bits (1211),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/416 (57%), Positives = 298/416 (72%), Gaps = 23/416 (6%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+L+ FL SGIY    +N FF+DPVR+ NRSYTR+RVSPSAYYSRFF+S +  + S++S 
Sbjct  5     DKLAQFLDSGIYESDDSNWFFLDPVRITNRSYTRFRVSPSAYYSRFFNSKQLNQQSSDSN  64

Query  265   KRKRNEKKTISLNEREKVAEQ----RHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
              RKR  K+         V EQ    RHQE R  L KAHE+ L   EL+ + + L  ++ +
Sbjct  65    PRKRKRKQKDPSFHLPSVGEQASNLRHQEARLFLSKAHESFLKDVELVNLTKGLSDDDSS  124

Query  433   deerreLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG-QDVIPAFD  603
                   L  + C  ELSF++LG VWQAP YEI LN+   +   +NEG     Q V   F+
Sbjct  125   ------LLNKCCDDELSFIELGGVWQAPFYEITLNF---NLCCDNEGETCNEQRVFQVFN  175

Query  604   NLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENS  783
             NLVVN+   +  AEF N +YI+P++SCFYMSD+  I NL+P  S+ GFN+IVIDPPWEN+
Sbjct  176   NLVVNETGEEVGAEFSNRRYIMPRKSCFYMSDLLHIRNLVPGKSEEGFNLIVIDPPWENA  235

Query  784   SAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVT  963
             SAHQK +Y TLPNR+FLSLPIKQL H  GALVALWVTNREKL SFVEKELFPAWG+KYV 
Sbjct  236   SAHQKSKYPTLPNRYFLSLPIKQLAHAEGALVALWVTNREKLLSFVEKELFPAWGIKYVA  295

Query  964   SFYWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQVFMS  1131
             + YWLKVK +G+LI +LDL HH+PYE LLLGY      G ++ SDF  L+    NQ+ MS
Sbjct  296   TMYWLKVKPDGTLICDLDLVHHKPYEYLLLGYRYTELPGSEHRSDFKLLD---KNQIIMS  352

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             +PGD+SRKPPIGE+LL++  G++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF+
Sbjct  353   IPGDFSRKPPIGEILLKHTPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSRYFL  408



>ref|XP_007160783.1| hypothetical protein PHAVU_001G016200g [Phaseolus vulgaris]
 gb|ESW32777.1| hypothetical protein PHAVU_001G016200g [Phaseolus vulgaris]
Length=427

 Score =   467 bits (1201),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 297/422 (70%), Gaps = 22/422 (5%)
 Frame = +1

Query  88    QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRK  267
             +LSSF +SG+Y    +NA F+D VRV+NR Y R+ VSPS YYSRFF +     + + +  
Sbjct  9     KLSSFYESGVYSFDDSNAVFVDSVRVLNRFYHRFSVSPSTYYSRFFKTQTTPNSVSSTVT  68

Query  268   RK-----RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
                    R  +++  LNERE +A QRHQE RPLLL AHE LL +TE+L  ++ L+ E   
Sbjct  69    SSLRKRKRRRRESRPLNERELIALQRHQEARPLLLAAHECLLKSTEVLNALKALKSESSC  128

Query  433   deerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENE----------GSHLGQ  582
                  +  Q+S    FVDLG V  AP  E+ L+ +  D   +                 Q
Sbjct  129   STRECDGGQRS----FVDLGHV--APQLEVTLSLRVSDTDADPHPLPKDLDDFPSGQCVQ  182

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
              V+ AF+N+V N    DA AE L++ YI+P+ESCFYMSD+ +I NLIPA +D+GFN+I++
Sbjct  183   KVLRAFNNVVANDTQDDAVAEILSNPYIMPRESCFYMSDLGQIRNLIPAHADAGFNLIMV  242

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN+SAHQK RYQTLPNR+FLSLPIKQLTHT GALVALWVTNREKLRSF+E ELFPA
Sbjct  243   DPPWENASAHQKSRYQTLPNRYFLSLPIKQLTHTEGALVALWVTNREKLRSFIESELFPA  302

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAIPNNQ  1119
             WGV Y  +FYWLKVK NGSLI +LDLFHHRPYECL+LGYS GK +NT + S+   + N++
Sbjct  303   WGVSYAATFYWLKVKENGSLICDLDLFHHRPYECLILGYSPGKVNNTDNLSEFKPVKNDR  362

Query  1120  VFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             V MS+PGDYSRKPPI +LL+E++ G K   CIELF+RE+ AGW +WGNEPL+FQ SKYFV
Sbjct  363   VIMSIPGDYSRKPPIADLLVEHVPGLKPPRCIELFAREILAGWVAWGNEPLYFQDSKYFV  422

Query  1300  SK  1305
              K
Sbjct  423   KK  424



>ref|XP_004499129.1| PREDICTED: methyltransferase-like protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499130.1| PREDICTED: methyltransferase-like protein 2-like isoform X2 [Cicer 
arietinum]
Length=435

 Score =   467 bits (1202),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 301/434 (69%), Gaps = 29/434 (7%)
 Frame = +1

Query  79    EDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS---------  231
             E  +L  F +SGIY    +NA FIDPVRV+NRSY R+ VSPS YY RFF +         
Sbjct  3     ESQKLPLFHESGIYHFNDSNAVFIDPVRVLNRSYNRFTVSPSTYYPRFFQTLTPNPVPIT  62

Query  232   TEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRN  411
                  T  + +K KR  K+   LN+RE +A QRHQE+RPLLLKAHE LL + ELL  +R 
Sbjct  63    VSSSPTKRKRKKPKRTPKEPPPLNDRELIALQRHQELRPLLLKAHECLLKSNELLDAIRT  122

Query  412   LrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQ----EGDAHIENEGS---  570
             LR    +   + E   +  E  FV+LG  WQ+P   + LN +    + D+H   + +   
Sbjct  123   LRSGSDSYCLKEEC--EGGEQCFVELG--WQSPDLVVTLNVRLCDTDNDSHDRTQNNLED  178

Query  571   --------HLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIP  726
                        Q ++PAF+NLVVN    DA AE +N++YI+P+ESCFYMSD+ +I NLIP
Sbjct  179   FSDSPSVQCCEQRILPAFNNLVVNDTEDDAVAEIMNNRYIMPQESCFYMSDLGQIRNLIP  238

Query  727   ADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREK  906
             A +D GFN+I++DPPWEN+SA+QK RY TLPNR+FLSLPIKQLTHT GALVALWVTNREK
Sbjct  239   AHTDCGFNLIMVDPPWENASAYQKSRYPTLPNRYFLSLPIKQLTHTEGALVALWVTNREK  298

Query  907   LRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTS  1083
             LRSFVEKELF AWGV Y  SF+WLKVKANGS IS+LDLFHHRPYE L+LGYS GK  N+ 
Sbjct  299   LRSFVEKELFAAWGVSYAASFHWLKVKANGSWISDLDLFHHRPYESLILGYSPGKVKNSD  358

Query  1084  DFSKLNAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGN  1263
             D SK   +  ++V MS+PGDYSRKPPI +LL EY+ G K   CIELF+RE+ AGW +WGN
Sbjct  359   DHSKFKPVKEDRVIMSIPGDYSRKPPIADLLQEYVPGVKPPRCIELFAREIMAGWVAWGN  418

Query  1264  EPLHFQASKYFVSK  1305
             EPLHFQ S+YFV K
Sbjct  419   EPLHFQDSRYFVKK  432



>gb|AAM61513.1| unknown [Arabidopsis thaliana]
Length=414

 Score =   466 bits (1199),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/414 (56%), Positives = 295/414 (71%), Gaps = 15/414 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+L+ FL SGIY     N FF+D VR+ NRSYTR++VSPSAYYSRFF+S +  + S+ES 
Sbjct  5     DKLAQFLDSGIYESDEFNWFFLDTVRITNRSYTRFKVSPSAYYSRFFNSKQLNQQSSESN  64

Query  265   KRKRNEKKTISLNEREKVAEQ----RHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
              +KR  K+  S      V EQ    RHQE R  L KAHE+ L   ELL + + L  +   
Sbjct  65    PKKRKRKQKNSSFHLPSVGEQASNLRHQEARLFLSKAHESFLKEIELLSLTKGLSDDNDD  124

Query  433   deerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG-QDVIPAFDNL  609
             D+          E+SF++LG VWQAP YEI L++   + H +NEG     Q V   F+NL
Sbjct  125   DDSSLLNKCCDDEVSFIELGGVWQAPFYEITLSF---NLHCDNEGESCNEQRVFQVFNNL  181

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             VVN+   + EAEF N +YI+P+ SCFYMSD+  I NL+PA S+ G+N+IVIDPPWEN+SA
Sbjct  182   VVNEIGEEVEAEFSNRRYIMPRNSCFYMSDLHHIRNLVPAKSEEGYNLIVIDPPWENASA  241

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
             HQK +Y TLPN++FLSLPIKQL H  GALVALWVTNREKL SFVEKELFPAWG+KYV + 
Sbjct  242   HQKSKYPTLPNQYFLSLPIKQLAHAEGALVALWVTNREKLLSFVEKELFPAWGIKYVATM  301

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQVFMSVP  1137
             YWLKVK +G+LI +LDL HH+PYE LLLGY      G +  SDF  L+    NQ+ MS+P
Sbjct  302   YWLKVKPDGTLICDLDLVHHKPYEYLLLGYHFTELAGSEKRSDFKLLD---KNQIIMSIP  358

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             GD+SRKPPIG++LL++  G++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF+
Sbjct  359   GDFSRKPPIGDILLKHTPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSRYFL  412



>ref|NP_564080.1| methyltransferase-like protein 2 [Arabidopsis thaliana]
 sp|Q8LFA9.2|METL2_ARATH RecName: Full=Methyltransferase-like protein 2 [Arabidopsis thaliana]
 gb|AEE29833.1| methyltransferase-like protein 2 [Arabidopsis thaliana]
Length=414

 Score =   465 bits (1196),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 233/414 (56%), Positives = 295/414 (71%), Gaps = 15/414 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+L+ FL SGIY     N FF+D VR+ NRSYTR++VSPSAYYSRFF+S +  + S+ES 
Sbjct  5     DKLAQFLDSGIYESDEFNWFFLDTVRITNRSYTRFKVSPSAYYSRFFNSKQLNQHSSESN  64

Query  265   KRKRNEKKTISLNEREKVAEQ----RHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
              +KR  K+  S      V EQ    RHQE R  L KAHE+ L   ELL + + L  +   
Sbjct  65    PKKRKRKQKNSSFHLPSVGEQASNLRHQEARLFLSKAHESFLKEIELLSLTKGLSDDNDD  124

Query  433   deerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG-QDVIPAFDNL  609
             D+          E+SF++LG VWQAP YEI L++   + H +NEG     Q V   F+NL
Sbjct  125   DDSSLLNKCCDDEVSFIELGGVWQAPFYEITLSF---NLHCDNEGESCNEQRVFQVFNNL  181

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             VVN+   + EAEF N +YI+P+ SCFYMSD+  I NL+PA S+ G+N+IVIDPPWEN+SA
Sbjct  182   VVNEIGEEVEAEFSNRRYIMPRNSCFYMSDLHHIRNLVPAKSEEGYNLIVIDPPWENASA  241

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
             HQK +Y TLPN++FLSLPIKQL H  GALVALWVTNREKL SFVEKELFPAWG+KYV + 
Sbjct  242   HQKSKYPTLPNQYFLSLPIKQLAHAEGALVALWVTNREKLLSFVEKELFPAWGIKYVATM  301

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQVFMSVP  1137
             YWLKVK +G+LI +LDL HH+PYE LLLGY      G +  SDF  L+    NQ+ MS+P
Sbjct  302   YWLKVKPDGTLICDLDLVHHKPYEYLLLGYHFTELAGSEKRSDFKLLD---KNQIIMSIP  358

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             GD+SRKPPIG++LL++  G++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF+
Sbjct  359   GDFSRKPPIGDILLKHTPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSRYFL  412



>gb|KGN62578.1| hypothetical protein Csa_2G361440 [Cucumis sativus]
Length=416

 Score =   461 bits (1187),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 245/418 (59%), Positives = 307/418 (73%), Gaps = 14/418 (3%)
 Frame = +1

Query  76    MED-----DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD----  228
             MED     D+LS FL+SGIYR   +   F+DPVRV+NRSY+R+RVSP+ YYSRFFD    
Sbjct  1     MEDRCLARDELSVFLESGIYRFVDSRFIFVDPVRVLNRSYSRFRVSPAGYYSRFFDYERK  60

Query  229   STEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
               E  +  +  +KRKR EKK   LNE+E  A+QRHQ  +PLLLKA+E LL AT+LL V R
Sbjct  61    GLENKDCLSYGKKRKRKEKKLRCLNEKECAADQRHQVAKPLLLKAYELLLQATDLLSVTR  120

Query  409   NLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV  588
             +L  E  + E R   S        ++ G +WQAPLYEI L   E D   E  GS     V
Sbjct  121   SLNRESGSSEGRNLPSDHQL---LIEHGRIWQAPLYEITLKLPEHDQSSEVGGSSFKDRV  177

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
             +P F+NLVVN+ S + EAEFL+H+YI+P+ESCFYMSD+R++HNLIPA + SGF++I+IDP
Sbjct  178   VPLFNNLVVNETSDEVEAEFLDHQYILPRESCFYMSDLRQVHNLIPAKASSGFSLILIDP  237

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN SA QK +Y TLPNR+FL+LPIK+L+H  GALVALWVTNREK   F++ ELFPAWG
Sbjct  238   PWENGSAQQKSKYPTLPNRYFLALPIKKLSHGKGALVALWVTNREKFHRFIDLELFPAWG  297

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLN-AIPNNQVF  1125
             V +++++YWLKVKA+GSLIS+LDLFHHRPYECLLLGY  G+D   D   L+  +P ++V 
Sbjct  298   VVHISTYYWLKVKADGSLISDLDLFHHRPYECLLLGYCYGED-VQDVKILDQTLPKDRVI  356

Query  1126  MSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             +S+PGDYSRKPPI ELL EY+ G K   CIELF+RE++ GW SWGNEPLHFQ S+YF 
Sbjct  357   ISIPGDYSRKPPIAELLQEYVPGPKPGRCIELFAREMNPGWLSWGNEPLHFQESQYFT  414



>gb|KEH40098.1| methyltransferase-like protein [Medicago truncatula]
Length=422

 Score =   461 bits (1187),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 244/426 (57%), Positives = 298/426 (70%), Gaps = 23/426 (5%)
 Frame = +1

Query  76    MEDDQ-LSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETS  252
             MED Q LS F KSG+Y  + +N  FIDPVRV+NR Y R+ VSPS YY RFF S     T 
Sbjct  1     MEDSQKLSLFHKSGVYNFKDSNTVFIDPVRVLNRFYNRFTVSPSTYYPRFFKSLTPKTTV  60

Query  253   TES------RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
               S      +KRKR  +++  LN+RE++A QRHQE+RPLL+KAHE LL +  LL  +++L
Sbjct  61    PSSPTKRKRKKRKRCSEESRPLNDREQIALQRHQELRPLLMKAHECLLKSNGLLGALKDL  120

Query  415   rceectdeerreLSQQSCEL---SFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ-  582
             R E  +        ++ CE     FV+LG   QAP   + LN    D   + E S   Q 
Sbjct  121   RSESDSCCL-----KEECECGEQCFVELGQ--QAPDLVVTLNLCIRDIDKDMEDSPNVQY  173

Query  583   ----DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFN  750
                  ++P F+N VVN    DA AE LN+ YI+P+ESCFYMSD+ +I NLIPA +D GFN
Sbjct  174   CEQRSILPVFNNFVVNDTEDDAMAEILNNHYIMPRESCFYMSDLGQIRNLIPAHTDCGFN  233

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +I++DPPWEN+SAHQK RY TLPNR+FLSLPIKQLTHT GALVALWVTNREKLRSFVEKE
Sbjct  234   LIMVDPPWENASAHQKSRYSTLPNRYFLSLPIKQLTHTEGALVALWVTNREKLRSFVEKE  293

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAI  1107
             LF  WGV Y  SF+WLKVKANGSLI +LDLFHHRPYE L+LGYS GK  N+ + SK   +
Sbjct  294   LFATWGVSYAASFHWLKVKANGSLIGDLDLFHHRPYESLILGYSPGKVKNSDNQSKFKPL  353

Query  1108  PNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
              ++ V MS+PGDYSRKPPI +LL EY+ G K   C+ELF+RE+ AG  +WGNEPLHFQ S
Sbjct  354   KDDHVIMSIPGDYSRKPPIADLLQEYIPGVKPPRCVELFAREIMAGCVAWGNEPLHFQDS  413

Query  1288  KYFVSK  1305
             +YFV K
Sbjct  414   RYFVKK  419



>ref|XP_004152710.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
2-like [Cucumis sativus]
Length=420

 Score =   460 bits (1183),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 243/421 (58%), Positives = 306/421 (73%), Gaps = 16/421 (4%)
 Frame = +1

Query  76    MED-----DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD----  228
             MED     D+LS FL+SGIYR   +   F+DPVRV+NRSY+R+RVSP+ YYSRFFD    
Sbjct  1     MEDRCLARDELSVFLESGIYRFVDSRFIFVDPVRVLNRSYSRFRVSPAGYYSRFFDYERK  60

Query  229   STEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
               E  +  +  +KRKR EKK   LNE+E  A+QRHQ  +PLLLKA+E LL AT+LL V R
Sbjct  61    GLENKDCLSYGKKRKRKEKKLRCLNEKECAADQRHQVAKPLLLKAYELLLQATDLLSVTR  120

Query  409   NLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV  588
             +L  E  + E R   S        ++ G +WQAPLYEI L   E D   E  GS     V
Sbjct  121   SLNRESGSSEGRNLPSDHQL---LIEHGRIWQAPLYEITLKLPEHDQSSEVGGSSFKDRV  177

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
             +P F+NLVVN+ S + EAEFL+H+YI+P+ESCFYMSD+R++HNLIPA + SGF++I+IDP
Sbjct  178   VPLFNNLVVNETSDEVEAEFLDHQYILPRESCFYMSDLRQVHNLIPAKASSGFSLILIDP  237

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN SA QK +Y TLPNR+FL+LPIK+L+H  GALVALWVTNREK   F++ ELFPAWG
Sbjct  238   PWENGSAQQKSKYPTLPNRYFLALPIKKLSHGKGALVALWVTNREKFHRFIDLELFPAWG  297

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKL----NAIPNN  1116
             V +++++YWLKVKA+GSLIS+LDLFHHRPYECLLLGY  G+ +  D   +      +P +
Sbjct  298   VVHISTYYWLKVKADGSLISDLDLFHHRPYECLLLGYCYGEVSIXDVQDVKILDQTLPKD  357

Query  1117  QVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             +V +S+PGDYSRKPPI ELL EY+ G K   CIELF+RE++ GW SWGNEPLHFQ S+YF
Sbjct  358   RVIISIPGDYSRKPPIAELLQEYVPGPKPGRCIELFAREMNPGWLSWGNEPLHFQESQYF  417

Query  1297  V  1299
              
Sbjct  418   T  418



>ref|XP_010498348.1| PREDICTED: methyltransferase-like protein 2 [Camelina sativa]
Length=422

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/423 (54%), Positives = 302/423 (71%), Gaps = 26/423 (6%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD----STEKLETS  252
             D+L+ FL SGIY    +N FF+DPVR++NRSYT++R SPSAYY+RFF+    +++  + +
Sbjct  5     DKLAQFLDSGIYESDDSNWFFLDPVRIINRSYTKFRASPSAYYTRFFNPKHLNSQPKDPN  64

Query  253   TESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
                RKRK+        N  E+ +  RHQ+ R  L KA E+ LG TELL + + L  ++ +
Sbjct  65    PRKRKRKQKNPSFHLPNAGEQASYLRHQDARLFLSKALESFLGETELLSLTKALSDDDGS  124

Query  433   deerreLSQQSCE--LSFVDLGSVWQAPLYEIVLNYQEGDAHIEN-EGSHLGQ----DVI  591
                   L  + CE  LSFV+LG VWQAPLYEI LN+   + H +N EG  + +     V 
Sbjct  125   S-----LLTKCCEDGLSFVELGGVWQAPLYEITLNF---NLHCDNNEGCLIDKCNEKRVF  176

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F+NLVVN+   + EAEF N +YI+P++SCFYMSD+  I NL+PA    GFN+IVIDPP
Sbjct  177   QVFNNLVVNESGEEVEAEFSNRRYIMPRKSCFYMSDLLHIRNLVPAKPKEGFNLIVIDPP  236

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN+SAHQK +Y TLPNR+FLSLPIKQL H  GALVALWVTNREKL +FVEKELFPAWGV
Sbjct  237   WENASAHQKSKYPTLPNRYFLSLPIKQLAHAEGALVALWVTNREKLLNFVEKELFPAWGV  296

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQ  1119
             KYV + YWLKVK +G+LI +LDL HH+PYE LLLGY      G ++ SDF  L+    NQ
Sbjct  297   KYVATKYWLKVKPDGTLICDLDLVHHKPYEYLLLGYRFTELAGSEHRSDFKLLD---KNQ  353

Query  1120  VFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             + +S+PGD+SRKPP+GE+L++++ G++ A C+ELF+RE++AGWTSWGNEPLHFQ  +YF+
Sbjct  354   IIISIPGDFSRKPPLGEILMKHVPGSQPARCLELFAREMAAGWTSWGNEPLHFQDLRYFL  413

Query  1300  SKN  1308
               N
Sbjct  414   KDN  416



>ref|XP_010533242.1| PREDICTED: methyltransferase-like protein 2 [Tarenaya hassleriana]
Length=412

 Score =   451 bits (1160),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/414 (55%), Positives = 293/414 (71%), Gaps = 14/414 (3%)
 Frame = +1

Query  82    DDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS----TEKLET  249
             D  L+ FL SGIY        F+DPVR++NRSYTR+ VS S+YYSRF  S     +  + 
Sbjct  5     DHNLALFLDSGIYESDDPEWVFLDPVRILNRSYTRFGVSSSSYYSRFVGSGHPNRQPSDP  64

Query  250   STESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceec  429
             +++ RKRK+       L+  E+ A  RHQE RP+LLKAHE+ +   ELL  +  L     
Sbjct  65    NSKKRKRKQRNPNPNPLSAGEQAANLRHQEARPMLLKAHESFVQEFELLSAMEGLSDTGD  124

Query  430   tdeerreLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFD  603
             +      +S +SC  ELS V+LG VWQAPLYEI+LN        +++G      V+PAF+
Sbjct  125   SS-----VSIKSCGHELSLVELGRVWQAPLYEIMLNLNP--RLDDDDGCSTEHRVVPAFN  177

Query  604   NLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENS  783
             NLV+N+   + EAEFL+ KYIIP++SCFYMSD+ +I NLI A  D GFN+IVIDPPWEN+
Sbjct  178   NLVMNETGEEIEAEFLDRKYIIPRKSCFYMSDLLQIRNLIAARPDEGFNLIVIDPPWENA  237

Query  784   SAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVT  963
             SAHQK +Y TLPNR+FLSLPIKQL H  GA+VALWVTNREKL  FVEKELFPAWGV+Y  
Sbjct  238   SAHQKSKYPTLPNRYFLSLPIKQLAHAEGAVVALWVTNREKLLKFVEKELFPAWGVRYSA  297

Query  964   SFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFS-KLNAIPNNQVFMSVPG  1140
             + +WLKVK +GSLIS+LDL HH+PYE LLLGY   +   S+ S +L  +   Q+ +S+PG
Sbjct  298   TMFWLKVKPDGSLISDLDLTHHKPYEYLLLGYYFREFPGSECSPELKPMKERQIIISIPG  357

Query  1141  DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             D+SRKPP+GELL +Y  G + A CIELF+RE++AGWT+WGNEPLHFQ S+YF++
Sbjct  358   DFSRKPPVGELLKKYAPGPQPARCIELFAREMAAGWTAWGNEPLHFQDSRYFLT  411



>ref|XP_010477143.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Camelina 
sativa]
Length=420

 Score =   448 bits (1152),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 300/420 (71%), Gaps = 26/420 (6%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTE---KLETST  255
             ++L+ FL SGIY    +N FF+DPVR++NRSYT++RVSPSAYY+RFF+      +L    
Sbjct  5     EKLAQFLDSGIYESDDSNWFFLDPVRIINRSYTKFRVSPSAYYTRFFNPKHLNPQLNDPN  64

Query  256   ESRKRKRNEKKTISL-NEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
               +++++ +  T  L N  E+ +  RHQ+ R  L KA E+ LG TELL + + L  ++  
Sbjct  65    PKKRKRKQKDPTFQLPNAGEQASNLRHQDARLFLSKALESFLGETELLSLTKALSDDDGY  124

Query  433   deerreLSQQSCE--LSFVDLGSVWQAPLYEIVLNYQEGDAHIE-NEGSHLGQ----DVI  591
                   L  + C+  LSFV+LG VWQAPLYEI LN+   + H + NEG  + +     V 
Sbjct  125   S-----LLTKCCDDGLSFVELGGVWQAPLYEITLNF---NLHCDSNEGCLIDKCNEKRVF  176

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F+NLVVN+   + EAEF N ++I+P++SCFYMSD+  I NL+PA    G+N+IVIDPP
Sbjct  177   QVFNNLVVNENGEEVEAEFSNRRFIMPRKSCFYMSDLLHIRNLVPAKPAEGYNLIVIDPP  236

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN+SAHQK +Y TLPNR+FLSLPIKQL H  GALVALWVTNREKL +FVEKELFPAWGV
Sbjct  237   WENASAHQKSKYPTLPNRYFLSLPIKQLAHAEGALVALWVTNREKLLNFVEKELFPAWGV  296

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQ  1119
             KYV + YWLKVK + +LI +LDL HH+PYE LLLGY      G ++ SDF  L+    NQ
Sbjct  297   KYVATMYWLKVKPDCTLICDLDLVHHKPYEYLLLGYRFTELAGSEHRSDFKLLD---KNQ  353

Query  1120  VFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             + +S+PGD+SRKPP+GE+L++++ G++ A C+ELF+RE++AGWTSWGNEPLHFQ  +YF+
Sbjct  354   IIISIPGDFSRKPPLGEILMKHVPGSQPARCLELFAREMAAGWTSWGNEPLHFQDLRYFL  413



>gb|KFK44069.1| hypothetical protein AALP_AA1G212000 [Arabis alpina]
Length=412

 Score =   446 bits (1147),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 230/421 (55%), Positives = 300/421 (71%), Gaps = 31/421 (7%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST------EKLE  246
             DQL+ F+ SGIY  + +  FF+DPVR+ NRSYTR+RVSPS+YYSRFF+S       + + 
Sbjct  5     DQLAWFIDSGIYESEDSTWFFLDPVRITNRSYTRFRVSPSSYYSRFFNSKHLNPQQQPIN  64

Query  247   TSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrcee  426
              + + RKRK+    T   +  E+ +  RHQEVR  L + HE+LL   ELL + + L  + 
Sbjct  65    PNPKKRKRKQKNPNTHLPSVAEQASNLRHQEVRLFLSETHESLLREIELLSLTKCLSDD-  123

Query  427   ctdeerreLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG----QDV  588
                     L  + C  ELSFV+LG VWQAPLYEI LN    + H +NEG        Q V
Sbjct  124   --------LLNKCCGDELSFVELGGVWQAPLYEITLNL---NLHCDNEGCSTENCNEQRV  172

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F+NLVVN+   + EAEF N +YI+P++SCFYMSD++ I NL+PA  + GFN+IVIDP
Sbjct  173   FQVFNNLVVNEREEEVEAEFSNRRYIMPRKSCFYMSDLQHIRNLVPAKPEEGFNLIVIDP  232

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN+SAHQK +Y TLPNR+FLSLPIKQL H  GALVALWVTNREKL +FVEKELFPAWG
Sbjct  233   PWENASAHQKSKYPTLPNRYFLSLPIKQLAHAEGALVALWVTNREKLLNFVEKELFPAWG  292

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNN  1116
             +KY  + YWLKVK +G+LI +LDL HH+PYE LLLGY      G +++SDF   N +  N
Sbjct  293   IKYAATIYWLKVKPDGTLICDLDLVHHKPYEYLLLGYCFTELAGSEHSSDF---NLLDKN  349

Query  1117  QVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             ++ +S+PGD+SRKPPIG++L +++ G++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF
Sbjct  350   KIIISIPGDFSRKPPIGDILKKHVPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSRYF  409

Query  1297  V  1299
             +
Sbjct  410   L  410



>ref|XP_010943156.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Elaeis 
guineensis]
Length=422

 Score =   446 bits (1147),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 295/422 (70%), Gaps = 22/422 (5%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTE--  258
             D+  SFL SGIYRL  +   F+DPVR++N SY+R+R+SPS+YYSR F ST++     E  
Sbjct  7     DEFKSFLDSGIYRLDGSKVVFVDPVRLLNDSYSRFRISPSSYYSRSFQSTDRRRVVEEVN  66

Query  259   ----SRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrcee  426
                 S+K+++ +K    LNEREK AE+RHQE R LLLKAH A L A EL   +  L    
Sbjct  67    VPSISKKKRKRKKTPRDLNEREKSAEKRHQEARSLLLKAHRAFLEAAELQTFLPKLVKCV  126

Query  427   ctdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEG------SHLGQDV  588
                        ++ E +F++LGS WQAPLYEI L + +      NEG      +H+G+ V
Sbjct  127   EFSR-----GGETEEKNFIELGSCWQAPLYEIGLCFPKS-----NEGEDSWLANHVGRTV  176

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
             +P F+NL+ ++ + + EAEF N +YI+P  SCFYMSD+R+I NLIPA SD GFN+IVIDP
Sbjct  177   VPLFNNLISHETNDEVEAEFNNSQYILPGRSCFYMSDLRQIRNLIPAKSDQGFNLIVIDP  236

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN SA QK  Y TLPNR+FL LP+K+L H  GALVALW+TNREKL  FVEK+LFPAWG
Sbjct  237   PWENGSARQKAAYPTLPNRYFLYLPVKELAHAEGALVALWMTNREKLHMFVEKDLFPAWG  296

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFM  1128
             V  VT  YWLKVK +GSLI ELDLFHHRPYE LLLGY + ++  S+      + + +V +
Sbjct  297   VTNVTLCYWLKVKPDGSLIGELDLFHHRPYEYLLLGYINMENIDSECMPAVNLEDARVII  356

Query  1129  SVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             S+PG +SRKP +G+LL +++ G K   CIELF+REL AGWTSWGNEPLHFQ S+YFV K+
Sbjct  357   SIPGVHSRKPALGKLLWDHIPGNKPVKCIELFARELMAGWTSWGNEPLHFQDSRYFVEKD  416

Query  1309  RQ  1314
             ++
Sbjct  417   KK  418



>ref|XP_010459600.1| PREDICTED: methyltransferase-like protein 2 [Camelina sativa]
Length=425

 Score =   446 bits (1147),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 296/421 (70%), Gaps = 19/421 (5%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD----STEKLETS  252
             ++L+ F+ SGIY    +N FF+DPVR++NRSYT++RVSPSAYY+RFF+    +++  + +
Sbjct  5     EKLAQFIDSGIYESDDSNWFFLDPVRIINRSYTKFRVSPSAYYTRFFNPKHLNSQPKDPN  64

Query  253   TESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
                RKRK+        N  E  +  RHQ+ R  L KA ++ LG TELLK+ + L  ++  
Sbjct  65    PRKRKRKQKAPSFHLPNAGELASNLRHQDARLFLSKALDSFLGETELLKLTKGLSDDDDN  124

Query  433   deerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIEN-EGSHLG----QDVIPA  597
             D+           LSFV+LG VWQAPLYEI L++   + H +N EG  +     + V   
Sbjct  125   DDSSLLTKCFDDGLSFVELGGVWQAPLYEITLDF---NLHCDNNEGCLIDNCNEKRVFQV  181

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+NLVVN+   + EAEF N +YI+P++SCFYMSD+  I NL+PA    GFN+IVIDPPWE
Sbjct  182   FNNLVVNESGEEVEAEFSNRRYIMPRKSCFYMSDLLHIRNLVPAKPAEGFNLIVIDPPWE  241

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N+SAHQK +Y TLPNR+FLSLPIKQL H  GALVALWVTNREKL +FVEKELFPAWGVKY
Sbjct  242   NASAHQKSKYPTLPNRYFLSLPIKQLAHAEGALVALWVTNREKLLNFVEKELFPAWGVKY  301

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQVF  1125
               + YWLKVK + +LI +LDL HH+PYE LLLGY      G +  SDF  L+     Q+ 
Sbjct  302   AATMYWLKVKPDSALICDLDLVHHKPYEYLLLGYCFTELSGSETRSDFKVLD---KKQII  358

Query  1126  MSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             +S+PGD+SRKPPIGE+L++++ G++ A C+ELF+RE++AGWTSWGNEPLHFQ  +YF+  
Sbjct  359   ISIPGDFSRKPPIGEILMKHVPGSQRARCLELFAREMAAGWTSWGNEPLHFQDLRYFLKD  418

Query  1306  N  1308
             N
Sbjct  419   N  419



>ref|XP_006307629.1| hypothetical protein CARUB_v10009255mg [Capsella rubella]
 gb|EOA40527.1| hypothetical protein CARUB_v10009255mg [Capsella rubella]
Length=420

 Score =   445 bits (1144),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 299/423 (71%), Gaps = 27/423 (6%)
 Frame = +1

Query  82    DDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST----EKLET  249
             D     FL SGIY    ++ FF+DPVR++NRSYT+++VS SAYY+RFF+S     +  + 
Sbjct  5     DKLAQQFLDSGIYESDDSDWFFLDPVRLINRSYTKFKVSRSAYYTRFFNSKHLNLQPRDP  64

Query  250   STESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceec  429
             + + RKRK+        +  E+ +++RHQ+ R  L K+HE+ L  TELL + + L  +  
Sbjct  65    NPKKRKRKQKNPSFQLPSAGEQASDRRHQDARLFLSKSHESFLRETELLSLTKGLSDDSS  124

Query  430   tdeerreLSQQSCE--LSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVI  591
                    L  + C+  LSFV+LG VWQAPLYEI LN+   + H +++G  + +     V 
Sbjct  125   -------LLTKCCDDGLSFVELGGVWQAPLYEITLNF---NLHCDDKGCSIDKCNEKRVF  174

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F+NLVVN+   + EAEF N +YI+P +S FYMSD+  I NL+PA    GFN+IVIDPP
Sbjct  175   QVFNNLVVNESGEEVEAEFSNRRYIMPTKSSFYMSDLLHIRNLVPAKPAEGFNLIVIDPP  234

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN+SAHQK +Y TLPNR+FLSLPIKQL H  GA+VALWVTNREKL +FVEKELFPAWG+
Sbjct  235   WENASAHQKSKYPTLPNRYFLSLPIKQLAHAEGAVVALWVTNREKLLNFVEKELFPAWGI  294

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQ  1119
             KYV + YWLKVK +G+LI +LDL HH+PYE LLLGY      G ++ S+F+ L+    NQ
Sbjct  295   KYVATMYWLKVKPDGTLICDLDLVHHKPYEYLLLGYRYTKLAGSEHRSNFTLLD---KNQ  351

Query  1120  VFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             V +S+PG++SRKPPIGE+L++++ G++ A C+ELF+RE++AGWTSWGNEPLHFQ SKYF+
Sbjct  352   VIISIPGEFSRKPPIGEILMKHVPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSKYFL  411

Query  1300  SKN  1308
               N
Sbjct  412   KDN  414



>ref|XP_009395619.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395620.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=420

 Score =   442 bits (1137),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 291/423 (69%), Gaps = 19/423 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRL--QSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST------EK  240
             D++ SFL +GIYRL    +   F+DPVR++N SYTR+ VSPSAYYSR F++T      + 
Sbjct  3     DEVRSFLDTGIYRLVRDGSKVVFLDPVRIINHSYTRFWVSPSAYYSRSFETTTAALKTDA  62

Query  241   LETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
             +E S   +KRKR  +    LNE E+ A +RHQE R  LL AH+A L A EL  ++  L  
Sbjct  63    VEDSRILKKRKRT-RAPRDLNESERAAVKRHQEARTFLLNAHKAFLEAAELQALLPELVK  121

Query  421   eectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD-----  585
              E +       ++++ E  F+ LGS+WQAPLYEI L ++  +   +  G  LG       
Sbjct  122   SEVSLP-----TRRASEQKFIQLGSLWQAPLYEISLCFRNKNLSDDTGGYRLGDHGGTII  176

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             V   ++NL+ N+ + D EAEF +++YI+P  SCF+MSD++++ NL+PA S  GFN IVID
Sbjct  177   VHQLYNNLICNETNEDVEAEFQSNRYILPSRSCFHMSDLQQVRNLVPAHSKDGFNFIVID  236

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN SA QK  Y TLPNR+FL LP+K+L H  GALVALW+TNREKLR FVE ELFPAW
Sbjct  237   PPWENGSACQKAVYPTLPNRYFLYLPVKELAHEGGALVALWMTNREKLRIFVENELFPAW  296

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVF  1125
             GV      YWLKVK +GSLI ELDLFHHRPYECLLLGY + +++ S       +  NQV 
Sbjct  297   GVTKFVLSYWLKVKPDGSLIGELDLFHHRPYECLLLGYINLQNDDSRAMPFEYLGINQVI  356

Query  1126  MSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             +S+PGDYSRKPP+G+LL +++ G K A CIELF+REL AGWTSWGNEPLHFQ SKYFV +
Sbjct  357   VSIPGDYSRKPPLGQLLKDHIPGPKPAKCIELFARELGAGWTSWGNEPLHFQDSKYFVER  416

Query  1306  NRQ  1314
             + +
Sbjct  417   DNE  419



>ref|XP_010943155.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Elaeis 
guineensis]
Length=423

 Score =   441 bits (1135),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 295/423 (70%), Gaps = 23/423 (5%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTE--  258
             D+  SFL SGIYRL  +   F+DPVR++N SY+R+R+SPS+YYSR F ST++     E  
Sbjct  7     DEFKSFLDSGIYRLDGSKVVFVDPVRLLNDSYSRFRISPSSYYSRSFQSTDRRRVVEEVN  66

Query  259   ----SRKRKRNEKKTISLNEREKVAEQRHQ-EVRPLLLKAHEALLGATELLKVVRNLrce  423
                 S+K+++ +K    LNEREK AE+RHQ E R LLLKAH A L A EL   +  L   
Sbjct  67    VPSISKKKRKRKKTPRDLNEREKSAEKRHQQEARSLLLKAHRAFLEAAELQTFLPKLVKC  126

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEG------SHLGQD  585
                         ++ E +F++LGS WQAPLYEI L + +      NEG      +H+G+ 
Sbjct  127   VEFSR-----GGETEEKNFIELGSCWQAPLYEIGLCFPKS-----NEGEDSWLANHVGRT  176

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             V+P F+NL+ ++ + + EAEF N +YI+P  SCFYMSD+R+I NLIPA SD GFN+IVID
Sbjct  177   VVPLFNNLISHETNDEVEAEFNNSQYILPGRSCFYMSDLRQIRNLIPAKSDQGFNLIVID  236

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN SA QK  Y TLPNR+FL LP+K+L H  GALVALW+TNREKL  FVEK+LFPAW
Sbjct  237   PPWENGSARQKAAYPTLPNRYFLYLPVKELAHAEGALVALWMTNREKLHMFVEKDLFPAW  296

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVF  1125
             GV  VT  YWLKVK +GSLI ELDLFHHRPYE LLLGY + ++  S+      + + +V 
Sbjct  297   GVTNVTLCYWLKVKPDGSLIGELDLFHHRPYEYLLLGYINMENIDSECMPAVNLEDARVI  356

Query  1126  MSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             +S+PG +SRKP +G+LL +++ G K   CIELF+REL AGWTSWGNEPLHFQ S+YFV K
Sbjct  357   ISIPGVHSRKPALGKLLWDHIPGNKPVKCIELFARELMAGWTSWGNEPLHFQDSRYFVEK  416

Query  1306  NRQ  1314
             +++
Sbjct  417   DKK  419



>emb|CDY50575.1| BnaA06g13610D [Brassica napus]
Length=409

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 229/419 (55%), Positives = 301/419 (72%), Gaps = 30/419 (7%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST----EKLETS  252
             DQL+ FL SGIY  + +  FF+DPVR++NRSYTRYRVSP AYYSR F+S     ++    
Sbjct  5     DQLARFLDSGIYESEDSKWFFLDPVRIINRSYTRYRVSPCAYYSRCFNSKHLNPQQPNEP  64

Query  253   TESRKRKRNEKKTISL---NEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
               +RKRKRN++K  S    N  E+ +  RHQE R  L +A+E+LL  TELL +V++L  +
Sbjct  65    PNTRKRKRNKQKNPSFHLPNTAEQASNLRHQEARLFLSEAYESLLEETELLSLVKSLSDD  124

Query  424   ectdeerreLSQQSCE--LSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
             +        L  + CE  +SFV+LG VWQAPLYEI L+  +       E       V   
Sbjct  125   DGL------LRTKCCEDEVSFVELGGVWQAPLYEITLSCDDNKEKCSEER------VFKV  172

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+NLVVN+   D +AEF N +YI+P++SCFYMSD+  + NL+PA  + GFN+IVIDPPWE
Sbjct  173   FNNLVVNETEEDIDAEFSNRRYIMPRKSCFYMSDLLHLRNLVPAKYEEGFNLIVIDPPWE  232

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N+SAHQK +Y TLPNR+FLSLP+KQLTH  GALVALWVTNREKL +FVEKELFPAWGVKY
Sbjct  233   NASAHQKSKYPTLPNRYFLSLPVKQLTHAEGALVALWVTNREKLLNFVEKELFPAWGVKY  292

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGY-----SDGKDNTSDFSKLNAIPNNQV  1122
               + YWLKVK +G++I +LDL HH+PYE L+LGY     ++ K + SDF  L+    N++
Sbjct  293   AATMYWLKVKPDGTMICDLDLVHHKPYEYLILGYRFTELAESK-HRSDFELLD---KNKI  348

Query  1123  FMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +S+PGD+SRKPPIGE+L +++ G++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF+
Sbjct  349   IISIPGDFSRKPPIGEILKKHVPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSRYFL  407



>ref|XP_010246997.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Nelumbo 
nucifera]
Length=389

 Score =   437 bits (1125),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 280/383 (73%), Gaps = 20/383 (5%)
 Frame = +1

Query  49    VQPEITGSGMEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD  228
             V+PE      ++++L  FL SGIYR +S+NA FIDPVR++N SYTR+RVSP+AYYSR F+
Sbjct  2     VEPE------KNEELFLFLDSGIYRFRSSNAIFIDPVRILNSSYTRFRVSPAAYYSRSFE  55

Query  229   STEKLET---STESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLK  399
               ++ ET   S  SRKRKR + K++  NE E+ A QRH   RPLLL+AHEALLG  +LL 
Sbjct  56    HIKREETPLASPSSRKRKRKQSKSLPRNETEESAHQRHLAARPLLLRAHEALLGVKDLLS  115

Query  400   VVRNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG  579
              + +++ +  +  E +EL      L FV+LG VWQAPLYE+ L ++  D   E+ G  L 
Sbjct  116   CLCDIKNDGRSSVESKEL------LPFVELGKVWQAPLYEMSLYFRPHDKQTEDGGMPLI  169

Query  580   Q----DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGF  747
             Q    +V+P F+NLVVNK S D EAEF    YIIP+ESCFYMSD+ +IHNLIP  SD GF
Sbjct  170   QCGEREVVPIFNNLVVNKTSDDLEAEFHTRWYIIPRESCFYMSDLGQIHNLIPDQSDHGF  229

Query  748   NIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEK  927
             N+IVIDPPWEN SA+QK  Y  LPNR+FLSLPIKQL+HT GALVALW+TNREKL+ FVEK
Sbjct  230   NLIVIDPPWENKSAYQKSVYSVLPNRYFLSLPIKQLSHTEGALVALWITNREKLQVFVEK  289

Query  928   ELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAI  1107
             ELFP WGV+YV   YWLKVK +GSLI +LDLFHHRPYECLLLGYS+ ++  SD       
Sbjct  290   ELFPIWGVRYVARLYWLKVKLDGSLIGDLDLFHHRPYECLLLGYSNVQEVASDHHSAFKR  349

Query  1108  P-NNQVFMSVPGDYSRKPPIGEL  1173
             P +NQV +SVPGDYSRKPPIG +
Sbjct  350   PQDNQVIISVPGDYSRKPPIGSI  372



>ref|XP_007050710.1| Methyltransferase MT-A70 family protein [Theobroma cacao]
 gb|EOX94867.1| Methyltransferase MT-A70 family protein [Theobroma cacao]
Length=423

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 235/406 (58%), Positives = 299/406 (74%), Gaps = 21/406 (5%)
 Frame = +1

Query  61    ITGSGMEDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEK  240
             + G     D+LS F  SGIYR  ++NA FIDPVRV+NRSY+R++VSPSAYYSRFF+S   
Sbjct  1     MQGESKPSDELSRFFDSGIYRFPNSNAVFIDPVRVLNRSYSRFKVSPSAYYSRFFESKHP  60

Query  241   LETSTESRKRKRNEK----KTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
              + ST S   K+ ++    ++  LNE+E+ A+QRHQE RPLLLKAHE LLGA + L ++ 
Sbjct  61    AQESTHSSNPKKRKRKPKKQSYFLNEKEQAADQRHQEARPLLLKAHELLLGAADFLAIMS  120

Query  409   NLrceectdeerreLSQQSC---ELSFVDLGSVWQAPLYEIVLNYQEGD-AHIENEGSHL  576
              LR + C+       S + C   E SF++LG VWQAPLY+I L+++     +  + G +L
Sbjct  121   KLRSDFCS-------STELCGGEEHSFLELGRVWQAPLYDITLDFKLSRLTNQSDNGENL  173

Query  577   G--QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFN  750
                Q V+P F+NLVVN    + EAEFLN  YI+P+ESCFYMSD+ +IHNLIPA+ +SGFN
Sbjct  174   NGEQRVLPIFNNLVVNDTRDEMEAEFLNRHYILPRESCFYMSDLGQIHNLIPAEPNSGFN  233

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +IVIDPPWEN SA QK  Y TLP+R+FLSLPIKQLTH  GALVALWVTNREKL + VEKE
Sbjct  234   LIVIDPPWENGSAFQKSVYPTLPHRYFLSLPIKQLTHREGALVALWVTNREKLHNVVEKE  293

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSD---FSKL  1098
             LFPAWGV+Y+++ YWLKVK +GSLIS+LDLFHHRPYECLLLGY  GK  N +D    S+ 
Sbjct  294   LFPAWGVRYLSTVYWLKVKVDGSLISDLDLFHHRPYECLLLGYCHGKMMNETDSEYLSEF  353

Query  1099  NAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSREL  1236
              ++ + Q+ +S+PG YSRKPPIGELLL ++ G K A CIELF+RE+
Sbjct  354   RSVKDKQIVISIPGGYSRKPPIGELLLGHVPGVKPARCIELFAREM  399



>gb|AAF79421.1|AC025808_3 F18O14.6 [Arabidopsis thaliana]
Length=403

 Score =   434 bits (1116),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/416 (54%), Positives = 284/416 (68%), Gaps = 30/416 (7%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+L+ FL SGIY     N FF+D VR+ NRSYTR++VSPSAYYSRFF+S +  + S+ES 
Sbjct  5     DKLAQFLDSGIYESDEFNWFFLDTVRITNRSYTRFKVSPSAYYSRFFNSKQLNQHSSESN  64

Query  265   KRKRNEKKTISLNEREKVAEQ----RHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
              +KR  K+  S      V EQ    RHQE R  L KAHE+ L   ELL + + L  +   
Sbjct  65    PKKRKRKQKNSSFHLPSVGEQASNLRHQEARLFLSKAHESFLKEIELLSLTKGLSDDNDD  124

Query  433   deerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG-QDVIPAFDNL  609
             D+          E+SF++LG VWQAP YEI L++   + H +NEG     Q V   F+NL
Sbjct  125   DDSSLLNKCCDDEVSFIELGGVWQAPFYEITLSF---NLHCDNEGESCNEQRVFQVFNNL  181

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             VVN+   + EAEF N +YI+P+ SCFYMSD+  I NL+PA S+ G+N+IVIDPPWEN+SA
Sbjct  182   VVNEIGEEVEAEFSNRRYIMPRNSCFYMSDLHHIRNLVPAKSEEGYNLIVIDPPWENASA  241

Query  790   HQKQR------YQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             HQK +      Y TLPN++FLSLPIKQL H  GALVALWVTNREKL SFVEKELFPAWG+
Sbjct  242   HQKSKFVIYLMYPTLPNQYFLSLPIKQLAHAEGALVALWVTNREKLLSFVEKELFPAWGI  301

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             KYV + YWLKVK +G+LI +LDL               G +  SDF  L+    NQ+ MS
Sbjct  302   KYVATMYWLKVKPDGTLICDLDLL-------------AGSEKRSDFKLLD---KNQIIMS  345

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             +PGD+SRKPPIG++LL++  G++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF+
Sbjct  346   IPGDFSRKPPIGDILLKHTPGSQPARCLELFAREMAAGWTSWGNEPLHFQDSRYFL  401



>ref|XP_002510345.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF52532.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=386

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 226/371 (61%), Positives = 281/371 (76%), Gaps = 13/371 (4%)
 Frame = +1

Query  76    MED----DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKL  243
             MED    D LS FL +GIYR +++NA FIDPVR++NRSYTR+RV PSAYYSRFFDS   L
Sbjct  2     MEDSKFSDCLSEFLSTGIYRFENSNAVFIDPVRILNRSYTRFRVLPSAYYSRFFDSNHNL  61

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
               S+  +KRKR +KK   LNERE+ A++RHQ+ RP+L KA E L+  T+LL ++R+LR +
Sbjct  62    --SSNPKKRKRKQKKNYYLNEREQAADKRHQQARPMLSKALECLMETTDLLSIMRDLRSD  119

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEG--DAHIENEGSHLGQDVIPA  597
              C+ E  + L+    ELSFV+LG VWQAPLY+I LN+     D+ I+       Q  +P 
Sbjct  120   ICSSELTK-LTLPHDELSFVELGRVWQAPLYDITLNFPRSVKDSAIDQCRD---QSNLPV  175

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+NLVVN+   D EAEFLN KYI+P+ESCFYMSD+  I NLIPA+S  GFN+I++DPPWE
Sbjct  176   FNNLVVNETCDDLEAEFLNRKYILPRESCFYMSDLGLIRNLIPAESGCGFNLILVDPPWE  235

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N+SA QK  Y TLPNR+FLSLPIKQLTHT GALV LWVTNREKLRSFVEKELFPAWGV Y
Sbjct  236   NASASQKLLYPTLPNRYFLSLPIKQLTHTDGALVGLWVTNREKLRSFVEKELFPAWGVSY  295

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-NTSDFSKLNAIPNNQVFMSV  1134
                F+WLKVKA+GSL+S+L+LFHHRPYECLLLGY   +  N+     L A+ N+++ +S+
Sbjct  296   AACFHWLKVKADGSLVSDLNLFHHRPYECLLLGYCHPESTNSKQMLNLRALENDEIIISI  355

Query  1135  PGDYSRKPPIG  1167
             PGDYSRKPP+G
Sbjct  356   PGDYSRKPPVG  366



>ref|XP_009149415.1| PREDICTED: methyltransferase-like protein 2 [Brassica rapa]
Length=411

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 221/419 (53%), Positives = 299/419 (71%), Gaps = 28/419 (7%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST----EKLETS  252
             D+L+ FL SGI+  + +  FF+DPVR++NRSYTR+RVSP  YYSR F+S     ++    
Sbjct  5     DRLARFLDSGIHESEDSKWFFLDPVRIINRSYTRFRVSPCGYYSRCFNSKHLNPQQPNEL  64

Query  253   TESRKRKRNEKKTISLN---EREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
             T +RKRKRN++K  S +     E+ +  RHQE    + +A+E+LL  TELL +++ L  +
Sbjct  65    TNTRKRKRNKQKDPSFHLPSAAEQASNLRHQEASLFISEAYESLLEETELLSLIKGLSSD  124

Query  424   ectdeerreLSQQSCE--LSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
             +        L  + CE  +SFV+LG VWQAPLYEI L+  +       E       V   
Sbjct  125   DDGGL----LRTKCCEDEVSFVELGGVWQAPLYEITLSCDDNKEKCSEER------VFKV  174

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+NLVVN+   D +AEF N +YI+P++SCFYMSD+  + NL+PA  + GFN+IVIDPPWE
Sbjct  175   FNNLVVNETEEDIDAEFSNRRYIMPRKSCFYMSDLLHLRNLVPAKYEEGFNLIVIDPPWE  234

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N+SAHQK +Y TLPNR+FLSLP+KQLTH  GALVALWVTNREKL +FVEKELFPAWGVKY
Sbjct  235   NASAHQKSKYPTLPNRYFLSLPVKQLTHAEGALVALWVTNREKLLNFVEKELFPAWGVKY  294

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGY-----SDGKDNTSDFSKLNAIPNNQV  1122
               + YWLKVK +G++I +LDL HH+PYE L+LGY     ++ K + SDF  L+    N++
Sbjct  295   AATMYWLKVKPDGTMICDLDLVHHKPYEYLILGYRFTELAESK-HRSDFELLD---KNKI  350

Query  1123  FMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +S+PGD+SRKPPIGE+L +++ G++ A C+ELF+RE+++GWTSWGNEPLHFQ S+YF+
Sbjct  351   IISIPGDFSRKPPIGEILKKHVPGSQPARCLELFAREMASGWTSWGNEPLHFQDSRYFL  409



>ref|XP_006856096.1| hypothetical protein AMTR_s00059p00131310 [Amborella trichopoda]
 gb|ERN17563.1| hypothetical protein AMTR_s00059p00131310 [Amborella trichopoda]
Length=428

 Score =   427 bits (1097),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 220/418 (53%), Positives = 290/418 (69%), Gaps = 9/418 (2%)
 Frame = +1

Query  79    EDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETS-T  255
             E  +L  F  +G+Y L  + A  +DPVRV+N  YT +RVSPS YY R F+S    E   +
Sbjct  9     ETGELKEFFSNGLYHLPKSRALVMDPVRVLNAFYTNFRVSPSMYYCRSFESISHGEKPVS  68

Query  256   ESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectd  435
             ESR++++ +++  +LNERE  AE RHQE RP LL AH+ALL   + + ++ +L+   C  
Sbjct  69    ESRRKRKRKRRPYALNERELAAEMRHQEARPFLLDAHKALLEEIDFMSILPSLKRNGCPT  128

Query  436   eerreLS--QQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIEN----EGSHLGQDV-IP  594
                  LS  +Q  E SFV+LG +WQAP YEI L +++     E+    E     ++V + 
Sbjct  129   NGIESLSNAEQVTEPSFVELGHLWQAPYYEISLRFRDQSTPSEDFTGAEPIQYCKEVSMS  188

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F+NLV N    D +A+FL++ YI+P++  F+MSD+R+IH+LIPA SD GFN+IVIDPPW
Sbjct  189   LFNNLVSNWTDDDMKAQFLDNLYILPRKCRFHMSDLRQIHHLIPASSDDGFNLIVIDPPW  248

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             EN + H K  Y TLPNR+ LSLP+K+L H+ GALVALWVTNREKLR FVEKEL PAWGV 
Sbjct  249   ENRNVHTKSVYPTLPNRYLLSLPVKKLAHSEGALVALWVTNREKLRVFVEKELLPAWGVN  308

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAIPNNQVFMS  1131
               T FYWLK+K +GSL+S+LDL HHRPYECL+LGY+ GK  N  D  K   +  +QV +S
Sbjct  309   QETIFYWLKIKEDGSLLSDLDLIHHRPYECLVLGYTQGKGGNFCDQQKYTPLKGDQVVIS  368

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             +PGD+SRKPPIG LL  ++ G   A C+ELF+REL AGWTSWGNEPL FQ S++F+SK
Sbjct  369   IPGDHSRKPPIGNLLTNHVPGPLPARCLELFARELMAGWTSWGNEPLRFQHSRFFLSK  426



>ref|XP_006375069.1| hypothetical protein POPTR_0014s04090g [Populus trichocarpa]
 gb|ERP52866.1| hypothetical protein POPTR_0014s04090g [Populus trichocarpa]
Length=362

 Score =   420 bits (1079),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 214/363 (59%), Positives = 276/363 (76%), Gaps = 18/363 (5%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             D+LS+FL+SGIYR +++N  FIDPVR++NRSYTR+R SPSAYYSRFFDS E + TS   +
Sbjct  8     DKLSAFLESGIYRFENSNVVFIDPVRMLNRSYTRFRSSPSAYYSRFFDSKETIVTSDSKK  67

Query  265   KRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeer  444
             ++++ +K    LNERE+ A  RHQ+ RP+LLKAH  L+ AT+LL ++++LR         
Sbjct  68    RKRKEKKTPHDLNEREQAATLRHQQARPMLLKAHGFLMEATDLLAIMKDLRGGSNICSST  127

Query  445   reLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG-QDVIPAFDNLVVNK  621
               LS+Q    SF++LG VWQAPLYEIVL           +G+  G + V+P F+NLVVN+
Sbjct  128   E-LSEQH---SFIELGKVWQAPLYEIVL-----------KGAWKGLERVVPVFNNLVVNE  172

Query  622   GSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQ  801
              S D EAEFLN+KYI+P+ESCFYMSD+ ++HNLI  + + GFN+IVIDPPWEN SA QK 
Sbjct  173   TSDDMEAEFLNNKYILPRESCFYMSDLGQVHNLI-HECNVGFNLIVIDPPWENGSARQKL  231

Query  802   RYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLK  981
             RY TLPN +FLSLPIKQL H  GALVALW+TNREKL +FV+KELFP+WGV +  ++YWLK
Sbjct  232   RYPTLPNWYFLSLPIKQLAHPDGALVALWMTNREKLHNFVQKELFPSWGVSHEATYYWLK  291

Query  982   VKANGSLISELDLFHHRPYECLLLGYSDGK-DNTSDFSKLNAIPNNQVFMSVPGDYSRKP  1158
             VKA+GSLIS+LDLFHHRPYECLLLGY  G+  N+    +L  I ++Q+ +S+PG+YSRKP
Sbjct  292   VKADGSLISDLDLFHHRPYECLLLGYFHGQGTNSKQPPRLRPIKHDQIIISIPGEYSRKP  351

Query  1159  PIG  1167
             PIG
Sbjct  352   PIG  354



>ref|XP_006416515.1| hypothetical protein EUTSA_v10007768mg [Eutrema salsugineum]
 gb|ESQ34868.1| hypothetical protein EUTSA_v10007768mg [Eutrema salsugineum]
Length=411

 Score =   416 bits (1069),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 221/412 (54%), Positives = 295/412 (72%), Gaps = 14/412 (3%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTE-KLETSTES  261
             D+L+ FL+SGI+  + +  FF+DPVR++NRSYTR RVS SAYYSRFF+S    L++S  +
Sbjct  5     DKLARFLESGIFESEDSKWFFLDPVRIINRSYTRLRVSSSAYYSRFFNSKHLNLQSSDPN  64

Query  262   RKRKRNEKKTISLN---EREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
              K+++ ++K  S +     E+ +  RH+  R  L +AHE+LL   ELL + + L  ++  
Sbjct  65    PKKRKRKQKKPSPHLPSAGEQASNLRHEGARLSLSEAHESLLREVELLSLTKGLSDDDDP  124

Query  433   deerreLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDN  606
                   L  + C  ELSFV+LG VWQAPLYEI LN          + S   Q V   F+N
Sbjct  125   S-----LLTECCGDELSFVELGGVWQAPLYEITLNSNPHCGCSTEKCSE--QRVFKVFNN  177

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             LVVN+   + EAEF N +YI+P++SCFYMSD+  I NL+PA  + GFN+IVIDPPWEN+S
Sbjct  178   LVVNEAEEEVEAEFSNRRYIVPRKSCFYMSDLLHIRNLVPAKPEEGFNLIVIDPPWENAS  237

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
             AHQK +Y TLPNR+FLSLPI QLTH  GALVALWVTNREKL +FVEKELFPAWG+KYV +
Sbjct  238   AHQKSKYPTLPNRYFLSLPINQLTHAEGALVALWVTNREKLLNFVEKELFPAWGIKYVAT  297

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS-DFSKLNAIPNNQVFMSVPGD  1143
              YWLKV+ +G+LI ++DL HH+PYE +LLGY   +   S   S  N +  N++ +S+PGD
Sbjct  298   MYWLKVRPDGTLICDMDLVHHKPYEYVLLGYRFTELAESIHRSDFNLLDKNKIIISIPGD  357

Query  1144  YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             +SRKPPIGE+L++++ G + A CIELF+RE++AGWTSWGNEPLHFQ S++F+
Sbjct  358   FSRKPPIGEILMKHVPGPQPARCIELFAREMAAGWTSWGNEPLHFQDSRFFL  409



>emb|CDY26677.1| BnaA06g13450D [Brassica napus]
Length=412

 Score =   412 bits (1059),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 298/420 (71%), Gaps = 29/420 (7%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTE-------KL  243
             DQL+ FL SGIY  + +   F+DPVR++NRSYTR+RVSP AYYSR F+S         +L
Sbjct  5     DQLTRFLDSGIYESEDSKWLFVDPVRIINRSYTRFRVSPCAYYSRCFNSKHLNPQQPNEL  64

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
               + + ++ K+ +      +  E+ +  RHQE R  L +A+E+LL  TELL +V+ L  +
Sbjct  65    PNTRKRKRNKQKKPSFHLPSAAEQASNLRHQEARLFLSEAYESLLEETELLSLVKGLSSD  124

Query  424   ectdeerreLSQQSCE---LSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
             +        L  + CE   +SFV+LG VWQAPLYEI L+    + H ++      ++ + 
Sbjct  125   DDGL-----LRTKCCEDDEVSFVELGGVWQAPLYEITLSL---NLHRDDNKEKCSEERV-  175

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F+NLV N+   + +AEF N +YI+P++SCFYMSD+  + NL+PA  + GFN+IVIDPPW
Sbjct  176   -FNNLVANETEEEVDAEFSNRRYIMPRKSCFYMSDLLHLRNLVPAKHEEGFNLIVIDPPW  234

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             EN+SAHQK +Y TLPNR+FLSLPIKQLTH  GALVALWVTNREKL +FVEKELFPAWGVK
Sbjct  235   ENASAHQKSKYPTLPNRYFLSLPIKQLTHAEGALVALWVTNREKLLNFVEKELFPAWGVK  294

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGY-----SDGKDNTSDFSKLNAIPNNQ  1119
             YV + YWLKVK +G++I +LDL HH+PYE L+LGY     ++ K + SDF  L+    N+
Sbjct  295   YVATMYWLKVKPDGTMICDLDLVHHKPYEYLILGYRFTELAESK-HRSDFELLD---KNK  350

Query  1120  VFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             + +S+PGD+SRKPPIGE+L +++ G++ A C+ELF+RE++AGWTSWGNEPL FQ S+YF+
Sbjct  351   IIISIPGDFSRKPPIGEILKKHVPGSQPARCLELFAREMAAGWTSWGNEPLRFQDSRYFL  410



>ref|XP_010685197.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=383

 Score =   401 bits (1031),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 210/418 (50%), Positives = 267/418 (64%), Gaps = 71/418 (17%)
 Frame = +1

Query  100   FLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRKRKR-  276
             FL+SGIYR  +++ FFIDPVR +NR+YT++RVSPS+YY RFF + E+ +   E  +  + 
Sbjct  13    FLESGIYRFPASSTFFIDPVRTLNRNYTQFRVSPSSYYPRFF-TEEQQQNHDEGVQEDKC  71

Query  277   ------------NEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
                          + +  +LNE+E +A+QRHQE+RPLL+KAHE LL   ELL V+  L+C
Sbjct  72    SSRKRKRNQKNKKKHQCYTLNEKELLADQRHQEIRPLLVKAHEELLKVKELLDVMCELQC  131

Query  421   eectdeerreLSQQSC---ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVI  591
             E+   E   +L        E+SF +LG VWQAPLYEI L++ + + H+   G        
Sbjct  132   EDEGWERCVDLDCGGIKEEEVSFFELGKVWQAPLYEIALDFAQANKHVIENG--------  183

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
                                                          ADSD GFN I++DPP
Sbjct  184   ---------------------------------------------ADSDCGFNFIMVDPP  198

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN SA+QK +Y TLPNR FLSLPIKQLTHT+GALVALWVTNREKLR FVE ELFPAWGV
Sbjct  199   WENRSAYQKSKYPTLPNRHFLSLPIKQLTHTSGALVALWVTNREKLRKFVEDELFPAWGV  258

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             +Y  + YWLKVKANGSLI +LDLFHHRPYECLLLGY+      S+   ++ +  +QV ++
Sbjct  259   RYAATLYWLKVKANGSLICDLDLFHHRPYECLLLGYTGSHGIESELLSVSNL-KDQVVIT  317

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             +PGDYSRKPP+ ELLLEY+ G+K A C+ELF+RE+  GWTSWGNEPLHFQ  +YF  K
Sbjct  318   IPGDYSRKPPVEELLLEYVPGSKPARCLELFAREMMGGWTSWGNEPLHFQEKRYFSRK  375



>ref|XP_006473461.1| PREDICTED: methyltransferase-like protein 2-like isoform X4 [Citrus 
sinensis]
Length=330

 Score =   395 bits (1016),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 245/333 (74%), Gaps = 26/333 (8%)
 Frame = +1

Query  88    QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESRK  267
             +LS FL SGIYR +++N  FIDPVRV+NRSYTR+RVSPSAYY RFF++       +  +K
Sbjct  11    ELSKFLDSGIYRFENSNTVFIDPVRVLNRSYTRFRVSPSAYYCRFFETN----VCSNPKK  66

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RKR +KKT  LNERE  A+QRHQEV+PLLL AHEALL A +LL  V  L  +        
Sbjct  67    RKRKQKKTHMLNERELAADQRHQEVKPLLLIAHEALLAAIDLLNFVGKLNGDFG------  120

Query  448   eLSQQSC--ELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVIPAFDNL  609
               S   C  E SF++LG VWQAP+YEI LN+        N+ S + Q     V+P F+NL
Sbjct  121   --SSMKCGVEESFIELGRVWQAPMYEITLNF--------NQCSVIDQFREPRVLPLFNNL  170

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             V N+   D EAE L+  YI+P+ESCF+MSD+ +IHNLIPADSD GFN+IVIDPPWEN SA
Sbjct  171   VANETGDDVEAEILDRTYILPRESCFFMSDLGQIHNLIPADSDCGFNLIVIDPPWENGSA  230

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
              QK  Y TLPNR+FLSLPIKQLTH+ GALVALW+TNREKLR FVEKELFP WGVKYV + 
Sbjct  231   RQKSVYPTLPNRYFLSLPIKQLTHSEGALVALWMTNREKLRDFVEKELFPTWGVKYVATI  290

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYSDG  1068
             YWLKVK +GSLIS+LDLFHHRPYE LLLGY  G
Sbjct  291   YWLKVKLDGSLISDLDLFHHRPYEYLLLGYCSG  323



>ref|XP_008669718.1| PREDICTED: uncharacterized protein LOC100275615 isoform X1 [Zea 
mays]
 ref|XP_008669721.1| PREDICTED: uncharacterized protein LOC100275615 isoform X1 [Zea 
mays]
 ref|XP_008669725.1| PREDICTED: uncharacterized protein LOC100275615 isoform X1 [Zea 
mays]
 gb|ACF82152.1| unknown [Zea mays]
 tpg|DAA43954.1| TPA: hypothetical protein ZEAMMB73_591151 [Zea mays]
 tpg|DAA43955.1| TPA: hypothetical protein ZEAMMB73_591151 [Zea mays]
 tpg|DAA43956.1| TPA: hypothetical protein ZEAMMB73_591151 [Zea mays]
Length=418

 Score =   397 bits (1021),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/418 (48%), Positives = 271/418 (65%), Gaps = 15/418 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQ----SANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD------ST  234
             D+L SF  +G+YRL     SA A ++DPVR++N SY R+R+ PSAYYSR F         
Sbjct  5     DELRSFEATGVYRLNGTCTSAGATYLDPVRLLNASYQRFRIVPSAYYSRSFGPQHQEGEP  64

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             E        ++++  + K   LN  E++AE RHQE +PLLL AHE+L+ A  LL+ +   
Sbjct  65    EIERPEKRRKRKRNQKPKPRELNPMERIAEARHQEAKPLLLNAHESLVKAKHLLEYISKT  124

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS-HLGQDVI  591
                     +    S+ +    FV+LG+ W+AP YEI + ++        EG  H  +   
Sbjct  125   IKGNEHTLDAGSGSENN----FVELGTSWRAPFYEITICFRNPHVLGNEEGFFHAQKTSF  180

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F++L+  +G+ +AE EF N +YI+P+ SCF M+D +++ +LIP   + G+N+IV+DPP
Sbjct  181   PLFNSLISVEGTDEAEGEFRNRRYILPRGSCFLMADFKRVRDLIPCSPNQGYNLIVVDPP  240

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN    QK+ Y TLPN+ FL LP++QL H  GAL+ LW+TNREKLR+FVEK+L P+WGV
Sbjct  241   WENGCVRQKEVYPTLPNKNFLYLPVQQLAHPTGALLVLWITNREKLRAFVEKKLLPSWGV  300

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             +  T FYWLKVK +GSLI +LDLFHHRPYECLLLGY +   N    S    +  +QV MS
Sbjct  301   EDSTVFYWLKVKPDGSLIGDLDLFHHRPYECLLLGYINVNANAKKGSNFKLLERSQVIMS  360

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             VPG +SRKPP+ +LL EY+ G K + CIELF+REL   WTSWGNEPLHFQ + YF  K
Sbjct  361   VPGAHSRKPPLEKLLSEYIPGPKPSRCIELFARELFPRWTSWGNEPLHFQDTMYFSEK  418



>ref|XP_003558576.1| PREDICTED: methyltransferase-like protein 2 isoform X3 [Brachypodium 
distachyon]
Length=415

 Score =   395 bits (1016),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 276/416 (66%), Gaps = 14/416 (3%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFF---------DSTE  237
             D+L S   +GIYRL  + A F+DPVR++N SY R+R+ PSAYYSR F         +S  
Sbjct  5     DELRSLEATGIYRLADSRAAFLDPVRLLNESYRRFRLVPSAYYSRSFGPSHQGGDAESER  64

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
              + +    +++++ +KK   LN  E++A+ RHQE RPLL+ AH++LL A +LL+ +  + 
Sbjct  65    TVPSPNREKRKRKRQKKPRELNAVERLADARHQEARPLLISAHDSLLKAKDLLEFLPEMI  124

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
               E    +     +   E +FV+LGS W+AP YE+ + +Q+   + E+   ++ +  IP 
Sbjct  125   KGEECLLDV----ETKLENNFVELGSSWRAPFYEMTVCFQKAQNN-EDGFCNVQRRSIPL  179

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+ ++    + DAE EF + +YI+PK SCF M+D R + +LIP +S   +N+IVIDPPWE
Sbjct  180   FNRIINGDENDDAEGEFQSRRYILPKGSCFLMTDFRHVRDLIPDNSKQEYNLIVIDPPWE  239

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N    QK+ Y TLPNR+ L LP+++L H AGAL+ LW+TNREKL  FVE EL P+WGVK 
Sbjct  240   NGCVRQKEAYPTLPNRYLLYLPVQELAHPAGALLVLWITNREKLWKFVEDELLPSWGVKD  299

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVP  1137
              T FYWLKVK++GSLI +LDLFHHRPYECLLLGY +         K   +  +QV MSVP
Sbjct  300   PTVFYWLKVKSDGSLIGDLDLFHHRPYECLLLGYINVNKEAELKPKFKFLEGSQVIMSVP  359

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             G +SRKPP+ ++L EY+ GTK   CIELF+R+L +GWTSWGNE LHFQ S YF  K
Sbjct  360   GAHSRKPPLQKILSEYIPGTKPPRCIELFARDLGSGWTSWGNEALHFQDSMYFSEK  415



>ref|XP_010229027.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Brachypodium 
distachyon]
Length=429

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 276/416 (66%), Gaps = 14/416 (3%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFF---------DSTE  237
             D+L S   +GIYRL  + A F+DPVR++N SY R+R+ PSAYYSR F         +S  
Sbjct  5     DELRSLEATGIYRLADSRAAFLDPVRLLNESYRRFRLVPSAYYSRSFGPSHQGGDAESER  64

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
              + +    +++++ +KK   LN  E++A+ RHQE RPLL+ AH++LL A +LL+ +  + 
Sbjct  65    TVPSPNREKRKRKRQKKPRELNAVERLADARHQEARPLLISAHDSLLKAKDLLEFLPEMI  124

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
               E    +     +   E +FV+LGS W+AP YE+ + +Q+   + E+   ++ +  IP 
Sbjct  125   KGEECLLDV----ETKLENNFVELGSSWRAPFYEMTVCFQKAQNN-EDGFCNVQRRSIPL  179

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+ ++    + DAE EF + +YI+PK SCF M+D R + +LIP +S   +N+IVIDPPWE
Sbjct  180   FNRIINGDENDDAEGEFQSRRYILPKGSCFLMTDFRHVRDLIPDNSKQEYNLIVIDPPWE  239

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N    QK+ Y TLPNR+ L LP+++L H AGAL+ LW+TNREKL  FVE EL P+WGVK 
Sbjct  240   NGCVRQKEAYPTLPNRYLLYLPVQELAHPAGALLVLWITNREKLWKFVEDELLPSWGVKD  299

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVP  1137
              T FYWLKVK++GSLI +LDLFHHRPYECLLLGY +         K   +  +QV MSVP
Sbjct  300   PTVFYWLKVKSDGSLIGDLDLFHHRPYECLLLGYINVNKEAELKPKFKFLEGSQVIMSVP  359

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             G +SRKPP+ ++L EY+ GTK   CIELF+R+L +GWTSWGNE LHFQ S YF  K
Sbjct  360   GAHSRKPPLQKILSEYIPGTKPPRCIELFARDLGSGWTSWGNEALHFQDSMYFSEK  415



>ref|XP_006651137.1| PREDICTED: methyltransferase-like protein 2-like [Oryza brachyantha]
Length=426

 Score =   389 bits (999),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/422 (48%), Positives = 272/422 (64%), Gaps = 20/422 (5%)
 Frame = +1

Query  79    EDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEK------  240
             E D+L SF  SGIYRL  + A F+DPVR++N SY R+R+ PSAYYSR F  + +      
Sbjct  5     ESDELRSFEDSGIYRLAGSGAAFLDPVRILNESYRRFRLVPSAYYSRCFGPSHQGGEAET  64

Query  241   ------LETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKV  402
                        + ++++  E K   LNE E++AE RHQE RPLLL AH +LL A  LL+ 
Sbjct  65    ERTEETSPKRKKRKRKREREPKPRELNEVERIAEARHQEARPLLLSAHRSLLKAEYLLEF  124

Query  403   VRNLrceectdeerreLSQQSCEL-SFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG  579
             +  +  E+        +    C L +FV+LGS W+AP  E+ L + +       EG    
Sbjct  125   LPRMTKEDVR------VLDVECNLKNFVELGSSWRAPFCEMTLCFHKSSDEDSEEGI-CH  177

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             +   P F++++  + + DAE EF +  YI+P++SCF MSD++ +  LI  + D G+N+IV
Sbjct  178   RTSTPLFNSIISVEENDDAEGEFQDRCYILPRQSCFLMSDLKHVGGLIHDNYDQGYNLIV  237

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             +DPPWEN    QK  Y TLPNR FL LP+++L H+AGALV LW+TNREKL  FVE+ELFP
Sbjct  238   VDPPWENGCVRQKVVYPTLPNRHFLYLPVQELAHSAGALVVLWITNREKLWKFVEEELFP  297

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQ  1119
             +WGVK  T FYWLKVK +GSLI +LDL HHRPYECLL+GY +     +  SK   +   +
Sbjct  298   SWGVKEHTVFYWLKVKQDGSLIGDLDLLHHRPYECLLVGYINLNKEDARGSKFKFLEERR  357

Query  1120  VFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             V MSVPG +SRKPP+ +LL +Y+ G K A CIELF+REL +GWTSWGNEPL FQ + YF 
Sbjct  358   VIMSVPGAHSRKPPLQKLLSQYIPGPKPARCIELFARELVSGWTSWGNEPLRFQDAVYFS  417

Query  1300  SK  1305
              +
Sbjct  418   ER  419



>ref|XP_010229028.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Brachypodium 
distachyon]
Length=425

 Score =   387 bits (995),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 199/416 (48%), Positives = 273/416 (66%), Gaps = 18/416 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFF---------DSTE  237
             D+L S   +GIYRL  + A F+DPVR++N SY R+R+ PSAYYSR F         +S  
Sbjct  5     DELRSLEATGIYRLADSRAAFLDPVRLLNESYRRFRLVPSAYYSRSFGPSHQGGDAESER  64

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
              + +    +++++ +KK   LN  E++A+ RHQE RPLL+ AH++LL A +LL+ +  + 
Sbjct  65    TVPSPNREKRKRKRQKKPRELNAVERLADARHQEARPLLISAHDSLLKAKDLLEFLPEMI  124

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
               E    +     +   E +FV+LGS W+AP YE+ + +Q+   + E+   ++ +  IP 
Sbjct  125   KGEECLLDV----ETKLENNFVELGSSWRAPFYEMTVCFQKAQNN-EDGFCNVQRRSIPL  179

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+ ++    + DAE EF + +YI+PK SCF M+D R + +LIP +S   +N+IVIDPPWE
Sbjct  180   FNRIINGDENDDAEGEFQSRRYILPKGSCFLMTDFRHVRDLIPDNSKQEYNLIVIDPPWE  239

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N    QK+ Y TLPNR+ L LP+++L H AGAL+ LW+TNREKL  FVE EL P+WGVK 
Sbjct  240   NGCVRQKEAYPTLPNRYLLYLPVQELAHPAGALLVLWITNREKLWKFVEDELLPSWGVKD  299

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVP  1137
              T FYWLKVK++GSLI +LDLFHHRPYECLLLGY +         K   +  +QV MSVP
Sbjct  300   PTVFYWLKVKSDGSLIGDLDLFHHRPYECLLLGYINVNKEAELKPKFKFLEGSQVIMSVP  359

Query  1138  GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             G +SRKPP    L +Y+ GTK   CIELF+R+L +GWTSWGNE LHFQ S YF  K
Sbjct  360   GAHSRKPP----LQKYIPGTKPPRCIELFARDLGSGWTSWGNEALHFQDSMYFSEK  411



>ref|XP_009395621.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=382

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 251/374 (67%), Gaps = 19/374 (5%)
 Frame = +1

Query  85    DQLSSFLKSGIYRL--QSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDST------EK  240
             D++ SFL +GIYRL    +   F+DPVR++N SYTR+ VSPSAYYSR F++T      + 
Sbjct  3     DEVRSFLDTGIYRLVRDGSKVVFLDPVRIINHSYTRFWVSPSAYYSRSFETTTAALKTDA  62

Query  241   LETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
             +E S   +KRKR  +    LNE E+ A +RHQE R  LL AH+A L A EL  ++  L  
Sbjct  63    VEDSRILKKRKRT-RAPRDLNESERAAVKRHQEARTFLLNAHKAFLEAAELQALLPELVK  121

Query  421   eectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD-----  585
              E +       ++++ E  F+ LGS+WQAPLYEI L ++  +   +  G  LG       
Sbjct  122   SEVSLP-----TRRASEQKFIQLGSLWQAPLYEISLCFRNKNLSDDTGGYRLGDHGGTII  176

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             V   ++NL+ N+ + D EAEF +++YI+P  SCF+MSD++++ NL+PA S  GFN IVID
Sbjct  177   VHQLYNNLICNETNEDVEAEFQSNRYILPSRSCFHMSDLQQVRNLVPAHSKDGFNFIVID  236

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN SA QK  Y TLPNR+FL LP+K+L H  GALVALW+TNREKLR FVE ELFPAW
Sbjct  237   PPWENGSACQKAVYPTLPNRYFLYLPVKELAHEGGALVALWMTNREKLRIFVENELFPAW  296

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVF  1125
             GV      YWLKVK +GSLI ELDLFHHRPYECLLLGY + +++ S       +  NQV 
Sbjct  297   GVTKFVLSYWLKVKPDGSLIGELDLFHHRPYECLLLGYINLQNDDSRAMPFEYLGINQVI  356

Query  1126  MSVPGDYSRKPPIG  1167
             +S+PGDYSRKPP+G
Sbjct  357   VSIPGDYSRKPPLG  370



>ref|XP_004985323.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
2-like [Setaria italica]
Length=400

 Score =   369 bits (947),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 196/418 (47%), Positives = 261/418 (62%), Gaps = 33/418 (8%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQ----SANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKL-ET  249
             D+L SF  +G+YRL     S  A F+DPVR++N SY R+RV PSAYYSR F+   +L + 
Sbjct  5     DELRSFEATGVYRLDGTGTSTGATFLDPVRLLNGSYQRFRVVPSAYYSRSFEPPRQLGDP  64

Query  250   STESRKRKRNEKKTI-----SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
              TE  ++++  K+        LN  E++AE RHQE R LLL AHE+L+    LL+ +  +
Sbjct  65    ETEQPEKRKKRKRNQKPKPRELNAMERIAEARHQEARTLLLSAHESLIKDKYLLEHLSKM  124

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS-HLGQDVI  591
                +    +         E +F++LG+ W+AP YEI + +++       EGS H  +   
Sbjct  125   IEGKEHTLDVG----SGPENNFIELGTSWRAPFYEITICFRKPLVLGNGEGSFHAQRTSF  180

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
             P F++++  +   +AE EF N +YI+P+ SCF MSD +++ +LIP  SD G+N IV+DPP
Sbjct  181   PLFNSIISVEAIDEAEGEFQNKRYILPRGSCFLMSDFKRVQDLIPGSSDEGYNXIVVDPP  240

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN    QK+ Y TLPNR+ L LP+++L HTAGAL+ LW+TNREKLR FVEKEL P+WGV
Sbjct  241   WENGCVRQKEAYPTLPNRYLLYLPVQELAHTAGALLVLWITNREKLRMFVEKELLPSWGV  300

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             K  T FYWLKVK +GSLI +LDLFHHRPYECLLLGY +   +         +  +QV MS
Sbjct  301   KDPTVFYWLKVKPDGSLIGDLDLFHHRPYECLLLGYINVNTDAKQELNFKLLEGSQVIMS  360

Query  1132  VPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             VPG    KPP                C+ELF+REL   WTSWGNEPLHFQ S YF  K
Sbjct  361   VPGP---KPP---------------RCLELFARELFPRWTSWGNEPLHFQDSVYFSEK  400



>ref|XP_001758385.1| predicted protein [Physcomitrella patens]
 gb|EDQ76787.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   359 bits (921),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 261/423 (62%), Gaps = 35/423 (8%)
 Frame = +1

Query  103   LKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETS------TESR  264
             L++G+  ++  N  F++PVRV+N  Y  + V    YYSR F ++  + +S      +++R
Sbjct  13    LQNGVVIIEGNNGVFMEPVRVLNSGYDMHDVKFERYYSRAFFTSVSMPSSGVTNEGSDTR  72

Query  265   KRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRN----------L  414
             KRKR  K+  +LNE+E +AE RHQEVR ++LKAHEA      +   +RN          +
Sbjct  73    KRKR--KRVYNLNEKEVLAENRHQEVRSVILKAHEAFQAT--VAPSLRNYITFDGRDDCV  128

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
                  +    + L  +  E++FV+L ++WQAPLYE   ++ +G    E E S       P
Sbjct  129   PSPSKSCSSMQNLGIEEGEVNFVELAALWQAPLYE--FSFSKGQVDCEEEESR----TTP  182

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F+ ++ +       AE    KY++PK   F +SD+ ++H LIP DS  GFN++VIDPPW
Sbjct  183   MFNTIIKSSSRTSEVAECGACKYLLPKSCTFLISDISEVHRLIPGDSKDGFNLMVIDPPW  242

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             EN S H+K  Y TLPN++ LSLP+KQL H  GALVALW+TNREKLR F E ELFPAWGVK
Sbjct  243   ENKSVHRKSLYPTLPNKYLLSLPVKQLAHADGALVALWITNREKLRHFAETELFPAWGVK  302

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLN--------AIP  1110
                 +YWLKV   G+++S LDL HH+PYECLLLGY   K  ++    +          +P
Sbjct  303   MAAVWYWLKVTVEGTMVSPLDLAHHKPYECLLLGYLPSKIGSTSEESVQFTGSREHADLP  362

Query  1111  NNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAH-CIELFSRELSAGWTSWGNEPLHFQAS  1287
             +  V +S+PGD+SRKPP+  LL +++ G +HA   +ELF+RELSAGWTSWGNEPL FQ  
Sbjct  363   DKFVLISIPGDHSRKPPLKSLLSKHIPGQRHAERGLELFARELSAGWTSWGNEPLRFQHL  422

Query  1288  KYF  1296
              YF
Sbjct  423   NYF  425



>ref|XP_010477144.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Camelina 
sativa]
Length=351

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 238/341 (70%), Gaps = 19/341 (6%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTE---KLETST  255
             ++L+ FL SGIY    +N FF+DPVR++NRSYT++RVSPSAYY+RFF+      +L    
Sbjct  5     EKLAQFLDSGIYESDDSNWFFLDPVRIINRSYTKFRVSPSAYYTRFFNPKHLNPQLNDPN  64

Query  256   ESRKRKRNEKKTISL-NEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceect  432
               +++++ +  T  L N  E+ +  RHQ+ R  L KA E+ LG TELL + + L  ++  
Sbjct  65    PKKRKRKQKDPTFQLPNAGEQASNLRHQDARLFLSKALESFLGETELLSLTKALSDDDGY  124

Query  433   deerreLSQQSCE--LSFVDLGSVWQAPLYEIVLNYQEGDAHIE-NEGSHLGQ----DVI  591
                   L  + C+  LSFV+LG VWQAPLYEI LN+   + H + NEG  + +     V 
Sbjct  125   S-----LLTKCCDDGLSFVELGGVWQAPLYEITLNF---NLHCDSNEGCLIDKCNEKRVF  176

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F+NLVVN+   + EAEF N ++I+P++SCFYMSD+  I NL+PA    G+N+IVIDPP
Sbjct  177   QVFNNLVVNENGEEVEAEFSNRRFIMPRKSCFYMSDLLHIRNLVPAKPAEGYNLIVIDPP  236

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN+SAHQK +Y TLPNR+FLSLPIKQL H  GALVALWVTNREKL +FVEKELFPAWGV
Sbjct  237   WENASAHQKSKYPTLPNRYFLSLPIKQLAHAEGALVALWVTNREKLLNFVEKELFPAWGV  296

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD  1074
             KYV + YWLKVK + +LI +LDL HH+PYE LLLGY   +D
Sbjct  297   KYVATMYWLKVKPDCTLICDLDLVHHKPYEYLLLGYRFTED  337



>ref|XP_010106033.1| Methyltransferase-like protein 2 [Morus notabilis]
 gb|EXC07303.1| Methyltransferase-like protein 2 [Morus notabilis]
Length=356

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/412 (48%), Positives = 259/412 (63%), Gaps = 71/412 (17%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLETSTESR  264
             ++L +FL+SGIYR +++N+ FIDPVRV+N+SYTR+RVSPSAYYSRFF+S+   + S+ SR
Sbjct  8     EKLFAFLESGIYRFENSNSIFIDPVRVLNQSYTRFRVSPSAYYSRFFESSNATQQSSNSR  67

Query  265   KRKRNEKKT--ISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectde  438
             KRKR EK+    +LNERE+ A++RHQE  PLLLKA E+L  AT+LL+V+ NLR    +  
Sbjct  68    KRKRKEKEKKPYALNERERAADRRHQESEPLLLKALESLQRATDLLEVICNLRDLSDSSP  127

Query  439   erreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS---HLGQDVIPAFDNL  609
                    Q    S ++LG VWQAPLYEI L +       E  GS      + V+P F+NL
Sbjct  128   SSSSSRVQQ---SLIELGRVWQAPLYEITLKFHPSGERNEGGGSPPTQYCERVLPVFNNL  184

Query  610   VVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
             +VN+ S D EAEF+N +YI+P +S FYM                         P+     
Sbjct  185   IVNETSDDLEAEFMNTRYILPHDSSFYM-------------------------PY-----  214

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
                 RY TLPN++FLS+PIK+L+H  GA++ALWVTNREKLR FVE+ELFPAWGVKY+ +F
Sbjct  215   ----RYPTLPNKYFLSVPIKKLSHKEGAIIALWVTNREKLRCFVEEELFPAWGVKYMATF  270

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVPGDYS  1149
             YWLK   + S+                             S++ A P+NQV +S+PGDYS
Sbjct  271   YWLKAVDSNSM-----------------------------SRIKAAPDNQVIISIPGDYS  301

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSK  1305
             RKPPIG LL EY++G   + C+ELF+RE+   W SWGNEPL FQ S+YF  +
Sbjct  302   RKPPIGGLLKEYIAGHSPSRCLELFAREMLPQWVSWGNEPLQFQESRYFYER  353



>ref|XP_010060917.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Eucalyptus 
grandis]
Length=316

 Score =   330 bits (847),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 229/315 (73%), Gaps = 8/315 (3%)
 Frame = +1

Query  61   ITGSGMEDDQ-LSSFLKSGIYRLQ-SANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS-  231
            + G G E  + LS FL+SG+YRL+ S  A F+DPVRV+NR+  R+ +SPSAYYSRFF+  
Sbjct  1    MGGDGSEPRRSLSLFLESGVYRLEGSGGAVFVDPVRVLNRALARFSISPSAYYSRFFEPG  60

Query  232  -TEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
             +E     +  RKRKR  +K + LN+RE+VA QRHQE RP L+KAHEAL+GATEL  ++ 
Sbjct  61   PSEADRGGSNGRKRKRRARKPLVLNDRERVAAQRHQEARPFLVKAHEALVGATELRSLML  120

Query  409  NLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG---  579
             ++ E  T E+R+ L+      SF++LG +WQAPLYEI LN+ +     +   S +    
Sbjct  121  KMKGEVATAEDRK-LAPPGVPPSFIELGRLWQAPLYEITLNFLQEKPTGDGGPSIIHSKE  179

Query  580  QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
            Q VIP F+NLV N    D EAEFL  +Y+IP+ESCFYMSD+++IH +IP + D+ F+ IV
Sbjct  180  QKVIPIFNNLVHNGTKDDLEAEFLGSQYVIPRESCFYMSDLQQIHRMIPVEGDAHFHFIV  239

Query  760  IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
            IDPPWEN SA QK RY TLPN++FLSLP++QL H  GALVALWVTNREKLR+FVEKELFP
Sbjct  240  IDPPWENGSAQQKSRYPTLPNKYFLSLPVQQLAHREGALVALWVTNREKLRNFVEKELFP  299

Query  940  AWGVKYVTSFYWLKV  984
            AWGVK++ +FYWLK 
Sbjct  300  AWGVKFLATFYWLKT  314



>dbj|BAC42388.1| unknown protein [Arabidopsis thaliana]
Length=214

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 176/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  667   IPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPI  846
             +P+ SCFYMSD+  I NL+PA S+ G+N+IVIDPPWEN+SAHQK +Y TLPN++FLSLPI
Sbjct  1     MPRNSCFYMSDLHHIRNLVPAKSEEGYNLIVIDPPWENASAHQKSKYPTLPNQYFLSLPI  60

Query  847   KQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFH  1026
             KQL H  GALVALWVTNREKL SFVEKELFPAWG+KYV + YWLKVK +G+LI +LDL H
Sbjct  61    KQLAHAEGALVALWVTNREKLLSFVEKELFPAWGIKYVATMYWLKVKPDGTLICDLDLVH  120

Query  1027  HRPYECLLLGYS----DGKDNTSDFSKLNAIPNNQVFMSVPGDYSRKPPIGELLLEYMSG  1194
             H+PYE LLLGY      G +  SDF  L+    NQ+ MS+PGD+SRKPPIG++LL++  G
Sbjct  121   HKPYEYLLLGYHFTELAGSEKRSDFKLLD---KNQIIMSIPGDFSRKPPIGDILLKHTPG  177

Query  1195  TKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             ++ A C+ELF+RE++AGWTSWGNEPLHFQ S+YF+
Sbjct  178   SQPARCLELFAREMAAGWTSWGNEPLHFQDSRYFL  212



>gb|EEE58513.1| hypothetical protein OsJ_09794 [Oryza sativa Japonica Group]
Length=459

 Score =   311 bits (796),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 160/339 (47%), Positives = 218/339 (64%), Gaps = 17/339 (5%)
 Frame = +1

Query  79    EDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKL-ETST  255
             E D+L +F  +GIYRL  + A F+DPVR++N SY R+R+ PSAYYSR F ++ +  E  T
Sbjct  5     ESDELRAFEATGIYRLAESGAAFLDPVRILNASYRRFRLVPSAYYSRSFGTSRQGGEAET  64

Query  256   ESRKRKRNEKKTI-----------SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKV  402
             E       E+K              LNE E++AE RHQE RPLL  AH++LL A +LL+ 
Sbjct  65    ERTGEASPERKKRKRKRQRQPKPRELNEVERMAEARHQEARPLLSSAHKSLLKAKDLLEF  124

Query  403   VRNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
             +  +  E+    +     + + E + V+LGS W+APL E+ L +Q+       EG    +
Sbjct  125   LPRMIKEDVRMLDV----ESNLEKNLVELGSSWRAPLCEMTLCFQKSSGEDSEEGI-CHK  179

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
                P F++ +  + + DAE EF + +YI+P+  CF M+D++ +  LIP + + G+N+IV+
Sbjct  180   TSTPLFNSTISIEENDDAEGEFQDRRYILPRRCCFLMTDLKHVRGLIPDNYNQGYNLIVV  239

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN    QK  Y TLPNR FL LP+++L H AGAL+ LW+TNREKL  FVE+ELFPA
Sbjct  240   DPPWENGCVRQKVAYPTLPNRHFLYLPVQELAHPAGALLVLWITNREKLWKFVEEELFPA  299

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGY  1059
             WGVK  T FYWLKVK +GSLI  LDL HHRPYECLL+GY
Sbjct  300   WGVKDHTVFYWLKVKPDGSLIGNLDLLHHRPYECLLVGY  338



>ref|XP_008369490.1| PREDICTED: methyltransferase-like protein 2 [Malus domestica]
Length=241

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 171/243 (70%), Gaps = 27/243 (11%)
 Frame = +1

Query  571   HLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFN  750
             +  Q  +P F+NLVVN+ S D                         IHNLIP +SD GFN
Sbjct  24    YCKQRAVPVFNNLVVNETSED-------------------------IHNLIP-ESDCGFN  57

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +IV+DPPWEN SA QK RY TLPNR+FLSLPIKQL HT GALVALWVTNREKLR FVEKE
Sbjct  58    LIVVDPPWENGSARQKLRYSTLPNRYFLSLPIKQLCHTNGALVALWVTNREKLRGFVEKE  117

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIP  1110
             LFPAWGV+Y  +F+WLKVKA+GSLI +LDLFHHRPYECLLLG   G + T D S+   IP
Sbjct  118   LFPAWGVEYAATFFWLKVKADGSLIGDLDLFHHRPYECLLLGLCPG-EATDDNSRSKPIP  176

Query  1111  NNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +NQ+ +S+PGDYSRKPP+   L EY    +   C+ELF+RE++AG  SWGNEPLHFQ S 
Sbjct  177   DNQIMLSIPGDYSRKPPVARFLQEYSPTLQRNRCVELFAREMTAGCVSWGNEPLHFQESG  236

Query  1291  YFV  1299
              F 
Sbjct  237   NFT  239



>gb|EMT20927.1| Methyltransferase-like protein 2 [Aegilops tauschii]
Length=751

 Score =   311 bits (797),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 162/361 (45%), Positives = 224/361 (62%), Gaps = 13/361 (4%)
 Frame = +1

Query  85    DQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFD-STEKLETSTES  261
             D+L S   +GIYRL  + A F+DPVR++  SY R+R+ PSAY SR F  S +  E   E 
Sbjct  5     DELRSLEATGIYRLAGSRAAFVDPVRLLGESYRRFRLVPSAYCSRSFGPSRQGGEAQAEG  64

Query  262   --------RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
                     +++++ + K   LN  E++AE RHQE RPLL+ AH +LL A  LL+ +  + 
Sbjct  65    TAPSPDRKKRKRKRQTKARELNAVERIAEARHQEARPLLISAHNSLLDAKYLLEYLPGMI  124

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
               +    E     + S E +FV+LG  W+AP YE+ + +Q+     E     + +   P 
Sbjct  125   KGDECRPEL----ETSSENNFVELGGSWRAPFYEMTICFQKPLGQDEAGTCDVQKRSSPL  180

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+ +V  + +G+AE EF    Y++PK SCF  +D   + +LIP + ++G+N+IVIDPPWE
Sbjct  181   FNRVVRVEENGEAEGEFQGRLYVLPKGSCFMTTDFTHVRDLIPDNPNTGYNLIVIDPPWE  240

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N    QK+ Y TLPNR  L LP+++L H AGALV LW+TNREKLR FVE+EL P+WGVK 
Sbjct  241   NGCVRQKEAYPTLPNRNLLYLPVQELAHPAGALVVLWITNREKLRRFVEEELLPSWGVKD  300

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVP  1137
              T FYWLKVK++GSLI +LDLFHHRPYECLLLGY +        SK   +  +QV  +  
Sbjct  301   PTEFYWLKVKSDGSLIGDLDLFHHRPYECLLLGYINVNREAESGSKFKVLQGSQVVKNTC  360

Query  1138  G  1140
             G
Sbjct  361   G  361



>gb|KHG14750.1| hypothetical protein F383_18060 [Gossypium arboreum]
Length=1108

 Score =   302 bits (773),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 171/226 (76%), Gaps = 8/226 (4%)
 Frame = +1

Query  655   HKYIIP-KESCFYMSDVR------KIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQT  813
             H  ++P  E CF M          K+    P +SDSGFN++VID PWEN SA QK  Y T
Sbjct  882   HLAMMPHPERCFLMWQFPWYPKDWKVDKKGPTESDSGFNLMVIDSPWENGSARQKSVYPT  941

Query  814   LPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKAN  993
             LPNR+FLSLPIKQLTH  GALVALWVTNREKLR+F+EKELFPAWGV+YV++FYWLKVK +
Sbjct  942   LPNRYFLSLPIKQLTHRGGALVALWVTNREKLRTFIEKELFPAWGVRYVSTFYWLKVKGD  1001

Query  994   GSLISELDLFHHRPYECLLLGYSDGKDNTSDF-SKLNAIPNNQVFMSVPGDYSRKPPIGE  1170
             GSLIS+LDLFHHRPYECLLLGY  GK+  S+  S   +I +  + +S+PG YSRKP IGE
Sbjct  1002  GSLISDLDLFHHRPYECLLLGYCQGKEMDSNCPSVFRSIKDEHIIISIPGGYSRKPLIGE  1061

Query  1171  LLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             LLL+++ G K A CIELF+RE+  GW SWGNEPLHFQ S+YF + N
Sbjct  1062  LLLDHVPGVKPARCIELFAREMLGGWVSWGNEPLHFQDSRYFETVN  1107



>ref|NP_001143136.1| uncharacterized protein LOC100275615 [Zea mays]
 gb|ACG29265.1| hypothetical protein [Zea mays]
Length=205

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = +1

Query  691   MSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAG  870
             M+D +++ +LIP   + G+N+IV+DPPWEN    QK+ Y TLPN+ FL LP++QL    G
Sbjct  1     MADFKRVRDLIPCSPNQGYNLIVVDPPWENGCVRQKEVYPTLPNKNFLYLPVQQLARPTG  60

Query  871   ALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLL  1050
             AL+ LW+TNREKLR+FVEK+L P+WGV+  T FYWLKVK +GSLI +LDLFHHRPYEC L
Sbjct  61    ALLVLWITNREKLRAFVEKKLLPSWGVEDSTVFYWLKVKPDGSLIGDLDLFHHRPYECFL  120

Query  1051  LGYSDGKDNTSDFSKLNAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSR  1230
             LGY +G  N    S    +  +QV MSVPG +SRKPP+ +LL EY+ G K + CIELF+R
Sbjct  121   LGYINGNANAKQGSNFKLLERSQVIMSVPGAHSRKPPLEQLLSEYIPGPKPSRCIELFAR  180

Query  1231  ELSAGWTSWGNEPLHFQASKYFVSK  1305
             EL   WTSWGNEPLHFQ + YF  K
Sbjct  181   ELFPRWTSWGNEPLHFQDTMYFSEK  205



>ref|XP_008355576.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Malus 
domestica]
Length=246

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 176/252 (70%), Gaps = 15/252 (6%)
 Frame = +1

Query  76   MEDDQ----LSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS-TEK  240
            MED +    LS+FL SG+YR + + A FIDPVRV+NRSYTR+RVSPSAYYSR F S  ++
Sbjct  1    MEDSKPAGKLSTFLDSGVYRFEDSTAVFIDPVRVLNRSYTRFRVSPSAYYSRSFKSKIQE  60

Query  241  LETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
                + SRKRKR EKK  +LN+RE+ A+QRHQE RP LLKAH++LL +TELL+VV NLR 
Sbjct  61   PRVCSNSRKRKRKEKKPQNLNDRERAADQRHQEARPFLLKAHKSLLRSTELLEVVSNLRD  120

Query  421  eectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS----HLGQDV  588
            +          +Q     S V+LG VWQAPLYEI LN Q  D   E+ GS    +  Q  
Sbjct  121  DFDNSASSPGTTQ-----SLVELGRVWQAPLYEITLNSQSHDNASEDGGSPVMEYCKQRA  175

Query  589  IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
            +P F+NLVVN+ S D EAE L  +YI+P ES FYMSD+ +IHNLIP +SD GFN+IV+DP
Sbjct  176  VPVFNNLVVNETSEDVEAELLGSRYILPPESSFYMSDLGQIHNLIP-ESDCGFNLIVVDP  234

Query  769  PWENSSAHQKQR  804
            PWEN SA QK R
Sbjct  235  PWENGSARQKLR  246



>gb|EEC74694.1| hypothetical protein OsI_10399 [Oryza sativa Indica Group]
Length=406

 Score =   250 bits (638),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 190/340 (56%), Gaps = 72/340 (21%)
 Frame = +1

Query  79    EDDQLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKL-ETST  255
             E D+L +F  +GIYRL  + A F+DPVR++N SY R+R+ PSAYYSR F ++ +  E  T
Sbjct  5     ESDELRAFEATGIYRLAESGAAFLDPVRILNASYRRFRLVPSAYYSRSFGTSRQGGEAET  64

Query  256   ESRKRKRNEKKTI-----------SLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKV  402
             E       E+K              LNE E++AE RHQE RPLL  AH++LL A +LL+ 
Sbjct  65    ERTGEASPERKKRKRKRQRQPKPRELNEVERMAEARHQEARPLLSSAHKSLLKAKDLLEF  124

Query  403   VRNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
             +  +  E+    +     + + E + V+LGS W+APL E+ L +Q               
Sbjct  125   LPRMIKEDVRVLDV----ESNLEKNLVELGSSWRAPLCEMTLCFQ---------------  165

Query  583   DVIPAFDNLVVNKGSG-DAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
                         K SG D+E +  N                             G+N+IV
Sbjct  166   ------------KSSGEDSEEDNYNQ----------------------------GYNLIV  185

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             +DPPWEN    QK  Y TLPNR FL LP+++L H AGAL+ LW+TNREKL  FVE+ELFP
Sbjct  186   VDPPWENGCVRQKVAYPTLPNRHFLYLPVQELAHPAGALLVLWITNREKLWKFVEEELFP  245

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGY  1059
             AWGVK  T FYWLKVK +GSLI  LDL HHRPYECLL+GY
Sbjct  246   AWGVKDHTVFYWLKVKPDGSLIGNLDLLHHRPYECLLVGY  285



>ref|XP_004160055.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
2-like [Cucumis sativus]
Length=180

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +1

Query  802   RYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLK  981
             RY TLPNR+FL+LPIK+L+H  GALVALWVTNREK   F++ ELFPAWGV +++++YWLK
Sbjct  9     RYPTLPNRYFLALPIKKLSHGKGALVALWVTNREKFHRFIDLELFPAWGVVHISTYYWLK  68

Query  982   VKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKL----NAIPNNQVFMSVPGDYS  1149
             VKA+GSLIS+LDLFHHRPYECLLLGY  G+ +  D   +      +P ++V +S+PGDYS
Sbjct  69    VKADGSLISDLDLFHHRPYECLLLGYCYGEVSIXDVQDVKILDQTLPKDRVIISIPGDYS  128

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             RKPPI ELL EY+ G K   CIELF+RE++ GW SWGNEPLHFQ S+YF
Sbjct  129   RKPPIAELLQEYVPGPKPGRCIELFAREMNPGWLSWGNEPLHFQESQYF  177



>gb|ACU22910.1| unknown [Glycine max]
Length=273

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 168/264 (64%), Gaps = 24/264 (9%)
 Frame = +1

Query  73   GMEDD--QLSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDSTEKLE  246
            G  DD  +LS F +SGIY    +NA F+DPVRV+NRSY R+ VSPS YYSRFF S     
Sbjct  3    GEHDDSQKLSLFYESGIYYFDDSNAVFVDPVRVLNRSYHRFTVSPSTYYSRFFKSPTTPN  62

Query  247  TSTES-----RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRN  411
            + + +     RKRKR  K+   LNERE +A QRHQE RPLLL AHE LL +TELL V++ 
Sbjct  63   SVSSTVSSSLRKRKRKPKEPPPLNERELIALQRHQEARPLLLAAHECLLKSTELLNVLKT  122

Query  412  LrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHL-----  576
            L+ E    ++  E  QQ    SFVDLG    +P  E+ L+ +  DA      + L     
Sbjct  123  LKSESRCSKKECEGGQQH---SFVDLGR--GSPQLEVTLSLRVSDADTHLPPNELEDSLS  177

Query  577  ----GQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYM---SDVRKIHNLIPADS  735
                 Q V+PAF+NLV N    DA AE L++ YI+P+ESCFYM   SD+ +I NLIPA +
Sbjct  178  VQCCEQKVLPAFNNLVANDTKDDAVAEILDNCYIVPRESCFYMMWKSDLGQIRNLIPAHA  237

Query  736  DSGFNIIVIDPPWENSSAHQKQRY  807
            DSGFN+IV+DPPWEN+SAHQK RY
Sbjct  238  DSGFNLIVVDPPWENASAHQKSRY  261



>ref|XP_010060918.1| PREDICTED: methyltransferase-like protein 2 isoform X3 [Eucalyptus 
grandis]
Length=267

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 174/253 (69%), Gaps = 8/253 (3%)
 Frame = +1

Query  61   ITGSGMEDDQ-LSSFLKSGIYRLQ-SANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS-  231
            + G G E  + LS FL+SG+YRL+ S  A F+DPVRV+NR+  R+ +SPSAYYSRFF+  
Sbjct  1    MGGDGSEPRRSLSLFLESGVYRLEGSGGAVFVDPVRVLNRALARFSISPSAYYSRFFEPG  60

Query  232  -TEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
             +E     +  RKRKR  +K + LN+RE+VA QRHQE RP L+KAHEAL+GATEL  ++ 
Sbjct  61   PSEADRGGSNGRKRKRRARKPLVLNDRERVAAQRHQEARPFLVKAHEALVGATELRSLML  120

Query  409  NLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG---  579
             ++ E  T E+R+ L+      SF++LG +WQAPLYEI LN+ +     +   S +    
Sbjct  121  KMKGEVATAEDRK-LAPPGVPPSFIELGRLWQAPLYEITLNFLQEKPTGDGGPSIIHSKE  179

Query  580  QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
            Q VIP F+NLV N    D EAEFL  +Y+IP+ESCFYMSD+++IH +IP + D+ F+ IV
Sbjct  180  QKVIPIFNNLVHNGTKDDLEAEFLGSQYVIPRESCFYMSDLQQIHRMIPVEGDAHFHFIV  239

Query  760  IDPPWENSSAHQK  798
            IDPPWEN SA QK
Sbjct  240  IDPPWENGSAQQK  252



>ref|XP_002981617.1| hypothetical protein SELMODRAFT_114834, partial [Selaginella 
moellendorffii]
 gb|EFJ17432.1| hypothetical protein SELMODRAFT_114834, partial [Selaginella 
moellendorffii]
Length=207

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 141/197 (72%), Gaps = 4/197 (2%)
 Frame = +1

Query  718   LIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTN  897
             L+     +G+N+I+IDPPWEN S H++  Y TLPN++ LSLP++QL H++GAL+ LW+TN
Sbjct  1     LVSDSPSTGYNLIIIDPPWENKSVHRRSIYPTLPNKYLLSLPLQQLVHSSGALIGLWITN  60

Query  898   REKLRSFVEKELFPAWGVKYVTSFYWLKVKAN-GSLISELDLFHHRPYECLLLGYSDGKD  1074
             REKL  FVEKELFPAW +  V  +YWLKV  + G+++SELDL HH+PYECLL+  +  + 
Sbjct  61    REKLHQFVEKELFPAWKLIPVGVWYWLKVITDAGTMVSELDLNHHKPYECLLVASTLMQA  120

Query  1075  NTSDFSKLNAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTS  1254
                 F   N +P+ +V ++VPG +SRKPP+G LL ++    K    +ELF+RE++A WTS
Sbjct  121   RLRFFDH-NDVPHRRVAITVPGQHSRKPPLGVLLADF--APKPVRALELFAREMNANWTS  177

Query  1255  WGNEPLHFQASKYFVSK  1305
             WGNEPL FQ   YFV +
Sbjct  178   WGNEPLRFQGKSYFVER  194



>ref|XP_002963171.1| hypothetical protein SELMODRAFT_80323, partial [Selaginella moellendorffii]
 gb|EFJ35042.1| hypothetical protein SELMODRAFT_80323, partial [Selaginella moellendorffii]
Length=190

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 138/189 (73%), Gaps = 4/189 (2%)
 Frame = +1

Query  742   GFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFV  921
             G+N+I+IDPPWEN S H++  Y TLPN++ +SLP++QL H++GAL+ LW+TNREKL  FV
Sbjct  1     GYNLIIIDPPWENKSVHRRSIYPTLPNKYLMSLPLQQLVHSSGALIGLWITNREKLHQFV  60

Query  922   EKELFPAWGVKYVTSFYWLKVKAN-GSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKL  1098
             EKELFPAW +  V  +YWLKV  + G+++SELDL HH+PYECLL+  +  +     F   
Sbjct  61    EKELFPAWKLIPVGVWYWLKVITDAGAMVSELDLNHHKPYECLLVAGTLMQARLRFFDH-  119

Query  1099  NAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHF  1278
             N +P+ +V ++VPG +SRKPP+G LL ++    K    +ELF+RE++A WTSWGNEPL F
Sbjct  120   NDVPHRRVAITVPGQHSRKPPLGVLLADF--APKPVRALELFAREMNANWTSWGNEPLRF  177

Query  1279  QASKYFVSK  1305
             Q   YFV +
Sbjct  178   QGKSYFVER  186



>ref|XP_002465694.1| hypothetical protein SORBIDRAFT_01g043900 [Sorghum bicolor]
 gb|EER92692.1| hypothetical protein SORBIDRAFT_01g043900 [Sorghum bicolor]
Length=640

 Score =   223 bits (569),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 158/277 (57%), Gaps = 58/277 (21%)
 Frame = +1

Query  310   EKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQSCELSFVDL  489
             E+VAE RHQE RPLLLKAHE+L+ A  LL+ +     +     +    S+ +    FV+L
Sbjct  2     EQVAEARHQEARPLLLKAHESLIKAKHLLEYISKTIKDNRHTLDAGSGSENN----FVEL  57

Query  490   GSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYII  669
             G+ W+AP YEI L +Q+  +H+      LG +           +GS              
Sbjct  58    GTSWRAPFYEITLCFQK--SHV------LGNE-----------EGS--------------  84

Query  670   PKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIK  849
                                   + G+N+IV+DPPWEN    QK+ Y TLPNR+ L LP++
Sbjct  85    ---------------------PNQGYNLIVVDPPWENGCVRQKEEYPTLPNRYLLYLPVQ  123

Query  850   QLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHH  1029
             +L H AGAL+ LW+TNREKLR FVEKEL P+WGVK  + FYWLKVK +GSLI +LDLFHH
Sbjct  124   ELAHPAGALLVLWITNREKLRVFVEKELLPSWGVKNPSVFYWLKVKPDGSLIGDLDLFHH  183

Query  1030  RPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVPG  1140
             RPYECLLLGY +   N    S    +  +QV MSVPG
Sbjct  184   RPYECLLLGYINVNTNGEQGSNFKLLEGSQVIMSVPG  220



>ref|XP_008355577.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Malus 
domestica]
Length=233

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 146/216 (68%), Gaps = 14/216 (6%)
 Frame = +1

Query  76   MEDDQ----LSSFLKSGIYRLQSANAFFIDPVRVVNRSYTRYRVSPSAYYSRFFDS-TEK  240
            MED +    LS+FL SG+YR + + A FIDPVRV+NRSYTR+RVSPSAYYSR F S  ++
Sbjct  1    MEDSKPAGKLSTFLDSGVYRFEDSTAVFIDPVRVLNRSYTRFRVSPSAYYSRSFKSKIQE  60

Query  241  LETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrc  420
                + SRKRKR EKK  +LN+RE+ A+QRHQE RP LLKAH++LL +TELL+VV NLR 
Sbjct  61   PRVCSNSRKRKRKEKKPQNLNDRERAADQRHQEARPFLLKAHKSLLRSTELLEVVSNLRD  120

Query  421  eectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGS----HLGQDV  588
            +          +Q     S V+LG VWQAPLYEI LN Q  D   E+ GS    +  Q  
Sbjct  121  DFDNSASSPGTTQ-----SLVELGRVWQAPLYEITLNSQSHDNASEDGGSPVMEYCKQRA  175

Query  589  IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMS  696
            +P F+NLVVN+ S D EAE L  +YI+P ES FYMS
Sbjct  176  VPVFNNLVVNETSEDVEAELLGSRYILPPESSFYMS  211



>ref|XP_005647981.1| MT-A70 [Coccomyxa subellipsoidea C-169]
 gb|EIE23437.1| MT-A70 [Coccomyxa subellipsoidea C-169]
Length=197

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 128/191 (67%), Gaps = 3/191 (2%)
 Frame = +1

Query  736   DSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRS  915
             + G++ IV+DPPWEN SA +   Y TLP+R  LS+PI +L +  G L+ALWVTNRE+LR 
Sbjct  9     EGGYDCIVMDPPWENKSAKRSGHYPTLPSRHLLSIPIARLLNQQGGLLALWVTNRERLRR  68

Query  916   FVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFS  1092
             FV++EL   WG++ V +++WLKV  +G L+S L++ H RPYE LLL        + SD +
Sbjct  69    FVDQELLAKWGLEQVATWFWLKVTNSGQLVSPLEVAHRRPYEALLLARLRPSAASGSDTN  128

Query  1093  KLNAIPNNQVFMSVPGDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPL  1272
             +      N VF++VPG++SRKP IG LL  ++       C+E+F+REL+A WTSWGNE L
Sbjct  129   EEGRAVRNMVFLAVPGEHSRKPHIGSLLAPHL--LAQPACLEMFARELAADWTSWGNEAL  186

Query  1273  HFQASKYFVSK  1305
              FQ   +F+ K
Sbjct  187   RFQTLDHFIDK  197



>ref|XP_005798616.1| PREDICTED: methyltransferase-like protein 4-like [Xiphophorus 
maculatus]
Length=362

 Score =   188 bits (478),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 185/358 (52%), Gaps = 25/358 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +K E S + RKRK  E     LN+ E  A+  H+++R ++L+  +AL+ + + L  +   
Sbjct  3     QKTEKSAKKRKRKHGE-----LNQGEIDAKAFHEKIRSIILEGTKALVDSAQSLGYLSG-  56

Query  415   rceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVI  591
                  T+  +  L  Q C L+   ++    + PL  +    QE    +  E    G   +
Sbjct  57    ----ETETSQDPLPSQDCRLAALCEIAK--ELPL--VADEEQEWTQSLLTEEG--GASHV  106

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F  +  N  +  A    +  +YIIP  + F +SD  +I  L+       F++IVIDPP
Sbjct  107   DLFSQVTENSQAWAAVVPLIGEEYIIPPNTAFLLSDFTRIQPLV--QCGRRFDVIVIDPP  164

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             WEN S  + +RY +LP+     LP+  L  + G LV  WVTNR     FV  EL+P WGV
Sbjct  165   WENKSVKRSRRYSSLPSSQLKRLPVP-LLGSPGCLVVTWVTNRPSHLRFVRDELYPHWGV  223

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNA-IPNNQVF  1125
             + V  ++W+KV  +G  +  LD  H +PYE L+LG Y    D+TS     N  + + ++ 
Sbjct  224   EVVAEWFWVKVTTSGEFVFPLDSPHKKPYEVLVLGRYRPANDHTSPLQTANVPVEDKRLI  283

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             +SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  284   VSVPSALHSQKPSLSEVLKLYVGA--EAKCLELFARSLQPGWTSWGNEVLKFQHISYF  339



>ref|XP_689178.3| PREDICTED: methyltransferase-like protein 4 isoform X1 [Danio 
rerio]
Length=450

 Score =   191 bits (484),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 185/371 (50%), Gaps = 25/371 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGA-TELLKVVRN  411
             EK+E  T    RK+ ++K   LN  E  A   H +VR ++L+   ALL A  +       
Sbjct  79    EKIELQT----RKKRKRKHHDLNTGEIEANIYHDKVRSVVLEGSRALLEAGRQCGYFTEA  134

Query  412   LrceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAH-IENEGSHLGQD  585
             L   +         S   C+L+ F DL    Q PL E      E   H +  +G +   D
Sbjct  135   LTESQTISTPSESTSAHECQLAAFCDLAK--QLPLSE------ESPVHTLSRDGQNPALD  186

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F ++  N      E  F+  +Y++P    F +SDV ++  L+  +S   F++IV+D
Sbjct  187   L---FSSITENPFDCACEITFMRERYLLPPRCRFLLSDVTRMDPLV--NSGDKFDLIVLD  241

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN S  +  RY +LP+     LP+  L    G LV  WVTNR K R FV +EL+P W
Sbjct  242   PPWENKSVKRSNRYSSLPSSQLKKLPVPALA-APGGLVVTWVTNRAKHRRFVREELYPHW  300

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYS-DGKDNTSDFSKLNAIPNNQV  1122
              V+ +  + W+KV  +G  +  LD  H +PYE L+LG      D+T   S +N +P+ ++
Sbjct  301   AVEVLAEWLWVKVTRSGEFVFPLDSQHKKPYEVLVLGRCRSTSDHTDRCSAVNELPDQRL  360

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KP +  +L  Y+   +   C+ELF+R L + W+ WGNE L FQ   YF 
Sbjct  361   LVSVPSTLHSHKPSLAAVLKPYIR--REPRCLELFARSLQSDWSCWGNEVLKFQHCSYFS  418

Query  1300  SKNRQMKAPDS  1332
                 Q    D+
Sbjct  419   RHTDQEPTSDT  429



>gb|KDO84448.1| hypothetical protein CISIN_1g031322mg [Citrus sinensis]
Length=161

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 116/176 (66%), Gaps = 22/176 (13%)
 Frame = +1

Query  298  LNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQSC--E  471
            LNERE  A+QRHQEV+PLLL AHEALL A +LL  V  L  +          S   C  E
Sbjct  2    LNERELAADQRHQEVKPLLLIAHEALLAAIDLLNFVGKLNGDFG--------SSMKCGVE  53

Query  472  LSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ----DVIPAFDNLVVNKGSGDAE  639
             SF++LG VWQAP+YEI LN+        N+ S + Q     V+P F+NLV N+   D E
Sbjct  54   ESFIELGRVWQAPMYEITLNF--------NQCSVIDQFREPRVLPLFNNLVANETGDDVE  105

Query  640  AEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRY  807
            AE L+  YI+P+ESCF+MSD+ +IHNLIPADSD GFN+IVIDPPWEN SA QK  Y
Sbjct  106  AEILDRTYILPRESCFFMSDLGQIHNLIPADSDCGFNLIVIDPPWENGSARQKSVY  161



>ref|XP_007555737.1| PREDICTED: methyltransferase-like protein 4 [Poecilia formosa]
Length=423

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/362 (34%), Positives = 187/362 (52%), Gaps = 31/362 (9%)
 Frame = +1

Query  232   TEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRN  411
             T+K E   + RKRK  E     LN+ E  A+  H+++R ++L+  ++L+ + + L  +  
Sbjct  67    TQKTEKCAKKRKRKHGE-----LNQGEIDAKAFHEKIRSIILEGTKSLVDSAQSLGYLSG  121

Query  412   LrceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHI---ENEGSHLG  579
                   T+  +  L  Q C L+   ++    + PL  +    QE    +   E   SH  
Sbjct  122   -----ETETSKDPLPSQDCRLAALCEMAK--ELPL--VADEEQEWTQSLLTEEGVASH--  170

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
                +  F  +  N  +  A    +  +YIIP ++ F +SD  +I  L+       F++IV
Sbjct  171   ---VDLFSQVTENSEAWAAVVPLMGEEYIIPHDTAFLLSDFTRIQPLV--QCGRRFDVIV  225

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPWEN S  + +RY +LP+     LP+  L  + G LV  WVTNR     FV  EL+P
Sbjct  226   IDPPWENKSVKRSRRYSSLPSSQLKRLPVP-LLGSPGCLVVTWVTNRPSHLRFVRDELYP  284

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNA-IPN  1113
              WGV+ V  ++W+KV  +G  +  LD  H +PYE L+LG Y    D+TS     N  + +
Sbjct  285   HWGVEVVAEWFWVKVTTSGEFVFPLDSPHKKPYEVLVLGRYRPANDHTSPLQTANVPVED  344

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ   
Sbjct  345   KRLIVSVPSALHSQKPSLSEVLKLYVGA--EAKCLELFARSLQPGWTSWGNEVLKFQHIS  402

Query  1291  YF  1296
             YF
Sbjct  403   YF  404



>ref|XP_002158431.2| PREDICTED: methyltransferase-like protein 4-like [Hydra vulgaris]
Length=269

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 143/244 (59%), Gaps = 11/244 (5%)
 Frame = +1

Query  571   HLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFN  750
             H G +++   D +  N  +      + N +Y+IP +S F +SD  K+  L  A  D  ++
Sbjct  31    HEGFNIVCLEDQIYKNSLTNTCTVVYQNERYLIPPKSSFIVSDFSKLSYL--AKQDIVYD  88

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +IVIDPPWEN SA +K+ Y TLP      +P+++L    G +VA+WVTN+ K   FV+ +
Sbjct  89    LIVIDPPWENKSAKRKKDYTTLPEYDLKKIPVRRLLSKHG-IVAIWVTNKPKYIDFVKHQ  147

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIP  1110
             LF  WGV+ V  ++W+KV  +G  +++    H RPYE LLLG  +  +      +   IP
Sbjct  148   LFVEWGVRVVAHWHWVKVTNDGEFVTDFSSIHKRPYEPLLLGQRENCE-----LRFCEIP  202

Query  1111  NNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
               +V  SVP + +SRKPP+  +L  Y+   ++A C+E+F+R L  GW SWGNE L FQ S
Sbjct  203   ERKVICSVPCNIHSRKPPLNFILSSYVP--ENALCLEMFARNLLPGWLSWGNEVLKFQNS  260

Query  1288  KYFV  1299
             KYF 
Sbjct  261   KYFC  264



>ref|XP_004606060.1| PREDICTED: methyltransferase-like protein 4 [Sorex araneus]
Length=471

 Score =   183 bits (465),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 118/361 (33%), Positives = 187/361 (52%), Gaps = 21/361 (6%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST   ++KR  K+ +  N+ E  A + H ++R L+++    L+        +    
Sbjct  121   KKEMSTARMRKKR--KRCVDFNQGELDAMEYHTKIRELIMEGSSQLIQEGLKSGFLHPFS  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              +E   ++   L   +C LS +   +     L E+ L   +    +EN  S   QD+   
Sbjct  179   EKEDKCKKPITLPLNTCSLSDLCEMAKHLPCLSEMELQTLQ---LMENNTSFTEQDL---  232

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  +Y +P  S F +SD+  I  L+  +    +++IVIDPPW+
Sbjct  233   FSRVVENNSSFTKMITLMGQQYFLPPRSSFLLSDISCIQPLL--NCRKAYDVIVIDPPWQ  290

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       LPI +L      LV  WVTNR+K+  FV++EL+P+W V  
Sbjct  291   NKSVKRSNRYSYLSYLQIKQLPISKLA-APNCLVITWVTNRQKILRFVKEELYPSWSVAV  349

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-----NTSDFSKLNAIPNNQV  1122
             V  ++W+K+ ++G  +  LD  H +PYE L++G    K      NT +  K+  +P++++
Sbjct  350   VAEWHWVKITSSGEFVFPLDSLHKKPYEGLIIGRVQEKTASPVRNTDE--KVLPVPDHKL  407

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L +YM    +  C+ELF+R L  GWTSWGNE L FQ   YFV
Sbjct  408   IVSVPCTLHSHKPPLAEVLKDYMK--PNGRCLELFARNLQPGWTSWGNEVLKFQHVDYFV  465

Query  1300  S  1302
             +
Sbjct  466   A  466



>ref|NP_001254806.1| methyltransferase-like protein 4 [Ovis aries]
 gb|AFC41219.1| methyltransferase-like protein 4 [Ovis aries]
Length=470

 Score =   182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 186/367 (51%), Gaps = 27/367 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  118   DVKKEISISVNGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHL  576
              +   +     E   L   +C LS +   +     L E+    L   E DA++  +G   
Sbjct  174   HSCSEKRNKCSEPITLPHGTCNLSELCEMAKHLPSLNEMELQTLQLMEDDAYVTEQG---  230

Query  577   GQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNII  756
                    F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++I
Sbjct  231   ------LFSRIVENTSSFTKMITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVI  282

Query  757   VIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELF  936
             VIDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+
Sbjct  283   VIDPPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELY  341

Query  937   PAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNA  1104
             P+W V+ V  ++W+K+ ++G  +   D  H +PYE L+LG    K       +D  +L  
Sbjct  342   PSWSVEVVAEWHWVKITSSGEFVFPFDSPHKKPYEGLILGRVREKAALLLRNADVKEL-P  400

Query  1105  IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
             IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ
Sbjct  401   IPDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQ  458

Query  1282  ASKYFVS  1302
                YFV+
Sbjct  459   HMDYFVA  465



>emb|CDS08180.1| hypothetical protein LRAMOSA02128 [Absidia idahoensis var. thermophila]
Length=395

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 179/357 (50%), Gaps = 28/357 (8%)
 Frame = +1

Query  247   TSTESRKRKRNEKKTISLNEREKVAEQRHQE-VRPLLLKAHEALLGATELLKVVRNLrce  423
             T++  +KRKR     I         E  HQE  RP L++         EL K +      
Sbjct  49    TASAGQKRKRENIADIE-------TESWHQEHARPFLVQC------IKELSKDI--FSQL  93

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFD  603
             + T      LS     + F  L S+ QA         Q     + ++      + +  F 
Sbjct  94    DSTKHTSTALSNDDSGIDFTSLVSLAQA---SSRFTRQLDRLELTDQDHVTDMEPLDVFH  150

Query  604   NLVVNKGSGDAEAEFL-NHKYIIPKESCFYMSDVRK-IHNLIPADSDSGF-NIIVIDPPW  774
              ++ N  + +A    + + KYIIP ++ FYMSD+   + +L       GF + IV+DPPW
Sbjct  151   RMISNSSTSNAVQIIIQDQKYIIPPDASFYMSDMTTGMKDLKTHARSIGFYDFIVMDPPW  210

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
              N S H+   Y+T        +P+KQL  T G L+A+WVTN+ K R FV  +LFP W +K
Sbjct  211   PNKSVHRSSHYETQDIYDLFKIPMKQLIATGG-LLAVWVTNKPKFRKFVINKLFPTWNIK  269

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD--NTSDFSKLNAIPNNQVFM  1128
             +V  +YWLKV  +G  +  LD  H +PYE L+LG +  +   +  D S    IP+    +
Sbjct  270   FVGVWYWLKVTTSGETVVPLDSPHRKPYEQLVLGIAMPQQPLDQEDESSSKGIPDTHAII  329

Query  1129  SVPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             S+P   +SRKPP+ +++  Y+   K   C+ELF+R L+  WTSWGNE L FQ S+YF
Sbjct  330   SIPSRQHSRKPPLQDVMANYLP--KDPKCLELFARCLTPHWTSWGNECLKFQHSQYF  384



>ref|XP_005697124.1| PREDICTED: methyltransferase-like protein 4 [Capra hircus]
Length=470

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/367 (32%), Positives = 189/367 (51%), Gaps = 27/367 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  118   DVKKEISISVNGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHL  576
              +   ++    E   L   +C LS +   +     L E+    L   E DA++       
Sbjct  174   HSCSEKQNKFSEPIALPHDTCNLSELCEMAKHLPSLNEMELQTLQLMEDDAYVTE-----  228

Query  577   GQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNII  756
              QD+   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++I
Sbjct  229   -QDL---FSRIVENTSSFTKMITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVI  282

Query  757   VIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELF  936
             VIDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+
Sbjct  283   VIDPPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELY  341

Query  937   PAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNA  1104
             P+W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  
Sbjct  342   PSWSVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLRNADVKEL-P  400

Query  1105  IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
             IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ
Sbjct  401   IPDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQ  458

Query  1282  ASKYFVS  1302
                YFV+
Sbjct  459   HMDYFVA  465



>ref|XP_008072956.1| PREDICTED: methyltransferase-like protein 4 [Tarsius syrichta]
Length=467

 Score =   181 bits (460),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 188/365 (52%), Gaps = 23/365 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  E++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  115   DVKEEISISVIGKKRKR----CVVFNQGELDAMEYHTKIRKLILDGSLQLIQEGLKSGFL  170

Query  406   RNLrceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
               L  ++    +   L   +C LS   ++   W + L E+ L   +    +E++ S   Q
Sbjct  171   YPLCEKQDKCSKLISLPLDTCSLSELCEMAKHWPS-LNEMELQTLQL---LEDDTSVAEQ  226

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D+   F  +V N  S       +  KY++P +SCF +SD+  +  L+  +    F++IVI
Sbjct  227   DL---FSRVVENNSSFTKMITLMGQKYLLPPKSCFLLSDISCMQPLL--NCGKKFDVIVI  281

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN S  +  RY  L       +P+ +L      L+  WVTNR+K   FV+ EL+P+
Sbjct  282   DPPWENKSVKRSNRYSYLSPLQIKQIPVPKLA-APNCLIVTWVTNRQKHLHFVKGELYPS  340

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK----DNTSDFSKLNAIP  1110
             W V+    ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  K+  IP
Sbjct  341   WSVEMAAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVQEKTALPSRNADV-KVLPIP  399

Query  1111  NNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
             ++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ  
Sbjct  400   DHKLIVSVPCTLHSHKPPLAEVLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHM  457

Query  1288  KYFVS  1302
              YF++
Sbjct  458   DYFIA  462



>ref|XP_002938955.1| PREDICTED: methyltransferase like 4 [Xenopus (Silurana) tropicalis]
Length=417

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 183/357 (51%), Gaps = 18/357 (5%)
 Frame = +1

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
             ET+  +  +K+  K++ + N+ E  A   H+++   +L+  + L+        ++ L   
Sbjct  68    ETNPTATNQKKKRKRSCAFNQGELDAMDYHKKITDFILEGTQPLIQEGFKKLFLQALSVN  127

Query  424   ectdeerreLSQQSCELSFVDLGSVWQA-PLYEIVLNYQEGDAHIENEGSHLGQDVIPAF  600
             +   +    L    C+L+  +L ++ ++ PL    LN+ E    +   G +L Q+     
Sbjct  128   DNHSQTEPGLCNNPCQLA--ELCNMAKSMPL----LNFGEHTVLVLESGLYLPQETN-VL  180

Query  601   DNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWEN  780
               +  NK        F+  KYIIP +S F MSDV  +  L+       +NIIV+DPPWEN
Sbjct  181   SCITENKSECPKVIHFIGEKYIIPPKSTFLMSDVSCMEPLL---QYKKYNIIVMDPPWEN  237

Query  781   SSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYV  960
              S  + +RY +L       LP+  L      LV  WVTN++K   FV+++L+P W V+ +
Sbjct  238   KSVKRSKRYNSLSPNEIQQLPVPALA-APDCLVITWVTNKQKHLRFVKEDLYPQWSVRTL  296

Query  961   TSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFS---KLNAIPNNQVFMS  1131
               ++W+K+  +G  +  LD  H +PYE L+LG   G  N++       L  IP  ++ +S
Sbjct  297   GEWHWVKITRSGEFVFPLDSNHKKPYEVLVLGRFQGTVNSAGRESGISLPPIPERKLIVS  356

Query  1132  VPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             VP   +S KPP+ E+L EY+       C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  357   VPCKLHSHKPPLSEVLKEYVK--PDVECLELFARNLQPGWTSWGNEVLKFQHIDYFT  411



>ref|XP_006058716.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Bubalus 
bubalis]
 ref|XP_006058717.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Bubalus 
bubalis]
Length=469

 Score =   181 bits (459),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 190/366 (52%), Gaps = 25/366 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D+ +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  117   DAKKEISISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  172

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLG  579
              +   +     E   L   +C LS      + +   + + LN  E      +E++ S   
Sbjct  173   HSCSEKPNKCSEPITLPLDTCNLS-----ELCEMAKHLLSLNEMELQTLQLMEDDTSVTE  227

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             QD+   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV
Sbjct  228   QDL---FSRIVENTSSFTKMITLMGQKYLLPPKSSFLLSDISYMHPLL--NCKKTYDVIV  282

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P
Sbjct  283   IDPPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYP  341

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAI  1107
             +W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  I
Sbjct  342   SWSVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLRNADVKEL-PI  400

Query  1108  PNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
             P++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ 
Sbjct  401   PDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQH  458

Query  1285  SKYFVS  1302
               YFV+
Sbjct  459   MDYFVA  464



>ref|XP_005974118.1| PREDICTED: methyltransferase-like protein 4 [Pantholops hodgsonii]
Length=468

 Score =   180 bits (457),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 115/364 (32%), Positives = 188/364 (52%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  116   DVKKEISISVNGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  171

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
              +   +     E   L   +C LS +   +     L E+ L   +    +E++     QD
Sbjct  172   HSCSEKWNKCSEPITLPHDTCNLSELCEMAKHLPSLNEMELQTLQL---MEDDACVTEQD  228

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IVID
Sbjct  229   L---FSRIVENTSSFTKMITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIVID  283

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  284   PPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHVRFVKEELYPSW  342

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  343   SVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLRNADVKEL-PIPD  401

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  402   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  459

Query  1291  YFVS  1302
             YFV+
Sbjct  460   YFVA  463



>emb|CDH52371.1| methyltransferase-like protein 4 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=394

 Score =   178 bits (452),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 120/358 (34%), Positives = 179/358 (50%), Gaps = 32/358 (9%)
 Frame = +1

Query  247   TSTESRKRKRNEKKTISLNEREKVAEQRHQE-VRPLLLKAHEALLGATELLKVVRNLrce  423
             T++  +KRKR E      N  +   E  HQE  RP L++         EL K V      
Sbjct  50    TASAGQKRKRQE------NTADIETENWHQEHARPFLIQC------INELPKDV-----F  92

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIE-NEGSHLGQDVIPAF  600
                D      S  +  + F  L S+ QA        + + + H+    G+H+  + +  F
Sbjct  93    SHLDNTETAASNDAIGIDFTSLVSLAQA-----SSRFTQKEDHLNLPPGNHV-MEPLDVF  146

Query  601   DNLVVNKGSGDA-EAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDS--GFNIIVIDPP  771
               ++ N  + +A +    +  YIIP  + FYMSD+      + A + S   F+ +V+DPP
Sbjct  147   HRIISNPSTSNAVQITIQDQDYIIPPGASFYMSDMSTGMKDLKAHARSIGFFDFVVMDPP  206

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             W N S H+   Y+T        +P+KQL    G L+A+WVTN+ K R FV  +LFP W +
Sbjct  207   WPNKSVHRSSHYETQDIYDLFKIPMKQLI-APGGLLAVWVTNKPKFRKFVMNKLFPTWNI  265

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             K V  +YWLKV  +G  +  LD  H +PYE L+LG      +    S   +IP+    +S
Sbjct  266   KLVGVWYWLKVTTSGEPVVPLDSPHRKPYEQLVLGMVMPHQDQESLSTRESIPDTHAIIS  325

Query  1132  VPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +P   +SRKPP+ +++  Y+   K   C+ELF+R L+  WTSWGNE L FQ  +YF S
Sbjct  326   IPSRRHSRKPPLQDVMAHYLP--KDPKCLELFARCLTPHWTSWGNECLKFQHDEYFES  381



>ref|XP_006761927.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Myotis 
davidii]
 ref|XP_006761928.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Myotis 
davidii]
Length=463

 Score =   179 bits (455),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 117/360 (33%), Positives = 185/360 (51%), Gaps = 25/360 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E S  +  +KR  K+ +  N+ E  A + H+++R L+L     ++        +  L 
Sbjct  117   KKEISISALGKKR--KRCVGFNQGELDAMEYHEKIRGLILDGSSQIIQEGLKSGFLHPLS  174

Query  418   ceectdeerreLSQQSCELSFV-----DLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
              ++    E   LS  +C LS +      L S+ +  L  + L        +EN+ S   Q
Sbjct  175   EKQDKCNEPVTLSFDTCNLSELCEMAKHLPSLNETELLTLQL--------MENDMSVTEQ  226

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D+   F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVI
Sbjct  227   DL---FSRIVENNSRFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVI  281

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+
Sbjct  282   DPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPS  340

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQV  1122
             W V+ +  ++WLK+  +G  +  LD  H +PYE L+LG    K  T     +  IP++++
Sbjct  341   WSVEIIAEWHWLKITNSGEFVFPLDSPHKKPYEGLILGRVQEK-TTLPLRNMVPIPDHKL  399

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  400   IVSVPCTLHSHKPPLAEVLKDYIKPD--GDCLELFARNLQPGWTSWGNEVLKFQHVDYFI  457



>ref|XP_005868808.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Myotis 
brandtii]
 gb|EPQ09283.1| Methyltransferase-like protein 4 [Myotis brandtii]
Length=462

 Score =   179 bits (454),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 186/361 (52%), Gaps = 27/361 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  ST  +KRKR     +  N+ E  A + H+++R L+L     ++        +  L
Sbjct  118   KEISISTLGKKRKR----CVGFNQGELDAMEYHEKIRGLILNGSSQIIQEGLKSGFLHPL  173

Query  415   rceectdeerreLSQQSCELSFV-----DLGSVWQAPLYEIVLNYQEGDAHIENEGSHLG  579
               ++    E   LS  +C LS +      L S+ +  L  + L        +EN+ S   
Sbjct  174   SEKQDKCNEPITLSFDTCNLSELCEMAKHLPSLNEMELLTLQL--------MENDMSVTE  225

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             QD+   F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IV
Sbjct  226   QDL---FSRIVENNSRFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIV  280

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P
Sbjct  281   IDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYP  339

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQ  1119
             +W V+ +  ++WLK+  +G  +  LD  H +PYE L+LG    K  T     +  +P+++
Sbjct  340   SWSVEIIAEWHWLKITNSGEFVFPLDSPHKKPYEGLILGRVQEK-TTLPLRNMLPVPDHK  398

Query  1120  VFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             + +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  399   LIVSVPCTLHSHKPPLAEVLKDYIKPD--GDCLELFARNLQPGWTSWGNEVLKFQHVDYF  456

Query  1297  V  1299
             +
Sbjct  457   I  457



>ref|XP_003464466.1| PREDICTED: methyltransferase-like protein 4 [Cavia porcellus]
Length=470

 Score =   179 bits (454),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 174/351 (50%), Gaps = 23/351 (7%)
 Frame = +1

Query  274   RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreL  453
             +  K+++  N+ E  A + H ++R L+L     L+        +  L  +     E   L
Sbjct  130   KKRKRSVVFNQGELDAMEYHTKIRELILDGSSQLIQEGLKSGFLYQLSEKRDKGSEPIAL  189

Query  454   SQQSCELS-FVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNK  621
                SC LS   DL      PL E+    L   E DA +        QD+   F  ++ N 
Sbjct  190   PLDSCSLSGLCDLAKRL-PPLSEMGQRTLQLMEEDASVAE------QDL---FSRVIENN  239

Query  622   GSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQ  801
              S       +  KY++P +S F +SD+  I  L+  +    F++IVIDPPW+N S  +  
Sbjct  240   SSFSKMITLMGQKYLLPPKSSFLLSDISCIQPLL--NCGKMFDVIVIDPPWQNKSVKRSN  297

Query  802   RYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLK  981
             RY  L       +P+ QL      LV  WVTNR++   FV  EL+P+W V+ +  ++W+K
Sbjct  298   RYSYLSPLQIQQIPVPQLA-APDCLVITWVTNRQRHLRFVRDELYPSWSVETLAEWHWVK  356

Query  982   VKANGSLISELDLFHHRPYECLLLGYSDGK---DNTSDFSKLNAIPNNQVFMSVPGD-YS  1149
             +   G  +  LD  H +PYE L+LG   GK    ++    K+   P+ +V +SVP   +S
Sbjct  357   ITKTGEFVFPLDSPHKKPYEGLILGRVQGKAILPSSCPEVKVPPPPDGKVIVSVPCALHS  416

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
              KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  417   HKPPLAEVLKDYIK--PGGECLELFARSLQPGWTSWGNEVLKFQHVDYFVA  465



>ref|XP_005868807.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Myotis 
brandtii]
Length=483

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 186/357 (52%), Gaps = 19/357 (5%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  ST  +KRKR     +  N+ E  A + H+++R L+L     ++        +  L
Sbjct  139   KEISISTLGKKRKR----CVGFNQGELDAMEYHEKIRGLILNGSSQIIQEGLKSGFLHPL  194

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEI-VLNYQEGDAHIENEGSHLGQDVI  591
               ++    E   LS  +C LS +   +     L E+ +L  Q     +EN+ S   QD+ 
Sbjct  195   SEKQDKCNEPITLSFDTCNLSELCEMAKHLPSLNEMELLTLQL----MENDMSVTEQDL-  249

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVIDPP
Sbjct  250   --FSRIVENNSRFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVIDPP  305

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             W+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V
Sbjct  306   WQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSV  364

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             + +  ++WLK+  +G  +  LD  H +PYE L+LG    K  T     +  +P++++ +S
Sbjct  365   EIIAEWHWLKITNSGEFVFPLDSPHKKPYEGLILGRVQEK-TTLPLRNMLPVPDHKLIVS  423

Query  1132  VPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             VP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  424   VPCTLHSHKPPLAEVLKDYIKPD--GDCLELFARNLQPGWTSWGNEVLKFQHVDYFI  478



>ref|XP_006089315.1| PREDICTED: methyltransferase-like protein 4 [Myotis lucifugus]
Length=484

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/356 (33%), Positives = 185/356 (52%), Gaps = 19/356 (5%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             ++  ST  +KRKR     +  N+ E  A + H+++R L+L     ++        +  L 
Sbjct  140   EISISTLGKKRKR----CVGFNQGELDAMEYHEKIRGLILDGSSQIIQEGLKSGFLHPLS  195

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEI-VLNYQEGDAHIENEGSHLGQDVIP  594
              ++    E   LS  +C LS +   +     L E+ +L  Q     +EN+ S   QD+  
Sbjct  196   EKQDKCNEPITLSFDTCNLSELCEMAKHLPSLNEMELLTLQL----MENDMSVTEQDL--  249

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW
Sbjct  250   -FSRIVENNSRFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVIDPPW  306

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V+
Sbjct  307   QNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVE  365

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSV  1134
              +  ++WLK+  +G  +  LD  H +PYE L+LG    K  T     +  IP++++ +SV
Sbjct  366   IIAEWHWLKITNSGEFVFPLDSPHKKPYEGLILGRVQEK-TTLPLRNMLPIPDHKLIVSV  424

Query  1135  PGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             P   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  425   PCTLHSHKPPLAEVLKDYIKPD--GDCLELFARNLQPGWTSWGNEVLKFQHVDYFI  478



>ref|XP_005893715.1| PREDICTED: methyltransferase-like protein 4 [Bos mutus]
Length=470

 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/364 (32%), Positives = 187/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  118   DVKKEIFISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
              +   +     E   L   +C LS +   +     L E  L   +    +E++ S   QD
Sbjct  174   HSCSEKPNKCSEPITLPLDTCNLSELCEMAKHLPSLNETELQTLQL---MEDDTSVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVID
Sbjct  231   L---FSRIVENTSGFTKIITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  +YW+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  345   SVEVVAEWYWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLRNADVKEL-PIPD  403

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  404   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  461

Query  1291  YFVS  1302
             YFV+
Sbjct  462   YFVA  465



>gb|ELR57869.1| Methyltransferase-like protein 4 [Bos mutus]
Length=471

 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 187/365 (51%), Gaps = 22/365 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  118   DVKKEIFISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
              +   +     E   L   +C LS +   +     L E  L   +    +E++ S   QD
Sbjct  174   HSCSEKPNKCSEPITLPLDTCNLSELCEMAKHLPSLNETELQTLQL---MEDDTSVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVID
Sbjct  231   L---FSRIVENTSGFTKIITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-----DNTSDFSKLNAIP  1110
              V+ V  +YW+K+ ++G  +  LD  H +PYE L+LG    K        +D  +L  IP
Sbjct  345   SVEVVAEWYWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLSRNADVKEL-PIP  403

Query  1111  NNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
             ++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ  
Sbjct  404   DHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHM  461

Query  1288  KYFVS  1302
              YFV+
Sbjct  462   DYFVA  466



>ref|XP_007121907.1| PREDICTED: methyltransferase-like protein 4-like [Physeter catodon]
Length=470

 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 187/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  118   DVKKEISISVNGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGLKSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  +     E   L   +C LS +   +     L E+ L   +    +E++ S   QD
Sbjct  174   HTLYEKRDKYSEPITLPLDTCNLSELCEMAKHLPSLNEMELQTLQL---MEDDISVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IVID
Sbjct  231   L---FLRIVENNSSFTKMITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  345   SVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVQEKAALPLRNADVKEL-PIPD  403

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  404   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHVD  461

Query  1291  YFVS  1302
             YFV+
Sbjct  462   YFVA  465



>ref|XP_006205189.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Vicugna 
pacos]
Length=467

 Score =   177 bits (450),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 188/364 (52%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  115   DVKKEISISVTGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGFKSGFL  170

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  ++    E  +L   +C LS +   +     L E+ L   +     E++ S   QD
Sbjct  171   HPLSEKQDKCSEPVKLPLDTCSLSELCEMAKRLPSLNELELQTLQL---TEDDISVTEQD  227

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVID
Sbjct  228   L---FSRVVENNSSFTKMMTLMGQKYLLPPKSSFLLSDISCMQPLL--NCKKTYDVIVID  282

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  283   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  341

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    KD      +D  +L  IP+
Sbjct  342   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKDALLLRNADVKELR-IPD  400

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  401   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  458

Query  1291  YFVS  1302
             YF++
Sbjct  459   YFIA  462



>ref|XP_003507964.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007646689.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007646690.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007646691.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007631167.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007631168.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007631169.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_007631170.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cricetulus 
griseus]
 gb|EGV95242.1| Methyltransferase-like protein 4 [Cricetulus griseus]
 gb|ERE83555.1| methyltransferase-like protein 4 [Cricetulus griseus]
Length=473

 Score =   177 bits (450),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 113/356 (32%), Positives = 185/356 (52%), Gaps = 29/356 (8%)
 Frame = +1

Query  262   RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdee  441
             +KRKR     ++ N+ E  A + H ++R L+L     L+        +     ++  +  
Sbjct  133   KKRKR----CVAFNQGELDAMEYHTKIRELILDGSSQLIQEGLKSGFLYPFVGKQDGNSG  188

Query  442   rreLSQQSCELS-FVDLG----SVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDN  606
             R  L   +C LS F ++     SV +  L  + L         E++ S    D++P    
Sbjct  189   RITLPLDACNLSEFCEMAKRLPSVSETELQTLHLT--------EDDLSVTELDLLP---Q  237

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDPPW+N S
Sbjct  238   VVENNSSFSRMITLMGQKYLLPPQSSFLLSDISCMQPLL--NCSKTFDVIVIDPPWQNKS  295

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
               +  RY  L  +    +P+ +L   A  L+  WVTNR+K   FV++EL+P+W V+ +  
Sbjct  296   VKRSNRYSCLSPQQIKQMPVPKLA-AADCLIVTWVTNRQKHLCFVKEELYPSWSVEVIAE  354

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVP  1137
             +YW+K+  +G  +  LD  H +PYECL+LG    K  +   S   K++ +P+ ++ +SVP
Sbjct  355   WYWVKITHSGEFVFPLDSPHKKPYECLVLGRVREKAASVLRSTGVKVSPVPDQKLIVSVP  414

Query  1138  GD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
                +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   YF++
Sbjct  415   CILHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHVDYFLA  468



>ref|XP_006205188.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Vicugna 
pacos]
Length=467

 Score =   177 bits (449),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 188/364 (52%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  115   DVKKEISISVTGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGFKSGFL  170

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  ++    E  +L   +C LS +   +     L E+ L   +     E++ S   QD
Sbjct  171   HPLSEKQDKCSEPVKLPLDTCSLSELCEMAKRLPSLNELELQTLQL---TEDDISVTEQD  227

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVID
Sbjct  228   L---FSRVVENNSSFTKMMTLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKTYDVIVID  282

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  283   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  341

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    KD      +D  +L  IP+
Sbjct  342   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKDALLLRNADVKELR-IPD  400

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  401   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  458

Query  1291  YFVS  1302
             YF++
Sbjct  459   YFIA  462



>ref|XP_004683825.1| PREDICTED: methyltransferase-like protein 4 [Condylura cristata]
Length=471

 Score =   177 bits (449),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 115/362 (32%), Positives = 188/362 (52%), Gaps = 23/362 (6%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E S+ + ++KR  K+    N+ E  A + H ++R L+L     L+        +  L 
Sbjct  121   KKEISSSTIRKKR--KRCAVFNQGELDAMEYHTKIRRLILDGSSQLIQEGLKSGFLHPLS  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              +     E   L   +C LS +   +     L E+ L   +    +E++ S + QD+   
Sbjct  179   EKRDKCSEPVTLPLDTCNLSELCEMAKHLPSLNEMELQTLQL---MEDDISDIEQDL---  232

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  +       +  KY++P ++ F +SD+  +H L+       +++IVIDPPW+
Sbjct  233   FSRVVENNSNFTKLITLMGQKYLLPPKASFLLSDISCMHPLL--SCKKMYDVIVIDPPWQ  290

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       LP+  L      L+  WVTN++K+  FV++EL+P+W V  
Sbjct  291   NKSVKRSNRYSYLSPLQIKQLPVPTLA-APNCLIVTWVTNKQKILRFVKEELYPSWSVDI  349

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNA------IPNNQ  1119
             V  ++W+K+ ++G  +  LD  H +PYE L+LG    K   +D S  NA      IP+++
Sbjct  350   VAEWHWVKITSSGEFVFPLDSPHKKPYEVLILGRVREK---TDLSLRNADVKVLPIPDHK  406

Query  1120  VFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             + +SVP   +S KPP+ E+L +Y+    +  C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  407   LIVSVPCTLHSHKPPLAEVLKDYIK--PNGECLELFARNLQPGWTSWGNEVLKFQHLDYF  464

Query  1297  VS  1302
             ++
Sbjct  465   IA  466



>ref|XP_010817139.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Bos taurus]
 ref|XP_010817140.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Bos taurus]
 ref|XP_010817141.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Bos taurus]
Length=470

 Score =   177 bits (448),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 116/367 (32%), Positives = 188/367 (51%), Gaps = 26/367 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  117   DVKKEIFISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  172

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLG  579
              +   +     E   L   +C LS      + +   +   LN  E      +E++ S   
Sbjct  173   HSCSEKLNKCSEPITLPLDTCNLS-----ELCEMAKHLPFLNETELQTLQLMEDDTSVTE  227

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             QD+   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV
Sbjct  228   QDL---FSRIVENTSSFTKIITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIV  282

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P
Sbjct  283   IDPPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYP  341

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-----DNTSDFSKLNA  1104
             +W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K        +D  +L  
Sbjct  342   SWSVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLSRNADVKEL-P  400

Query  1105  IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
             IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ
Sbjct  401   IPDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQ  458

Query  1282  ASKYFVS  1302
                YFV+
Sbjct  459   HMDYFVA  465



>ref|NP_001192812.1| methyltransferase-like protein 4 [Bos taurus]
 ref|XP_005224233.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Bos taurus]
 tpg|DAA15839.1| TPA: hypothetical protein BOS_22302 [Bos taurus]
Length=469

 Score =   177 bits (448),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 188/366 (51%), Gaps = 25/366 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  117   DVKKEIFISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  172

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLG  579
              +   +     E   L   +C LS      + +   +   LN  E      +E++ S   
Sbjct  173   HSCSEKLNKCSEPITLPLDTCNLS-----ELCEMAKHLPFLNETELQTLQLMEDDTSVTE  227

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             QD+   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV
Sbjct  228   QDL---FSRIVENTSSFTKIITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIV  282

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P
Sbjct  283   IDPPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYP  341

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAI  1107
             +W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  I
Sbjct  342   SWSVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLRNADVKEL-PI  400

Query  1108  PNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
             P++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ 
Sbjct  401   PDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQH  458

Query  1285  SKYFVS  1302
               YFV+
Sbjct  459   MDYFVA  464



>ref|XP_007456615.1| PREDICTED: methyltransferase-like protein 4 [Lipotes vexillifer]
Length=470

 Score =   176 bits (447),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 186/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H +VR L+L     L+        +
Sbjct  118   DVKKEISISVSGKKRKR----CVVFNQGELDAMEYHTKVRGLILDGSSQLIQEGLKSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  +     E   L   +C LS +   +     L E+ L   +    +E++ S   QD
Sbjct  174   HPLYEKRDKYSEPITLPLDTCNLSELCEMAKHLPSLNEVELQTLQL---MEDDISVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  ++ L+       +++IVID
Sbjct  231   L---FSRIVENNSSFTKMITLMGQKYLLPPKSSFLLSDISCMYPLL--SCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  345   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALPLRNADVKEL-PIPD  403

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  404   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHVD  461

Query  1291  YFVS  1302
             YFV+
Sbjct  462   YFVA  465



>ref|XP_004909635.1| PREDICTED: methyltransferase-like protein 4 [Heterocephalus glaber]
 gb|EHB18686.1| Methyltransferase-like protein 4 [Heterocephalus glaber]
Length=471

 Score =   176 bits (447),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 179/359 (50%), Gaps = 17/359 (5%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  KK +  N+ E  A + H ++R L+L     L+        +    
Sbjct  121   KKEISTSIIGKKR--KKCVVFNQGELDAMEYHTKIRELILDGSLKLIQEGLKSGFLYQFF  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              ++    E   +   +C LS +   +     L E  L   +    IE + S   QD+   
Sbjct  179   EKQDKCSEPNAIPHDACSLSGLCEMAKHLPALSEKELQTLQ---LIEEDLSVTEQDL---  232

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P    F +SD+  +  L+  +    F++IVIDPPW+
Sbjct  233   FSRVVENNSSFSKMITLMGQKYLLPPNCSFLLSDISCMQPLL--NCRKTFDVIVIDPPWQ  290

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +PI QL      LV  WVTNR+K   FV++ELFP+W V+ 
Sbjct  291   NKSVKRSNRYSYLSPLQIQQIPIHQLA-APNCLVVTWVTNRQKHLRFVKEELFPSWSVET  349

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFM  1128
             +  ++W+K+   G  +  LD  H +PYE L+LG   GK      S   K+  IP++++ +
Sbjct  350   LAEWHWVKITKTGEFVFPLDSPHKKPYEGLILGRVQGKTTLPLRSTDVKVPPIPDHKLIV  409

Query  1129  SVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  410   SVPCVLHSHKPPLAEVLKDYIK--PDGECLELFARNLQPGWTSWGNEVLKFQHMDYFIA  466



>ref|XP_010831031.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Bison 
bison bison]
Length=470

 Score =   176 bits (447),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/364 (32%), Positives = 187/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  118   DVKKEIFISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
              +   +     E   L   +C LS +   +     L E  L   +    +E++ S   QD
Sbjct  174   HSCSEKPNKCSEPITLPLDTCNLSELCEMAKHLPSLNETELQTLQL---MEDDTSVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVID
Sbjct  231   L---FSRIVENTSGFTKIITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  345   SVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLRNADVKEL-PIPD  403

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  404   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  461

Query  1291  YFVS  1302
             YFV+
Sbjct  462   YFVA  465



>ref|XP_010831029.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Bison 
bison bison]
Length=471

 Score =   176 bits (446),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 187/365 (51%), Gaps = 22/365 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     ++ N+ E  A + H+++R L+L     L+        +
Sbjct  118   DVKKEIFISINGKKRKR----CVAFNQGELDAMEYHRKIRGLILDGSSQLIQEGLTSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
              +   +     E   L   +C LS +   +     L E  L   +    +E++ S   QD
Sbjct  174   HSCSEKPNKCSEPITLPLDTCNLSELCEMAKHLPSLNETELQTLQL---MEDDTSVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N          +  KY++P +S F +SD+  +H L+  +    +++IVID
Sbjct  231   L---FSRIVENTSGFTKIITLMGQKYLLPPKSSFLLSDISCMHPLL--NCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APSCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK-----DNTSDFSKLNAIP  1110
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K        +D  +L  IP
Sbjct  345   SVEVVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALLLSRNADVKEL-PIP  403

Query  1111  NNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
             ++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ  
Sbjct  404   DHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHM  461

Query  1288  KYFVS  1302
              YFV+
Sbjct  462   DYFVA  466



>ref|XP_004853241.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Heterocephalus 
glaber]
Length=471

 Score =   176 bits (446),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 179/359 (50%), Gaps = 17/359 (5%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  KK +  N+ E  A + H ++R L+L     L+        +    
Sbjct  121   KKEISTSIIGKKR--KKCVVFNQGELDAMEYHTKIRELILDGSLKLIQEGLKSGFLYQFF  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              ++    E   +   +C LS +   +     L E  L   +    IE + S   QD+   
Sbjct  179   EKQDKCSEPNAIPHDACSLSGLCEMAKHLPALSEKELQTLQ---LIEEDLSVAEQDL---  232

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P    F +SD+  +  L+  +    F++IVIDPPW+
Sbjct  233   FSRVVENNSSFSKMITLMGQKYLLPPNCSFLLSDISCMQPLL--NCRKTFDVIVIDPPWQ  290

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +PI QL      LV  WVTNR+K   FV++ELFP+W V+ 
Sbjct  291   NKSVKRSNRYSYLSPLQIQQIPIHQLA-APNCLVVTWVTNRQKHLRFVKEELFPSWSVET  349

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFM  1128
             +  ++W+K+   G  +  LD  H +PYE L+LG   GK      S   K+  IP++++ +
Sbjct  350   LAEWHWVKITKTGEFVFPLDSPHKKPYEGLILGRVQGKTTLPLRSTDVKVPPIPDHKLIV  409

Query  1129  SVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  410   SVPCVLHSHKPPLAEVLKDYIK--PDGECLELFARNLQPGWTSWGNEVLKFQHMDYFIA  466



>ref|XP_007191658.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007191659.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=469

 Score =   176 bits (446),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/367 (32%), Positives = 181/367 (49%), Gaps = 27/367 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  117   DVKKEISISVNGKKRKR----CVDFNQGELDAMEYHTKIRGLILDGSSQLIQEGLKSGFL  172

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHL  576
               L  +     E   L   +C LS +   +     L E+    L   E D  +  +    
Sbjct  173   HPLYEKRDKYSEPIILPLDTCNLSELCEMAKHLPSLNEMELQTLQLMEDDISVTEQY---  229

Query  577   GQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNII  756
                    F  +V N  S       +  KY++P  S F +SD+  IH L+  +    +++I
Sbjct  230   ------LFSRIVDNNSSFTKMITLMGQKYLLPPRSSFLLSDISCIHPLL--NCKKTYDVI  281

Query  757   VIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELF  936
             VIDPPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+
Sbjct  282   VIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELY  340

Query  937   PAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNA  1104
             P+W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  
Sbjct  341   PSWSVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALPLRNADVKEL-P  399

Query  1105  IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
             IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ
Sbjct  400   IPDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQ  457

Query  1282  ASKYFVS  1302
                YFV+
Sbjct  458   HVDYFVA  464



>ref|XP_008938680.1| PREDICTED: methyltransferase-like protein 4, partial [Merops 
nubicus]
Length=337

 Score =   172 bits (436),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 136/251 (54%), Gaps = 11/251 (4%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             ++ E S   QD++        N  S     E +  KY++P +S F +SD+  +  L+  +
Sbjct  88    LDEETSAPEQDLLSCVTE---NSSSWAKIVELMGQKYLVPPKSSFLLSDISYLQPLL--N  142

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 +++IVIDPPWEN S  +  RY  LP      +P+  L    G LVA WVTNR+K  
Sbjct  143   YKKKYDVIVIDPPWENKSVKRSNRYGHLPAWQVKQVPVPALA-APGCLVATWVTNRQKHL  201

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTSD  1086
              FV+ EL+P W V+ +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+    
Sbjct  202   RFVKDELYPHWSVETLAEWHWVKITRAGEFVFPLDSLHKKPYEVLVLGRVQGDVKEAVRK  261

Query  1087  FSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGN  1263
                   IP +Q+ +SVP   +S KPP+  +L E++     A C+ELF+R L  GWTSWGN
Sbjct  262   SEDAVPIPEHQLIVSVPCSLHSHKPPLAAVLAEFIQPD--AECLELFARNLQPGWTSWGN  319

Query  1264  EPLHFQASKYF  1296
             E L FQ   YF
Sbjct  320   EVLKFQHMDYF  330



>ref|XP_005372719.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Chinchilla 
lanigera]
Length=468

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 181/362 (50%), Gaps = 23/362 (6%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K ETS     +KR  K+++  N+ E  A + H+++R L+L     L+        +  L 
Sbjct  118   KQETSISVVGKKR--KRSVVFNQGELDAMEYHKKIRELILDGSSQLIQEGLRSGFLYQLL  175

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDVI  591
              +         L   +C LS      + +   +   LN  E      +E + S   QD+ 
Sbjct  176   EKRDKCSNLITLPLDTCSLS-----GLCEMAKHLPSLNGMELQTLQLVEEDSSVAEQDL-  229

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F   V N  S       +  KY++P  S F +SD+  +  L+  +    F++IV+DPP
Sbjct  230   --FSRFVENNSSFSKMITLMGQKYLLPPNSSFLLSDISCMQPLL--NCGKTFDVIVMDPP  285

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             W+N S  +  RY  L       +P+ QL      LV  WVTNR+K   FV+ EL+PAW V
Sbjct  286   WQNKSVKRSNRYSYLSPLQIQQIPVPQLA-APNCLVVTWVTNRQKHLRFVKDELYPAWSV  344

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDN----TSDFSKLNAIPNNQ  1119
             + +  ++W+K+ + G  +  LD  H +PYE L+LG    K      ++D + +  IP+++
Sbjct  345   EVLAEWHWVKITSAGEYVFPLDSPHKKPYEGLILGRVQAKATLPLRSTDVT-MPPIPDHK  403

Query  1120  VFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             + +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  404   LIVSVPCVLHSHKPPLAEVLKDYIK--PGGECLELFARNLQPGWTSWGNEVLKFQHVDYF  461

Query  1297  VS  1302
             V+
Sbjct  462   VA  463



>ref|XP_010974853.1| PREDICTED: methyltransferase-like protein 4 [Camelus dromedarius]
 ref|XP_010974862.1| PREDICTED: methyltransferase-like protein 4 [Camelus dromedarius]
Length=467

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 116/364 (32%), Positives = 187/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  115   DVKKEISISVTGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGFKSGFL  170

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  ++    E  +L   +C LS +   +     L E+ L   +     E++ S   QD
Sbjct  171   HPLSEKQDKCSEPIKLPLDTCSLSELCEMAKHLPSLNELELQTLQL---TEDDISVTEQD  227

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVID
Sbjct  228   L---FSRVVENNSSFTKMMTLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKTYDVIVID  282

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  283   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  341

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  342   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEVLILGRVREKGALLLRNADVKELR-IPD  400

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  401   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  458

Query  1291  YFVS  1302
             YF++
Sbjct  459   YFIA  462



>gb|KFQ18653.1| Methyltransferase-like 4, partial [Merops nubicus]
Length=346

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 136/251 (54%), Gaps = 11/251 (4%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             ++ E S   QD++        N  S     E +  KY++P +S F +SD+  +  L+  +
Sbjct  98    LDEETSAPEQDLLSCVTE---NSSSWAKIVELMGQKYLVPPKSSFLLSDISYLQPLL--N  152

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 +++IVIDPPWEN S  +  RY  LP      +P+  L    G LVA WVTNR+K  
Sbjct  153   YKKKYDVIVIDPPWENKSVKRSNRYGHLPAWQVKQVPVPALA-APGCLVATWVTNRQKHL  211

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTSD  1086
              FV+ EL+P W V+ +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+    
Sbjct  212   RFVKDELYPHWSVETLAEWHWVKITRAGEFVFPLDSLHKKPYEVLVLGRVQGDVKEAVRK  271

Query  1087  FSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGN  1263
                   IP +Q+ +SVP   +S KPP+  +L E++     A C+ELF+R L  GWTSWGN
Sbjct  272   SEDAVPIPEHQLIVSVPCSLHSHKPPLAAVLAEFIQPD--AECLELFARNLQPGWTSWGN  329

Query  1264  EPLHFQASKYF  1296
             E L FQ   YF
Sbjct  330   EVLKFQHMDYF  340



>ref|XP_010742406.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Larimichthys 
crocea]
Length=455

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 116/363 (32%), Positives = 188/363 (52%), Gaps = 25/363 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +K + +++ RKRK +E     LN+ E  ++  H+++R ++L+  + L+ +   +  +
Sbjct  67    DVLQKTDKASKKRKRKHSE-----LNQGEVDSQAFHEKIRSVILEGTKTLVDSARSVGHL  121

Query  406   RNLrceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
                     TD  +  L  Q C L+   ++    + PL +     +     +  +G     
Sbjct  122   NG-----TTDTVKEPLPSQECSLAALCEMAK--ELPLVDEEEPEECVQQLVAEDGCTSHV  174

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D+   F  +  N          +  +Y+IP  + F +SD  ++  L+   S S F++IV+
Sbjct  175   DL---FSRVTENGADSAIVVTLMGEQYVIPPCAAFLLSDFTRMQPLV--HSGSKFDLIVM  229

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN S  + +RY  LP+     LP+  L  +   LV  WVTNR     FV  EL+P 
Sbjct  230   DPPWENKSVKRSRRYSFLPSTQLKRLPVPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPH  288

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--N  1113
             WGV+ V  ++W+KV  +G  +  LD  H +PYE L+LG Y    DN++  S  + +P  +
Sbjct  289   WGVEVVAEWFWVKVTTSGQFVFPLDSQHKKPYEVLVLGRYRPPADNSTSSSVTSEVPVED  348

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S+KP + E+L  Y+ G   A C+ELF+R L  GWTSWGNE L FQ + 
Sbjct  349   QRLIVSVPSALHSQKPSLSEVLKPYVGG--EAKCLELFARCLQPGWTSWGNEVLKFQHTS  406

Query  1291  YFV  1299
             YF 
Sbjct  407   YFT  409



>ref|XP_007238967.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Astyanax 
mexicanus]
Length=433

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 111/340 (33%), Positives = 173/340 (51%), Gaps = 20/340 (6%)
 Frame = +1

Query  298   LNEREKVAEQRHQEVRPLLLKAHEALLGATELLK-VVRNLrceectdeerreLSQQS-CE  471
             LN+ E  AE  H +VR L+L+  ++L+ A      ++++L  E+       E    + C+
Sbjct  87    LNQGEVDAEVFHGKVRLLVLEGSKSLVEAGHHCGYLIKDLPAEQSEQTPVPECQLAALCD  146

Query  472   LSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFL  651
             ++   L     AP  + V  + + D+H+              F  L  N      E   +
Sbjct  147   MAKQLLAVENSAPRIQAVQGHADVDSHLN------------LFSCLTENPNDFAREVTLM  194

Query  652   NHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFF  831
               KY +P  S F +SD  +I  L+   S   F++IV+DPPWEN S  +  RY  LP+   
Sbjct  195   GQKYFLPPRSRFLLSDFTRIQPLV--HSGKKFDLIVLDPPWENKSVKRSSRYSFLPSSQL  252

Query  832   LSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISE  1011
               LP+  ++  AG +V  WVTNR +   FV +EL+P WGVK +  + W+KV   G  +  
Sbjct  253   KQLPVPAVS-AAGCVVVTWVTNRPRHIRFVREELYPHWGVKLLAEWLWVKVTRTGEFVFP  311

Query  1012  LDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYM  1188
             LD  H +PYE LLLG       ++   +   IP+ ++ +S+P   +S KP +  +L  Y+
Sbjct  312   LDSPHKKPYEVLLLGRICTDSTSTTRPEECEIPDQRLIISIPSALHSHKPSLSAVLRPYI  371

Query  1189  SGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKN  1308
             S   +A C+E+F+R L   WTSWGNE L FQ   YF +++
Sbjct  372   S--PNARCLEMFARSLQPDWTSWGNEVLKFQHHSYFTTES  409



>ref|XP_007646692.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Cricetulus 
griseus]
 ref|XP_007631171.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Cricetulus 
griseus]
 gb|ERE83554.1| methyltransferase-like protein 4 [Cricetulus griseus]
Length=444

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 141/244 (58%), Gaps = 12/244 (5%)
 Frame = +1

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D++P    +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVI
Sbjct  204   DLLP---QVVENNSSFSRMITLMGQKYLLPPQSSFLLSDISCMQPLL--NCSKTFDVIVI  258

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPW+N S  +  RY  L  +    +P+ +L   A  L+  WVTNR+K   FV++EL+P+
Sbjct  259   DPPWQNKSVKRSNRYSCLSPQQIKQMPVPKLA-AADCLIVTWVTNRQKHLCFVKEELYPS  317

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPN  1113
             W V+ +  +YW+K+  +G  +  LD  H +PYECL+LG    K  +   S   K++ +P+
Sbjct  318   WSVEVIAEWYWVKITHSGEFVFPLDSPHKKPYECLVLGRVREKAASVLRSTGVKVSPVPD  377

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   
Sbjct  378   QKLIVSVPCILHSHKPPLAEVLKDYIKPG--GQCLELFARNLQPGWMSWGNEVLKFQHVD  435

Query  1291  YFVS  1302
             YF++
Sbjct  436   YFLA  439



>ref|XP_010742404.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Larimichthys 
crocea]
Length=455

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 116/363 (32%), Positives = 188/363 (52%), Gaps = 25/363 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +K + +++ RKRK +E     LN+ E  ++  H+++R ++L+  + L+ +   +  +
Sbjct  67    DVLQKTDKASKKRKRKHSE-----LNQGEVDSQAFHEKIRSVILEGTKTLVDSARSVGHL  121

Query  406   RNLrceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
                     TD  +  L  Q C L+   ++    + PL +     +     +  +G     
Sbjct  122   NG-----TTDTVKEPLPSQECSLAALCEMAK--ELPLVDEEEPEECVQQLVAEDGCTSHV  174

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D+   F  +  N          +  +Y+IP  + F +SD  ++  L+   S S F++IV+
Sbjct  175   DL---FSRVTENGADSAIVVTLMGEQYVIPPCAAFLLSDFTRMQPLV--HSGSKFDLIVM  229

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN S  + +RY  LP+     LP+  L  +   LV  WVTNR     FV  EL+P 
Sbjct  230   DPPWENKSVKRSRRYSFLPSTQLKRLPVPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPH  288

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--N  1113
             WGV+ V  ++W+KV  +G  +  LD  H +PYE L+LG Y    DN++  S  + +P  +
Sbjct  289   WGVEVVAEWFWVKVTTSGQFVFPLDSQHKKPYEVLVLGRYRPPADNSTSSSVTSEVPVED  348

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S+KP + E+L  Y+ G   A C+ELF+R L  GWTSWGNE L FQ + 
Sbjct  349   QRLIVSVPSALHSQKPSLSEVLKPYVGG--EAKCLELFARCLQPGWTSWGNEVLKFQHTS  406

Query  1291  YFV  1299
             YF 
Sbjct  407   YFT  409



>gb|ERE83553.1| methyltransferase-like protein 4 [Cricetulus griseus]
Length=452

 Score =   174 bits (441),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 141/244 (58%), Gaps = 12/244 (5%)
 Frame = +1

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D++P    +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVI
Sbjct  212   DLLP---QVVENNSSFSRMITLMGQKYLLPPQSSFLLSDISCMQPLL--NCSKTFDVIVI  266

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPW+N S  +  RY  L  +    +P+ +L   A  L+  WVTNR+K   FV++EL+P+
Sbjct  267   DPPWQNKSVKRSNRYSCLSPQQIKQMPVPKLA-AADCLIVTWVTNRQKHLCFVKEELYPS  325

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPN  1113
             W V+ +  +YW+K+  +G  +  LD  H +PYECL+LG    K  +   S   K++ +P+
Sbjct  326   WSVEVIAEWYWVKITHSGEFVFPLDSPHKKPYECLVLGRVREKAASVLRSTGVKVSPVPD  385

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   
Sbjct  386   QKLIVSVPCILHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHVD  443

Query  1291  YFVS  1302
             YF++
Sbjct  444   YFLA  447



>emb|CAG10214.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=308

 Score =   170 bits (431),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 165/325 (51%), Gaps = 23/325 (7%)
 Frame = +1

Query  337   EVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQSCELS-FVDLGSVWQAPL  513
             ++R ++L   +AL+ A + L  +  +            L    C L+   D+    + PL
Sbjct  2     KIRSVVLDGTKALVDAAQALGYLSGVSDAMEEP-----LPSHECNLAALCDMAK--EFPL  54

Query  514   YEIVLNYQEGDAHI-ENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFY  690
              E     QEG   + E EG     D+   F  L  N G   +    +  +Y+IP  + F 
Sbjct  55    AE---ERQEGVQPLTEGEGDTSHVDL---FSRLTENTGDWASVVSLMGEEYVIPPNTTFL  108

Query  691   MSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAG  870
             +SD  +I  L+  D    F++IV+DPPWEN S  + +RY  LP+     LP+  L  +  
Sbjct  109   LSDFTRIQPLV--DYGGRFDVIVMDPPWENKSVKRSRRYSFLPSTQLKRLPVPLLA-SPN  165

Query  871   ALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLL  1050
              LV  WVTNR   + FV  EL+P WGV+ V  ++W+KV  +G  +  LD  H +PYE L+
Sbjct  166   CLVVTWVTNRSAHQRFVRHELYPHWGVQVVAEWFWVKVTTSGQFVFPLDSPHKKPYESLV  225

Query  1051  LG-YSDGKDNTSDFSKLNA-IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIEL  1221
             LG Y    +N       +  + + ++ +SVP   +S+KP + ++L  Y+     A C+EL
Sbjct  226   LGRYRCSPENLRCLEPSDVPVEDQRLLVSVPSALHSQKPSLSDVLKPYIGA--EARCLEL  283

Query  1222  FSRELSAGWTSWGNEPLHFQASKYF  1296
             F+R L  GWTSWGNE L FQ + YF
Sbjct  284   FARNLQPGWTSWGNEVLKFQHASYF  308



>ref|XP_004320794.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
4 [Tursiops truncatus]
Length=470

 Score =   174 bits (442),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 116/364 (32%), Positives = 186/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  118   DVKKEISISVNGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGLKSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  +     E   L   +C LS +   +     L E+ L   +    ++++ S   QD
Sbjct  174   HPLYEKRDKYTEPITLPLDTCNLSELCEMAKHLPSLNEMELQTLQL---MDDDISVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  ++ L+       +++IVID
Sbjct  231   L---FSRIVENNSSFTKMITLMGQKYLLPPKSSFLLSDISCMYPLL--SCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  345   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALPLRNADVKEL-PIPD  403

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  404   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHVD  461

Query  1291  YFVS  1302
             YFV+
Sbjct  462   YFVA  465



>ref|XP_010956376.1| PREDICTED: methyltransferase-like protein 4 [Camelus bactrianus]
 ref|XP_010956377.1| PREDICTED: methyltransferase-like protein 4 [Camelus bactrianus]
Length=467

 Score =   174 bits (442),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 116/364 (32%), Positives = 187/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  115   DVKKEISISVTGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGFKSGFL  170

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  ++    E  +L   +C LS +   +     L E+ L   +     E++ S   QD
Sbjct  171   HPLSEKQDKCSEPIKLPLDTCSLSELCEMAKHLPSLNELELQTLQ---LTEDDISVTEQD  227

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVID
Sbjct  228   L---FSRVVENNSSFTKMMTLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKTYDVIVID  282

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  283   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  341

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  342   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKGALLLRNADVKELR-IPD  400

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  401   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHMD  458

Query  1291  YFVS  1302
             YF++
Sbjct  459   YFIA  462



>ref|XP_004412396.1| PREDICTED: methyltransferase-like protein 4 isoform 2 [Odobenus 
rosmarus divergens]
Length=472

 Score =   174 bits (441),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 183/360 (51%), Gaps = 19/360 (5%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             E+   S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   EENRISIIGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
               +     E   L   +C LS +   +     L E+ L   +    +E + S   QD+  
Sbjct  179   SEKWDKCSEPITLPLDTCNLSELCTMAKHLPSLNEMDL---QALQLMEEDMSVTEQDL--  233

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV+DPPW
Sbjct  234   -FSRVVENNSSFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCKKTYDVIVMDPPW  290

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +PI +L      L+  WVTNR+K   FV++EL+P+W V+
Sbjct  291   QNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLIITWVTNRQKHLRFVKEELYPSWSVE  349

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVF  1125
              V  ++W+K+  +G  +  LD  H +PYE L+LG    K      S+  K+  IP++++ 
Sbjct  350   IVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVREKTAVPLRSEDVKVLPIPDHKLI  409

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  410   VSVPCTLHSHKPPLAEVLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  467



>emb|CEG74880.1| hypothetical protein RMATCC62417_10014 [Rhizopus microsporus]
Length=371

 Score =   172 bits (435),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 109/366 (30%), Positives = 186/366 (51%), Gaps = 58/366 (16%)
 Frame = +1

Query  271   KRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGA-------TELLKVVRNLrceec  429
             K+ ++K+ S+ + E   E+RH+E+RPLL    + L          +   K ++N      
Sbjct  41    KKKQRKSPSITDVE--TEKRHEELRPLLTNCIDKLQAVWPKREQKSTKSKEIKN------  92

Query  430   tdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNY-------QEGDAHIENEGSHLGQDV  588
                          E+ F  + S+ ++        +       +EGD    ++ ++   D+
Sbjct  93    -------------EIDFPSIQSMVESAHNRFTSQHDERIELPEEGD----DDAAYRDLDI  135

Query  589   IPAFDNLVVNKGSGDAEAEFL-NHKYIIPKESCFYM-----SDVRKIHNLIPADSDSGFN  750
                F+ + +N      + E   + KY+IP  S F M     S ++++ + +   S  G +
Sbjct  136   FSVFNKICINSAQRLKQIEITPSAKYLIPPRSSFIMGSMTDSSLQQLSDYV--SSLGGAD  193

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +I+IDPPW N S H+  +Y+T       ++P+K + +   ++VA+WVTN+ K R F+  +
Sbjct  194   LIIIDPPWPNKSVHRSSKYETQDIYDLFTIPMKDMIN-VNSVVAVWVTNKPKFRKFIIHK  252

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIP  1110
             LFPAW ++    + WLKV   G  I  LD  H +PYE L++G+   +  TSD      +P
Sbjct  253   LFPAWELECKAEWVWLKVTTEGQCIFPLDSSHKKPYEQLIIGH---RQKTSD------LP  303

Query  1111  NNQVFMSVPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
             +  V +SVP   +SRKPP+ +++L Y+       C+E+F+R L+ GW SWGNE L FQ +
Sbjct  304   SRHVIVSVPSLRHSRKPPLQDVILPYLKNKDRPVCVEMFARCLTPGWISWGNECLKFQHT  363

Query  1288  KYFVSK  1305
             +YF  K
Sbjct  364   EYFEKK  369



>ref|XP_004412395.1| PREDICTED: methyltransferase-like protein 4 isoform 1 [Odobenus 
rosmarus divergens]
Length=472

 Score =   174 bits (440),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 183/360 (51%), Gaps = 19/360 (5%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             E+   S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   EENRISIIGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
               +     E   L   +C LS +   +     L E+ L   +    +E + S   QD+  
Sbjct  179   SEKWDKCSEPITLPLDTCNLSELCTMAKHLPSLNEMDL---QALQLMEEDMSVTEQDL--  233

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV+DPPW
Sbjct  234   -FSRVVENNSSFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVMDPPW  290

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +PI +L      L+  WVTNR+K   FV++EL+P+W V+
Sbjct  291   QNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLIITWVTNRQKHLRFVKEELYPSWSVE  349

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVF  1125
              V  ++W+K+  +G  +  LD  H +PYE L+LG    K      S+  K+  IP++++ 
Sbjct  350   IVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVREKTAVPLRSEDVKVLPIPDHKLI  409

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  410   VSVPCTLHSHKPPLAEVLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  467



>ref|NP_001178743.1| methyltransferase-like protein 4 [Rattus norvegicus]
Length=471

 Score =   174 bits (440),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 180/364 (49%), Gaps = 26/364 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             EK E S    K++   K+ ++ N  E  A + H ++R L+L     L+        +  L
Sbjct  121   EKQEVSVSVGKKR---KRCVAFNRGELDAMEYHTKIRELILDGSSQLIQEGLRSGFLFPL  177

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV-I  591
               +      R  L   +C LS           L E+  +    +         +G DV +
Sbjct  178   VEKHDGSSGRITLPLDACNLS----------ELCEMAKHLPSLNDMELQTLQLMGDDVFV  227

Query  592   PAFD---NLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
                D    ++ N  S       +  +Y++P +S F +SD+  +  L+  + +  F++IVI
Sbjct  228   TELDLSSRIIENNSSFSKMITLMGQRYLLPPKSSFLLSDISCMQPLL--NCNKTFDVIVI  285

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN S  +  RY +L  +    +P+ +L      LV  WVTNR+K   FV++EL+P+
Sbjct  286   DPPWENKSVKRSNRYNSLSPQQIKRMPVPKLA-APDCLVVTWVTNRQKHLCFVKEELYPS  344

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPN  1113
             W V+ +  +YW+K+  +G  +  LD  H +PYECL+LG    K   +   +  +   +P+
Sbjct  345   WSVEVIAEWYWVKITNSGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPD  404

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   
Sbjct  405   QRLIVSVPCALHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHMD  462

Query  1291  YFVS  1302
             YF++
Sbjct  463   YFIA  466



>emb|CEI88870.1| hypothetical protein RMCBS344292_03246 [Rhizopus microsporus]
Length=371

 Score =   171 bits (434),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/366 (30%), Positives = 186/366 (51%), Gaps = 58/366 (16%)
 Frame = +1

Query  271   KRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGA-------TELLKVVRNLrceec  429
             K+ ++K+ S+ + E   E+RH+E+RPLL    + L          +   K ++N      
Sbjct  41    KKKQRKSPSITDVE--TEKRHEELRPLLTNCIDKLQAVWPKREQKSTKSKEIKN------  92

Query  430   tdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNY-------QEGDAHIENEGSHLGQDV  588
                          E+ F  + S+ ++        +       +EGD    ++ ++   D+
Sbjct  93    -------------EIDFPSIQSMVESAHNRFTSQHDERIELPEEGD----DDAAYRDLDI  135

Query  589   IPAFDNLVVNKGSGDAEAEFL-NHKYIIPKESCFYM-----SDVRKIHNLIPADSDSGFN  750
                F+ + +N      + E   + KY+IP  S F M     S ++++ + +   S  G +
Sbjct  136   FSVFNKICINSAQRLKQIEITPSAKYLIPPRSSFIMGSMTDSSLQQLSDYV--SSLGGAD  193

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +I+IDPPW N S H+  +Y+T       ++P+K + +   ++VA+WVTN+ K R F+  +
Sbjct  194   LIIIDPPWPNKSVHRSSKYETHDIYDLFTIPMKDMIN-VNSVVAVWVTNKPKFRKFIIHK  252

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIP  1110
             LFPAW ++    + WLKV   G  I  LD  H +PYE L++G+   +  TSD      +P
Sbjct  253   LFPAWELECKAEWVWLKVTTEGQCIFPLDSSHKKPYEQLIIGH---RQKTSD------LP  303

Query  1111  NNQVFMSVPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
             +  V +SVP   +SRKPP+ +++L Y+       C+E+F+R L+ GW SWGNE L FQ +
Sbjct  304   SRHVIVSVPSLRHSRKPPLQDVILPYLKNKDRPVCVEMFARCLTPGWISWGNECLKFQHT  363

Query  1288  KYFVSK  1305
             +YF  K
Sbjct  364   EYFEKK  369



>ref|XP_003406424.2| PREDICTED: methyltransferase-like protein 4 [Loxodonta africana]
Length=502

 Score =   174 bits (441),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 117/360 (33%), Positives = 186/360 (52%), Gaps = 19/360 (5%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E+ST    +KR  K+ +  N+ E  A + H ++R L+L     L+        +  L 
Sbjct  152   KKESSTPIIGKKR--KRCVVFNQGELDAMEYHAKIRSLILDGSSQLVQEGLKSGFLYPLS  209

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              ++    +   LS  +C LS +   +     L+E+ L   +    +E++ S   QD+   
Sbjct  210   EKQDKCSDHITLSLDTCSLSELCEMAKHLPSLHEMELQTLQ---LMEDDMSVTEQDL---  263

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVIDPPW+
Sbjct  264   FSRVVENNSSFTKMITLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKKYDVIVIDPPWQ  321

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +P+ Q+      LV  WVTNR+K   FV++EL+PAW V+ 
Sbjct  322   NKSVKRSNRYSYLSPMQIKQIPVPQMV-APDCLVITWVTNRQKHLRFVKEELYPAWSVEM  380

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNNQVF  1125
             V  ++W+K+  +G  +  LD  H +PYE LLLG    K       +D + L  IP++++ 
Sbjct  381   VAEWHWVKITKSGEFVFPLDSLHKKPYEGLLLGRVREKTALPLRNADETAL-PIPDHKLI  439

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   YF +
Sbjct  440   VSVPCTLHSHKPPLAEILKDYIK--PDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFTA  497



>ref|XP_002926112.1| PREDICTED: methyltransferase-like protein 4-like [Ailuropoda 
melanoleuca]
 gb|EFB21808.1| hypothetical protein PANDA_015723 [Ailuropoda melanoleuca]
Length=470

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/403 (30%), Positives = 192/403 (48%), Gaps = 36/403 (9%)
 Frame = +1

Query  169   NRSYTRYRVSPSAYYSRFFDSTEKLETST---ESRKRKRNE------------------K  285
             NR      +    + S  F+ T+   T     E R+RK  E                  +
Sbjct  74    NRGNCEIFIQKYVFRSELFNVTKPYITPAVHKECRQRKEKEDPVDGVKEESRISIIGKKR  133

Query  286   KTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQS  465
             K    N+ E  A + H ++R L+L     L+        +  L        +   L   +
Sbjct  134   KRCVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPLSENWDKCSDPITLPLDT  193

Query  466   CELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEAE  645
             C LS +   +     L E+ L   +    +E + S   QD+   F  +V N  S      
Sbjct  194   CNLSELCAMAKHLPSLNEMEL---QALRLMEEDVSVTEQDL---FSRVVENNSSFTKMIT  247

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  RY  L   
Sbjct  248   LMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVIDPPWQNKSVKRSNRYSYLSPL  305

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+ +L      LV  WVTNR+K   FV++EL+P+W V+ V  ++W+K+ ++G  +
Sbjct  306   QIKQIPVPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVEIVAEWHWVKITSSGEFV  364

Query  1006  SELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGEL  1173
               LD  H +PYE L+LG    K      ++  K+  IP++++ +SVP   +S KPP+ E+
Sbjct  365   FPLDSPHKKPYEGLILGRVREKTAVPLRNEDVKVLPIPDHKLIVSVPCTLHSHKPPLAEV  424

Query  1174  LLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  425   LKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  465



>ref|XP_006972308.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Peromyscus 
maniculatus bairdii]
Length=471

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/367 (31%), Positives = 181/367 (49%), Gaps = 28/367 (8%)
 Frame = +1

Query  229   STEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVR  408
             S  K E S    K++   K+ +  N+ E  A + H ++R L+L     L+        + 
Sbjct  119   SGNKQEVSVSIGKKR---KRCLVFNQGELDAIEYHTKIRELILDGSSQLIQEGLKSGFLY  175

Query  409   NLrceectdeerreLSQQSCELS-FVDLGSVWQAP--LYEIVLNYQEGDAHIENEGSHLG  579
              L  ++  +  R  L   +C LS   ++   W A   +    L   E D  +        
Sbjct  176   PLVEKQDGNSGRIALPLDACNLSELCEMAKQWPASNEMELQTLRLPEDDMSVTE------  229

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
                +     ++ N  S       +  KY++P  S F +SD+  +  L+  +    F++IV
Sbjct  230   ---LDLSSQVIENGSSFSKMITLMGQKYLLPPRSSFLLSDISCMQPLL--NCGKTFDVIV  284

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPWEN S  +  RY  L  +    +P+ +L   A  L+  WVTNR+K   FV++EL+P
Sbjct  285   IDPPWENKSVKRSNRYSCLSPQQIKQMPVPKLA-AADCLIVTWVTNRQKHLCFVKEELYP  343

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-----NTSDFSKLNA  1104
             +W V+ V  +YW+K+  +G  +  LD  H +PYECL+LG    K      NT   +++  
Sbjct  344   SWSVEVVAEWYWVKITHSGEFVFPLDSPHKKPYECLVLGRVREKAALAFRNTD--TEVPP  401

Query  1105  IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
             +P+ ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ
Sbjct  402   VPDQKLIVSVPCILHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQ  459

Query  1282  ASKYFVS  1302
                YF++
Sbjct  460   HVDYFIA  466



>ref|XP_006245720.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Rattus 
norvegicus]
Length=471

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 179/364 (49%), Gaps = 26/364 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             EK E S    K++   K+ ++ N  E  A + H ++R L+L     L+        +  L
Sbjct  121   EKQEVSVSVGKKR---KRCVAFNRGELDAMEYHTKIRELILDGSSQLIQEGLRSGFLFPL  177

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV-I  591
               +      R  L   +C LS           L E+  +    +         +G DV +
Sbjct  178   VEKHDGSSGRITLPLDACNLS----------ELCEMAKHLPSLNDMELQTLQLMGDDVFV  227

Query  592   PAFD---NLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
                D    ++ N  S       +  +Y++P +S F +SD+  +  L+  +    F++IVI
Sbjct  228   TELDLSSRIIENNSSFSKMITLMGQRYLLPPKSSFLLSDISCMQPLL--NCSKTFDVIVI  285

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPWEN S  +  RY +L  +    +P+ +L      LV  WVTNR+K   FV++EL+P+
Sbjct  286   DPPWENKSVKRSNRYNSLSPQQIKRMPVPKLA-APDCLVVTWVTNRQKHLCFVKEELYPS  344

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPN  1113
             W V+ +  +YW+K+  +G  +  LD  H +PYECL+LG    K   +   +  +   +P+
Sbjct  345   WSVEVIAEWYWVKITNSGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPD  404

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
              ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   
Sbjct  405   QRLIVSVPCALHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHMD  462

Query  1291  YFVS  1302
             YF++
Sbjct  463   YFIA  466



>ref|NP_795891.2| methyltransferase-like protein 4 [Mus musculus]
 ref|XP_006525168.1| PREDICTED: methyltransferase like 4 isoform X1 [Mus musculus]
 ref|XP_006525169.1| PREDICTED: methyltransferase like 4 isoform X2 [Mus musculus]
 sp|Q3U034.1|METL4_MOUSE RecName: Full=Methyltransferase-like protein 4 [Mus musculus]
 dbj|BAE34021.1| unnamed protein product [Mus musculus]
 gb|EDL38666.1| mCG23397 [Mus musculus]
Length=471

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 180/363 (50%), Gaps = 26/363 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E S    K++   K+ I+ N+ E  A + H ++R L+L     L+        +  L 
Sbjct  122   KQEVSVSVGKKR---KRCIAFNQGELDAMEYHTKIRELILDGSSKLIQEGLRSGFLYPLV  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV---  588
              ++        L   +C LS +   +     L E+ L   +           +G DV   
Sbjct  179   EKQDGSSGCITLPLDACNLSELCEMAKHLPSLNEMELQTLQ----------LMGDDVSVI  228

Query  589   -IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
              +     ++ N  S       +  KY++P +S F +SD+  +  L+  +    F+ IVID
Sbjct  229   ELDLSSQIIENNSSFSKMITLMGQKYLLPPQSSFLLSDISCMQPLL--NCGKTFDAIVID  286

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN S  +  RY +L  +    +PI +L   A  L+  WVTNR+K   FV++EL+P+W
Sbjct  287   PPWENKSVKRSNRYSSLSPQQIKRMPIPKLA-AADCLIVTWVTNRQKHLCFVKEELYPSW  345

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPNN  1116
              V+ V  +YW+K+  +G  +  LD  H +PYECL+LG    K   +      ++  +P+ 
Sbjct  346   SVEVVAEWYWVKITNSGEFVFPLDSPHKKPYECLVLGRVKEKTPLALRNPDVRIPPVPDQ  405

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   Y
Sbjct  406   KLIVSVPCVLHSHKPPLTEVLRDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHMDY  463

Query  1294  FVS  1302
             F++
Sbjct  464   FIA  466



>ref|XP_006727841.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Leptonychotes 
weddellii]
Length=472

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/360 (32%), Positives = 183/360 (51%), Gaps = 19/360 (5%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             E+   S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   EENRISIIGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
               +     E   L   +C LS +   +     L E+ L   +    +E + S   QD+  
Sbjct  179   SEKWNKCSEPITLPLDTCSLSELCTMAKHLPSLNEMDL---QALQLMEEDMSITEQDL--  233

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV+DPPW
Sbjct  234   -FSRVVENNSSFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCKKTYDVIVMDPPW  290

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +PI +L      L+  WVTNR+K   FV++EL+P+W V+
Sbjct  291   QNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLIITWVTNRQKHLRFVKEELYPSWSVE  349

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVF  1125
              V  ++W+K+  +G  +  LD  H +PYE L+LG    K      ++  K+  IP++++ 
Sbjct  350   IVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVREKTAVPLRNEDVKVLPIPDHKLI  409

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  410   VSVPCTLHSHKPPLAEVLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  467



>ref|XP_006867338.1| PREDICTED: methyltransferase-like protein 4 [Chrysochloris asiatica]
Length=471

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/361 (32%), Positives = 187/361 (52%), Gaps = 21/361 (6%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++ TS   +KRKR     +  N+ E  A + H +VR L+L     L+        +  L
Sbjct  122   KEISTSIIGKKRKR----CVIFNQGELDAMEYHTKVRRLILDGSSQLVQEGLKSGFLYPL  177

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
               +     E   L   +C LS +   +     L ++ L   +    +E++ S   QD+  
Sbjct  178   SEKREKCSEHMTLPLDTCNLSELCEMAKHLPSLNDMELQTLQ---LMEDDMSVTEQDL--  232

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVIDPPW
Sbjct  233   -FSRIVENSSSFTKMITLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKKYDVIVIDPPW  289

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +P+ ++      LV  WVTNR+K   FV++EL+P+W ++
Sbjct  290   QNKSVKRSNRYSYLSPMQIKQIPVPKMA-APNCLVITWVTNRQKHLRFVKEELYPSWSLE  348

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGY----SDGKDNTSDFSKLNAIPNNQV  1122
              V  ++W+K+  +G  +  LD  H +PYE L+LG     +D +   +D  +L  IP++++
Sbjct  349   IVAEWHWVKITNSGEFVFPLDSLHKKPYEGLILGRVRENADLQLRNADEKRL-TIPDHKL  407

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV
Sbjct  408   IVSVPCTLHSHKPPLAEVLKDYIK--PDGQCLELFARNLQPGWTSWGNEVLKFQHVDYFV  465

Query  1300  S  1302
             +
Sbjct  466   T  466



>emb|CEI87299.1| hypothetical protein RMCBS344292_01716 [Rhizopus microsporus]
Length=371

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/365 (31%), Positives = 186/365 (51%), Gaps = 62/365 (17%)
 Frame = +1

Query  271   KRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLG--------ATELLKVVRNLrcee  426
             K+ ++K+ S+ + E   E+RH+E+RPLL    + L          +TE  K ++N     
Sbjct  41    KKKQRKSPSITDVE--TEKRHEELRPLLTNCIDKLQAVWSKHEQNSTEP-KEIKN-----  92

Query  427   ctdeerreLSQQSCELSFVDLGSVWQAPLYEIVLN--YQEGDAHIE------NEGSHLGQ  582
                           E+ F  + S     + E V N    + D  IE      ++ ++   
Sbjct  93    --------------EIDFPSIQS-----MVESVHNRFTSQHDERIELPEENDDDAAYRDL  133

Query  583   DVIPAFDNLVVNKGSGDAEAEFL-NHKYIIPKESCFYM-----SDVRKIHNLIPADSDSG  744
             D+   F+ + +N      + E   + KY+IP  S F M     S ++++ + +   S  G
Sbjct  134   DIFSVFNKICINSAQRLKQIEITPSAKYLIPPRSSFIMGSMTDSSLQQLSDYV--SSLGG  191

Query  745   FNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVE  924
              ++IVIDPPW N S H+  +Y+T       ++PIK + +   ++VA+WVTN+ K R F+ 
Sbjct  192   ADLIVIDPPWPNKSVHRSSKYETQDIYDLFTIPIKDMIN-ENSVVAVWVTNKPKFRKFII  250

Query  925   KELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNA  1104
              +LFPAW ++    + WLKV   G  I  LD  H +PYE L++G+           K + 
Sbjct  251   HKLFPAWELECKAEWVWLKVTTEGQCIFPLDSSHKKPYEQLIIGHR---------QKASD  301

Query  1105  IPNNQVFMSVPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQ  1281
             +P+  V +SVP   +SRKPP+ +++L Y+   +   C+E+F+R L+ GW SWGNE L FQ
Sbjct  302   LPSRHVIVSVPSLRHSRKPPLQDVILPYLKNKERPVCVEMFARCLTPGWISWGNECLKFQ  361

Query  1282  ASKYF  1296
              ++YF
Sbjct  362   HTEYF  366



>ref|XP_005367603.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Microtus 
ochrogaster]
Length=460

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 177/358 (49%), Gaps = 39/358 (11%)
 Frame = +1

Query  274   RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreL  453
             +  K++++ N+ E  A + H ++R L+L     L+       V+  +   +  +  R  L
Sbjct  122   KKRKRSLAFNQGELDAMEHHTKIRELILGGSSQLIQEGLKSGVLCPVVDTQHGNSGRVPL  181

Query  454   SQQSCELS--------FVDLGSVWQAPLYEIVLNYQEGDAH---IENEGSHLGQDVIPAF  600
                +C LS           L      PL E  ++  E D     IEN  S         F
Sbjct  182   PLDACNLSELCEMAKHLPSLEDTQTLPLAEDDMSVIELDLSSRVIENNSS---------F  232

Query  601   DNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWEN  780
               +V            +  KY++P  S F +SD+  +  L+  + +  F++IVIDPPW+N
Sbjct  233   SRMV----------NLMGQKYLLPPNSSFLLSDISCMQPLL--NCNKTFDVIVIDPPWQN  280

Query  781   SSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYV  960
              S  +  RY  L  +    +P+ +L   A  LV  WVTNR+K   FV++EL+P+W V+ +
Sbjct  281   KSVKRSNRYSCLSPQQIKHMPVPKLA-AADCLVVTWVTNRQKHLCFVKEELYPSWSVEVI  339

Query  961   TSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMS  1131
               +YW+K+  +G  +  LD  H +PYECL+LG    K      S   K+  +P+ ++ +S
Sbjct  340   AEWYWVKITRSGEFVFPLDSPHKKPYECLVLGRFREKTALVLRSPDVKVPPVPDRKLIVS  399

Query  1132  VPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             VP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   YF++
Sbjct  400   VPCLLHSHKPPLAEVLKDYIKPG--GQCLELFARNLQPGWMSWGNEVLKFQHVDYFIA  455



>ref|XP_008306488.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Cynoglossus 
semilaevis]
Length=432

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 183/373 (49%), Gaps = 31/373 (8%)
 Frame = +1

Query  229   STEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLG---ATELLK  399
             + +K+    + RKRK  E     LN+ E  A   H  +R ++ +  + L+    + E LK
Sbjct  65    NVDKINKPLKKRKRKHAE-----LNQGEIDARVYHDGIRAVISEGTKTLVDLAQSREYLK  119

Query  400   VVRNLrceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHL  576
              V +             L  Q C L+   D+    + PL + +   +   A +  +G   
Sbjct  120   GVED--------SVAEPLPLQECNLAALCDMAK--ELPLMDDLELEECAQALVAEDGGLC  169

Query  577   GQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNII  756
               D+   F  +  N+    A    +  +Y+IP  + F +SD  +   L+  +    F++I
Sbjct  170   HVDL---FSRVTENRSDQAAVVRLMGEEYVIPAHTSFLLSDFTRTRPLV--NYGKKFDLI  224

Query  757   VIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELF  936
             V+DPPWEN S  + +RY  LP+     LP+  L  +   LV  WVTNR     FV  EL+
Sbjct  225   VMDPPWENKSVKRSRRYSALPSSQLKRLPVPLLA-SDNCLVVTWVTNRASHLRFVRDELY  283

Query  937   PAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP-  1110
             P WGV+ V  ++W+KV ++G  +  LD  H +PYE L+LG Y      +  FSK+  IP 
Sbjct  284   PHWGVEVVAEWFWVKVTSSGHFVFPLDSVHKKPYEVLVLGRYRSSSHPSISFSKIPEIPV  343

Query  1111  -NNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
                ++ +SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ 
Sbjct  344   EGARLIVSVPSALHSQKPLLSEVLRPYVGA--EAKCLELFARNLHPGWTSWGNEVLKFQH  401

Query  1285  SKYFVSKNRQMKA  1323
             S YF     Q  A
Sbjct  402   SSYFTVTPVQESA  414



>ref|XP_001493724.2| PREDICTED: methyltransferase like 4 isoform X1 [Equus caballus]
 ref|XP_005612834.1| PREDICTED: methyltransferase like 4 isoform X2 [Equus caballus]
 ref|XP_005612835.1| PREDICTED: methyltransferase like 4 isoform X3 [Equus caballus]
 ref|XP_005612836.1| PREDICTED: methyltransferase like 4 isoform X4 [Equus caballus]
 ref|XP_008535608.1| PREDICTED: methyltransferase-like protein 4 [Equus przewalskii]
 ref|XP_008535609.1| PREDICTED: methyltransferase-like protein 4 [Equus przewalskii]
 ref|XP_008535610.1| PREDICTED: methyltransferase-like protein 4 [Equus przewalskii]
 ref|XP_008535611.1| PREDICTED: methyltransferase-like protein 4 [Equus przewalskii]
Length=470

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/357 (33%), Positives = 183/357 (51%), Gaps = 24/357 (7%)
 Frame = +1

Query  250   STESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceec  429
             ST  +KRKR     +  N+ E  A + H ++R L+L     L+        +  L  ++ 
Sbjct  127   STIGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGLKSGFLHPLLEKQD  182

Query  430   tdeerreLSQQSCELSFVDLGSVWQAPLYEIVL-NYQEGDAHIENEGSHLGQDVIPAFDN  606
                E   L   +C L+ +   +     L E+ L   Q  + H+  E     QDV   F  
Sbjct  183   KCSEPITLPLDTCNLAELCEMAKHLPSLNEVELQTLQLMEDHMVTE-----QDV---FSR  234

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S
Sbjct  235   VVENNSSFTKMITLMGQKYLLPPQSSFLLSDISCMHPLL--NCRKTYDVIVIDPPWQNKS  292

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
               +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V+ V  
Sbjct  293   VKRSNRYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVEIVAE  351

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNNQVFMSV  1134
             ++W+K+  +G  +  LD  H +PYE L+LG    +       +D  K+  IP++++ +SV
Sbjct  352   WHWVKITNSGEFVFPLDSPHKKPYEGLILGRVREEIALPLRNADV-KMLPIPDHKLIVSV  410

Query  1135  PGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             P   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  411   PCTLHSHKPPLAEVLKDYIKPD--GKCLELFARNLQPGWTSWGNEVLKFQHVDYFIA  465



>ref|XP_008688633.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Ursus 
maritimus]
Length=472

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/404 (30%), Positives = 192/404 (48%), Gaps = 37/404 (9%)
 Frame = +1

Query  169   NRSYTRYRVSPSAYYSRFFDSTEKLETST---ESRKRKRNE-------------------  282
             NR      +    + S  F+ T+   T     E R+RK  E                   
Sbjct  75    NRGNCEIFIQKYVFRSELFNVTKPYITPAVHKECRQRKEKEDPMDGVKEESRISIIGKKR  134

Query  283   KKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQ  462
             K+ +  N+ E  A + H ++R L+L     L+        +  L        E   L   
Sbjct  135   KRCVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPLSENWDKCSEPITLPLD  194

Query  463   SCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEA  642
             +C LS +   +     L E+ L   +    +  + S   QD+   F  +V N  S     
Sbjct  195   TCNLSELCAMAKHLPSLNEMEL---QALQLMGEDVSVTEQDL---FSRVVENNSSFTKMI  248

Query  643   EFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPN  822
               +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  RY  L  
Sbjct  249   TLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVIDPPWQNKSVKRSNRYSYLSP  306

Query  823   RFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSL  1002
                  +PI +L      LV  WVTNR+K   FV++EL+P+W V+ V  ++W+K+ ++G  
Sbjct  307   LQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVEIVAEWHWVKITSSGEF  365

Query  1003  ISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGE  1170
             +  LD  H +PYE L+LG    K      ++  K+  IP++++ +SVP   +S KPP+ E
Sbjct  366   VFPLDSPHKKPYEGLILGRVREKTAVPLRNEDVKVLPIPDHKLIVSVPCTLHSHKPPLAE  425

Query  1171  LLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  426   VLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  467



>ref|XP_006727840.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Leptonychotes 
weddellii]
Length=472

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/360 (32%), Positives = 183/360 (51%), Gaps = 19/360 (5%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             E+   S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   EENRISIIGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
               +     E   L   +C LS +   +     L E+ L   +    +E + S   QD+  
Sbjct  179   SEKWNKCSEPITLPLDTCSLSELCTMAKHLPSLNEMDL---QALQLMEEDMSITEQDL--  233

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV+DPPW
Sbjct  234   -FSRVVENNSSFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVMDPPW  290

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +PI +L      L+  WVTNR+K   FV++EL+P+W V+
Sbjct  291   QNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLIITWVTNRQKHLRFVKEELYPSWSVE  349

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVF  1125
              V  ++W+K+  +G  +  LD  H +PYE L+LG    K      ++  K+  IP++++ 
Sbjct  350   IVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVREKTAVPLRNEDVKVLPIPDHKLI  409

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  410   VSVPCTLHSHKPPLAEVLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  467



>ref|XP_004275969.1| PREDICTED: methyltransferase-like protein 4 [Orcinus orca]
Length=470

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/364 (32%), Positives = 186/364 (51%), Gaps = 21/364 (6%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  118   DVKKEISISVNGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGLKSGFL  173

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
               L  +     E   L   +C LS +   +     L E+ L   +    +E++ S   QD
Sbjct  174   HPLYEKWDKYSEPITLPLDTCNLSELCEMAKHLPSLNEMELQTLQL---MEDDISVTEQD  230

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             ++     +V N  S       +  KY++P +S F +SD+  ++ L+       +++IVID
Sbjct  231   LL---SRIVENNSSFTKMITLMGQKYLLPPKSSFLLSDISCMYPLL--SCKKTYDVIVID  285

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W
Sbjct  286   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSW  344

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPN  1113
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  +L  IP+
Sbjct  345   SVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVREKAALPLRNADVKEL-PIPD  403

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   
Sbjct  404   HKLIVSVPCTLHSHKPPLAEVLKDYIK--PEGECLELFARNLQPGWTSWGNEVLKFQHVD  461

Query  1291  YFVS  1302
             YFV+
Sbjct  462   YFVA  465



>ref|XP_006245723.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Rattus 
norvegicus]
Length=450

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/236 (36%), Positives = 135/236 (57%), Gaps = 9/236 (4%)
 Frame = +1

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             ++ N  S       +  +Y++P +S F +SD+  +  L+  +    F++IVIDPPWEN S
Sbjct  215   IIENNSSFSKMITLMGQRYLLPPKSSFLLSDISCMQPLL--NCSKTFDVIVIDPPWENKS  272

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
               +  RY +L  +    +P+ +L      LV  WVTNR+K   FV++EL+P+W V+ +  
Sbjct  273   VKRSNRYNSLSPQQIKRMPVPKLA-APDCLVVTWVTNRQKHLCFVKEELYPSWSVEVIAE  331

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPNNQVFMSVP  1137
             +YW+K+  +G  +  LD  H +PYECL+LG    K   +   +  +   +P+ ++ +SVP
Sbjct  332   WYWVKITNSGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVSVP  391

Query  1138  GD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
                +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   YF++
Sbjct  392   CALHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHMDYFIA  445



>ref|XP_005367602.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Microtus 
ochrogaster]
Length=460

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 176/358 (49%), Gaps = 39/358 (11%)
 Frame = +1

Query  274   RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreL  453
             +  K++++ N+ E  A + H ++R L+L     L+       V+  +   +  +  R  L
Sbjct  122   KKRKRSLAFNQGELDAMEHHTKIRELILGGSSQLIQEGLKSGVLCPVVDTQHGNSGRVPL  181

Query  454   SQQSCELS--------FVDLGSVWQAPLYEIVLNYQEGDAH---IENEGSHLGQDVIPAF  600
                +C LS           L      PL E  ++  E D     IEN  S         F
Sbjct  182   PLDACNLSELCEMAKHLPSLEDTQTLPLAEDDMSVIELDLSSRVIENNSS---------F  232

Query  601   DNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWEN  780
               +V            +  KY++P  S F +SD+  +  L+  +    F++IVIDPPW+N
Sbjct  233   SRMV----------NLMGQKYLLPPNSSFLLSDISCMQPLL--NCSKTFDVIVIDPPWQN  280

Query  781   SSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYV  960
              S  +  RY  L  +    +P+ +L   A  LV  WVTNR+K   FV++EL+P+W V+ +
Sbjct  281   KSVKRSNRYSCLSPQQIKHMPVPKLA-AADCLVVTWVTNRQKHLCFVKEELYPSWSVEVI  339

Query  961   TSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMS  1131
               +YW+K+  +G  +  LD  H +PYECL+LG    K      S   K+  +P+ ++ +S
Sbjct  340   AEWYWVKITRSGEFVFPLDSPHKKPYECLVLGRFREKTALVLRSPDVKVPPVPDRKLIVS  399

Query  1132  VPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             VP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   YF++
Sbjct  400   VPCLLHSHKPPLAEVLKDYIKPG--GQCLELFARNLQPGWMSWGNEVLKFQHVDYFIA  455



>ref|XP_008688625.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Ursus 
maritimus]
Length=491

 Score =   172 bits (437),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/404 (30%), Positives = 192/404 (48%), Gaps = 37/404 (9%)
 Frame = +1

Query  169   NRSYTRYRVSPSAYYSRFFDSTEKLETST---ESRKRKRNE-------------------  282
             NR      +    + S  F+ T+   T     E R+RK  E                   
Sbjct  94    NRGNCEIFIQKYVFRSELFNVTKPYITPAVHKECRQRKEKEDPMDGVKEESRISIIGKKR  153

Query  283   KKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQ  462
             K+ +  N+ E  A + H ++R L+L     L+        +  L        E   L   
Sbjct  154   KRCVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPLSENWDKCSEPITLPLD  213

Query  463   SCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEA  642
             +C LS +   +     L E+ L   +    +  + S   QD+   F  +V N  S     
Sbjct  214   TCNLSELCAMAKHLPSLNEMEL---QALQLMGEDVSVTEQDL---FSRVVENNSSFTKMI  267

Query  643   EFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPN  822
               +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  RY  L  
Sbjct  268   TLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVIDPPWQNKSVKRSNRYSYLSP  325

Query  823   RFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSL  1002
                  +PI +L      LV  WVTNR+K   FV++EL+P+W V+ V  ++W+K+ ++G  
Sbjct  326   LQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVEIVAEWHWVKITSSGEF  384

Query  1003  ISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGE  1170
             +  LD  H +PYE L+LG    K      ++  K+  IP++++ +SVP   +S KPP+ E
Sbjct  385   VFPLDSPHKKPYEGLILGRVREKTAVPLRNEDVKVLPIPDHKLIVSVPCTLHSHKPPLAE  444

Query  1171  LLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  445   VLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  486



>emb|CBN82076.1| Methyltransferase-like protein 4 [Dicentrarchus labrax]
Length=351

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 132/237 (56%), Gaps = 9/237 (4%)
 Frame = +1

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +  ++         +  +Y+IP  + F +SD  +I  L+       F++IV+DPPWE
Sbjct  80    FSRVTESRSDRATVVTLMGEEYVIPPHTAFLLSDFTRIQPLV--HYGRTFDLIVMDPPWE  137

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  + +RY +LP+     LPI  L  +   LV  WVTNR     FV  EL+P WGV+ 
Sbjct  138   NKSVKRSRRYSSLPSTQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHWGVEV  196

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NNQVFM  1128
             V  ++W+KV  +G  +  LD  H +PYE L+LG Y    DN    S+ + +P  + ++ +
Sbjct  197   VAEWFWVKVTTSGQFVFPLDSHHKKPYEVLVLGRYRSSADNPKSSSETSEVPVEDQRLIV  256

Query  1129  SVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             SVP   +S+KP + E+L  ++     A C+ELF+R L  GWTSWGNE L FQ + YF
Sbjct  257   SVPSALHSQKPSLSEVLKPHVRA--EARCLELFARSLQPGWTSWGNEVLKFQHTSYF  311



>ref|XP_007519944.1| PREDICTED: methyltransferase-like protein 4 [Erinaceus europaeus]
Length=537

 Score =   173 bits (439),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 180/364 (49%), Gaps = 32/364 (9%)
 Frame = +1

Query  274   RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreL  453
             +  K+  + N+ E  A + H ++R L+L     L+        +R L  +      R  L
Sbjct  115   QKRKRCAAFNQGELDAMEYHAQIRGLILDGSSQLIQDGLKSGFLRPLSEQPSKRAGRSSL  174

Query  454   SQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA-----FDNLVVN  618
              +++C LS           L E+  +   G   +E +   L  D +       F  +V N
Sbjct  175   PREACSLS----------ELCEMAKHLPSG-RDVEPQALQLRGDDMSVREQDLFSRVVEN  223

Query  619   KGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQK  798
               S       +  KY++P +S F +SDV  IH L+       +++IVIDPPW+N S  + 
Sbjct  224   SSSLTKMITLMGQKYLLPPKSAFLLSDVSCIHPLLACGKT--YDVIVIDPPWQNKSVKRS  281

Query  799   QRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWL  978
              RY  L       LP+ +L      LV  WVTN++K   FV++EL+P+W V+ +  ++W+
Sbjct  282   SRYNYLSPLQIKQLPVPKLA-APNCLVITWVTNKQKNLRFVKEELYPSWSVEILAEWHWV  340

Query  979   KVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVPGD-Y  1146
             K+ ++G  +  LD  H +PYE L+LG    K      +   K   +P ++V +SVP   +
Sbjct  341   KITSSGEFVFPLDSPHKKPYEVLILGRVREKTVVPLRATAVKALPVPGHKVLVSVPCVLH  400

Query  1147  SRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKNRQMKAP  1326
             S KPP+ E+L +Y+    +  C+ELF+R L  GWTSWGNE L FQ   YF+       AP
Sbjct  401   SHKPPLAEVLKDYLE--PNGECLELFARNLQPGWTSWGNEVLKFQHVDYFL-------AP  451

Query  1327  DSAY  1338
             +S +
Sbjct  452   ESGH  455



>ref|XP_008832831.1| PREDICTED: methyltransferase-like protein 4 [Nannospalax galili]
Length=468

 Score =   172 bits (435),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 183/361 (51%), Gaps = 26/361 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K ETS    K++   K+ I+ N+ E  A + H ++R L+L     L+        +  L 
Sbjct  119   KKETSISVGKKR---KRCIAFNQGELDAMEYHTKIRELILDGALQLIQEGLRSGFLYPLV  175

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQDV  588
              ++    ER  L   +C LS +   +     L E    +L   E D  I        QD+
Sbjct  176   EKQDKCSERITLPLDACSLSGLCEMAKHLPSLNETEPQMLQLMEDDMSITE------QDL  229

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+       F++IVIDP
Sbjct  230   ---FSRVVENSSSFSKTITLMGEKYLLPPKSSFLLSDISCMQPLL--KCSKTFDVIVIDP  284

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W 
Sbjct  285   PWQNKSVKRSNRYSYLSPLQIKQMPIPKLA-APDCLVVTWVTNRQKHLRFVKEELYPSWS  343

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQ  1119
             V+ +  ++W+K+  +G  +  LD  H +PYECL+LG    K      +   K+  IP+++
Sbjct  344   VETLAEWHWVKITNSGEFVFPLDSPHKKPYECLVLGRVREKTALLLRTAGVKVLPIPDHR  403

Query  1120  VFMSVPGD-YSRKPPIGELLLEYMS-GTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             + +SVP   +S KPP+ E+L +Y+  G K   C+ELF+R L  GWTSWGNE L FQ   Y
Sbjct  404   LVVSVPCVLHSHKPPLAEVLKDYIKPGGK---CLELFARSLQPGWTSWGNEVLKFQHVDY  460

Query  1294  F  1296
             F
Sbjct  461   F  461



>ref|XP_008159733.1| PREDICTED: methyltransferase-like protein 4 [Eptesicus fuscus]
Length=465

 Score =   172 bits (435),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 185/358 (52%), Gaps = 19/358 (5%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  ST  +KRKR     +  N+ E  A + H+++R L+L     ++        +  L
Sbjct  118   KEISISTLGKKRKR----CVGFNQGELDAMEYHEKIRGLILDGSSQIIQEGLKSGFLHPL  173

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEI-VLNYQEGDAHIENEGSHLGQDVI  591
               ++    E   LS  +C LS +   +     L E+ +L  Q     +EN+ S   QD+ 
Sbjct  174   SEKQDKCNEPITLSFDTCNLSELCEMAKHLPSLNEMEILTLQL----MENDMSVTEQDL-  228

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F  +V N          +  KY++P +S F +SD+  +  L+  +    +++IVIDPP
Sbjct  229   --FSRIVENNSRFTKMITLMGQKYLVPPKSSFLLSDISCMQPLL--NCRKTYDVIVIDPP  284

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             W+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V
Sbjct  285   WQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSV  343

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMS  1131
             + V  ++WLK+  +G  +  LD  H +PYE L+LG    K  T     +  IP++++ +S
Sbjct  344   EIVAEWHWLKITNSGEFVFPLDSPHKKPYEGLILGRVQEK-TTLPLRNMLPIPDHKLIVS  402

Query  1132  VPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             VP   +S KPP+ E+L +++        +ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  403   VPCALHSHKPPLAEVLKDFIKPD--GDYLELFARNLQPGWTSWGNEVLKFQHVDYFIA  458



>ref|XP_004853240.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Heterocephalus 
glaber]
Length=475

 Score =   172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 180/363 (50%), Gaps = 21/363 (6%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  KK +  N+ E  A + H ++R L+L     L+        +    
Sbjct  121   KKEISTSIIGKKR--KKCVVFNQGELDAMEYHTKIRELILDGSLKLIQEGLKSGFLYQFF  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              ++    E   +   +C LS +   +     L E  L   +    IE + S   QD+   
Sbjct  179   EKQDKCSEPNAIPHDACSLSGLCEMAKHLPALSEKELQTLQ---LIEEDLSVAEQDL---  232

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P    F +SD+  +  L+  +    F++IVIDPPW+
Sbjct  233   FSRVVENNSSFSKMITLMGQKYLLPPNCSFLLSDISCMQPLL--NCRKTFDVIVIDPPWQ  290

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +PI QL      LV  WVTNR+K   FV++ELFP+W V+ 
Sbjct  291   NKSVKRSNRYSYLSPLQIQQIPIHQLA-APNCLVVTWVTNRQKHLRFVKEELFPSWSVET  349

Query  958   VTSFYWLKVKA----NGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNN  1116
             +  ++W+KV +     G  +  LD  H +PYE L+LG   GK      S   K+  IP++
Sbjct  350   LAEWHWVKVSSEITKTGEFVFPLDSPHKKPYEGLILGRVQGKTTLPLRSTDVKVPPIPDH  409

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   Y
Sbjct  410   KLIVSVPCVLHSHKPPLAEVLKDYIK--PDGECLELFARNLQPGWTSWGNEVLKFQHMDY  467

Query  1294  FVS  1302
             F++
Sbjct  468   FIA  470



>emb|CEG78239.1| hypothetical protein RMATCC62417_12876 [Rhizopus microsporus]
Length=371

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 112/366 (31%), Positives = 187/366 (51%), Gaps = 58/366 (16%)
 Frame = +1

Query  271   KRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLG--------ATELLKVVRNLrcee  426
             K+ ++K+ S+ + E   E+RH+E+RPLL    + L          +TE  K V+N     
Sbjct  41    KKKQRKSPSITDVE--TEKRHEELRPLLTDCIDRLQAVWPKREQKSTEP-KEVKN-----  92

Query  427   ctdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIE------NEGSHLGQDV  588
                           E+ F  + S+ ++          + D  IE      ++ ++   D+
Sbjct  93    --------------EIDFPSIQSMVESAHNRFT---SQRDERIELPDESDDDAAYRDLDI  135

Query  589   IPAFDNLVVNKGSGDAEAEFL-NHKYIIPKESCFYMSDV-----RKIHNLIPADSDSGFN  750
                F+ + +N      + E   + KY+IP  S F M  +     +++ + +   S  G +
Sbjct  136   FSVFNKICINSAQRLKQIEITPSAKYLIPPRSSFIMGSMTDGSLQQLSDYV--SSLGGAD  193

Query  751   IIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKE  930
             +IVIDPPW N S H+  +Y+T       ++P+K L +   ++VA+WVTN+ K R F+  +
Sbjct  194   LIVIDPPWPNKSVHRSSKYETQDIYDLFTIPMKDLIN-EDSVVAMWVTNKPKFRKFIIHK  252

Query  931   LFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIP  1110
             LFPAW ++    + WLKV   G  I  LD  H +PYE L++G+   +  TSD      +P
Sbjct  253   LFPAWELECKAEWIWLKVTTEGQCIFPLDSSHKKPYEQLIIGH---RQKTSD------LP  303

Query  1111  NNQVFMSVPG-DYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQAS  1287
             +  V +SVP   +SRKPP+ +++L Y+   +   C+E+F+R L+ GW SWGN+ L FQ +
Sbjct  304   SRHVIVSVPSLRHSRKPPLQDVILPYLKNRERPVCVEMFARCLTPGWISWGNDCLKFQHT  363

Query  1288  KYFVSK  1305
             +YF  K
Sbjct  364   EYFEKK  369



>gb|KFO27103.1| Methyltransferase-like protein 4 [Fukomys damarensis]
Length=471

 Score =   172 bits (435),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 119/363 (33%), Positives = 181/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K ET+T    +KR  KK +  N+ E  A + H ++R  +L     L+        +  L 
Sbjct  121   KKETATSITGKKR--KKCVVFNQGELDAMEYHTKIREQILDGSLRLIQEGLKSGFLYQLF  178

Query  418   ceectdeerreLSQQSCEL-SFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQD  585
              ++    E   L   +C L    +L    QA L E+    L  +E D  +        QD
Sbjct  179   EKQDQRSEPTSLPPDACSLPGLCELAKRSQA-LGEVELPTLRLREEDLSVAE------QD  231

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             ++     +V N  S       +  KY++P +S F +SD+  +  L+  +    F+ IVID
Sbjct  232   LL---SRVVENDSSFSKMITLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKTFDAIVID  286

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI QL      LV  WVTNR+K   FV+ EL+P+W
Sbjct  287   PPWQNKSVKRSNRYSYLSPLQIQQVPIPQLA-APDCLVVTWVTNRQKHLRFVKDELYPSW  345

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNN  1116
              V  +  ++W+K+   G  +  LD  H +PYE L+LG    K+     S  +++  IP++
Sbjct  346   SVAALAEWHWVKITKTGEFVFPLDSPHKKPYEGLILGRVQEKNTLPLRSTDAEVPPIPDH  405

Query  1117  QVFMSVP-GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   Y
Sbjct  406   KLIVSVPCAVHSHKPPLAEVLKDYIK--PGGECLELFARNLQPGWTSWGNEVLKFQHMDY  463

Query  1294  FVS  1302
             FV+
Sbjct  464   FVA  466



>ref|XP_008259344.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_008259345.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Oryctolagus 
cuniculus]
Length=467

 Score =   171 bits (434),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 186/364 (51%), Gaps = 27/364 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  K+ ++ N+ E  A + H ++R L+L     L+        +  L 
Sbjct  121   KKENSTSIIGKKR--KRCVTFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLHPLS  178

Query  418   ceectdeerreLSQQSCELSFV-----DLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
               +    E   L   +C LS +     +L S  +  L  + L        I+++ S   +
Sbjct  179   ENQDKYSEPVTLPLDTCSLSGLCAMAKNLPSFSETELQMLQL--------IDDDMSVTEK  230

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D+   F  LV N          +  KY++P +S F +SD+  +  L+  +    F++IVI
Sbjct  231   DL---FSRLVENSSRFTRMITLMGQKYLLPPKSSFLLSDISYMKPLL--NCRKTFDVIVI  285

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPW+N S  +  +Y  L  +    +P+ +L      LV  WVTNR+K   FV++EL+P 
Sbjct  286   DPPWQNKSVKRSHKYSYLSPQEIKQIPVPELA-APNCLVVTWVTNRQKHLRFVKEELYPF  344

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPN  1113
             W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K   S      K+  IP+
Sbjct  345   WSVERVAEWHWVKITSSGEFVFPLDSPHKKPYEVLILGRIQEKATLSLRNTDVKVLPIPD  404

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+     A C+ELF+R L  GWTSWGNE L FQ   
Sbjct  405   HKLIVSVPCILHSHKPPLTEVLKDYIKPD--AECLELFARNLQPGWTSWGNEVLKFQHVD  462

Query  1291  YFVS  1302
             YF++
Sbjct  463   YFIA  466



>ref|XP_008298782.1| PREDICTED: methyltransferase-like protein 4 [Stegastes partitus]
Length=431

 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 125/420 (30%), Positives = 203/420 (48%), Gaps = 45/420 (11%)
 Frame = +1

Query  124   LQSANAFFIDPVRVVNRSYT---RYRVSPSAYYSRFFD--------------STEKLETS  252
             LQS   +F+DP  +++R Y+   R+R +  ++    F+              +   ++  
Sbjct  5     LQSDQGWFVDPRSLIDRGYSPCIRWRDTQKSHVECRFNKQCFQILKSHYSVPAGAAVDGG  64

Query  253   TESRKRKRNEKKTIS------LNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
                  +K  +           LN+ E  ++  H++VR ++L+      G   L+  VR+L
Sbjct  65    NADMLQKTGKPPKKRKRKHSELNQGELDSQAFHEKVRSVILE------GTKSLVDSVRSL  118

Query  415   -rceectdeerreLSQQSCEL-SFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV  588
                   TD  +  L  Q C L +  ++    + PL +         + +  +G     D+
Sbjct  119   GHLNGGTDTAKEPLPSQECSLAALCEMAK--ELPLVDEEEQECCSQSLVAEDGCTSHVDL  176

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  L  N+    A    +  +Y+IP  S F +SD  +I  L+       F++IV+DP
Sbjct  177   ---FSRLTENRTDWAAVVTLMGEEYVIPPHSAFLLSDFTRIQPLV--HYGRRFDLIVMDP  231

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN S  + +RY +LP+     LP+  L  +   LV  WVTNR     FV  EL+P WG
Sbjct  232   PWENKSVKRSRRYSSLPSSQLKQLPVPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHWG  290

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLNAIP--NNQV  1122
             V+ V  ++W+KV  +G  +  LD  H +PYE L+LG      +TS  S+ + +P  + ++
Sbjct  291   VEVVAEWFWVKVTTSGQFVFPLDSPHKKPYEMLVLGRYRAPVDTSP-SEASEVPVEDQRL  349

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S+KP + ++L  Y+     A C+ELF+R L  GWTSWGNE L FQ + YF 
Sbjct  350   IVSVPSALHSQKPSLSDVLKPYVGA--EAKCLELFARSLQPGWTSWGNEVLKFQHTSYFT  407



>ref|XP_008259343.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Oryctolagus 
cuniculus]
Length=501

 Score =   172 bits (436),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 186/364 (51%), Gaps = 27/364 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  K+ ++ N+ E  A + H ++R L+L     L+        +  L 
Sbjct  155   KKENSTSIIGKKR--KRCVTFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLHPLS  212

Query  418   ceectdeerreLSQQSCELSFV-----DLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQ  582
               +    E   L   +C LS +     +L S  +  L  + L        I+++ S   +
Sbjct  213   ENQDKYSEPVTLPLDTCSLSGLCAMAKNLPSFSETELQMLQL--------IDDDMSVTEK  264

Query  583   DVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVI  762
             D+   F  LV N          +  KY++P +S F +SD+  +  L+  +    F++IVI
Sbjct  265   DL---FSRLVENSSRFTRMITLMGQKYLLPPKSSFLLSDISYMKPLL--NCRKTFDVIVI  319

Query  763   DPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPA  942
             DPPW+N S  +  +Y  L  +    +P+ +L      LV  WVTNR+K   FV++EL+P 
Sbjct  320   DPPWQNKSVKRSHKYSYLSPQEIKQIPVPELA-APNCLVVTWVTNRQKHLRFVKEELYPF  378

Query  943   WGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPN  1113
             W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K   S      K+  IP+
Sbjct  379   WSVERVAEWHWVKITSSGEFVFPLDSPHKKPYEVLILGRIQEKATLSLRNTDVKVLPIPD  438

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+     A C+ELF+R L  GWTSWGNE L FQ   
Sbjct  439   HKLIVSVPCILHSHKPPLTEVLKDYIK--PDAECLELFARNLQPGWTSWGNEVLKFQHVD  496

Query  1291  YFVS  1302
             YF++
Sbjct  497   YFIA  500



>ref|XP_004421082.1| PREDICTED: methyltransferase-like protein 4 [Ceratotherium simum 
simum]
Length=491

 Score =   172 bits (435),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 115/351 (33%), Positives = 177/351 (50%), Gaps = 24/351 (7%)
 Frame = +1

Query  274   RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreL  453
             +  K+ +  N+ E  A + H ++R L+L     L+        +  L  ++    ER  L
Sbjct  152   KKRKRCVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGLKSGFLHPLPEKQDKCSERITL  211

Query  454   SQQSCELSFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKG  624
                +C LS +   +     L EI    L   E D   E       QD+   F  +V N  
Sbjct  212   PLDTCNLSELCEMAKHLPSLNEIELQTLQLMEDDMVTE-------QDL---FSRVVENNS  261

Query  625   SGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQR  804
             S       +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  R
Sbjct  262   SFTKMITLMGQKYLLPPKSSFLLSDISYMHPLL--NCRKTYDVIVIDPPWQNKSVKRSNR  319

Query  805   YQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKV  984
             Y  L       LPI +L      LV  WVTNR+K   FV++EL+P+W V+ V  ++W+K+
Sbjct  320   YSYLSPLQIKQLPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSWSVEIVAEWHWVKI  378

Query  985   KANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNNQVFMSVPGD-YS  1149
               +G  +  LD  H +PYE L+LG    +       +D   L  IP++++ +SVP   +S
Sbjct  379   TTSGEFVFPLDSPHKKPYEGLILGRVREETALPLRNADVRVL-PIPDHKLIVSVPCTLHS  437

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
              KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  438   HKPPLAEVLKDYIKPD--GECLELFARNLQPGWTSWGNEVLKFQHVDYFIA  486



>ref|XP_006972309.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=450

 Score =   171 bits (433),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 136/239 (57%), Gaps = 13/239 (5%)
 Frame = +1

Query  604   NLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENS  783
              ++ N  S       +  KY++P  S F +SD+  +  L+  +    F++IVIDPPWEN 
Sbjct  214   QVIENGSSFSKMITLMGQKYLLPPRSSFLLSDISCMQPLL--NCGKTFDVIVIDPPWENK  271

Query  784   SAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVT  963
             S  +  RY  L  +    +P+ +L   A  L+  WVTNR+K   FV++EL+P+W V+ V 
Sbjct  272   SVKRSNRYSCLSPQQIKQMPVPKLA-AADCLIVTWVTNRQKHLCFVKEELYPSWSVEVVA  330

Query  964   SFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-----NTSDFSKLNAIPNNQVFM  1128
              +YW+K+  +G  +  LD  H +PYECL+LG    K      NT   +++  +P+ ++ +
Sbjct  331   EWYWVKITHSGEFVFPLDSPHKKPYECLVLGRVREKAALAFRNTD--TEVPPVPDQKLIV  388

Query  1129  SVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             SVP   +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   YF++
Sbjct  389   SVPCILHSHKPPLAEVLKDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHVDYFIA  445



>ref|XP_003219728.1| PREDICTED: methyltransferase-like protein 4 [Anolis carolinensis]
 ref|XP_008106867.1| PREDICTED: methyltransferase-like protein 4 [Anolis carolinensis]
 ref|XP_008106868.1| PREDICTED: methyltransferase-like protein 4 [Anolis carolinensis]
Length=479

 Score =   171 bits (434),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 138/254 (54%), Gaps = 14/254 (6%)
 Frame = +1

Query  559   NEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPADS  735
             N+G  L Q V P+    +    +  AE    +  KY+ P +S F +SDV  +  L+  D 
Sbjct  228   NKGGCLPQQVQPS---CITENTTNYAEIITLMGEKYLFPPKSAFLLSDVSFMQPLL--DY  282

Query  736   DSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRS  915
                F IIVIDPPWEN S  +  RY  L +     +P+  L    G LV  WVTNR++   
Sbjct  283   KKKFGIIVIDPPWENKSVKRSNRYSYLSHSQIKQIPVPALA-APGCLVVTWVTNRQRHLR  341

Query  916   FVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDN----TS  1083
             FV+ EL+P W V  V  ++W+K+  +G  +  L+ FH +PYE L+LG   G  +     S
Sbjct  342   FVKNELYPYWSVHGVVEWFWVKITRSGEFVFPLNSFHKKPYEVLILGRVQGSTDRPLRIS  401

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
             +   L  IP+ ++ +SVP   +S KPP+ ++L EY       +C+ELF+R L  GWTSWG
Sbjct  402   EDIVLPEIPDQKLIVSVPCTLHSHKPPLADVLKEY--AKPEVNCLELFARNLQPGWTSWG  459

Query  1261  NEPLHFQASKYFVS  1302
             NE L FQ   YF +
Sbjct  460   NEVLKFQHMDYFTA  473



>ref|XP_006525170.1| PREDICTED: methyltransferase like 4 isoform X3 [Mus musculus]
 gb|AAH99943.1| Mettl4 protein [Mus musculus]
Length=450

 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 135/236 (57%), Gaps = 9/236 (4%)
 Frame = +1

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             ++ N  S       +  KY++P +S F +SD+  +  L+  +    F+ IVIDPPWEN S
Sbjct  215   IIENNSSFSKMITLMGQKYLLPPQSSFLLSDISCMQPLL--NCGKTFDAIVIDPPWENKS  272

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
               +  RY +L  +    +PI +L   A  L+  WVTNR+K   FV++EL+P+W V+ V  
Sbjct  273   VKRSNRYSSLSPQQIKRMPIPKLA-AADCLIVTWVTNRQKHLCFVKEELYPSWSVEVVAE  331

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPNNQVFMSVP  1137
             +YW+K+  +G  +  LD  H +PYECL+LG    K   +      ++  +P+ ++ +SVP
Sbjct  332   WYWVKITNSGEFVFPLDSPHKKPYECLVLGRVKEKTPLALRNPDVRIPPVPDQKLIVSVP  391

Query  1138  GD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
                +S KPP+ E+L +Y+       C+ELF+R L  GW SWGNE L FQ   YF++
Sbjct  392   CVLHSHKPPLTEVLRDYIK--PGGQCLELFARNLQPGWMSWGNEVLKFQHMDYFIA  445



>ref|XP_003439404.1| PREDICTED: methyltransferase-like protein 4-like [Oreochromis 
niloticus]
Length=343

 Score =   168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 132/237 (56%), Gaps = 9/237 (4%)
 Frame = +1

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +  NK         +  +Y+IP  + F +SD  +I  L+     + F++IV+DPPWE
Sbjct  81    FSQVTENKADWATVVTLMGEEYVIPPHTAFLLSDFTRIQPLV--HYGTRFDLIVMDPPWE  138

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  + +RY +LP+     LPI  L  +   LV  WVTNR     FV  EL+P WGV+ 
Sbjct  139   NKSVKRSRRYGSLPSSQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHWGVEV  197

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NNQVFM  1128
             V  ++W+KV   G  +  LD  H +PYE L+LG Y    D +   S+ + +P  + ++ +
Sbjct  198   VAEWFWVKVTTFGQFVFPLDSPHKKPYEVLVLGRYRCSADISESPSETSEVPVEDQRLIV  257

Query  1129  SVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ  +YF
Sbjct  258   SVPSALHSQKPSLSEVLKPYIGA--EAKCLELFARSLQPGWTSWGNEVLKFQHVRYF  312



>ref|XP_008306489.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Cynoglossus 
semilaevis]
Length=350

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 153/296 (52%), Gaps = 15/296 (5%)
 Frame = +1

Query  451   LSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGS  627
             L  Q C L+   D+    + PL + +   +   A +  +G     D+   F  +  N+  
Sbjct  47    LPLQECNLAALCDMAK--ELPLMDDLELEECAQALVAEDGGLCHVDL---FSRVTENRSD  101

Query  628   GDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRY  807
               A    +  +Y+IP  + F +SD  +   L+  +    F++IV+DPPWEN S  + +RY
Sbjct  102   QAAVVRLMGEEYVIPAHTSFLLSDFTRTRPLV--NYGKKFDLIVMDPPWENKSVKRSRRY  159

Query  808   QTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVK  987
               LP+     LP+  L  +   LV  WVTNR     FV  EL+P WGV+ V  ++W+KV 
Sbjct  160   SALPSSQLKRLPVPLLA-SDNCLVVTWVTNRASHLRFVRDELYPHWGVEVVAEWFWVKVT  218

Query  988   ANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NNQVFMSVPGD-YSRK  1155
             ++G  +  LD  H +PYE L+LG Y      +  FSK+  IP    ++ +SVP   +S+K
Sbjct  219   SSGHFVFPLDSVHKKPYEVLVLGRYRSSSHPSISFSKIPEIPVEGARLIVSVPSALHSQK  278

Query  1156  PPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKNRQMKA  1323
             P + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ S YF     Q  A
Sbjct  279   PLLSEVLRPYVGA--EAKCLELFARNLHPGWTSWGNEVLKFQHSSYFTVTPVQESA  332



>ref|XP_005922561.1| PREDICTED: methyltransferase-like protein 4-like [Haplochromis 
burtoni]
Length=439

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 183/361 (51%), Gaps = 33/361 (9%)
 Frame = +1

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
             +T   S+KRKR   K   LN+ E  +   H++++ ++L+  + L+ + + L  +      
Sbjct  71    KTCKPSKKRKR---KHHELNQGEIDSLVFHEKIKSVILEGTKYLVDSAQPLGYLNG----  123

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHL--GQDV---  588
               T+ ++  L  Q C L          A L E+  +    +   +  G+ L  G+D    
Sbjct  124   -QTNVDKEPLPSQECNL----------AALCEMAKDLPLVEDEEQERGAQLLVGEDGCMS  172

Query  589   -IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
              +  F  +  NK         +  +Y+IP  + F +SD  +I  L+     + F++IV+D
Sbjct  173   HVDLFSQVTENKADWATVVTVMGEEYVIPPHTAFLLSDFTRIQPLV--HYGTRFDLIVMD  230

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN S  + +RY +LP+     LPI  L  +   LV  WVTNR     FV  EL+P W
Sbjct  231   PPWENKSVKRSRRYGSLPSSQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHW  289

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NN  1116
             GV+ V  ++W+KV   G  +  LD  H +PYE L+LG Y    D +   S+ + +P  + 
Sbjct  290   GVEVVAEWFWVKVTTFGQFVFPLDSPHKKPYEVLVLGRYRCSADISESPSETSEVPVEDQ  349

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ   Y
Sbjct  350   RLIVSVPSALHSQKPSLSEVLKPYIGA--DAKCLELFARSLQPGWTSWGNEVLKFQHVSY  407

Query  1294  F  1296
             F
Sbjct  408   F  408



>ref|XP_005738879.1| PREDICTED: methyltransferase-like protein 4-like [Pundamilia 
nyererei]
Length=439

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 183/361 (51%), Gaps = 33/361 (9%)
 Frame = +1

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
             +T   S+KRKR   K   LN+ E  +   H++++ ++L+  + L+ + + L  +      
Sbjct  71    KTCKPSKKRKR---KHHELNQGEIDSLVFHEKIKSVILEGTKYLVDSAQPLGYLNG----  123

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHL--GQDV---  588
               T+ ++  L  Q C L          A L E+  +    +   +  G+ L  G+D    
Sbjct  124   -QTNVDKEPLPSQECNL----------AALCEMAKDLPLVEDEEQERGAQLLVGEDGCTS  172

Query  589   -IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
              +  F  +  NK         +  +Y+IP  + F +SD  +I  L+     + F++IV+D
Sbjct  173   HVDLFSQVTENKADWATVVTVMGEEYVIPPHTAFLLSDFTRIQPLV--HYGTRFDLIVMD  230

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN S  + +RY +LP+     LPI  L  +   LV  WVTNR     FV  EL+P W
Sbjct  231   PPWENKSVKRSRRYGSLPSSQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHW  289

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NN  1116
             GV+ V  ++W+KV   G  +  LD  H +PYE L+LG Y    D +   S+ + +P  + 
Sbjct  290   GVEVVAEWFWVKVTTFGQFVFPLDSPHKKPYEVLVLGRYRCSADISESPSETSEVPVEDQ  349

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ   Y
Sbjct  350   RLIVSVPSALHSQKPSLSEVLKPYIGA--DAKCLELFARSLQPGWTSWGNEVLKFQHVSY  407

Query  1294  F  1296
             F
Sbjct  408   F  408



>ref|XP_010883762.1| PREDICTED: methyltransferase-like protein 4, partial [Esox lucius]
Length=335

 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 126/225 (56%), Gaps = 9/225 (4%)
 Frame = +1

Query  634   AEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQT  813
              E   +  KYIIP    F +SD+ +I  L+  D    FN+IV+DPPWEN S  +  RY  
Sbjct  101   VELTLMGQKYIIPPRCSFLLSDLTRIQPLV--DYGKLFNLIVMDPPWENKSVKRSGRYGF  158

Query  814   LPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKAN  993
             LP+     LPI  L   AG +V  WVTNR     FV  EL+P WGV+ +  ++W+KV  +
Sbjct  159   LPSTQLKRLPIPLLA-AAGCVVVTWVTNRSSHLRFVRDELYPHWGVEVLAEWFWVKVTNS  217

Query  994   GSLISELDLFHHRPYECLLLGYSDGKDNTSDFSKLN---AIPNNQVFMSVPGD-YSRKPP  1161
             G  +  LD  H +PYE L+LG   G  + S  S+ N   ++ + +V +SVP   +S KP 
Sbjct  218   GKYVFPLDSPHKKPYEVLVLGRYRGSGDDSHRSRGNTELSMEDQRVIVSVPSALHSHKPS  277

Query  1162  IGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             + ++L  Y      A C+ELF+R L  GWTSWGNE + FQ   Y+
Sbjct  278   LSDVLKPYAGA--DADCLELFARSLQPGWTSWGNEVIKFQHVSYY  320



>ref|XP_007933801.1| PREDICTED: methyltransferase-like protein 4 [Orycteropus afer 
afer]
Length=471

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/361 (32%), Positives = 184/361 (51%), Gaps = 21/361 (6%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  K+ +  N+ E  A + H ++R L+L     L+        +    
Sbjct  121   KKEVSTSVIGKKR--KRCVVFNQGELDAMEYHTKIRRLILDGSSQLVQEGLKSGFLHPFS  178

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              ++ T  E   L   +C LS +   +   + L E+ L   +    +E++ S   QD+   
Sbjct  179   EKQDTCSEHITLPHNTCNLSELCEMAKHLSSLNEMELQTLQL---MEDDMSITEQDL---  232

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P +S F +SD+  +  L+  +    +++IVIDPPW+
Sbjct  233   FSRVVENSSSFTKMITLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKKYDVIVIDPPWQ  290

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +P+ ++      LV  WVTNR+K   FV++EL+P+W V+ 
Sbjct  291   NKSVKRSNRYSYLSPMQIKQIPVPEMV-APNCLVITWVTNRQKHLRFVKEELYPSWSVEI  349

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD-----NTSDFSKLNAIPNNQV  1122
             V  ++W+K+   G  +  LD  H +PYE L+LG    K      NT +  K+  IP +++
Sbjct  350   VAEWHWVKITNTGEFVFPLDSLHKKPYEVLILGRVREKAALPFRNTDE--KMLPIPEHKL  407

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  408   IVSVPCTLHSHKPPLTEVLKDYIKPD--GQYLELFARNLQPGWTSWGNEVLKFQHMDYFI  465

Query  1300  S  1302
             +
Sbjct  466   A  466



>ref|XP_547656.2| PREDICTED: methyltransferase like 4 isoform X3 [Canis lupus familiaris]
 ref|XP_005623083.1| PREDICTED: methyltransferase like 4 isoform X1 [Canis lupus familiaris]
Length=471

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/350 (33%), Positives = 177/350 (51%), Gaps = 18/350 (5%)
 Frame = +1

Query  262   RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdee  441
             +KRKR     +  N+ E  A + H ++R L+L     L+        +  L  +     E
Sbjct  132   KKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSELIQEGFKSGFLHPLSEKWDKCSE  187

Query  442   rreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNK  621
                L   +C LS +   +     L E  L   +    +E + S   QD+   F  +V N 
Sbjct  188   PVTLPLDTCNLSELCAMAKHLPSLNETEL---QALQLMEQDISVTEQDL---FSRVVENN  241

Query  622   GSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQ  801
              S       +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  
Sbjct  242   SSFTKMITLMGQKYLVPPKSSFLLSDISCMHPLL--NCRKTYDVIVIDPPWQNKSVKRSN  299

Query  802   RYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLK  981
             RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V  V  ++W+K
Sbjct  300   RYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVDIVAEWHWVK  358

Query  982   VKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFS--KLNAIPNNQVFMSVPGD-YSR  1152
             +  +G  +  LD  H +PYE L+LG    K      +  K+  IP++++ +SVP   +S 
Sbjct  359   ITNSGEFVFPLDSPHKKPYEGLILGRVREKTIPLRNAGIKVLPIPDHKLIVSVPCTLHSH  418

Query  1153  KPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  419   KPPLAEVLKDYVKPD--GECLELFARNLQPGWTSWGNEVLKFQHLDYFVA  466



>ref|XP_005372720.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Chinchilla 
lanigera]
Length=447

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 141/255 (55%), Gaps = 14/255 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +E + S   QD+   F   V N  S       +  KY++P  S F +SD+  +  L+  +
Sbjct  197   VEEDSSVAEQDL---FSRFVENNSSFSKMITLMGQKYLLPPNSSFLLSDISCMQPLL--N  251

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 F++IV+DPPW+N S  +  RY  L       +P+ QL      LV  WVTNR+K  
Sbjct  252   CGKTFDVIVMDPPWQNKSVKRSNRYSYLSPLQIQQIPVPQLA-APNCLVVTWVTNRQKHL  310

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDN----T  1080
              FV+ EL+PAW V+ +  ++W+K+ + G  +  LD  H +PYE L+LG    K      +
Sbjct  311   RFVKDELYPAWSVEVLAEWHWVKITSAGEYVFPLDSPHKKPYEGLILGRVQAKATLPLRS  370

Query  1081  SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSW  1257
             +D + +  IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSW
Sbjct  371   TDVT-MPPIPDHKLIVSVPCVLHSHKPPLAEVLKDYIK--PGGECLELFARNLQPGWTSW  427

Query  1258  GNEPLHFQASKYFVS  1302
             GNE L FQ   YFV+
Sbjct  428   GNEVLKFQHVDYFVA  442



>ref|XP_001368706.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Monodelphis 
domestica]
 ref|XP_007487706.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Monodelphis 
domestica]
 ref|XP_007487707.1| PREDICTED: methyltransferase-like protein 4 isoform X3 [Monodelphis 
domestica]
 ref|XP_007487708.1| PREDICTED: methyltransferase-like protein 4 isoform X4 [Monodelphis 
domestica]
 ref|XP_007487709.1| PREDICTED: methyltransferase-like protein 4 isoform X5 [Monodelphis 
domestica]
 ref|XP_007487710.1| PREDICTED: methyltransferase-like protein 4 isoform X6 [Monodelphis 
domestica]
 ref|XP_007487711.1| PREDICTED: methyltransferase-like protein 4 isoform X7 [Monodelphis 
domestica]
 ref|XP_007487712.1| PREDICTED: methyltransferase-like protein 4 isoform X8 [Monodelphis 
domestica]
Length=484

 Score =   169 bits (429),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 189/351 (54%), Gaps = 20/351 (6%)
 Frame = +1

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RK+N K++I  N+ E  A + H ++R L+L     L+       ++ +L  E+  D +  
Sbjct  143   RKKN-KRSIVFNQGELDAMEYHTKIRGLILDGTTQLVQEGLKSGLLCSLSEEQEIDNKTT  201

Query  448   eLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKG  624
              +   SC L+   D+    Q PL +   N  E    I+ + S   QDV   F  +  N  
Sbjct  202   PVELGSCGLAELCDMAK--QLPLVD--ENELETVQSIDADISVPEQDV---FSRITQNSS  254

Query  625   SGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQR  804
             +       +  KY++P +S F +SD+  +  L+  +    +++IVIDPPW+N S  + +R
Sbjct  255   NFTKIIILMGQKYLLPPKSSFLLSDLSCMQPLL--NYGEKYDVIVIDPPWQNKSVKRSKR  312

Query  805   YQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKV  984
             Y  L +     +PI +L      LV  WVTNR+K   FV++EL+P W V+ +T ++W+K+
Sbjct  313   YNYLSSWQIKQIPIPKLA-APNCLVITWVTNRQKHLQFVKEELYPYWSVETLTEWHWVKI  371

Query  985   KANGSLISELDLFHHRPYECLLLGYSDGKDNTS----DFSKLNAIPNNQVFMSVPGD-YS  1149
               +G  +  LD  H +PYE L+LG    K  ++    + + L  IP++++ +SVP   +S
Sbjct  372   TRSGEFVFPLDSPHKKPYEGLVLGRVRRKMVSTLREPEMTVL-PIPDHKLIVSVPCTLHS  430

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
              KPP+ E+L +Y+     A C+ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  431   HKPPLTEVLKDYI--VPDAKCLELFARNLQPGWTSWGNEVLKFQHVDYFIT  479



>ref|XP_005449018.1| PREDICTED: methyltransferase-like protein 4-like isoform X1 [Oreochromis 
niloticus]
Length=439

 Score =   168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 186/367 (51%), Gaps = 34/367 (9%)
 Frame = +1

Query  229   STEKLE-TSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             +TE L+ T   S+KRKR   K   LN+ E  +   H++++ ++L+  + L+ + + L  +
Sbjct  65    NTEVLQKTCKPSKKRKR---KHHELNQGEIDSLVFHEKIKSVILEGTKYLVDSAQPLGYL  121

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHL--G  579
                     T+ ++  L  Q C L          A L E+  +    +   +  G+ L  G
Sbjct  122   NG-----QTNVDKEPLPSQECNL----------AALCEMAKDLPLVEDEEQERGAQLLVG  166

Query  580   QDV----IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGF  747
             +D     +  F  +  NK         +  +Y+IP  + F +SD  +I  L+     + F
Sbjct  167   EDGCTSHVDLFSQVTENKADWATVVTLMGEEYVIPPHTAFLLSDFTRIQPLV--HYGTRF  224

Query  748   NIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEK  927
             ++IV+DPPWEN S  + +RY +LP+     LPI  L  +   LV  WVTNR     FV  
Sbjct  225   DLIVMDPPWENKSVKRSRRYGSLPSSQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRD  283

Query  928   ELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNA  1104
             EL+P WGV+ V  ++W+KV   G  +  LD  H +PYE L+LG Y    D +   S+ + 
Sbjct  284   ELYPHWGVEVVAEWFWVKVTTFGQFVFPLDSPHKKPYEVLVLGRYRCSADISESPSETSE  343

Query  1105  IP--NNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLH  1275
             +P  + ++ +SVP   +S+KP + E+L  Y+       C+ELF+R L  GWTSWGNE L 
Sbjct  344   VPVEDQRLIVSVPSALHSQKPSLSEVLKPYIGA--EDKCLELFARSLQPGWTSWGNEVLK  401

Query  1276  FQASKYF  1296
             FQ   YF
Sbjct  402   FQNVSYF  408



>ref|XP_005337179.1| PREDICTED: methyltransferase-like protein 4 [Ictidomys tridecemlineatus]
Length=472

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 113/364 (31%), Positives = 184/364 (51%), Gaps = 27/364 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++ +S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISSSIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLKLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQD  585
                +    E   L   +C LS +   +     + E+    L  +E D  +        QD
Sbjct  179   FENQDKCNEPITLPLDTCNLSGLCEMAKHLPSMNEMELQTLQLREDDMTVTE------QD  232

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V N  S       +  KY++P +  F +SD+  I  L+  +    F++IVID
Sbjct  233   L---FSRVVENNSSFTKMITLMGQKYLLPPKCSFLLSDISCIQPLL--NCRKTFDVIVID  287

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  RY  L       +PI +L      LV  WVTNR+K   F+++EL+P+W
Sbjct  288   PPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHVRFIKEELYPSW  346

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDF----SKLNAIPN  1113
              V+ +  ++W+K+ ++G  +  LD  H +PYE L+LG   G+  T       +K+  IP+
Sbjct  347   SVEIIAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRI-GEQTTLPLRNTDTKVLPIPD  405

Query  1114  NQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASK  1290
             +++ +SVP   +S KPP+ E+L +Y+       C+E+F+R L  GWTSWGNE L FQ   
Sbjct  406   HKLIVSVPCILHSHKPPLAEVLKDYIK--PDGKCLEMFARNLQPGWTSWGNEVLKFQHVD  463

Query  1291  YFVS  1302
             YFV+
Sbjct  464   YFVA  467



>ref|XP_007089564.1| PREDICTED: methyltransferase-like protein 4 [Panthera tigris 
altaica]
Length=480

 Score =   169 bits (427),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 113/347 (33%), Positives = 175/347 (50%), Gaps = 15/347 (4%)
 Frame = +1

Query  274   RNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerreL  453
             +  K+ +  N+ E  A + H ++R L+L     L+        +  L  +     E   L
Sbjct  140   KKRKRCVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPLSEKWNKCSEPITL  199

Query  454   SQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGD  633
                +C LS +   +     L E+ L   +     E + S   QD+   F  +V N  S  
Sbjct  200   PLDTCNLSELCAMAKHLPSLNEMEL---QALQLTEEDMSVTEQDL---FSRIVENNSSFT  253

Query  634   AEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQT  813
                  +  KY++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  RY  
Sbjct  254   KIITLMGQKYLVPPKSSFLLSDISCMHLLL--NCRKTYDVIVIDPPWQNKSVKRSNRYSY  311

Query  814   LPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKAN  993
             L       L I +L      LV  WVTNR+K   FV++EL+P+W V+ V  ++W+K+  +
Sbjct  312   LSPLQIKELLIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVEVVAEWHWVKITNS  370

Query  994   GSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVPGD-YSRKPP  1161
             G  +  LD  H +PYE L+LG    K      S   K+  IP++++ +SVP   +S KPP
Sbjct  371   GEFVFPLDSPHKKPYEGLVLGRVREKTAVPLRSADVKVLPIPDHKLIVSVPCTLHSHKPP  430

Query  1162  IGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             + E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  431   LAEVLKDYVK--PDGECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  475



>ref|XP_004546965.1| PREDICTED: methyltransferase-like protein 4-like [Maylandia zebra]
Length=405

 Score =   167 bits (422),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 114/357 (32%), Positives = 180/357 (50%), Gaps = 35/357 (10%)
 Frame = +1

Query  256   ESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectd  435
             + RKRK +E     LN+ E  +   H++++ ++L+  + L+ + + L  +        T+
Sbjct  43    QKRKRKHHE-----LNQGEIDSLVFHEKIKSVILEGTKYLVDSAQPLGYLNG-----QTN  92

Query  436   eerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHL--GQDV----IPA  597
              ++  L  Q C L          A L E+  +    +   +  G+ L  G+D     +  
Sbjct  93    VDKEPLPSQECNL----------AALCEMAKDLPLVEDEEQERGAQLLVGEDGCTSHVDL  142

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +  NK         +  +Y+IP  + F +SD  +I  L+     + F++IV+DPPWE
Sbjct  143   FSQVTENKADWATVVTVMGEEYVIPPHTAFLLSDFTRIQPLV--HYGTRFDLIVMDPPWE  200

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  + +RY +LP+     LPI  L  +   LV  WVTNR     FV  EL+P WGV+ 
Sbjct  201   NKSVKRSRRYGSLPSSQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHWGVEV  259

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NNQVFM  1128
             V  ++W+KV   G  +  LD  H +PYE  +LG Y    D +   S+ + +P  + ++ +
Sbjct  260   VAEWFWVKVTTFGQFVFPLDSPHKKPYEVFVLGRYRCSADISESPSETSEVPVEDQRLIV  319

Query  1129  SVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  320   SVPSALHSQKPSLSEVLKPYIGAD--AKCLELFARSLQPGWTSWGNEVLKFQHVSYF  374



>ref|XP_010636988.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Fukomys 
damarensis]
Length=508

 Score =   169 bits (427),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 175/352 (50%), Gaps = 23/352 (7%)
 Frame = +1

Query  271   KRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerre  450
             ++  KK +  N+ E  A + H ++R  +L     L+        +  L  ++    E   
Sbjct  167   RKKRKKCVVFNQGELDAMEYHTKIREQILDGSLRLIQEGLKSGFLYQLFEKQDQRSEPTS  226

Query  451   LSQQSCEL-SFVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQDVIPAFDNLVVN  618
             L   +C L    +L    QA L E+    L  +E D  +        QD++     +V N
Sbjct  227   LPPDACSLPGLCELAKRSQA-LGEVELPTLRLREEDLSVAE------QDLL---SRVVEN  276

Query  619   KGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQK  798
               S       +  KY++P +S F +SD+  +  L+  +    F+ IVIDPPW+N S  + 
Sbjct  277   DSSFSKMITLMGQKYLLPPKSSFLLSDISCMQPLL--NCRKTFDAIVIDPPWQNKSVKRS  334

Query  799   QRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWL  978
              RY  L       +PI QL      LV  WVTNR+K   FV+ EL+P+W V  +  ++W+
Sbjct  335   NRYSYLSPLQIQQVPIPQLA-APDCLVVTWVTNRQKHLRFVKDELYPSWSVAALAEWHWV  393

Query  979   KVKANGSLISELDLFHHRPYECLLLGYSDGKDN---TSDFSKLNAIPNNQVFMSVP-GDY  1146
             K+   G  +  LD  H +PYE L+LG    K+     S  +++  IP++++ +SVP   +
Sbjct  394   KITKTGEFVFPLDSPHKKPYEGLILGRVQEKNTLPLRSTDAEVPPIPDHKLIVSVPCAVH  453

Query  1147  SRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  454   SHKPPLAEVLKDYIK--PGGECLELFARNLQPGWTSWGNEVLKFQHMDYFVA  503



>ref|XP_006795091.1| PREDICTED: methyltransferase-like protein 4-like [Neolamprologus 
brichardi]
Length=439

 Score =   167 bits (423),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 183/361 (51%), Gaps = 22/361 (6%)
 Frame = +1

Query  229   STEKLE-TSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             +TE L+ T   S+KRKR   K   LN+ E  +   H++++ ++L+  + L+ + + L  +
Sbjct  65    NTEVLQKTCKPSKKRKR---KHHELNQGEIDSLVFHKKIKSVILEGTKYLVDSAQPLGYL  121

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQD  585
                   +   ++    SQ+S   +  ++      PL E     +     +  +G     D
Sbjct  122   NG----QTNVDKEPLPSQESKLAALCEMAK--DLPLVEDEEQERGAQLLVGEDGCTSHVD  175

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +  NK         +  +Y+IP  + F +SD  +I  L+     + F++IV+D
Sbjct  176   L---FSQVTENKADWATVVTLMGEEYVIPPHTAFLLSDFTRIQPLV--HYGTRFDLIVMD  230

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN S  +  RY +LP+     LPI  L  +   LV  WVTNR     FV  EL+P W
Sbjct  231   PPWENKSVKRSHRYGSLPSSQLKRLPIPLLA-SPNCLVVTWVTNRPSHLRFVRDELYPHW  289

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAIP--NN  1116
             GV+ V  ++W+KV   G  +  LD  H +PYE L+LG Y    D +   S+ + +P  + 
Sbjct  290   GVEVVAEWFWVKVTTFGQFVFPLDSPHKKPYEVLVLGRYRCSADISESPSETSEVPVEDQ  349

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S+KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ   Y
Sbjct  350   RLIVSVPSALHSQKPSLSEVLKPYIGA--EAKCLELFARSLQPGWTSWGNEVLKFQHVSY  407

Query  1294  F  1296
             F
Sbjct  408   F  408



>ref|XP_007064951.1| PREDICTED: methyltransferase-like protein 4 [Chelonia mydas]
Length=487

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 184/361 (51%), Gaps = 40/361 (11%)
 Frame = +1

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RK++++K    N+ E  A + H ++R LLL+    L+   E LK                
Sbjct  138   RKKHKRKISVFNQGELDALEYHTKIRGLLLEGTRCLI--EEGLK-----------SGFLH  184

Query  448   eLSQQSCELSFVDLGSVW--QAPLYEIVLNY---QEGD---AHIENEGSHLGQDVIPAFD  603
              +S +   +  V  G V    A L E+  ++    E D   A I +E     +  IP  D
Sbjct  185   PISAKQSSIKNVVTGHVGCGMAELCEMAKDFPSVHENDHRSAQIIDE-----ETSIPEQD  239

Query  604   NLVVNKGSGDAEAEFLN---HKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              L     +    A+ +N    KY++P +S F +SD+  +  L+  +  + +++IVIDPPW
Sbjct  240   LLSCVTENDTDYAKIINLMGQKYLVPPKSSFLLSDISCMQPLM--NYKNKYDVIVIDPPW  297

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L +     +PI+ L      LV  WVTNR+K   FV  EL+P W VK
Sbjct  298   QNKSVKRSNRYNHLSSWQIKQIPIQSLA-APNCLVVTWVTNRQKHLRFVRDELYPHWSVK  356

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDN----TSDFSKLNAIPNNQV  1122
              +  ++W+K+  +G  +  LD  H +PYE L+LG   G  +     SD   L  IP++++
Sbjct  357   TLAEWHWVKITRSGEFVFPLDSSHKKPYEVLVLGRVQGITDFPLRKSDVEVL-PIPDHKL  415

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L EY+     A C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  416   IVSVPCTLHSHKPPLTEILTEYIK--PDAECLELFARCLQPGWTSWGNEVLKFQHIDYFI  473

Query  1300  S  1302
             +
Sbjct  474   A  474



>ref|XP_006030171.1| PREDICTED: methyltransferase-like protein 4-like, partial [Alligator 
sinensis]
Length=399

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 117/383 (31%), Positives = 185/383 (48%), Gaps = 34/383 (9%)
 Frame = +1

Query  205   AYYSRFFDSTEKLETSTESRK---------RKRNEKKTISLNEREKVAEQRHQEVRPLLL  357
             A ++   DST   E    +R          RK  ++K   LN+ E  A + H ++R L+ 
Sbjct  29    AGHTELKDSTNGAEQEGGARSSDADSVANLRKTRKRKHSGLNQGELDALEYHTKIRGLIW  88

Query  358   KAHEALLGATELLKVVRNLrceectdeerreLSQQSCELSFV-DLGSVWQAPLYEIVLNY  534
             +   +++        ++++             +QQSC  + V +      A L E+   +
Sbjct  89    EGSTSIVQEGFKSGFLQSIS------------AQQSCSKNVVMEHIGCGLAELCEMAKQF  136

Query  535   QEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLN---HKYIIPKESCFYMSDVR  705
                + +       + +  IP  D L     +  + A+ LN    KY++P +S F +SD+ 
Sbjct  137   PSVNENAHQIVQMIAEVTIPEQDLLSCVTENMTSYAKILNLMGQKYLVPPKSSFLLSDIS  196

Query  706   KIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVAL  885
              +  L+  D    ++ IVIDPPW N S  +  RY  L       +PI  L      LV  
Sbjct  197   CMQPLL--DYKKKYDAIVIDPPWANKSVKRSNRYSYLSPWQIKQIPISALA-APNCLVVT  253

Query  886   WVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSD  1065
             WVTNR+K   FV+ EL+P W VK +  ++W+K+  +G  I  LD  H +PYE L+LG   
Sbjct  254   WVTNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRSGEFIFPLDSSHKKPYEVLVLGRVQ  313

Query  1066  GKDNTS---DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRE  1233
             G  + S      ++  IP++++ +SVP   +S KPP+ E+L E++       C+ELF+R 
Sbjct  314   GNVDLSLRKSEVEVPPIPDHKLIVSVPCTLHSHKPPLAEVLTEFIK--PDMECLELFARS  371

Query  1234  LSAGWTSWGNEPLHFQASKYFVS  1302
             L  GWTSWGNE L FQ   YF +
Sbjct  372   LQPGWTSWGNEVLKFQHIDYFTT  394



>ref|XP_006146543.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Tupaia 
chinensis]
 ref|XP_006146544.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Tupaia 
chinensis]
Length=471

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/362 (34%), Positives = 190/362 (52%), Gaps = 24/362 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             E++ TS   +KRKR     +  N+ E  A + H ++R L+L     L+   E LK     
Sbjct  123   EEISTSIVGKKRKR----CVDFNQGELDAMEYHAKIRELILDGSIQLI--QEGLKSGFLY  176

Query  415   rceectdeerreLSQ-QSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVI  591
              C E  D+++   S   SC LS  +L  + +  L +  +  Q     +E + S   QD+ 
Sbjct  177   PCFEKQDQKKPIASPLDSCSLS--ELCEMAKHLLSQNEIGLQTLKL-MEGDISFTEQDL-  232

Query  592   PAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPP  771
               F  +V N          +  KY++P +S F +SD+  +  L+  +    F++IVIDPP
Sbjct  233   --FSRIVENNSGFTKMITLMGQKYLLPPKSTFLLSDISCMQPLL--NCRKIFDVIVIDPP  288

Query  772   WENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGV  951
             W+N S  +  RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V
Sbjct  289   WQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFVKEELYPSWSV  347

Query  952   KYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNNQ  1119
             + V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       +D  K+  IP+++
Sbjct  348   QTVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRFQEKTALPLRNADV-KVLPIPDHK  406

Query  1120  VFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
             + +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  407   LIVSVPCILHSHKPPLAEVLKDYIK--PDGECLELFARNLQPGWTSWGNEVLKFQHVDYF  464

Query  1297  VS  1302
             ++
Sbjct  465   IA  466



>gb|EMP31059.1| Methyltransferase-like protein 4 [Chelonia mydas]
Length=529

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 184/361 (51%), Gaps = 40/361 (11%)
 Frame = +1

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RK++++K    N+ E  A + H ++R LLL+    L+   E LK                
Sbjct  138   RKKHKRKISVFNQGELDALEYHTKIRGLLLEGTRCLI--EEGLK-----------SGFLH  184

Query  448   eLSQQSCELSFVDLGSVW--QAPLYEIVLNY---QEGD---AHIENEGSHLGQDVIPAFD  603
              +S +   +  V  G V    A L E+  ++    E D   A I +E     +  IP  D
Sbjct  185   PISAKQSSIKNVVTGHVGCGMAELCEMAKDFPSVHENDHRSAQIIDE-----ETSIPEQD  239

Query  604   NLVVNKGSGDAEAEFLN---HKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              L     +    A+ +N    KY++P +S F +SD+  +  L+  +  + +++IVIDPPW
Sbjct  240   LLSCVTENDTDYAKIINLMGQKYLVPPKSSFLLSDISCMQPLM--NYKNKYDVIVIDPPW  297

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L +     +PI+ L      LV  WVTNR+K   FV  EL+P W VK
Sbjct  298   QNKSVKRSNRYNHLSSWQIKQIPIQSLA-APNCLVVTWVTNRQKHLRFVRDELYPHWSVK  356

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDN----TSDFSKLNAIPNNQV  1122
              +  ++W+K+  +G  +  LD  H +PYE L+LG   G  +     SD   L  IP++++
Sbjct  357   TLAEWHWVKITRSGEFVFPLDSSHKKPYEVLVLGRVQGITDFPLRKSDVEVL-PIPDHKL  415

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L EY+     A C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  416   IVSVPCTLHSHKPPLTEILTEYIKPD--AECLELFARCLQPGWTSWGNEVLKFQHIDYFI  473

Query  1300  S  1302
             +
Sbjct  474   A  474



>ref|XP_009506032.1| PREDICTED: methyltransferase-like protein 4 [Phalacrocorax carbo]
Length=321

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 135/258 (52%), Gaps = 17/258 (7%)
 Frame = +1

Query  559   NEGSHLGQDV------IPAFDNL-VVNKGSGDAE--AEFLNHKYIIPKESCFYMSDVRKI  711
             NE  H    V      IP  D L  V + S D       +  KY++P +S F +SD+  +
Sbjct  62    NESDHQAIHVLDDETSIPEHDLLSCVTENSSDCAKIVVLMGQKYLVPPKSSFLLSDISCL  121

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
             H L+       +++IVIDPPW+N S  +  RY  L +     +P+  L      LV  WV
Sbjct  122   HPLL--HYKKKYDVIVIDPPWDNKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWV  178

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG--YSD  1065
             TNR+K   FV+ EL+P W VK +  ++W+K+   G  I  LD  H +PYE L+LG    D
Sbjct  179   TNRQKHLRFVKDELYPHWSVKALAEWHWVKITRAGEFILPLDSLHKKPYEVLVLGRVQED  238

Query  1066  GKDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+       +  IP +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  239   VKETLRKSEDVLPIPEHKLIVSIPCSLHSHKPPLTAVLAEFIKPD--VECLELFARNLQP  296

Query  1243  GWTSWGNEPLHFQASKYF  1296
             GWTSWGNE L FQ   YF
Sbjct  297   GWTSWGNEVLKFQHVDYF  314



>ref|XP_004742852.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Mustela 
putorius furo]
 ref|XP_004742853.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Mustela 
putorius furo]
 ref|XP_004742854.1| PREDICTED: methyltransferase-like protein 4 isoform X3 [Mustela 
putorius furo]
 ref|XP_004790785.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Mustela 
putorius furo]
 ref|XP_004790786.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Mustela 
putorius furo]
 ref|XP_004790787.1| PREDICTED: methyltransferase-like protein 4 isoform X3 [Mustela 
putorius furo]
Length=469

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/351 (32%), Positives = 178/351 (51%), Gaps = 19/351 (5%)
 Frame = +1

Query  262   RKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdee  441
             +KRKR     +  N+ E  A + H ++R L+L     L+        +  L  +     E
Sbjct  131   KKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSELIQEGLKSGFLHPLSEKWDKCSE  186

Query  442   rreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNK  621
                L   +C LS +   +     L E+ L   +    ++ + S   QD+   F  +V N 
Sbjct  187   PITLPLDTCNLSELCAMAKHLPSLNEMELQVLQL---MDEDMSVTEQDL---FSRVVENN  240

Query  622   GSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQ  801
              S       +   Y++P +S F +SD+  +H L+  +    +++IVIDPPW+N S  +  
Sbjct  241   SSITKMITLMGQNYLVPPKSSFLLSDISCMHPLL--NCKKTYDVIVIDPPWQNKSVKRSN  298

Query  802   RYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLK  981
             RY  L       +PI +L      LV  WVTNR+K   FV++EL+P+W V+ V  ++W+K
Sbjct  299   RYSYLSPLQIKQIPIPKLA-APNCLVITWVTNRQKHLRFVKEELYPSWSVEIVAEWHWVK  357

Query  982   VKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNNQVFMSVPGD-YS  1149
             +  +G  +  LD  H +PYE L+LG    K      ++  K+  IP++++ +SVP   +S
Sbjct  358   ITNSGEFVFPLDSPHKKPYEGLILGRVQEKTAVPLRNEDVKVLPIPDHKLIVSVPCTLHS  417

Query  1150  RKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
              KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   YFV+
Sbjct  418   HKPPLAEVLKDYVKPD--GEYLELFARNLQPGWTSWGNEVLKFQHMDYFVA  466



>ref|XP_002193317.1| PREDICTED: methyltransferase-like protein 4 [Taeniopygia guttata]
Length=481

 Score =   167 bits (422),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 138/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFL-NHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E E S   QD++    + V+   S  A+   L   KY++P +S F +SD+  +  L+  
Sbjct  232   LEEETSSADQDLL----SCVMENSSNCAKIIMLMGQKYLVPPKSSFLLSDISCLQPLL--  285

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+ +L      LV  WVTNR+K 
Sbjct  286   NYKKKYDVIVIDPPWENKSVKRSNRYSYLSSWQIKKIPVPELA-APNCLVVTWVTNRQKH  344

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+KV   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  345   LRFVKDELYPHWSVKTLAEWHWVKVTTTGEFVLPLDSLHKKPYEVLILGRVQGDVKEALR  404

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  405   KSEGILPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIK--PDVECLELFARNLQPGWTSWG  462

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  463   NEVLKFQHIDYFT  475



>ref|XP_008173218.1| PREDICTED: methyltransferase-like protein 4 isoform X3 [Chrysemys 
picta bellii]
Length=487

 Score =   167 bits (422),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 179/356 (50%), Gaps = 30/356 (8%)
 Frame = +1

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RK+ ++K    N+ E  A + H ++R L+L+               R L  E        
Sbjct  138   RKKRKRKCSVFNQGELDALEYHTKIRGLILEG-------------TRCLIKEGLRSGFLH  184

Query  448   eLSQQSCELSFVDLGSVW--QAPLYEIVLNYQEGDAHIENEGSHLGQDV-IPAFDNLVVN  618
              +S +   +  V  G V    A L E+  ++   + +       + ++  IP  D L   
Sbjct  185   PISAKQSSVKNVITGHVGCGMAELCEMAKHFPSVNENDHRSAQIIDEETSIPEQDLLSCV  244

Query  619   KGSGDAEAEFLN---HKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSA  789
               +    A+ +N    KY++P +S F +SD+  +  L+  +  + +++IVIDPPW+N S 
Sbjct  245   TENNTDYAKIINLMGQKYLVPPKSSFLLSDISCMQPLL--NYKNKYDVIVIDPPWQNKSV  302

Query  790   HQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSF  969
              +  RY  L +     +PI  L      LV  WVTNR+K   FV+ EL+P W VK +  +
Sbjct  303   KRSNRYSHLSSWQIKQIPIPSLA-APNCLVVTWVTNRQKHLRFVKDELYPYWSVKTLAEW  361

Query  970   YWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDN----TSDFSKLNAIPNNQVFMSVP  1137
             +W+K+  +G  +  LD  H +PYE L+LG   G  N     SD   L  IP++++ +SVP
Sbjct  362   HWVKITRSGEFVFPLDSSHKKPYEVLVLGRVQGSINLPLRKSDVEVL-PIPDHKLIVSVP  420

Query  1138  GD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
                +S KPP+ E+L +Y+     A C+ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  421   CTLHSHKPPLTEILTKYIK--PDAECLELFARCLQPGWTSWGNEVLKFQHIDYFIA  474



>ref|XP_006920111.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Pteropus 
alecto]
 ref|XP_006920112.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Pteropus 
alecto]
 gb|ELK05720.1| Methyltransferase-like protein 4 [Pteropus alecto]
Length=472

 Score =   166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 186/366 (51%), Gaps = 25/366 (7%)
 Frame = +1

Query  226   DSTEKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVV  405
             D  +++  ST  +KRKR     +  N+ E  A + H ++R L+L     L+        +
Sbjct  120   DVKKEISISTIGKKRKR----CVVFNQGELDAMEYHTKIRGLILDGSSQLIQEGFKSGFL  175

Query  406   RNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLG  579
               L  +     +   L   +C LS      + +   +   LN  E  A   IE+  S   
Sbjct  176   HPLSEKWDKSSDPIPLPLDTCNLS-----KLCEMAKHLPSLNEMELPALQLIEDNVSITE  230

Query  580   QDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIV  759
             Q++   F  +V N  S       +  KY++P +S F +SD+  +H L+  +    +++IV
Sbjct  231   QNL---FSQVVENNSSFTKMITLMGQKYLLPPKSSFLLSDISCMHPLL--NYKKTYDVIV  285

Query  760   IDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFP  939
             IDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K   FV++EL+P
Sbjct  286   IDPPWQNKSVKRSNRYSYLSPLQIKQIPVPKLA-APNCLVITWVTNRQKHLRFVKEELYP  344

Query  940   AWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAI  1107
             +W V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    +       +D  K+ +I
Sbjct  345   SWSVEIVAEWHWVKITKSGEFVFPLDSPHKKPYEVLILGRIREETALPLRNADV-KVPSI  403

Query  1108  PNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
             P++++ +SVP   +S KPP+ E+L +++        +ELF+R L  GWTSWGNE L FQ 
Sbjct  404   PDHKLIVSVPCTLHSHKPPLAEILKDFIKPD--GEYLELFARNLLPGWTSWGNEVLKFQH  461

Query  1285  SKYFVS  1302
               YF++
Sbjct  462   VDYFIA  467



>ref|XP_006891448.1| PREDICTED: methyltransferase-like protein 4 [Elephantulus edwardii]
Length=472

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 185/363 (51%), Gaps = 25/363 (7%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             K E ST    +KR  K+ +  N+ E  A + H ++R L+      L+        +  L 
Sbjct  122   KKENSTSVIGKKR--KRCMVFNQGELDAMEYHAKIRMLISNGSSQLIQEGLKSGFLCPLS  179

Query  418   ceectdeerreLSQQSCELS-FVDLGSVWQAPLYEI---VLNYQEGDAHIENEGSHLGQD  585
              +     +   L   +C LS   ++   W + L+E    +L   E DA +        QD
Sbjct  180   EKPDKCSKPITLPCDTCNLSELCEMTKHWSS-LHEKEPEILQLMEDDAFVTE------QD  232

Query  586   VIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
             +   F  +V NK         +  KY++P +S F +SD+  +  L+  +    +++IVID
Sbjct  233   L---FSRVVENKSPFTKVITLMKQKYLLPPKSRFLLSDISCMQPLL--NYGKKYDVIVID  287

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPW+N S  +  +Y  L       +PI ++   +  LV  WVTNR+K   FV++EL+P+W
Sbjct  288   PPWQNKSVKRSNKYSYLSPMQIKQIPIPKIA-ASNCLVITWVTNRQKHLRFVKEELYPSW  346

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNT---SDFSKLNAIPNN  1116
              V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K      +D  ++  IP++
Sbjct  347   SVEIVAEWHWVKITSSGEYVFPLDSLHKKPYEGLILGRVRVKTALPLRNDNEEVLPIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCALHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_007433048.1| PREDICTED: methyltransferase-like protein 4 [Python bivittatus]
Length=469

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 125/224 (56%), Gaps = 10/224 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY+ P +S F +SD+  +  L+  +    ++IIVIDPPWEN S  +  RY  L + 
Sbjct  246   LMGQKYLFPPKSAFLLSDISCMQPLL--NYKKKYDIIVIDPPWENKSVKRSSRYGFLSHW  303

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      LV  WVTNR+K   FV+ EL+P W +  V  ++W+K+  +G  +
Sbjct  304   QIKEIPVPALA-APDCLVVTWVTNRQKHLRFVKNELYPHWSIHDVVEWFWVKITKSGEFV  362

Query  1006  SELDLFHHRPYECLLLGYSDGKDNT----SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGE  1170
               LD  H +PYE L+LG   G  +     S+  K  AIP+ ++ +SVP   +S KPP+ E
Sbjct  363   IPLDSLHKKPYEILVLGRVQGNTDVPLRLSEDEKFPAIPDQKLIVSVPCTLHSHKPPLSE  422

Query  1171  LLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +L EY        C+ELF+R L  GWTSWGNE L FQ   YF +
Sbjct  423   ILKEYTK--PDVECLELFARNLQPGWTSWGNEVLKFQDLDYFTA  464



>gb|ELW67706.1| Methyltransferase-like protein 4 [Tupaia chinensis]
Length=450

 Score =   166 bits (419),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 14/255 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +E + S   QD+   F  +V N          +  KY++P +S F +SD+  +  L+  +
Sbjct  200   MEGDISFTEQDL---FSRIVENNSGFTKMITLMGQKYLLPPKSTFLLSDISCMQPLL--N  254

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 F++IVIDPPW+N S  +  RY  L       +PI +L      LV  WVTNR+K  
Sbjct  255   CRKIFDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHL  313

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NT  1080
              FV++EL+P+W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       
Sbjct  314   RFVKEELYPSWSVQTVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRFQEKTALPLRN  373

Query  1081  SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSW  1257
             +D  K+  IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSW
Sbjct  374   ADV-KVLPIPDHKLIVSVPCILHSHKPPLAEVLKDYIK--PDGECLELFARNLQPGWTSW  430

Query  1258  GNEPLHFQASKYFVS  1302
             GNE L FQ   YF++
Sbjct  431   GNEVLKFQHVDYFIA  445



>ref|XP_004081180.1| PREDICTED: methyltransferase-like protein 4-like [Oryzias latipes]
Length=441

 Score =   165 bits (418),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 134/240 (56%), Gaps = 9/240 (4%)
 Frame = +1

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
             I  F  +  +     A    +  +Y+IP  + F +SD  ++  LI  D +  F++IV+DP
Sbjct  174   IDLFTQVTEHNSDCGAVVPLMGQEYVIPPHTAFLLSDFTRMKPLI--DYEKKFDLIVMDP  231

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PWEN S  + +RY +LP+     LPI Q T +   LV  WVTNR     FV  EL+P W 
Sbjct  232   PWENKSVKRSRRYGSLPSSQLKRLPIPQFT-SPNCLVVTWVTNRPSHLRFVCDELYPYWN  290

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG--YSDGKDNTSDFSKLNAIPNNQV  1122
             V+ V  ++W+KV   G  +  LD  H +PYE L+LG  +     +TS+  ++  + ++++
Sbjct  291   VQVVAKWFWVKVTTLGQFVFPLDSQHKKPYETLVLGRYHPSAPPSTSEMKEV-LLEDSRL  349

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KP + E+L  Y+     A C+ELF+R L  GWTSWGNE L FQ S YF 
Sbjct  350   IVSVPSALHSHKPSLSEVLKPYIR--PGAECLELFARSLQPGWTSWGNEVLKFQHSSYFT  407



>ref|XP_008567383.1| PREDICTED: methyltransferase-like protein 4 [Galeopterus variegatus]
Length=469

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 144/255 (56%), Gaps = 14/255 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +E++ S   QD+   F  +V N          +  KY++P +S F +SD+  +  L+  +
Sbjct  219   MEDDMSVTEQDL---FSRVVENNSRFTKMITLMGQKYLLPPKSSFLLSDISCMQPLL--N  273

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 F++IVIDPPW+N S  +  RY  L       +P+ +L      LV  WVTNR+K  
Sbjct  274   CGKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPVPELA-APNCLVVTWVTNRQKHL  332

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NT  1080
              FV++EL+P+W V+ V  ++W+K+ ++G  +  LD  H +PYE L+LG    K       
Sbjct  333   HFVKEELYPSWSVEIVAEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVQDKTALPLRN  392

Query  1081  SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSW  1257
             +D  K+  IP++++ +SVP   +S KPP+ E+L +Y+       C+ELF+R L  GWTSW
Sbjct  393   ADV-KVLPIPDHKLIVSVPCILHSHKPPLAEVLKDYIK--PDGECLELFARNLQPGWTSW  449

Query  1258  GNEPLHFQASKYFVS  1302
             GNE L FQ   YF++
Sbjct  450   GNEVLKFQHVDYFLA  464



>ref|XP_004702945.1| PREDICTED: methyltransferase-like protein 4 [Echinops telfairi]
Length=470

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 114/361 (32%), Positives = 186/361 (52%), Gaps = 23/361 (6%)
 Frame = +1

Query  238   KLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLr  417
             ++ TS   +KRKR     I  N+ E  A   H ++R L+L     L+        +  L 
Sbjct  122   EISTSVIGKKRKR----CIVFNQGELDAMDYHTKIRRLILDGSSQLVQEGLKSGFLYPLS  177

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              ++    E   L   +C+LS +   +   + + E+ L   +    ++++ S   QD+   
Sbjct  178   TKQAKCSEHVNLPLDTCKLSELCEMAKHLSSMNEMKLQTLQL---MDDDMSVNEQDL---  231

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P +S F +SD+  I  L+  +    +++IVIDPPWE
Sbjct  232   FSRIVENNSSFTKVITLMGQKYLLPPKSGFLLSDISCIQPLL--NCRKKYDVIVIDPPWE  289

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +P+ ++      LV  WVTNR+K   FV++EL+P W V+ 
Sbjct  290   NKSVKRSNRYSYLSPLQIKQIPVPKMA-APNCLVITWVTNRQKHLRFVKEELYPCWSVEV  348

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS-----DFSKLNAIPNNQV  1122
             V  ++W+K+  +G  +  LD  H +PYE L+LG    ++NT+        K+  IP++++
Sbjct  349   VAEWHWVKITNSGEFVFPLDSQHKKPYEGLILGRV--QENTALSLRNTDEKVLPIPDHKL  406

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  407   IVSVPCTLHSHKPPLAEVLKDYIKPG--GEYLELFARNLQPGWTSWGNEVLKFQHLNYFI  464

Query  1300  S  1302
             +
Sbjct  465   A  465



>ref|XP_010005148.1| PREDICTED: methyltransferase-like protein 4 [Chaetura pelagica]
Length=481

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 136/252 (54%), Gaps = 11/252 (4%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +++E S   QDV+        N  +       +  KY++P +S F +SD+  +  L+   
Sbjct  232   LDDEASFPEQDVLSCVTE---NSSNWAKIVVLMGQKYLVPPKSSFLLSDISCLQPLLXXK  288

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 +++IVIDPPWEN S  +  RY  L +     +P+ +L      LV +WVTNR+K  
Sbjct  289   KK--YDVIVIDPPWENKSVKRSNRYSYLSSWQIKQIPVPELA-APNCLVVMWVTNRQKHL  345

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTSD  1086
              FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+    
Sbjct  346   RFVKDELYPHWSVKTLAEWHWVKITRGGEFVLPLDSLHKKPYEVLVLGRVQGDVKETLRK  405

Query  1087  FSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGN  1263
                +  +P +++ +S+P   +S KPP+ E+L E +     A C+ELF+R L  GWTSWGN
Sbjct  406   SEDVLPVPEHKLIVSIPCSLHSHKPPLTEVLAEIIK--PDAECLELFARNLQPGWTSWGN  463

Query  1264  EPLHFQASKYFV  1299
             E L FQ   YF 
Sbjct  464   EVLKFQHIDYFT  475



>ref|XP_003968138.1| PREDICTED: methyltransferase-like protein 4-like [Takifugu rubripes]
Length=381

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/325 (33%), Positives = 159/325 (49%), Gaps = 21/325 (6%)
 Frame = +1

Query  337   EVRPLLLKAHEALLGATELLKVVRNLrceectdeerreLSQQSCELS-FVDLGSVWQAPL  513
             ++R ++L   +AL+ A + L  +  L            L  Q C L+   D+    + PL
Sbjct  49    KIRSVILDGTKALVSAAQALGYLNGLTDPTEEP-----LPSQECNLAALCDMAK--ELPL  101

Query  514   YEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYM  693
              E    + +       + SH     +  F  +  N     +    +  +YIIP  S F +
Sbjct  102   AEEQGEHSQPLTKGYGDTSH-----VDLFSLVTENAKDQGSVVSLMGEEYIIPPNSAFLL  156

Query  694   SDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGA  873
             SD  +I  L+  D    F++IV+DPPWEN S  + +RY  LP+     LPI  L      
Sbjct  157   SDFTRIRPLV--DYGRRFDLIVMDPPWENKSVKRSRRYSFLPSTQLKRLPIPLLA-CPNC  213

Query  874   LVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLL  1053
             LV  WVTNR     F+  EL+P WGV+ V  ++W+KV  +G  +  LD  H +PYE L+L
Sbjct  214   LVVTWVTNRSSHLRFICDELYPHWGVQVVAQWFWVKVTTSGQFVFPLDSPHKKPYEVLVL  273

Query  1054  G-YSDGKDNTSDFSKLNA-IPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELF  1224
             G Y    +NT         + + ++ +SVP   +S+KP + ++L  Y+       C+ELF
Sbjct  274   GRYRCSPENTRSLETSEVPVEDQRLIVSVPSALHSQKPSLTDVLKPYVG--SEPTCLELF  331

Query  1225  SRELSAGWTSWGNEPLHFQASKYFV  1299
             +R L  GWTSWGNE L FQ + YF 
Sbjct  332   ARSLLPGWTSWGNEVLKFQHASYFT  356



>ref|XP_010394657.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Corvus 
cornix cornix]
 ref|XP_010394658.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Corvus 
cornix cornix]
 ref|XP_010394660.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Corvus 
cornix cornix]
 ref|XP_010394661.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Corvus 
cornix cornix]
Length=482

 Score =   165 bits (417),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 138/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E+E  H  QD++    + V+   S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  233   LEDETCHPEQDLL----SCVMKNSSNCAKIIVLMGQKYLVPPKSSFLLSDISCLQPLL--  286

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  287   NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  345

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  346   LRFVKDELYPHWSVKTLAEWHWVKITRAGEFVLPLDSLHKKPYEVLVLGRVQGDVKEALR  405

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  406   KSEGVLPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIK--PDVECLELFARNLQPGWTSWG  463

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  464   NEVLKFQHIDYFT  476



>ref|XP_002587280.1| hypothetical protein BRAFLDRAFT_237642 [Branchiostoma floridae]
 gb|EEN43291.1| hypothetical protein BRAFLDRAFT_237642 [Branchiostoma floridae]
Length=244

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 138/243 (57%), Gaps = 12/243 (5%)
 Frame = +1

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F+ LV+   +       L  +Y++P  S F MSD+ ++  L+       +++IV+DPPWE
Sbjct  4     FNRLVLIDSNQPIIKCLLGSRYLLPPRSSFLMSDITRMEPLL--QGGLKYHLIVMDPPWE  61

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  + ++Y++L       LPI  L    G LV  WVTNR++   FV + L+P W V+ 
Sbjct  62    NKSVKRGRKYESLSPWQLFQLPIPSLA-APGCLVVTWVTNRQQHMRFVRERLYPHWSVEP  120

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLG----YSDGKDNTSDFSKLNAIPNNQVF  1125
             V  ++WLKV   G  +  +D  H +PYE ++LG     SDG   TS  S L+ +P ++V 
Sbjct  121   VAEWHWLKVTRTGEPVFPMDSPHKKPYETIILGRFQDQSDGHTETSS-SPLSDVPRHKVI  179

Query  1126  MSVP-GDYSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
              SVP   +SRKP + E+L +Y+  +    C+ELF+R L   WTSWGNE + FQ   +F +
Sbjct  180   CSVPCAIHSRKPTLDEVLQKYLPPS--PICLELFARCLQPRWTSWGNEVIKFQHLDFF-N  236

Query  1303  KNR  1311
             +NR
Sbjct  237   ENR  239



>gb|KFU96576.1| Methyltransferase-like 4, partial [Chaetura pelagica]
Length=461

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 135/251 (54%), Gaps = 13/251 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +++E S   QDV+        N  +       +  KY++P +S F +SD+  +  L    
Sbjct  215   LDDEASFPEQDVLSCVTE---NSSNWAKIVVLMGQKYLVPPKSSFLLSDISCLQPL----  267

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 +++IVIDPPWEN S  +  RY  L +     +P+ +L      LV +WVTNR+K  
Sbjct  268   HKKKYDVIVIDPPWENKSVKRSNRYSYLSSWQIKQIPVPELA-APNCLVVMWVTNRQKHL  326

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTSD  1086
              FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+    
Sbjct  327   RFVKDELYPHWSVKTLAEWHWVKITRGGEFVLPLDSLHKKPYEVLVLGRVQGDVKETLRK  386

Query  1087  FSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGN  1263
                +  +P +++ +S+P   +S KPP+ E+L E +     A C+ELF+R L  GWTSWGN
Sbjct  387   SEDVLPVPEHKLIVSIPCSLHSHKPPLTEVLAEIIK--PDAECLELFARNLQPGWTSWGN  444

Query  1264  EPLHFQASKYF  1296
             E L FQ   YF
Sbjct  445   EVLKFQHIDYF  455



>ref|XP_005042001.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Ficedula 
albicollis]
Length=480

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 125/221 (57%), Gaps = 8/221 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY++P +S F +SD+  +  L+  +    + +IVIDPPWEN S  +  RY  LP+ 
Sbjct  259   LMGQKYLVPPKSSFLLSDISYLQPLV--NYKKKYGVIVIDPPWENKSVKRSNRYSHLPSW  316

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      LV +WVTNR+K   FV+ EL+P W VK +  ++W+K+ + G  +
Sbjct  317   QIKQIPLPALA-APDCLVVMWVTNRQKHLRFVKDELYPHWSVKTLAEWHWVKITSAGEFV  375

Query  1006  SELDLFHHRPYECLLLGYSDG--KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELL  1176
               LD  H +PYE L+LG   G  K+       +  IP +++ +S+P   +S KPP+  +L
Sbjct  376   LPLDSLHKKPYEVLVLGRVQGDVKEALRKSEGVLPIPEHKLIVSIPCSLHSHKPPLAAVL  435

Query  1177  LEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              E++       C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  436   AEFIK--PDVECLELFARNLQPGWTSWGNEVLKFQHIDYFT  474



>ref|XP_009982376.1| PREDICTED: methyltransferase-like protein 4 [Tauraco erythrolophus]
Length=482

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 140/259 (54%), Gaps = 13/259 (5%)
 Frame = +1

Query  547   AHIENEGSHL--GQDVIPAFDNL--VVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKI  711
             + ++++  H+  G+  IP  D L  V    S  A+    +  KY++P  S F +SD+  +
Sbjct  223   SEVDHQAIHVLDGETSIPEQDLLSCVTENSSNRAKIVVLMGQKYLVPPRSSFLLSDISCL  282

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
               L   +    +++IVIDPPWEN S  +  RY  LP+     +P+  L      LV  WV
Sbjct  283   QPL--PNYKKKYDVIVIDPPWENKSVKRSNRYSYLPSWQIKQIPVPALA-APHCLVVTWV  339

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG-  1068
             TNR+K   FV+ EL+P W VK +  ++W+KV   G  +  LD  H +PYE L+LG   G 
Sbjct  340   TNRQKHLRFVKDELYPHWSVKTLAEWHWVKVTRAGEFVLPLDSLHKKPYEVLVLGRVQGG  399

Query  1069  -KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+      +L  +P +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  400   EKEALRKSEELLPVPEHKLIVSIPCSLHSHKPPLTAVLAEFIK--PDVECLELFARNLQP  457

Query  1243  GWTSWGNEPLHFQASKYFV  1299
             GWTSWGNE L FQ   YF 
Sbjct  458   GWTSWGNEVLKFQHIDYFT  476



>gb|KFO61558.1| Methyltransferase-like 4, partial [Corvus brachyrhynchos]
Length=462

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 138/252 (55%), Gaps = 13/252 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E+E  H  QD++    + V+   S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  214   LEDEICHPEQDLL----SCVMKNSSNCAKIIVLMGQKYLVPPKSSFLLSDISCLQPLL--  267

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  268   NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  326

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  327   LRFVKDELYPHWSVKTLAEWHWVKITRAGEFVLPLDSLHKKPYEVLVLGRVQGDVKEALR  386

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  387   KSEGVLPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIKPD--VECLELFARNLQPGWTSWG  444

Query  1261  NEPLHFQASKYF  1296
             NE L FQ   YF
Sbjct  445   NEVLKFQHIDYF  456



>ref|XP_001636434.1| predicted protein [Nematostella vectensis]
 gb|EDO44371.1| predicted protein [Nematostella vectensis]
Length=230

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 123/215 (57%), Gaps = 6/215 (3%)
 Frame = +1

Query  661   YIIPKESCFYMSDVRKIHNLIPADSDS--GFNIIVIDPPWENSSAHQKQRYQTLPNRFFL  834
             YI+P  S F  SD  K+  +I         F++IVIDPPW N SA +K+ Y  +      
Sbjct  19    YILPSMSSFLNSDATKLQPVIEHGKVKIVPFDLIVIDPPWYNKSAKRKRMYSFMSLWQIK  78

Query  835   SLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISEL  1014
             +LP+ +L    G L+A+WVTN+ K   F   EL P+WGV  +  ++W+KV   G  +  +
Sbjct  79    ALPVPELI-APGGLLAVWVTNKAKYIRFTRSELLPSWGVDVIAEWHWIKVTKTGEYVVGM  137

Query  1015  DLFHHRPYECLLLGYSDGKDNTSDFSKLNAIPNNQVFMSVPG-DYSRKPPIGELLLEYMS  1191
             +  H +PYE L++G        S    +  +P +QV  SVP   +SRKPP+G++  +++ 
Sbjct  138   ESAHKKPYETLIIGRLPILPGASIDGGVKQVPEHQVICSVPCLKHSRKPPLGDVFKDFLP  197

Query  1192  GTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
               +H HC+E+F+R L+ GWTSWGN+ L FQ   +F
Sbjct  198   --RHPHCLEMFARNLTPGWTSWGNQVLKFQHIGHF  230



>ref|XP_008635040.1| PREDICTED: methyltransferase-like protein 4 [Corvus brachyrhynchos]
Length=482

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 138/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E+E  H  QD++    + V+   S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  233   LEDEICHPEQDLL----SCVMKNSSNCAKIIVLMGQKYLVPPKSSFLLSDISCLQPLL--  286

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  287   NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  345

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  346   LRFVKDELYPHWSVKTLAEWHWVKITRAGEFVLPLDSLHKKPYEVLVLGRVQGDVKEALR  405

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  406   KSEGVLPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIKPD--VECLELFARNLQPGWTSWG  463

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  464   NEVLKFQHIDYFT  476



>gb|AAH56270.2| METTL4 protein, partial [Homo sapiens]
Length=353

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  4     KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  59

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  60    FEKQDKGSKPITLPLDACSLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  114

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  115   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  169

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  170   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  228

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  229   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  287

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  288   KLIVSVPCTLHSHKPPLAEVLKDYIK--PDGEYLELFARNLQPGWTSWGNEVLKFQHVDY  345

Query  1294  FVS  1302
             F++
Sbjct  346   FIA  348



>ref|XP_005258190.1| PREDICTED: methyltransferase-like protein 4 isoform X3 [Homo 
sapiens]
Length=325

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/255 (36%), Positives = 142/255 (56%), Gaps = 14/255 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +E + S   QD+   F  +V N  S       +  KY++P +S F +SD+  +  L+  +
Sbjct  75    VEEDTSVTEQDL---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--N  129

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 F++IVIDPPW+N S  +  RY  L       +PI +L      L+  WVTNR+K  
Sbjct  130   YRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLA-APNCLLVTWVTNRQKHL  188

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NT  1080
              F+++EL+P+W V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       
Sbjct  189   RFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRN  248

Query  1081  SDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSW  1257
             +D + L  IP++++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSW
Sbjct  249   ADVNVL-PIPDHKLIVSVPCTLHSHKPPLAEVLKDYIK--PDGEYLELFARNLQPGWTSW  305

Query  1258  GNEPLHFQASKYFVS  1302
             GNE L FQ   YF++
Sbjct  306   GNEVLKFQHVDYFIA  320



>gb|KFV52568.1| Methyltransferase-like 4, partial [Tyto alba]
Length=480

 Score =   164 bits (414),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 138/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +++E S   QDV+    + V    S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  232   LDDETSIPDQDVL----SCVTENSSNSAKIVVLMGQKYLVPPKSSFLLSDISCLQPLL--  285

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  286   NYKKNYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  344

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  345   LRFVKDELYPHWSVKTLAEWHWVKITRAGEFVLPLDSSHKKPYEVLVLGRVQGEVKETLR  404

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +++ +SVP   +S KPP+ E+L E++       C+ELF+R L  GWTSWG
Sbjct  405   KSEDVLPIPEHKLIVSVPCSLHSHKPPLTEVLAEFIK--PDVECLELFARNLQPGWTSWG  462

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  463   NEVLKFQHIDYFT  475



>ref|XP_009705438.1| PREDICTED: methyltransferase-like protein 4 [Cariama cristata]
Length=477

 Score =   163 bits (413),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 139/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +++E S   QD++    + V   GS  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  228   LDDETSIPEQDLL----SCVTENGSNCAKIVVLMGQKYLVPPKSSFLLSDISYLQPLLHY  283

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
               +  +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  284   KKE--YDVIVIDPPWENKSVKRSNRYSHLSSWQIKQMPVPALA-APNCLVVTWVTNRQKH  340

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  341   LRFVKDELYPHWSVKTLAEWHWVKITTAGEFVLPLDSLHKKPYEVLVLGRVQGDVKEALR  400

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +++ +S+P   +S KPP+  +L E++     A C+ELF+R L  GWTSWG
Sbjct  401   KSEDVLPIPEHKLIVSIPCSLHSHKPPLTAILAEFIK--PDAECLELFARNLQPGWTSWG  458

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  459   NEVLKFQHIDYFT  471



>emb|CAD38969.1| hypothetical protein [Homo sapiens]
Length=245

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 135/240 (56%), Gaps = 11/240 (5%)
 Frame = +1

Query  598   FDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWE  777
             F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDPPW+
Sbjct  7     FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDPPWQ  64

Query  778   NSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKY  957
             N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W V+ 
Sbjct  65    NKSVKRSNRYSYLSPLQIQQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWSVEV  123

Query  958   VTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNNQVF  1125
             V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++++ 
Sbjct  124   VAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDHKLI  182

Query  1126  MSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   YF++
Sbjct  183   VSVPCTLHSHKPPLAEVLKDYIK--PDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIA  240



>ref|XP_009966397.1| PREDICTED: methyltransferase-like protein 4 [Tyto alba]
Length=481

 Score =   164 bits (414),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 138/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +++E S   QDV+    + V    S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  232   LDDETSIPDQDVL----SCVTENSSNSAKIVVLMGQKYLVPPKSSFLLSDISCLQPLL--  285

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  286   NYKKNYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  344

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  345   LRFVKDELYPHWSVKTLAEWHWVKITRAGEFVLPLDSSHKKPYEVLVLGRVQGEVKETLR  404

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +++ +SVP   +S KPP+ E+L E++       C+ELF+R L  GWTSWG
Sbjct  405   KSEDVLPIPEHKLIVSVPCSLHSHKPPLTEVLAEFIK--PDVECLELFARNLQPGWTSWG  462

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  463   NEVLKFQHIDYFT  475



>ref|XP_009665385.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Struthio 
camelus australis]
Length=483

 Score =   163 bits (413),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 138/252 (55%), Gaps = 11/252 (4%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             I++E S   QD++        N  +     E +  KY++P +S F +SDV  +  L+  +
Sbjct  234   IDDEASIPEQDLLSCVTE---NNSNYAKMVELMGQKYLVPPKSSFLLSDVSCLQPLL--N  288

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 +++IV+DPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K  
Sbjct  289   YKKKYDVIVMDPPWENKSVKRSNRYGHLSSWQIKQIPVSALA-APNCLVVTWVTNRQKHL  347

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTSD  1086
              FV+ EL+P W VK +  ++W+K+  +G  +  LD  H +PYE L+LG   G  ++    
Sbjct  348   RFVKDELYPHWSVKTLAEWHWVKITRSGEFVLPLDSSHKKPYEVLVLGRVQGSVEEALRK  407

Query  1087  FSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGN  1263
                +  IP++++ +SVP   +S KPP+ E+L E++       C+ELF+R L  GWTSWGN
Sbjct  408   SDDVLPIPDHKLIVSVPCSLHSHKPPLTEVLAEFIK--PDVECLELFARNLQPGWTSWGN  465

Query  1264  EPLHFQASKYFV  1299
             E L FQ   YF 
Sbjct  466   EVLKFQHIDYFT  477



>gb|KFV01404.1| Methyltransferase-like 4, partial [Tauraco erythrolophus]
Length=476

 Score =   163 bits (413),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 140/258 (54%), Gaps = 13/258 (5%)
 Frame = +1

Query  547   AHIENEGSHL--GQDVIPAFDNL--VVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKI  711
             + ++++  H+  G+  IP  D L  V    S  A+    +  KY++P  S F +SD+  +
Sbjct  218   SEVDHQAIHVLDGETSIPEQDLLSCVTENSSNRAKIVVLMGQKYLVPPRSSFLLSDISCL  277

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
               L   +    +++IVIDPPWEN S  +  RY  LP+     +P+  L      LV  WV
Sbjct  278   QPL--PNYKKKYDVIVIDPPWENKSVKRSNRYSYLPSWQIKQIPVPALA-APHCLVVTWV  334

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG-  1068
             TNR+K   FV+ EL+P W VK +  ++W+KV   G  +  LD  H +PYE L+LG   G 
Sbjct  335   TNRQKHLRFVKDELYPHWSVKTLAEWHWVKVTRAGEFVLPLDSLHKKPYEVLVLGRVQGG  394

Query  1069  -KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+      +L  +P +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  395   EKEALRKSEELLPVPEHKLIVSIPCSLHSHKPPLTAVLAEFIK--PDVECLELFARNLQP  452

Query  1243  GWTSWGNEPLHFQASKYF  1296
             GWTSWGNE L FQ   YF
Sbjct  453   GWTSWGNEVLKFQHIDYF  470



>gb|KFP31185.1| Methyltransferase-like 4, partial [Colius striatus]
Length=452

 Score =   162 bits (411),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 140/258 (54%), Gaps = 17/258 (7%)
 Frame = +1

Query  559   NEGSH-----LGQDV-IPAFDNL--VVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKI  711
             NE  H     LG +  IP  D L  V    S  A+    +  KY++P +S F +SD+  +
Sbjct  194   NESDHQAVYVLGDETSIPEQDLLSCVTENSSNSAKIVVLMGQKYLVPPKSSFLLSDISCL  253

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
               L+  +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WV
Sbjct  254   QPLL--NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWV  310

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG-  1068
             TNR+K   FV+ EL+P W VK +  ++W+K+  +G  +  LD  H +PYE L+LG   G 
Sbjct  311   TNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRDGEFVLPLDSLHKKPYEVLVLGRVQGD  370

Query  1069  -KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+ +    ++  +P +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  371   IKEASRKSEEILPVPEHKLIVSIPCSLHSHKPPLAAVLAEFIK--PDVECLELFARNLQP  428

Query  1243  GWTSWGNEPLHFQASKYF  1296
             GWTSWGNE L FQ   YF
Sbjct  429   GWTSWGNEVLKFQHIDYF  446



>ref|XP_005438465.1| PREDICTED: methyltransferase-like protein 4 [Falco cherrug]
Length=482

 Score =   163 bits (412),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 124/222 (56%), Gaps = 10/222 (5%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY++P +S F +SD+  +  L        +++IVIDPPWEN S  +  RY  LP+ 
Sbjct  261   LMGQKYLVPPKSSFLLSDISCLQPLF--SDKKKYDVIVIDPPWENKSIKRSNRYSHLPSW  318

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      LV  WVTNR+K   FV+ EL+P W VK +  ++W+K+   G  +
Sbjct  319   QIKQIPVPALA-VPNCLVVTWVTNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRAGEFV  377

Query  1006  SELDLFHHRPYECLLLGYSDGKDNTSDFSK---LNAIPNNQVFMSVPGD-YSRKPPIGEL  1173
               LD  H +PYE L+LG  +G D      K   +  IP +++ +S+P   +S KPP+  +
Sbjct  378   LPLDSLHKKPYEVLVLGRVEG-DTEEGLRKPEDVLPIPEHKLIVSIPSSLHSHKPPLTAV  436

Query  1174  LLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
             L E++       C+ELF+R L  GWTSWGNE L FQ + YF 
Sbjct  437   LAEFVK--PDVECLELFARNLQPGWTSWGNEVLKFQHTDYFT  476



>ref|XP_006634415.1| PREDICTED: methyltransferase-like protein 4-like [Lepisosteus 
oculatus]
Length=441

 Score =   162 bits (410),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 135/232 (58%), Gaps = 13/232 (6%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  +Y++P +  F +SD+ K+  L+   +   +++IV+DPPWEN S  +  RY  LP  
Sbjct  216   LMGEQYLLPPQCSFLLSDMSKMQPLL---NYQKYDVIVLDPPWENKSVKRSNRYSFLPAS  272

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L+   G LV  WVTNR+K   F+ +EL+P W V+ +  + W+K+  +G  +
Sbjct  273   QLKRIPVPGLS-APGCLVITWVTNRQKHLRFIREELYPHWSVEVLAEWLWVKITNSGEYV  331

Query  1006  SELDLFHHRPYECLLLG-YSDGKDNTSDFSKLNAI--PNNQVFMSVPGD-YSRKPPIGEL  1173
               LD  H +PYE L+LG YS GK+++   S+   I  P+ ++ +SVP   +S KP + ++
Sbjct  332   FPLDSPHKKPYEILVLGRYSGGKESSLRSSEKQEIPVPDQKLIVSVPSTLHSHKPSLADV  391

Query  1174  LLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVSKNRQMKAPD  1329
             L EY+     A C+ELF+R L  GWTSWGNE L FQ   YF   N +   PD
Sbjct  392   LKEYVDPA--AKCLELFARNLQPGWTSWGNEVLKFQHLSYF---NVEETDPD  438



>emb|CDQ74599.1| unnamed protein product [Oncorhynchus mykiss]
Length=455

 Score =   162 bits (411),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 175/362 (48%), Gaps = 30/362 (8%)
 Frame = +1

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGA---TELLKVVRNL  414
             +T+ + +  K+ ++K   LN+ E  +   H ++R  +L+  ++L+ A    E L  V + 
Sbjct  83    KTTVDCKPSKKRKRKCNDLNQGEIDSLAFHHKIRSAILEGTKSLVDAGLSCEYLSEVND-  141

Query  415   rceectdeerreLSQQSCELS-FVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDV-  588
                     +   L    C L+   D+         E+ L  + G+  ++   S  G    
Sbjct  142   -------AQEGPLPSHECNLAALCDMAK-------ELPLVSEHGEDPVQFIESEDGCSTT  187

Query  589   -IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVID  765
              +  F  +  N      E   +  KYIIP    F +SD  ++  L+       F++IV+D
Sbjct  188   HLDLFTRITENCMDFAMEVMLMGEKYIIPPRCAFLLSDFARMQPLV--GYGKFFDLIVLD  245

Query  766   PPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAW  945
             PPWEN S  +  RY  LP+     LP+  L  T G +V  WVTNR     FV  EL+P W
Sbjct  246   PPWENKSVKRSGRYSFLPSSQLKRLPVPLLAST-GCVVVTWVTNRPSHLRFVRDELYPHW  304

Query  946   GVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTSDFS-KLNAIP--NN  1116
             GV+ +  ++W+KV  +G  +  LD  H +PYE L+LG   G  + S  S +   +P    
Sbjct  305   GVEVLAEWFWVKVTRSGEYVFPLDSPHKKPYEVLVLGRYRGCGHHSHSSLRKTELPMEEQ  364

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             +V +SVP   +S KP + E+L  Y+     A C+ELF+R L  GWTSWGNE + FQ   Y
Sbjct  365   RVIVSVPSALHSHKPSLSEVLSPYVGAD--ARCLELFARSLQPGWTSWGNEVIKFQHVSY  422

Query  1294  FV  1299
             + 
Sbjct  423   YT  424



>ref|XP_005418334.1| PREDICTED: methyltransferase-like protein 4 [Geospiza fortis]
Length=481

 Score =   162 bits (411),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 136/253 (54%), Gaps = 14/253 (6%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E E S   QD++    + VV   S  A+    +  KY++P  S F +S++     ++P 
Sbjct  233   LEEETSSAEQDLL----SCVVENSSNCAKIIVLMGQKYLVPPRSSFLLSEISCELPVLPW  288

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
                  +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  289   KK---YDVIVIDPPWENKSVKRSNRYSYLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  344

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  345   LRFVKDELYPHWSVKTLAEWHWVKITTAGEFVLPLDSLHKKPYEVLILGRVQGDVKETLR  404

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 ++ IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  405   KSEGVHPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIR--PDVECLELFARNLQPGWTSWG  462

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  463   NEVLKFQHIDYFT  475



>ref|XP_005009442.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Anas 
platyrhynchos]
Length=479

 Score =   162 bits (411),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 125/221 (57%), Gaps = 8/221 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY++P +S F +SD+  +  L+  +    +++IVIDPPWEN S  +  RY  L + 
Sbjct  258   LMGQKYLVPPKSSFLLSDISCLQPLL--NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSW  315

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      L+  WVTNR+K   FV+ EL+P W VK +  ++W+K+  +G  +
Sbjct  316   QIKQIPVAALA-APDCLIVTWVTNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRSGEFV  374

Query  1006  SELDLFHHRPYECLLLGYSDG--KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELL  1176
               LD FH +PYE L+LG   G  K+       +  IP +++ +S+P   +S KPP+  +L
Sbjct  375   LPLDSFHKKPYEVLILGRVQGSVKEAQRKSEDILPIPEHKLIVSIPCSLHSHKPPLTAVL  434

Query  1177  LEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              E++       C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  435   AEFVK--PDVECLELFARNLQPGWTSWGNEVLKFQHIDYFT  473



>ref|XP_009250550.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Pongo 
abelii]
Length=423

 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  74    KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  129

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  130   FEKQDKGSKPITLPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  184

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  185   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  239

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  240   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  298

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  299   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  357

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  358   KLIVSVPCTLHSHKPPLAEVLKDYIK--PDGEYLELFARNLQPGWTSWGNEVLKFQHVDY  415

Query  1294  FVS  1302
             F++
Sbjct  416   FIA  418



>ref|XP_005517288.1| PREDICTED: methyltransferase-like protein 4 [Pseudopodoces humilis]
Length=482

 Score =   162 bits (411),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 137/253 (54%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E E S   QD++    + V+   S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  233   LEEEISRAEQDLL----SCVMENSSNCAKIIVLMGEKYLVPPKSSFLLSDISCLQPLL--  286

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  287   NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  345

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG--YSDGKDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG    D K+   
Sbjct  346   LRFVKDELYPHWSVKTLAEWHWVKITTAGEFVLPLDSLHKKPYEVLILGRFQGDVKEALR  405

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  406   KSECVLPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIK--PDVECLELFARNLQPGWTSWG  463

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  464   NEVLKFQHIDYFT  476



>ref|XP_010198940.1| PREDICTED: methyltransferase-like protein 4 [Colius striatus]
Length=478

 Score =   162 bits (411),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 140/258 (54%), Gaps = 17/258 (7%)
 Frame = +1

Query  559   NEGSH-----LGQDV-IPAFDNL--VVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKI  711
             NE  H     LG +  IP  D L  V    S  A+    +  KY++P +S F +SD+  +
Sbjct  219   NESDHQAVYVLGDETSIPEQDLLSCVTENSSNSAKIVVLMGQKYLVPPKSSFLLSDISCL  278

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
               L+  +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WV
Sbjct  279   QPLL--NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWV  335

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG-  1068
             TNR+K   FV+ EL+P W VK +  ++W+K+  +G  +  LD  H +PYE L+LG   G 
Sbjct  336   TNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRDGEFVLPLDSLHKKPYEVLVLGRVQGD  395

Query  1069  -KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+ +    ++  +P +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  396   IKEASRKSEEILPVPEHKLIVSIPCSLHSHKPPLAAVLAEFIK--PDVECLELFARNLQP  453

Query  1243  GWTSWGNEPLHFQASKYF  1296
             GWTSWGNE L FQ   YF
Sbjct  454   GWTSWGNEVLKFQHIDYF  471



>ref|XP_007972696.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Chlorocebus 
sabaeus]
Length=472

 Score =   162 bits (410),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 111/361 (31%), Positives = 182/361 (50%), Gaps = 21/361 (6%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIP  594
               ++    +   L   +C L  +   +    PL E+     +    +E + S   QD+  
Sbjct  179   FEKQDKCSKPITLPLDTCNLPELCEMAKHLPPLNEM---EHQTFQLVEEDTSVTEQDL--  233

Query  595   AFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
              F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDPPW
Sbjct  234   -FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDPPW  290

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W V+
Sbjct  291   QNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWSVE  349

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNNQV  1122
              V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++++
Sbjct  350   VVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDHKL  408

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  409   IVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDYFI  466

Query  1300  S  1302
             +
Sbjct  467   A  467



>gb|EOB08778.1| Methyltransferase-like protein 4, partial [Anas platyrhynchos]
Length=477

 Score =   162 bits (411),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 125/221 (57%), Gaps = 8/221 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY++P +S F +SD+  +  L+  +    +++IVIDPPWEN S  +  RY  L + 
Sbjct  257   LMGQKYLVPPKSSFLLSDISCLQPLL--NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSW  314

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      L+  WVTNR+K   FV+ EL+P W VK +  ++W+K+  +G  +
Sbjct  315   QIKQIPVAALA-APDCLIVTWVTNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRSGEFV  373

Query  1006  SELDLFHHRPYECLLLGYSDG--KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELL  1176
               LD FH +PYE L+LG   G  K+       +  IP +++ +S+P   +S KPP+  +L
Sbjct  374   LPLDSFHKKPYEVLILGRVQGSVKEAQRKSEDILPIPEHKLIVSIPCSLHSHKPPLTAVL  433

Query  1177  LEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              E++       C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  434   AEFVK--PDVECLELFARNLQPGWTSWGNEVLKFQHIDYFT  472



>ref|XP_006139095.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Pelodiscus 
sinensis]
Length=479

 Score =   162 bits (410),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 114/361 (32%), Positives = 183/361 (51%), Gaps = 40/361 (11%)
 Frame = +1

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALL----------GATELLKVVRNLr  417
             RK+ ++K  + N+ E  A + H ++R L+L+    L+            +E    ++NL 
Sbjct  138   RKKRKRKYSAFNQGELDALEYHAKIRGLILEGTRCLIEEGLKSGFLHPVSEKQSSIKNLV  197

Query  418   ceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPA  597
              E            + CE++  D  S+ +        N       I+ E S   QD++  
Sbjct  198   TEHVGCALA-----ELCEMA-KDFPSINE--------NDHRPAQIIDEETSITEQDLL--  241

Query  598   FDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPW  774
               + V    +  A+    +  KY++P +S F +SD+  +  L+  + ++ +++IVIDPPW
Sbjct  242   --SCVTENNTDYAKIIHLMGQKYLVPPKSRFLLSDISCLQPLL--NYENKYDVIVIDPPW  297

Query  775   ENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVK  954
             +N S  +  RY  L +     +PI +L      LV  WVTNR+K   FV+ EL+P W VK
Sbjct  298   QNKSVKRSNRYSHLSSWQIKQIPIPELA-APNCLVVTWVTNRQKHLRFVKDELYPHWSVK  356

Query  955   YVTSFYWLKVKANGSLISELDLFHHRPYECLLLGY----SDGKDNTSDFSKLNAIPNNQV  1122
              +  ++W+K+  +G  +  L+  H +PYE L+LG      D     SD   L  IP +++
Sbjct  357   TLAEWHWVKITKSGEFVFPLESSHKKPYEVLVLGKVQRSVDLPLRKSDMEVL-PIPEHKL  415

Query  1123  FMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              +SVP   +S KPP+ E+L EY+     A C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  416   IVSVPCILHSHKPPLTEILTEYIKPD--AECLELFARYLQPGWTSWGNEVLKFQHIDYFI  473

Query  1300  S  1302
             +
Sbjct  474   A  474



>gb|KFP37226.1| Methyltransferase-like 4, partial [Chlamydotis macqueenii]
Length=456

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/253 (36%), Positives = 140/253 (55%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +++E S   QD++    + V+   S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  208   LDDETSIPEQDLL----SCVMENSSNCAKIVVLMGQKYLVPPKSSFLLSDISCLQPLL--  261

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  262   NYKKRYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  320

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +T ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  321   LRFVKDELYPHWSVKTLTEWHWVKITRAGEFVLPLDSLHKKPYEVLVLGRVQGDVKEALR  380

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +++ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  381   KSEDVLPIPEHKLIVSIPCSLHSHKPPLTGVLAEFIK--PDVECLELFARNLQPGWTSWG  438

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF+
Sbjct  439   NEVLKFQHIDYFI  451



>ref|XP_006269582.1| PREDICTED: methyltransferase-like protein 4 [Alligator mississippiensis]
Length=480

 Score =   162 bits (410),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/353 (32%), Positives = 176/353 (50%), Gaps = 25/353 (7%)
 Frame = +1

Query  268   RKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrceectdeerr  447
             RK  ++K   LN+ E  A + H ++R L+ +      G+T +++          +   + 
Sbjct  140   RKTCKRKHSGLNQGELDALEYHTKIRGLIWE------GSTSIVQ------EGFKSGFLQS  187

Query  448   eLSQQSCELSFV-DLGSVWQAPLYEIVLNYQEGDAHIENEGSHLGQDVIPAFDNLVVNKG  624
               +QQSC  + V +      A L ++   +   + +         +  IP  D L     
Sbjct  188   VSAQQSCSKNVVMEHIGCGLAELCKMAKQFPSVNENAHQIVQMTAEVTIPEQDLLSCVTE  247

Query  625   SGDAEAEFLN---HKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQ  795
             +  + A+ LN    KY++P +S F +SD+  +  L+  D    ++ IVIDPPW N S  +
Sbjct  248   NMTSYAKILNLMGQKYLVPPKSSFLLSDISCMQPLL--DYKKKYDAIVIDPPWANKSVKR  305

Query  796   KQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYW  975
               RY  L       +PI  L      LV  WVTNR+K   FV+ EL+P W VK +  ++W
Sbjct  306   SNRYCYLSPWQIKQIPISALA-APNCLVVTWVTNRQKHLRFVKDELYPHWSVKTLAEWHW  364

Query  976   LKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS---DFSKLNAIPNNQVFMSVPGD-  1143
             +K+  +G  I  LD  H +PYE L+LG   G  + S      ++  IP++++ +SVP   
Sbjct  365   VKITRSGEFIFPLDSSHKKPYEVLVLGRVQGNVDLSLRKSEVEVPPIPDHKLIVSVPCTL  424

Query  1144  YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFVS  1302
             +S KPP+ E+L E++       C+ELF+R L  GWTSWGNE L FQ   YF +
Sbjct  425   HSHKPPLAEVLTEFIK--PDMECLELFARSLQPGWTSWGNEVLKFQHIDYFTT  475



>ref|XP_010220649.1| PREDICTED: methyltransferase-like protein 4 [Tinamus guttatus]
Length=477

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 132/234 (56%), Gaps = 8/234 (3%)
 Frame = +1

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             ++ N  S       +  KY++P +S F +SD+  +  L+  +    +++IV+DPPWEN S
Sbjct  243   VIENNSSCAKMIVLMGQKYLVPPKSNFLLSDISCLQPLL--NCKKKYDVIVMDPPWENKS  300

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
               +  RY  L +     +P+  L      LV  WVTNR+K   FV+ EL+P W VK +  
Sbjct  301   VKRSNRYGYLSSWQIKQIPVSSLA-APNCLVVTWVTNRQKHLRFVKDELYPHWSVKTLAE  359

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK--DNTSDFSKLNAIPNNQVFMSVPG  1140
             ++W+K+  +G  +  LD  H +PYE L+LG   G+  +      ++  IP++++ +SVP 
Sbjct  360   WHWVKITRSGEFVFPLDSSHKKPYEVLVLGRVQGRVEEALRKSEEVLPIPDHKLIVSVPC  419

Query  1141  D-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
               +S KPP+ E+L E++     A C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  420   SLHSHKPPLTEVLAEFVK--PGAECLELFARNLQPGWTSWGNEVLKFQHIDYFT  471



>gb|KGL82546.1| Methyltransferase-like 4, partial [Tinamus guttatus]
Length=466

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 132/233 (57%), Gaps = 8/233 (3%)
 Frame = +1

Query  607   LVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSS  786
             ++ N  S       +  KY++P +S F +SD+  +  L+  +    +++IV+DPPWEN S
Sbjct  233   VIENNSSCAKMIVLMGQKYLVPPKSNFLLSDISCLQPLL--NCKKKYDVIVMDPPWENKS  290

Query  787   AHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTS  966
               +  RY  L +     +P+  L      LV  WVTNR+K   FV+ EL+P W VK +  
Sbjct  291   VKRSNRYGYLSSWQIKQIPVSSLA-APNCLVVTWVTNRQKHLRFVKDELYPHWSVKTLAE  349

Query  967   FYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK--DNTSDFSKLNAIPNNQVFMSVPG  1140
             ++W+K+  +G  +  LD  H +PYE L+LG   G+  +      ++  IP++++ +SVP 
Sbjct  350   WHWVKITRSGEFVFPLDSSHKKPYEVLVLGRVQGRVEEALRKSEEVLPIPDHKLIVSVPC  409

Query  1141  D-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYF  1296
               +S KPP+ E+L E++     A C+ELF+R L  GWTSWGNE L FQ   YF
Sbjct  410   SLHSHKPPLTEVLAEFVKPG--AECLELFARNLQPGWTSWGNEVLKFQHIDYF  460



>ref|XP_010125038.1| PREDICTED: methyltransferase-like protein 4 [Chlamydotis macqueenii]
Length=473

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 125/221 (57%), Gaps = 8/221 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              +  KY++P +S F +SD+  +  L+  +    +++IVIDPPWEN S  +  RY  L + 
Sbjct  252   LMGQKYLVPPKSSFLLSDISCLQPLL--NYKKRYDVIVIDPPWENKSVKRSNRYSHLSSW  309

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      LV  WVTNR+K   FV+ EL+P W VK +T ++W+K+   G  +
Sbjct  310   QIKQIPVPALA-APNCLVVTWVTNRQKHLRFVKDELYPHWSVKTLTEWHWVKITRAGEFV  368

Query  1006  SELDLFHHRPYECLLLGYSDG--KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELL  1176
               LD  H +PYE L+LG   G  K+       +  IP +++ +S+P   +S KPP+  +L
Sbjct  369   LPLDSLHKKPYEVLVLGRVQGDVKEALRKSEDVLPIPEHKLIVSIPCSLHSHKPPLTGVL  428

Query  1177  LEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              E++       C+ELF+R L  GWTSWGNE L FQ   YF+
Sbjct  429   AEFIK--PDVECLELFARNLQPGWTSWGNEVLKFQHIDYFI  467



>ref|XP_010333827.1| PREDICTED: methyltransferase-like protein 4 [Saimiri boliviensis 
boliviensis]
Length=472

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/366 (31%), Positives = 180/366 (49%), Gaps = 35/366 (10%)
 Frame = +1

Query  244   ETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNLrce  423
             E S    K+KR  K+    N+ E  A + H ++R L+L     L+        +  L  +
Sbjct  124   EISISIIKKKR--KRCAVFNQGELDAMEYHTKIRKLILDGSLQLIQEGLKSGFLNPLFEK  181

Query  424   ectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDA-HIENEGSHLGQDVIPAF  600
                  +   L   +C LS      + +   +   LN  E     +  EG+ + +  +  F
Sbjct  182   RDKCSKPIILPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLLEEGTSVTEQDL--F  234

Query  601   DNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWEN  780
               +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDPPW+N
Sbjct  235   LRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDPPWQN  292

Query  781   SSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYV  960
              S  +  RY  L       +PI +L      LV  WVTNR+K   F+++EL+P+W V+ V
Sbjct  293   KSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLVVTWVTNRQKHLRFIKEELYPSWSVEIV  351

Query  961   TSFYWLKVKANGSLISELDLFHHRPYECLLLG-----------YSDGKDNTSDFSKLNAI  1107
               ++W+K+ ++G  +  LD  H +PYE L+LG           Y+DG         +  I
Sbjct  352   AEWHWVKITSSGEFVFPLDSPHKKPYEGLILGRVQEKTVLPLRYADG--------NVIPI  403

Query  1108  PNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQA  1284
             P++++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ 
Sbjct  404   PDHKLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQH  461

Query  1285  SKYFVS  1302
               YF++
Sbjct  462   MDYFIA  467



>ref|XP_419143.3| PREDICTED: methyltransferase like 4 isoform X2 [Gallus gallus]
Length=476

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 137/259 (53%), Gaps = 17/259 (7%)
 Frame = +1

Query  559   NEGSHLGQDV------IPAFDNL--VVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKI  711
             N+G H   +V      IP  D L  V    S  A+    +  KY++P  S F +SD+  +
Sbjct  217   NDGDHQAVNVLDDETTIPEQDLLSCVTENNSNCAKIVVLMGQKYLVPPRSSFLLSDISCL  276

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
               L+  +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WV
Sbjct  277   QPLL--NYKKKYDVIVIDPPWENKSVKRSNRYSYLSSWQIKQIPVSMLA-APDCLVVTWV  333

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG-  1068
             TNR+K   FV+ EL+P W VK +  ++W+K+   G  +  LD FH +PYE L+LG   G 
Sbjct  334   TNRQKHLRFVKDELYPHWSVKTLAEWHWVKITRYGEFVLPLDSFHKKPYEVLILGRVQGN  393

Query  1069  -KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+       +  +P +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  394   IKEARRKSEDVLPVPEHKLIVSIPCSLHSHKPPLTAVLAEFIK--PDVECLELFARNLQP  451

Query  1243  GWTSWGNEPLHFQASKYFV  1299
             GWTSWGNE L FQ   YF 
Sbjct  452   GWTSWGNEVLKFQHIDYFT  470



>ref|XP_003817933.1| PREDICTED: methyltransferase-like protein 4 [Pan paniscus]
 ref|XP_008969395.1| PREDICTED: methyltransferase-like protein 4 [Pan paniscus]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSLTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_004059173.1| PREDICTED: methyltransferase-like protein 4 [Gorilla gorilla 
gorilla]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|NP_073751.3| methyltransferase-like protein 4 [Homo sapiens]
 sp|Q8N3J2.3|METL4_HUMAN RecName: Full=Methyltransferase-like protein 4 [Homo sapiens]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDACSLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIQQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_523876.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Pan troglodytes]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_002828133.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Pongo 
abelii]
 ref|XP_009250549.1| PREDICTED: methyltransferase-like protein 4 isoform X1 [Pongo 
abelii]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_003262069.1| PREDICTED: methyltransferase-like protein 4 [Nomascus leucogenys]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIREGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDTCNLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGK----DNTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKAALPSRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_009100625.1| PREDICTED: methyltransferase-like protein 4 [Serinus canaria]
Length=481

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/253 (36%), Positives = 135/253 (53%), Gaps = 13/253 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E E S   QD++    + V+   S  A+    +  +Y++P  S F +SD+  +  L+  
Sbjct  232   LEEETSSAEQDLL----SCVMENSSDCAKIIVLMGQRYLVPPRSSFLLSDISCLQPLL--  285

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  286   NYKKKYDVIVIDPPWENKSVKRSNRYSYLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  344

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  345   LRFVKDELYPHWSVKTLAEWHWVKITTAGEFVLPLDSLHKKPYEVLILGRVQGDVKEALR  404

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                    IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  405   KSEGALPIPEHQLIVSIPCSLHSHKPPLAAVLAEFIK--PDVECLELFARNLQPGWTSWG  462

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  463   NEVLKFQHIDYFT  475



>ref|XP_010132511.1| PREDICTED: methyltransferase-like protein 4, partial [Buceros 
rhinoceros silvestris]
Length=368

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/252 (37%), Positives = 133/252 (53%), Gaps = 13/252 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             +E E S   QD++        N  S       +  KY++P +S F +SDV    +L PA 
Sbjct  119   LEEETSVPEQDLLSCVTE---NSSSLAKIVVLMGQKYLVPPKSRFLLSDVS---SLRPAL  172

Query  733   S-DSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
                  +++IVIDPPWEN S  +  RY  L +     +P+  L    G LVA WVTNR+K 
Sbjct  173   CYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APGCLVATWVTNRQKH  231

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG--YSDGKDNTS  1083
               FV+ EL+P W V+ +  ++W+K+   G  +  LD  H +PYE L+LG    D  +   
Sbjct  232   LRFVKDELYPHWSVEPLAEWHWVKITRAGEFVLPLDSLHKKPYEVLVLGRVQGDASEALR  291

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  +P +++ +SVP   +S KPP+  +L E+        C+ELF+R L  GWTSWG
Sbjct  292   KSGDVPPVPEHKLIVSVPCVLHSHKPPLAAVLAEFTRPG--VECLELFARNLQPGWTSWG  349

Query  1261  NEPLHFQASKYF  1296
             NE L FQ   YF
Sbjct  350   NEVLKFQHVDYF  361



>gb|KFW92652.1| Methyltransferase-like 4, partial [Phalacrocorax carbo]
Length=310

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 131/258 (51%), Gaps = 24/258 (9%)
 Frame = +1

Query  559   NEGSHLGQDV------IPAFDNL-VVNKGSGDAE--AEFLNHKYIIPKESCFYMSDVRKI  711
             NE  H    V      IP  D L  V + S D       +  KY++P +S F +SD+   
Sbjct  59    NESDHQAIHVLDDETSIPEHDLLSCVTENSSDCAKIVVLMGQKYLVPPKSSFLLSDI---  115

Query  712   HNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWV  891
                        +++IVIDPPW+N S  +  RY  L +     +P+  L      LV  WV
Sbjct  116   ------SYKKKYDVIVIDPPWDNKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWV  168

Query  892   TNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLG--YSD  1065
             TNR+K   FV+ EL+P W VK +  ++W+K+   G  I  LD  H +PYE L+LG    D
Sbjct  169   TNRQKHLRFVKDELYPHWSVKALAEWHWVKITRAGEFILPLDSLHKKPYEVLVLGRVQED  228

Query  1066  GKDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSA  1242
              K+       +  IP +++ +S+P   +S KPP+  +L E++       C+ELF+R L  
Sbjct  229   VKETLRKSEDVLPIPEHKLIVSIPCSLHSHKPPLTAVLAEFIKPD--VECLELFARNLQP  286

Query  1243  GWTSWGNEPLHFQASKYF  1296
             GWTSWGNE L FQ   YF
Sbjct  287   GWTSWGNEVLKFQHVDYF  304



>gb|KFV98904.1| Methyltransferase-like 4, partial [Eurypyga helias]
Length=479

 Score =   160 bits (406),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 8/221 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              ++ KY++P  S F +SD+  +  L+  +    +++IVIDPPWEN S  +  RY  L + 
Sbjct  259   LMDQKYLVPPRSSFLLSDISCLQPLL--NYKKTYDVIVIDPPWENKSVKRSNRYSHLSSW  316

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      LV  WVTNR+K   FV++EL+P W VK +  ++W+K+   G  +
Sbjct  317   QIKQIPVPALA-APNCLVVTWVTNRQKHLRFVKEELYPHWSVKSLAEWHWVKITRAGEFV  375

Query  1006  SELDLFHHRPYECLLLGYSDG--KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELL  1176
               LD  H +PYE L+LG   G  K+       +  IP +++ +S+P   +S KPP+  +L
Sbjct  376   LPLDSLHKKPYEVLVLGRVQGDVKETLRKPEDVLPIPEHKLIVSIPCSLHSHKPPLTAVL  435

Query  1177  LEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              E++       C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  436   TEFIK--PDVECLELFARSLQPGWTSWGNEVLKFQHMDYFT  474



>gb|AAI11021.1| Methyltransferase like 4 [Homo sapiens]
 gb|EAX01698.1| methyltransferase like 4 [Homo sapiens]
 gb|AAI36767.1| Methyltransferase like 4 [Homo sapiens]
 gb|AAI36768.1| Methyltransferase like 4 [Homo sapiens]
 gb|AIC57031.1| METTL4, partial [synthetic construct]
Length=472

 Score =   160 bits (406),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (7%)
 Frame = +1

Query  235   EKLETSTESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLGATELLKVVRNL  414
             +++  S   +KRKR     +  N+ E  A + H ++R L+L     L+        +  L
Sbjct  123   KEISISIIGKKRKR----CVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPL  178

Query  415   rceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNYQEGDAH--IENEGSHLGQDV  588
               ++    +   L   +C LS      + +   +   LN  E      +E + S   QD+
Sbjct  179   FEKQDKGSKPITLPLDACSLS-----ELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDL  233

Query  589   IPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDP  768
                F  +V N  S       +  KY++P +S F +SD+  +  L+  +    F++IVIDP
Sbjct  234   ---FLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLL--NYRKTFDVIVIDP  288

Query  769   PWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWG  948
             PW+N S  +  RY  L       +PI +L      L+  WVTNR+K   F+++EL+P+W 
Sbjct  289   PWQNKSVKRSNRYSYLSPLQIKQIPIPKLA-APNCLLVTWVTNRQKHLRFIKEELYPSWS  347

Query  949   VKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKD----NTSDFSKLNAIPNN  1116
             V+ V  ++W+K+  +G  +  LD  H +PYE L+LG    K       +D + L  IP++
Sbjct  348   VEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVL-PIPDH  406

Query  1117  QVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKY  1293
             ++ +SVP   +S KPP+ E+L +Y+        +ELF+R L  GWTSWGNE L FQ   Y
Sbjct  407   KLIVSVPCTLHSHKPPLAEVLKDYIKPD--GEYLELFARNLQPGWTSWGNEVLKFQHVDY  464

Query  1294  FVS  1302
             F++
Sbjct  465   FIA  467



>ref|XP_010158885.1| PREDICTED: methyltransferase-like protein 4 [Eurypyga helias]
Length=480

 Score =   160 bits (406),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 8/221 (4%)
 Frame = +1

Query  646   FLNHKYIIPKESCFYMSDVRKIHNLIPADSDSGFNIIVIDPPWENSSAHQKQRYQTLPNR  825
              ++ KY++P  S F +SD+  +  L+  +    +++IVIDPPWEN S  +  RY  L + 
Sbjct  259   LMDQKYLVPPRSSFLLSDISCLQPLL--NYKKTYDVIVIDPPWENKSVKRSNRYSHLSSW  316

Query  826   FFLSLPIKQLTHTAGALVALWVTNREKLRSFVEKELFPAWGVKYVTSFYWLKVKANGSLI  1005
                 +P+  L      LV  WVTNR+K   FV++EL+P W VK +  ++W+K+   G  +
Sbjct  317   QIKQIPVPALA-APNCLVVTWVTNRQKHLRFVKEELYPHWSVKSLAEWHWVKITRAGEFV  375

Query  1006  SELDLFHHRPYECLLLGYSDG--KDNTSDFSKLNAIPNNQVFMSVPGD-YSRKPPIGELL  1176
               LD  H +PYE L+LG   G  K+       +  IP +++ +S+P   +S KPP+  +L
Sbjct  376   LPLDSLHKKPYEVLVLGRVQGDVKETLRKPEDVLPIPEHKLIVSIPCSLHSHKPPLTAVL  435

Query  1177  LEYMSGTKHAHCIELFSRELSAGWTSWGNEPLHFQASKYFV  1299
              E++       C+ELF+R L  GWTSWGNE L FQ   YF 
Sbjct  436   TEFIK--PDVECLELFARSLQPGWTSWGNEVLKFQHMDYFT  474



>gb|KFV77164.1| Methyltransferase-like 4, partial [Struthio camelus australis]
Length=471

 Score =   160 bits (406),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 139/252 (55%), Gaps = 12/252 (5%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEAEFLNHKYIIPKESCFYMSDVRKIHNLIPAD  732
             I++E S   QD++        N  +     E +  KY++P +S F +SDV  +  L+  +
Sbjct  222   IDDEASIPEQDLLSCVTE---NNSNYAKMVELMGQKYLVPPKSSFLLSDVSCLQPLL--N  276

Query  733   SDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLR  912
                 +++IV+DPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K  
Sbjct  277   YKKKYDVIVMDPPWENKSVKRSNRYGHLSSWQIKQIPVSALA-APNCLVVTWVTNRQKHL  335

Query  913   SFVEKELFPAWGVKYVTSFYWLKVKA-NGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
              FV+ EL+P W VK +  ++W+KV + +G  +  LD  H +PYE L+LG   G  ++   
Sbjct  336   RFVKDELYPHWSVKTLAEWHWVKVSSRSGEFVLPLDSSHKKPYEVLVLGRVQGSVEEALR  395

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP++++ +SVP   +S KPP+ E+L E++       C+ELF+R L  GWTSWG
Sbjct  396   KSDDVLPIPDHKLIVSVPCSLHSHKPPLTEVLAEFIK--PDVECLELFARNLQPGWTSWG  453

Query  1261  NEPLHFQASKYF  1296
             NE L FQ   YF
Sbjct  454   NEVLKFQHIDYF  465



>ref|XP_010394662.1| PREDICTED: methyltransferase-like protein 4 isoform X2 [Corvus 
cornix cornix]
Length=481

 Score =   160 bits (406),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 138/253 (55%), Gaps = 14/253 (6%)
 Frame = +1

Query  553   IENEGSHLGQDVIPAFDNLVVNKGSGDAEA-EFLNHKYIIPKESCFYMSDVRKIHNLIPA  729
             +E+E  H  QD++    + V+   S  A+    +  KY++P +S F +SD+  +  L+  
Sbjct  233   LEDETCHPEQDLL----SCVMKNSSNCAKIIVLMGQKYLVPPKSSFLLSDISCLQPLL--  286

Query  730   DSDSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKL  909
             +    +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K 
Sbjct  287   NYKKKYDVIVIDPPWENKSVKRSNRYSHLSSWQIKQIPVPALA-APNCLVVTWVTNRQKH  345

Query  910   RSFVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDG--KDNTS  1083
               FV+ EL+P W VK +  ++W+K+   G  +  LD  H +PYE L+LG   G  K+   
Sbjct  346   LRFVKDELYPHWSVKTLAEWHWVKITRAGEFVLPLDSLHKKPYEVLVLGRVQGDVKEALR  405

Query  1084  DFSKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWG  1260
                 +  IP +Q+ +S+P   +S KPP+  +L E++       C+ELF+R L  GWTSWG
Sbjct  406   KSEGVLPIPEHQLIVSIPCSLHSHKPPLA-VLAEFIKPD--VECLELFARNLQPGWTSWG  462

Query  1261  NEPLHFQASKYFV  1299
             NE L FQ   YF 
Sbjct  463   NEVLKFQHIDYFT  475



>ref|XP_010308137.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
4 [Balearica regulorum gibbericeps]
Length=485

 Score =   160 bits (406),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 177/371 (48%), Gaps = 53/371 (14%)
 Frame = +1

Query  250   STESRKRKRNEKKTISLNEREKVAEQRHQEVRPLLLKAHEALLG----------ATELLK  399
             S  S ++KR  K+  + N+ E+ A + H +VR L+ +    L+           AT  L 
Sbjct  141   SVASARKKR--KRKCAFNQGEQDALEYHSKVRKLIWEGTLHLVQEGLKSGFLHRATAELS  198

Query  400   VVRNLrceectdeerreLSQQSCELSFVDLGSVWQAPLYEIVLNY---QEGDAH----IE  558
               RN+                 C L          A L E+   +    E D H    ++
Sbjct  199   CRRNVVP-----------GHIGCGL----------AELCEMAKQFPAVNESDQHAVHALD  237

Query  559   NEGSHLGQDVIPAFDNLVVNKGSGDAE-AEFLNHKYIIPKESCFYMSDVRKIHNLIPADS  735
             +E S   QD++    + V    S  A+    +  KY++P +S F +SD+  +  L+  + 
Sbjct  238   DETSIPEQDLL----SCVTENSSNCAKIVVLMGQKYLVPPKSSFLLSDISCLQPLL--NY  291

Query  736   DSGFNIIVIDPPWENSSAHQKQRYQTLPNRFFLSLPIKQLTHTAGALVALWVTNREKLRS  915
                +++IVIDPPWEN S  +  RY  L +     +P+  L      LV  WVTNR+K   
Sbjct  292   KKKYDVIVIDPPWENKSVKRSNRYSYLSSWQIKQIPVPALA-APNCLVVTWVTNRQKHLR  350

Query  916   FVEKELFPAWGVKYVTSFYWLKVKANGSLISELDLFHHRPYECLLLGYSDGKDNTS--DF  1089
             FV+ EL+P W VK +  ++W+KV   G  +  LD  H +PYE L+LG   G +  +    
Sbjct  351   FVKHELYPYWSVKTLAEWHWVKVTRTGEFVLPLDSLHKKPYEVLVLGRVQGGEEEALRKS  410

Query  1090  SKLNAIPNNQVFMSVPGD-YSRKPPIGELLLEYMSGTKHAHCIELFSRELSAGWTSWGNE  1266
               +  IP +++ +SVP   +S KPP+  +L E++       C+ELF+R L  GWTSWGNE
Sbjct  411   EDVLPIPEHKLIVSVPCSLHSHKPPLTAVLAEFIK--PDVECLELFARNLQPGWTSWGNE  468

Query  1267  PLHFQASKYFV  1299
              L FQ   YF 
Sbjct  469   VLKFQHIDYFT  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6306649414994