BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30666_g1_i1 len=1421 path=[1399:0-1420]

Length=1421
                                                                      Score     E

emb|CDP14823.1|  unnamed protein product                                345   3e-109   
ref|XP_009595391.1|  PREDICTED: zinc finger CCCH domain-containin...    315   2e-98    
ref|XP_009789499.1|  PREDICTED: zinc finger CCCH domain-containin...    313   6e-98    
ref|XP_002274948.1|  PREDICTED: zinc finger CCCH domain-containin...    302   2e-94    Vitis vinifera
ref|XP_004243370.1|  PREDICTED: zinc finger CCCH domain-containin...    303   2e-94    
gb|EPS67507.1|  hypothetical protein M569_07268                         293   2e-91    
ref|XP_011029046.1|  PREDICTED: zinc finger CCCH domain-containin...    286   3e-88    
ref|XP_006372730.1|  zinc finger family protein                         283   4e-87    
ref|XP_011100356.1|  PREDICTED: zinc finger CCCH domain-containin...    278   1e-84    
ref|XP_007149822.1|  hypothetical protein PHAVU_005G101500g             277   2e-84    
ref|XP_004301223.1|  PREDICTED: zinc finger CCCH domain-containin...    277   2e-84    
ref|XP_003540372.2|  PREDICTED: zinc finger CCCH domain-containin...    277   2e-83    
ref|XP_007198967.1|  hypothetical protein PRUPE_ppa015121mg             275   3e-83    
gb|AJB84605.1|  C3H zinc finger protein                                 271   2e-82    
ref|XP_010260283.1|  PREDICTED: zinc finger CCCH domain-containin...    268   4e-81    
ref|XP_010070036.1|  PREDICTED: zinc finger CCCH domain-containin...    266   9e-81    
gb|KDP24097.1|  hypothetical protein JCGZ_25754                         266   1e-80    
ref|XP_002309749.2|  zinc finger family protein                         266   3e-80    Populus trichocarpa [western balsam poplar]
ref|XP_008455280.1|  PREDICTED: zinc finger CCCH domain-containin...    263   1e-79    
ref|XP_008381588.1|  PREDICTED: zinc finger CCCH domain-containin...    265   2e-79    
ref|XP_007043650.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    261   1e-78    
ref|XP_011047672.1|  PREDICTED: zinc finger CCCH domain-containin...    261   2e-78    
ref|XP_007132795.1|  hypothetical protein PHAVU_011G125300g             260   2e-78    
ref|XP_004487266.1|  PREDICTED: zinc finger CCCH domain-containin...    260   4e-78    
ref|XP_008362440.1|  PREDICTED: zinc finger CCCH domain-containin...    260   2e-77    
ref|XP_004136841.1|  PREDICTED: zinc finger CCCH domain-containin...    258   4e-77    
ref|XP_008342887.1|  PREDICTED: zinc finger CCCH domain-containin...    259   5e-77    
ref|XP_002517875.1|  conserved hypothetical protein                     250   4e-76    Ricinus communis
gb|ADL36652.1|  C3HL domain class transcription factor                  254   3e-75    
gb|EYU42142.1|  hypothetical protein MIMGU_mgv1a008328mg                252   5e-75    
ref|XP_002889476.1|  zinc finger (CCCH-type) family protein             252   8e-75    
ref|XP_006304480.1|  hypothetical protein CARUB_v10011207mg             249   8e-74    
gb|KEH39169.1|  zinc finger CCCH domain protein                         250   8e-74    
ref|XP_006418203.1|  hypothetical protein EUTSA_v10007884mg             249   9e-74    
ref|XP_003526267.1|  PREDICTED: zinc finger CCCH domain-containin...    245   1e-72    
ref|XP_010457395.1|  PREDICTED: zinc finger CCCH domain-containin...    244   6e-72    
ref|XP_010475006.1|  PREDICTED: zinc finger CCCH domain-containin...    244   6e-72    
dbj|BAC41895.1|  unknown protein                                        244   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|NP_171875.1|  CCCH-type zinc finger protein SOMNUS                  243   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475007.1|  PREDICTED: zinc finger CCCH domain-containin...    238   4e-70    
gb|KFK42723.1|  zinc finger ccch domain-containing protein 2-like       237   3e-69    
ref|XP_006447247.1|  hypothetical protein CICLE_v10015314mg             237   1e-68    
ref|XP_003539940.1|  PREDICTED: zinc finger CCCH domain-containin...    234   1e-68    
gb|KDO42121.1|  hypothetical protein CISIN_1g036437mg                   237   1e-68    
ref|XP_010556843.1|  PREDICTED: zinc finger CCCH domain-containin...    234   4e-68    
emb|CDY18184.1|  BnaC05g02070D                                          234   7e-68    
gb|AAX20386.1|  putative CCCH-type zinc finger transcription factor     231   2e-67    Gossypium hirsutum [American cotton]
gb|KFK31654.1|  hypothetical protein AALP_AA6G141300                    231   3e-67    
emb|CDY15473.1|  BnaA08g27570D                                          232   3e-67    
ref|XP_010689060.1|  PREDICTED: zinc finger CCCH domain-containin...    231   7e-67    
ref|XP_010482518.1|  PREDICTED: zinc finger CCCH domain-containin...    231   1e-66    
emb|CDX86670.1|  BnaC08g00330D                                          230   1e-66    
emb|CDX89867.1|  BnaA10g02150D                                          229   4e-66    
ref|XP_006403122.1|  hypothetical protein EUTSA_v10003231mg             227   1e-65    
ref|XP_009111142.1|  PREDICTED: zinc finger CCCH domain-containin...    228   2e-65    
ref|XP_009119364.1|  PREDICTED: zinc finger CCCH domain-containin...    227   2e-65    
ref|XP_009791791.1|  PREDICTED: zinc finger CCCH domain-containin...    224   3e-64    
gb|KFK40348.1|  hypothetical protein AALP_AA3G362300                    221   1e-63    
emb|CDX94766.1|  BnaC07g17750D                                          222   2e-63    
ref|XP_009408887.1|  PREDICTED: zinc finger CCCH domain-containin...    222   2e-63    
ref|XP_009381212.1|  PREDICTED: zinc finger CCCH domain-containin...    221   4e-63    
ref|XP_009608132.1|  PREDICTED: zinc finger CCCH domain-containin...    219   2e-62    
ref|XP_002863601.1|  zinc finger (CCCH-type) family protein             219   3e-62    
ref|XP_009403103.1|  PREDICTED: zinc finger CCCH domain-containin...    216   3e-62    
emb|CDY13114.1|  BnaA09g17030D                                          218   3e-62    
ref|XP_007204367.1|  hypothetical protein PRUPE_ppa007297mg             218   3e-62    
ref|XP_010429604.1|  PREDICTED: zinc finger CCCH domain-containin...    216   3e-62    
ref|XP_004505556.1|  PREDICTED: zinc finger CCCH domain-containin...    216   6e-62    
ref|XP_009397189.1|  PREDICTED: zinc finger CCCH domain-containin...    214   1e-61    
ref|XP_010417368.1|  PREDICTED: zinc finger CCCH domain-containin...    214   1e-61    
ref|XP_010267090.1|  PREDICTED: zinc finger CCCH domain-containin...    217   1e-61    
ref|XP_004288807.1|  PREDICTED: zinc finger CCCH domain-containin...    211   2e-61    
ref|XP_008242454.1|  PREDICTED: zinc finger CCCH domain-containin...    217   2e-61    
gb|KHN40356.1|  Zinc finger CCCH domain-containing protein 20           214   2e-61    
ref|XP_010925500.1|  PREDICTED: zinc finger CCCH domain-containin...    216   2e-61    
ref|XP_003529068.1|  PREDICTED: zinc finger CCCH domain-containin...    215   3e-61    
ref|XP_009388582.1|  PREDICTED: zinc finger CCCH domain-containin...    216   4e-61    
ref|XP_010909936.1|  PREDICTED: zinc finger CCCH domain-containin...    214   6e-61    
emb|CBI20604.3|  unnamed protein product                                213   7e-61    
ref|XP_004287502.1|  PREDICTED: zinc finger CCCH domain-containin...    215   7e-61    
ref|XP_002886019.1|  hypothetical protein ARALYDRAFT_480488             213   1e-60    
ref|XP_002275926.1|  PREDICTED: zinc finger CCCH domain-containin...    214   2e-60    Vitis vinifera
emb|CAN83255.1|  hypothetical protein VITISV_036981                     215   2e-60    Vitis vinifera
ref|XP_007152945.1|  hypothetical protein PHAVU_004G173600g             213   2e-60    
ref|XP_010540993.1|  PREDICTED: zinc finger CCCH domain-containin...    213   2e-60    
ref|XP_010481761.1|  PREDICTED: zinc finger CCCH domain-containin...    213   2e-60    
ref|XP_010472617.1|  PREDICTED: zinc finger CCCH domain-containin...    211   3e-60    
ref|XP_009352588.1|  PREDICTED: zinc finger CCCH domain-containin...    213   4e-60    
gb|AGL76984.1|  zinc finger CCCH domain-containing protein              213   4e-60    
ref|XP_009113932.1|  PREDICTED: zinc finger CCCH domain-containin...    213   5e-60    
ref|XP_006853780.1|  hypothetical protein AMTR_s00056p00207550          214   5e-60    
ref|XP_010086901.1|  Zinc finger CCCH domain-containing protein 49      213   5e-60    
ref|XP_007012951.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    213   5e-60    
ref|XP_006297982.1|  hypothetical protein CARUB_v10014025mg             212   5e-60    
ref|XP_004135688.1|  PREDICTED: zinc finger CCCH domain-containin...    213   6e-60    
ref|XP_010526073.1|  PREDICTED: zinc finger CCCH domain-containin...    211   7e-60    
ref|XP_004141305.1|  PREDICTED: zinc finger CCCH domain-containin...    211   7e-60    
ref|XP_003516267.1|  PREDICTED: zinc finger CCCH domain-containin...    211   8e-60    
ref|XP_010244375.1|  PREDICTED: zinc finger CCCH domain-containin...    212   8e-60    
ref|XP_009102134.1|  PREDICTED: zinc finger CCCH domain-containin...    211   8e-60    
emb|CDY35891.1|  BnaA07g00960D                                          210   9e-60    
emb|CDX82728.1|  BnaC07g01380D                                          211   9e-60    
ref|XP_002867421.1|  zinc finger (CCCH-type) family protein             211   1e-59    
ref|XP_008794080.1|  PREDICTED: zinc finger CCCH domain-containin...    212   1e-59    
ref|NP_179571.1|  oxidation-related zinc Finger 1                       211   1e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008450813.1|  PREDICTED: zinc finger CCCH domain-containin...    211   1e-59    
ref|XP_004158434.1|  PREDICTED: zinc finger CCCH domain-containin...    211   1e-59    
ref|XP_007012220.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    211   2e-59    
ref|XP_010441910.1|  PREDICTED: zinc finger CCCH domain-containin...    211   2e-59    
ref|XP_002455022.1|  hypothetical protein SORBIDRAFT_03g003110          210   2e-59    Sorghum bicolor [broomcorn]
emb|CBI27968.3|  unnamed protein product                                211   2e-59    
ref|XP_009101727.1|  PREDICTED: zinc finger CCCH domain-containin...    211   2e-59    
ref|XP_006451362.1|  hypothetical protein CICLE_v10008633mg             211   2e-59    
ref|XP_006475367.1|  PREDICTED: zinc finger CCCH domain-containin...    211   2e-59    
ref|XP_011081722.1|  PREDICTED: zinc finger CCCH domain-containin...    210   2e-59    
ref|XP_008452695.1|  PREDICTED: zinc finger CCCH domain-containin...    210   2e-59    
ref|XP_008798608.1|  PREDICTED: zinc finger CCCH domain-containin...    211   3e-59    
ref|XP_011078221.1|  PREDICTED: zinc finger CCCH domain-containin...    210   3e-59    
ref|XP_001781195.1|  predicted protein                                  202   3e-59    
gb|KDP33764.1|  hypothetical protein JCGZ_07335                         211   4e-59    
ref|XP_006280675.1|  hypothetical protein CARUB_v10026640mg             209   5e-59    
ref|XP_010548687.1|  PREDICTED: zinc finger CCCH domain-containin...    209   5e-59    
dbj|BAJ33902.1|  unnamed protein product                                209   5e-59    
gb|KDP34137.1|  hypothetical protein JCGZ_07708                         209   6e-59    
ref|XP_003530556.1|  PREDICTED: zinc finger CCCH domain-containin...    209   6e-59    
ref|XP_004960911.1|  PREDICTED: zinc finger CCCH domain-containin...    210   6e-59    
gb|ACU23866.1|  unknown                                                 209   6e-59    Glycine max [soybeans]
ref|NP_001042276.1|  Os01g0192000                                       209   7e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440755.1|  hypothetical protein SORBIDRAFT_09g006050          210   7e-59    Sorghum bicolor [broomcorn]
ref|XP_002283114.2|  PREDICTED: zinc finger CCCH domain-containin...    211   8e-59    Vitis vinifera
ref|XP_010438328.1|  PREDICTED: zinc finger CCCH domain-containin...    208   9e-59    
ref|XP_008795482.1|  PREDICTED: zinc finger CCCH domain-containin...    208   9e-59    
gb|EAY72862.1|  hypothetical protein OsI_00733                          209   1e-58    Oryza sativa Indica Group [Indian rice]
ref|NP_199239.1|  zinc finger CCCH domain-containing protein 61         209   1e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160259.1|  hypothetical protein PHAVU_002G306100g             208   1e-58    
ref|XP_010447881.1|  PREDICTED: zinc finger CCCH domain-containin...    208   1e-58    
ref|XP_001774473.1|  predicted protein                                  201   1e-58    
ref|XP_006412868.1|  hypothetical protein EUTSA_v10025226mg             210   1e-58    
ref|XP_010943958.1|  PREDICTED: zinc finger CCCH domain-containin...    207   1e-58    
ref|XP_003607493.1|  Zinc finger CCCH domain-containing protein         207   1e-58    
ref|XP_006408900.1|  hypothetical protein EUTSA_v10002026mg             208   1e-58    
ref|XP_011019549.1|  PREDICTED: zinc finger CCCH domain-containin...    209   2e-58    
ref|XP_010433125.1|  PREDICTED: zinc finger CCCH domain-containin...    207   2e-58    
gb|ABR16884.1|  unknown                                                 213   2e-58    Picea sitchensis
emb|CAN81808.1|  hypothetical protein VITISV_013303                     210   2e-58    Vitis vinifera
ref|XP_010494430.1|  PREDICTED: zinc finger CCCH domain-containin...    208   3e-58    
ref|XP_008337620.1|  PREDICTED: zinc finger CCCH domain-containin...    208   3e-58    
dbj|BAJ34229.1|  unnamed protein product                                207   3e-58    
ref|NP_194648.1|  protein OXIDATION-RELATED ZINC FINGER 2               207   3e-58    Arabidopsis thaliana [mouse-ear cress]
emb|CDY22300.1|  BnaA06g36220D                                          208   4e-58    
ref|XP_004503514.1|  PREDICTED: zinc finger CCCH domain-containin...    207   4e-58    
ref|XP_002978806.1|  hypothetical protein SELMODRAFT_443970             207   5e-58    
ref|XP_003525299.1|  PREDICTED: zinc finger CCCH domain-containin...    206   5e-58    
ref|XP_006285735.1|  hypothetical protein CARUB_v10007208mg             207   5e-58    
ref|XP_009784195.1|  PREDICTED: zinc finger CCCH domain-containin...    206   6e-58    
ref|XP_006408830.1|  hypothetical protein EUTSA_v10002045mg             205   6e-58    
ref|XP_002972737.1|  hypothetical protein SELMODRAFT_441947             212   7e-58    
ref|XP_009402941.1|  PREDICTED: zinc finger CCCH domain-containin...    207   7e-58    
ref|XP_002993351.1|  hypothetical protein SELMODRAFT_449116             212   7e-58    
ref|XP_004158433.1|  PREDICTED: zinc finger CCCH domain-containin...    206   8e-58    
ref|XP_006294702.1|  hypothetical protein CARUB_v10023740mg             204   8e-58    
ref|XP_002309525.2|  zinc finger family protein                         207   9e-58    Populus trichocarpa [western balsam poplar]
ref|XP_004245129.1|  PREDICTED: zinc finger CCCH domain-containin...    205   1e-57    
ref|XP_004513076.1|  PREDICTED: zinc finger CCCH domain-containin...    206   1e-57    
ref|XP_009128959.1|  PREDICTED: zinc finger CCCH domain-containin...    206   1e-57    
emb|CDP03218.1|  unnamed protein product                                206   1e-57    
ref|XP_010668905.1|  PREDICTED: zinc finger CCCH domain-containin...    206   2e-57    
ref|XP_009380460.1|  PREDICTED: zinc finger CCCH domain-containin...    205   2e-57    
ref|XP_011094664.1|  PREDICTED: zinc finger CCCH domain-containin...    205   2e-57    
ref|NP_180161.1|  putative Cys3His zinc finger protein ATCTH            203   2e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810557.1|  PREDICTED: zinc finger CCCH domain-containin...    204   3e-57    
ref|XP_006355306.1|  PREDICTED: zinc finger CCCH domain-containin...    204   4e-57    
ref|XP_003620782.1|  Zinc finger CCCH domain-containing protein         205   4e-57    
gb|EYU20391.1|  hypothetical protein MIMGU_mgv1a008351mg                205   4e-57    
ref|XP_010451167.1|  PREDICTED: zinc finger CCCH domain-containin...    199   5e-57    
ref|XP_006353579.1|  PREDICTED: zinc finger CCCH domain-containin...    205   5e-57    
gb|AGL40443.1|  C3H-type zinc finger protein                            204   6e-57    
ref|XP_004251650.1|  PREDICTED: zinc finger CCCH domain-containin...    205   6e-57    
gb|EPS65346.1|  hypothetical protein M569_09425                         197   8e-57    
ref|XP_010924475.1|  PREDICTED: zinc finger CCCH domain-containin...    203   9e-57    
ref|XP_008799753.1|  PREDICTED: zinc finger CCCH domain-containin...    204   1e-56    
gb|EPS57796.1|  hypothetical protein M569_17020                         203   2e-56    
gb|ACO54858.1|  zinc finger protein ZF3                                 203   2e-56    
ref|XP_007223349.1|  hypothetical protein PRUPE_ppa007432mg             202   2e-56    
ref|XP_009361457.1|  PREDICTED: zinc finger CCCH domain-containin...    202   3e-56    
ref|XP_003564747.1|  PREDICTED: zinc finger CCCH domain-containin...    202   3e-56    
gb|ABK92961.1|  unknown                                                 202   3e-56    Populus trichocarpa [western balsam poplar]
ref|XP_002324748.2|  hypothetical protein POPTR_0018s04720g             202   3e-56    Populus trichocarpa [western balsam poplar]
gb|AAM65505.1|  putative CCCH-type zinc finger protein                  201   3e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010049593.1|  PREDICTED: zinc finger CCCH domain-containin...    202   3e-56    
ref|XP_009137834.1|  PREDICTED: zinc finger CCCH domain-containin...    202   4e-56    
ref|XP_009372717.1|  PREDICTED: zinc finger CCCH domain-containin...    205   4e-56    
ref|NP_001146853.1|  nucleic acid binding protein                       201   5e-56    Zea mays [maize]
ref|XP_002878901.1|  hypothetical protein ARALYDRAFT_481444             200   5e-56    
gb|AGT16143.1|  nucleic acid binding protein                            202   5e-56    
ref|XP_010049147.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    202   6e-56    
ref|XP_010097108.1|  Zinc finger CCCH domain-containing protein 49      201   7e-56    
ref|XP_009337135.1|  PREDICTED: zinc finger CCCH domain-containin...    201   8e-56    
ref|XP_009610482.1|  PREDICTED: zinc finger CCCH domain-containin...    200   1e-55    
gb|ADL36656.1|  C3HL domain class transcription factor                  200   1e-55    
ref|XP_011012777.1|  PREDICTED: zinc finger CCCH domain-containin...    201   2e-55    
gb|AFW80253.1|  hypothetical protein ZEAMMB73_899917                    198   2e-55    
ref|XP_009802285.1|  PREDICTED: zinc finger CCCH domain-containin...    199   2e-55    
ref|XP_010526424.1|  PREDICTED: zinc finger CCCH domain-containin...    199   2e-55    
emb|CDP08206.1|  unnamed protein product                                200   2e-55    
gb|KEH21327.1|  zinc finger CCCH domain protein                         199   5e-55    
ref|XP_003568774.1|  PREDICTED: zinc finger CCCH domain-containin...    199   6e-55    
ref|XP_008655700.1|  PREDICTED: zinc finger CCCH domain-containin...    199   7e-55    
gb|EYU30674.1|  hypothetical protein MIMGU_mgv1a009490mg                197   8e-55    
ref|XP_008377933.1|  PREDICTED: zinc finger CCCH domain-containin...    198   1e-54    
ref|XP_009620041.1|  PREDICTED: zinc finger CCCH domain-containin...    197   1e-54    
ref|XP_008220427.1|  PREDICTED: zinc finger CCCH domain-containin...    197   2e-54    
gb|EAY96854.1|  hypothetical protein OsI_18775                          197   4e-54    Oryza sativa Indica Group [Indian rice]
ref|NP_001054861.1|  Os05g0195200                                       197   4e-54    Oryza sativa Japonica Group [Japonica rice]
emb|CDM81668.1|  unnamed protein product                                197   5e-54    
ref|XP_009409364.1|  PREDICTED: zinc finger CCCH domain-containin...    196   5e-54    
ref|XP_009385782.1|  PREDICTED: zinc finger CCCH domain-containin...    196   7e-54    
gb|KHN27902.1|  Zinc finger CCCH domain-containing protein 2            195   1e-53    
gb|KFK32533.1|  hypothetical protein AALP_AA6G255600                    193   1e-53    
dbj|BAJ85837.1|  predicted protein                                      195   2e-53    
ref|XP_006855265.1|  hypothetical protein AMTR_s00183p00052730          194   3e-53    
gb|KCW79588.1|  hypothetical protein EUGRSUZ_C00948                     192   6e-53    
gb|EYU29305.1|  hypothetical protein MIMGU_mgv1a008957mg                193   6e-53    
ref|XP_009109049.1|  PREDICTED: zinc finger CCCH domain-containin...    193   6e-53    
gb|ACF82790.1|  unknown                                                 191   8e-53    Zea mays [maize]
ref|XP_010047645.1|  PREDICTED: zinc finger CCCH domain-containin...    192   8e-53    
gb|EPS73621.1|  hypothetical protein M569_01136                         190   2e-52    
ref|XP_001417127.1|  predicted protein                                  196   2e-52    Ostreococcus lucimarinus CCE9901
gb|KCW81630.1|  hypothetical protein EUGRSUZ_C02990                     191   3e-52    
ref|XP_003522232.1|  PREDICTED: zinc finger CCCH domain-containin...    187   3e-52    
ref|XP_004141037.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    192   3e-52    
ref|XP_004157905.1|  PREDICTED: zinc finger CCCH domain-containin...    192   3e-52    
ref|XP_009395218.1|  PREDICTED: zinc finger CCCH domain-containin...    189   5e-52    
gb|ACN34007.1|  unknown                                                 192   5e-52    Zea mays [maize]
ref|XP_004157904.1|  PREDICTED: zinc finger CCCH domain-containin...    191   7e-52    
ref|XP_008459142.1|  PREDICTED: zinc finger CCCH domain-containin...    190   2e-51    
ref|NP_001144558.1|  uncharacterized protein LOC100277562               189   2e-51    Zea mays [maize]
ref|XP_009415367.1|  PREDICTED: zinc finger CCCH domain-containin...    188   5e-51    
emb|CDP18658.1|  unnamed protein product                                194   6e-51    
ref|XP_009411222.1|  PREDICTED: zinc finger CCCH domain-containin...    187   7e-51    
ref|XP_011033310.1|  PREDICTED: zinc finger CCCH domain-containin...    193   1e-50    
ref|XP_002323312.1|  zinc finger family protein                         193   2e-50    Populus trichocarpa [western balsam poplar]
ref|XP_006349561.1|  PREDICTED: zinc finger CCCH domain-containin...    193   2e-50    
ref|XP_006293740.1|  hypothetical protein CARUB_v10022702mg             193   2e-50    
ref|XP_006293739.1|  hypothetical protein CARUB_v10022702mg             193   2e-50    
ref|XP_002504751.1|  predicted protein                                  186   3e-50    Micromonas commoda
ref|XP_003525974.1|  PREDICTED: zinc finger CCCH domain-containin...    183   3e-50    
ref|XP_008443126.1|  PREDICTED: zinc finger CCCH domain-containin...    192   3e-50    
ref|XP_004136593.1|  PREDICTED: zinc finger CCCH domain-containin...    192   3e-50    
emb|CAN74402.1|  hypothetical protein VITISV_043632                     192   3e-50    Vitis vinifera
ref|XP_009394601.1|  PREDICTED: zinc finger CCCH domain-containin...    183   3e-50    
ref|XP_002308039.2|  zinc finger family protein                         192   3e-50    Populus trichocarpa [western balsam poplar]
ref|XP_011020337.1|  PREDICTED: zinc finger CCCH domain-containin...    192   4e-50    
ref|XP_010092985.1|  Zinc finger CCCH domain-containing protein 30      192   4e-50    
ref|XP_011020339.1|  PREDICTED: zinc finger CCCH domain-containin...    192   4e-50    
ref|XP_003632114.1|  PREDICTED: zinc finger CCCH domain-containin...    192   4e-50    
ref|XP_002308038.2|  zinc finger family protein                         192   4e-50    Populus trichocarpa [western balsam poplar]
ref|XP_007136803.1|  hypothetical protein PHAVU_009G075500g             182   5e-50    
ref|XP_009395592.1|  PREDICTED: zinc finger CCCH domain-containin...    191   8e-50    
ref|XP_006604367.1|  PREDICTED: zinc finger CCCH domain-containin...    191   8e-50    
ref|XP_009396540.1|  PREDICTED: zinc finger CCCH domain-containin...    183   1e-49    
ref|XP_007028819.1|  C3HL domain class transcription factor isofo...    191   1e-49    
ref|XP_003521185.1|  PREDICTED: zinc finger CCCH domain-containin...    190   2e-49    
gb|KHN07386.1|  Zinc finger CCCH domain-containing protein 30           190   2e-49    
gb|KFK37035.1|  hypothetical protein AALP_AA4G204000                    190   2e-49    
gb|ACU19973.1|  unknown                                                 181   2e-49    Glycine max [soybeans]
ref|XP_010057404.1|  PREDICTED: zinc finger CCCH domain-containin...    190   2e-49    
ref|XP_010517688.1|  PREDICTED: zinc finger CCCH domain-containin...    189   3e-49    
ref|XP_004234834.1|  PREDICTED: zinc finger CCCH domain-containin...    189   3e-49    
emb|CEF97418.1|  Ankyrin repeat                                         187   3e-49    
ref|XP_006411461.1|  hypothetical protein EUTSA_v10016315mg             189   4e-49    
ref|XP_011075220.1|  PREDICTED: zinc finger CCCH domain-containin...    189   4e-49    
emb|CDY14802.1|  BnaC04g47990D                                          188   5e-49    
emb|CAI30889.1|  putative CCCH-type zinc finger protein CsSEF1          181   5e-49    Cucumis sativus [cucumbers]
ref|XP_010275497.1|  PREDICTED: zinc finger CCCH domain-containin...    179   5e-49    
ref|XP_004493518.1|  PREDICTED: zinc finger CCCH domain-containin...    189   6e-49    
gb|KDO61257.1|  hypothetical protein CISIN_1g004266mg                   188   7e-49    
ref|XP_004142912.1|  PREDICTED: zinc finger CCCH domain-containin...    181   8e-49    
gb|ADL36655.1|  C3HL domain class transcription factor                  188   8e-49    
ref|XP_007204626.1|  hypothetical protein PRUPE_ppa002189mg             188   9e-49    
ref|XP_008240870.1|  PREDICTED: zinc finger CCCH domain-containin...    188   9e-49    
ref|XP_006470613.1|  PREDICTED: zinc finger CCCH domain-containin...    188   9e-49    
gb|KDP26019.1|  hypothetical protein JCGZ_21052                         188   9e-49    
gb|KHG03427.1|  hypothetical protein F383_27140                         188   1e-48    
ref|XP_004172043.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    179   1e-48    
gb|KDO61256.1|  hypothetical protein CISIN_1g004266mg                   188   1e-48    
gb|KHG06713.1|  hypothetical protein F383_33331                         187   1e-48    
ref|XP_009340157.1|  PREDICTED: zinc finger CCCH domain-containin...    188   1e-48    
ref|XP_002526718.1|  nucleic acid binding protein, putative             188   1e-48    
ref|XP_009334960.1|  PREDICTED: zinc finger CCCH domain-containin...    188   1e-48    
ref|XP_009414744.1|  PREDICTED: zinc finger CCCH domain-containin...    187   1e-48    
ref|XP_009340782.1|  PREDICTED: zinc finger CCCH domain-containin...    187   1e-48    
ref|XP_002947407.1|  CCCH zinc finger protein                           189   1e-48    
ref|XP_010909716.1|  PREDICTED: zinc finger CCCH domain-containin...    187   1e-48    
ref|XP_009394397.1|  PREDICTED: zinc finger CCCH domain-containin...    187   1e-48    
gb|EMS50712.1|  Zinc finger CCCH domain-containing protein 67           186   1e-48    
ref|XP_009799603.1|  PREDICTED: zinc finger CCCH domain-containin...    187   1e-48    
ref|XP_002526717.1|  nucleic acid binding protein, putative             187   1e-48    
emb|CBI24886.3|  unnamed protein product                                185   2e-48    
gb|KHG19524.1|  hypothetical protein F383_24471                         187   2e-48    
ref|XP_008665236.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_009411280.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_009394396.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_004306535.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_003625157.1|  Zinc finger CCCH domain-containing protein         187   2e-48    
ref|XP_002466619.1|  hypothetical protein SORBIDRAFT_01g011150          187   2e-48    
emb|CDY06895.1|  BnaA04g24200D                                          186   2e-48    
ref|XP_006446118.1|  hypothetical protein CICLE_v10014437mg             187   2e-48    
ref|XP_006421436.1|  hypothetical protein CICLE_v10004423mg             187   2e-48    
ref|XP_007015052.1|  C3HL domain class transcription factor, puta...    187   2e-48    
ref|NP_001267839.1|  zinc finger CCCH domain-containing protein 3...    187   2e-48    
ref|XP_004982091.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_006493920.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_010673641.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
gb|KHN19451.1|  Zinc finger CCCH domain-containing protein 24           184   2e-48    
ref|XP_003603107.1|  Zinc finger CCCH domain-containing protein         178   2e-48    
gb|KDO45407.1|  hypothetical protein CISIN_1g006944mg                   186   2e-48    
gb|EAZ28249.1|  hypothetical protein OsJ_12221                          187   2e-48    
ref|XP_009142026.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-48    
ref|XP_008392207.1|  PREDICTED: zinc finger CCCH domain-containin...    187   3e-48    
ref|NP_001280976.1|  zinc finger CCCH domain-containing protein 30      187   3e-48    
emb|CBI16373.3|  unnamed protein product                                185   3e-48    
ref|NP_001050982.1|  Os03g0698800                                       187   3e-48    
gb|AAO38462.1|  unknown protein                                         187   3e-48    
ref|XP_002277747.2|  PREDICTED: zinc finger CCCH domain-containin...    186   3e-48    
emb|CBI29869.3|  unnamed protein product                                186   3e-48    
ref|XP_011078886.1|  PREDICTED: zinc finger CCCH domain-containin...    186   3e-48    
ref|XP_010554845.1|  PREDICTED: zinc finger CCCH domain-containin...    186   3e-48    
ref|XP_009599703.1|  PREDICTED: zinc finger CCCH domain-containin...    186   3e-48    
ref|XP_009386116.1|  PREDICTED: zinc finger CCCH domain-containin...    186   3e-48    
ref|XP_007148879.1|  hypothetical protein PHAVU_005G022000g             186   3e-48    
gb|KHN37619.1|  Zinc finger CCCH domain-containing protein 30           186   4e-48    
ref|XP_010524053.1|  PREDICTED: zinc finger CCCH domain-containin...    186   4e-48    
emb|CDP07776.1|  unnamed protein product                                186   4e-48    
ref|XP_006651722.1|  PREDICTED: zinc finger CCCH domain-containin...    186   4e-48    
ref|XP_006589016.1|  PREDICTED: zinc finger CCCH domain-containin...    186   5e-48    
ref|XP_010257241.1|  PREDICTED: zinc finger CCCH domain-containin...    186   5e-48    
ref|XP_010257240.1|  PREDICTED: zinc finger CCCH domain-containin...    186   5e-48    
ref|XP_008444505.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    178   5e-48    
ref|XP_003540529.1|  PREDICTED: zinc finger CCCH domain-containin...    186   5e-48    
gb|KHN46294.1|  Zinc finger CCCH domain-containing protein 30           186   5e-48    
ref|NP_565962.1|  zinc finger CCCH domain-containing protein 30         186   5e-48    
ref|XP_009618285.1|  PREDICTED: zinc finger CCCH domain-containin...    186   6e-48    
ref|XP_006490064.1|  PREDICTED: zinc finger CCCH domain-containin...    177   6e-48    
gb|KHG27269.1|  hypothetical protein F383_12616                         186   6e-48    
gb|ADK63415.1|  CCCH type zinc finger protein                           184   7e-48    
gb|KDP43473.1|  hypothetical protein JCGZ_16760                         186   7e-48    
ref|XP_009396384.1|  PREDICTED: zinc finger CCCH domain-containin...    186   7e-48    
gb|EMS62800.1|  Zinc finger CCCH domain-containing protein 24           184   7e-48    
gb|EMT08668.1|  Zinc finger CCCH domain-containing protein 24           183   7e-48    
ref|XP_010505990.1|  PREDICTED: zinc finger CCCH domain-containin...    186   7e-48    
ref|XP_004229627.1|  PREDICTED: zinc finger CCCH domain-containin...    185   8e-48    
ref|XP_003559545.1|  PREDICTED: zinc finger CCCH domain-containin...    186   8e-48    
gb|EPS63683.1|  hypothetical protein M569_11102                         185   9e-48    
ref|XP_010508649.1|  PREDICTED: zinc finger CCCH domain-containin...    185   9e-48    
ref|XP_003533897.1|  PREDICTED: zinc finger CCCH domain-containin...    185   9e-48    
ref|XP_009777511.1|  PREDICTED: zinc finger CCCH domain-containin...    185   9e-48    
ref|XP_006587172.1|  PREDICTED: zinc finger CCCH domain-containin...    185   9e-48    
ref|XP_009781965.1|  PREDICTED: zinc finger CCCH domain-containin...    185   9e-48    
ref|XP_006345451.1|  PREDICTED: zinc finger CCCH domain-containin...    185   1e-47    
ref|XP_004501483.1|  PREDICTED: zinc finger CCCH domain-containin...    176   1e-47    
ref|XP_002961529.1|  hypothetical protein SELMODRAFT_62212              184   1e-47    
ref|XP_009804762.1|  PREDICTED: zinc finger CCCH domain-containin...    185   1e-47    
ref|XP_009617179.1|  PREDICTED: zinc finger CCCH domain-containin...    185   1e-47    
emb|CDY53968.1|  BnaA10g30000D                                          184   1e-47    
ref|XP_010931016.1|  PREDICTED: zinc finger CCCH domain-containin...    185   1e-47    
ref|XP_008461797.1|  PREDICTED: zinc finger CCCH domain-containin...    185   1e-47    
gb|KHN39938.1|  Zinc finger CCCH domain-containing protein 30           184   1e-47    
ref|XP_006351322.1|  PREDICTED: zinc finger CCCH domain-containin...    184   1e-47    
ref|XP_006664596.1|  PREDICTED: zinc finger CCCH domain-containin...    180   1e-47    
ref|XP_006598269.1|  PREDICTED: zinc finger CCCH domain-containin...    184   1e-47    
ref|XP_007145619.1|  hypothetical protein PHAVU_007G254100g             184   1e-47    
ref|XP_004149598.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-47    
ref|XP_004172112.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-47    
ref|XP_007052531.1|  CCCH-type zinc finger protein with ARM repea...    184   2e-47    
ref|XP_004249271.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-47    
ref|XP_002298434.1|  hypothetical protein POPTR_0001s27370g             184   2e-47    
gb|ADP02201.1|  zinc finger CCCH domain-containing protein              184   2e-47    
emb|CDX97207.1|  BnaC09g44180D                                          184   2e-47    
ref|XP_010088235.1|  Zinc finger CCCH domain-containing protein 30      184   2e-47    
ref|XP_011047401.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-47    
gb|KHG10972.1|  hypothetical protein F383_11482                         184   2e-47    
ref|XP_010031206.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-47    
ref|XP_003599158.1|  Zinc finger CCCH domain-containing protein         184   2e-47    
ref|XP_006351223.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-47    
ref|XP_006439117.1|  hypothetical protein CICLE_v10030816mg             184   3e-47    
ref|XP_006482880.1|  PREDICTED: zinc finger CCCH domain-containin...    184   3e-47    
ref|XP_004294290.1|  PREDICTED: zinc finger CCCH domain-containin...    184   3e-47    
ref|XP_003616654.1|  Zinc finger CCCH domain-containing protein         184   3e-47    
ref|XP_006439118.1|  hypothetical protein CICLE_v10030816mg             184   3e-47    
gb|KDO83403.1|  hypothetical protein CISIN_1g004911mg                   184   3e-47    
emb|CDP14011.1|  unnamed protein product                                183   3e-47    
gb|AES69409.2|  ARM repeat CCCH-type zinc finger protein                184   3e-47    
ref|XP_010031207.1|  PREDICTED: zinc finger CCCH domain-containin...    183   3e-47    
ref|XP_010278986.1|  PREDICTED: zinc finger CCCH domain-containin...    184   3e-47    
gb|KDO83402.1|  hypothetical protein CISIN_1g004911mg                   184   3e-47    
dbj|BAK06499.1|  predicted protein                                      184   3e-47    
ref|XP_003064640.1|  predicted protein                                  181   3e-47    
ref|XP_007133821.1|  hypothetical protein PHAVU_011G211700g             184   3e-47    
ref|XP_010923439.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    184   3e-47    
ref|XP_003544707.1|  PREDICTED: zinc finger CCCH domain-containin...    183   3e-47    
ref|XP_004499884.1|  PREDICTED: zinc finger CCCH domain-containin...    183   3e-47    
ref|XP_008801953.1|  PREDICTED: zinc finger CCCH domain-containin...    184   4e-47    
gb|KHN23869.1|  Zinc finger CCCH domain-containing protein 29           183   4e-47    
ref|XP_010672777.1|  PREDICTED: zinc finger CCCH domain-containin...    183   4e-47    
gb|AES99612.2|  ARM repeat CCCH-type zinc finger protein                183   4e-47    
ref|XP_004510954.1|  PREDICTED: zinc finger CCCH domain-containin...    183   4e-47    
ref|XP_008778438.1|  PREDICTED: zinc finger CCCH domain-containin...    183   4e-47    
ref|XP_011093548.1|  PREDICTED: zinc finger CCCH domain-containin...    183   5e-47    
gb|EYU18755.1|  hypothetical protein MIMGU_mgv1a005424mg                180   6e-47    
ref|XP_006421521.1|  hypothetical protein CICLE_v10006979mg             174   6e-47    
ref|XP_006838347.1|  hypothetical protein AMTR_s00103p00162010          183   6e-47    
ref|XP_004249196.1|  PREDICTED: zinc finger CCCH domain-containin...    182   6e-47    
ref|XP_011087691.1|  PREDICTED: zinc finger CCCH domain-containin...    183   6e-47    
dbj|BAG15872.1|  transcription factor                                   182   7e-47    
emb|CDY36994.1|  BnaC09g18100D                                          172   7e-47    
gb|EYU29028.1|  hypothetical protein MIMGU_mgv1a002533mg                182   7e-47    
ref|XP_008657958.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    179   7e-47    
gb|ACN39879.1|  unknown                                                 182   8e-47    
ref|XP_011084902.1|  PREDICTED: zinc finger CCCH domain-containin...    182   8e-47    
ref|XP_011047835.1|  PREDICTED: zinc finger CCCH domain-containin...    182   8e-47    
dbj|BAJ96143.1|  predicted protein                                      182   8e-47    
ref|XP_006843575.1|  hypothetical protein AMTR_s00007p00102750          182   1e-46    
ref|XP_010695261.1|  PREDICTED: zinc finger CCCH domain-containin...    182   1e-46    
ref|XP_010237224.1|  PREDICTED: zinc finger CCCH domain-containin...    181   1e-46    
ref|XP_010688398.1|  PREDICTED: zinc finger CCCH domain-containin...    177   1e-46    
ref|NP_001066886.1|  Os12g0515500                                       181   1e-46    
ref|XP_010555058.1|  PREDICTED: zinc finger CCCH domain-containin...    182   1e-46    
ref|XP_006399772.1|  hypothetical protein EUTSA_v10012818mg             182   1e-46    
ref|XP_008778227.1|  PREDICTED: zinc finger CCCH domain-containin...    182   2e-46    
emb|CDY22543.1|  BnaC03g23530D                                          180   2e-46    
ref|XP_011076700.1|  PREDICTED: zinc finger CCCH domain-containin...    181   2e-46    
ref|XP_008786132.1|  PREDICTED: zinc finger CCCH domain-containin...    181   2e-46    
ref|XP_002314035.2|  hypothetical protein POPTR_0009s06580g             181   2e-46    
gb|EYU27048.1|  hypothetical protein MIMGU_mgv1a002486mg                181   2e-46    
gb|AGT21469.1|  PEI1-like                                               172   2e-46    
ref|XP_004500271.1|  PREDICTED: zinc finger CCCH domain-containin...    181   2e-46    
ref|XP_009133516.1|  PREDICTED: zinc finger CCCH domain-containin...    180   3e-46    
ref|XP_008220916.1|  PREDICTED: zinc finger CCCH domain-containin...    181   3e-46    
ref|XP_007016084.1|  Zinc finger family protein                         181   3e-46    
ref|XP_006379630.1|  hypothetical protein POPTR_0008s06940g             180   3e-46    
ref|XP_011043783.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    180   4e-46    
ref|XP_006435753.1|  hypothetical protein CICLE_v10030920mg             180   4e-46    
gb|KDO68940.1|  hypothetical protein CISIN_1g006236mg                   180   5e-46    
ref|XP_006286367.1|  hypothetical protein CARUB_v10000345mg             180   5e-46    
ref|XP_004146938.1|  PREDICTED: zinc finger CCCH domain-containin...    170   5e-46    
ref|XP_004962884.1|  PREDICTED: zinc finger CCCH domain-containin...    179   5e-46    
ref|XP_009121831.1|  PREDICTED: zinc finger CCCH domain-containin...    179   6e-46    
ref|XP_009407642.1|  PREDICTED: zinc finger CCCH domain-containin...    180   6e-46    
ref|XP_001693433.1|  predicted protein                                  167   6e-46    
gb|EPS64556.1|  hypothetical protein M569_10225                         179   6e-46    
emb|CDY52117.1|  BnaA10g29460D                                          177   7e-46    
ref|NP_196789.1|  zinc finger CCCH domain-containing protein 56         179   7e-46    
gb|AAM20612.1|  zinc finger transcription factor-like protein           179   7e-46    
emb|CDP09199.1|  unnamed protein product                                179   7e-46    
ref|XP_002871530.1|  hypothetical protein ARALYDRAFT_488102             179   7e-46    
ref|XP_008674377.1|  PREDICTED: zinc finger CCCH domain-containin...    179   7e-46    
ref|XP_010419842.1|  PREDICTED: zinc finger CCCH domain-containin...    179   7e-46    
ref|XP_002299802.2|  hypothetical protein POPTR_0001s25960g             179   8e-46    
ref|XP_010483463.1|  PREDICTED: zinc finger CCCH domain-containin...    179   8e-46    
ref|XP_010443605.1|  PREDICTED: zinc finger CCCH domain-containin...    179   8e-46    
emb|CDY35396.1|  BnaA03g19640D                                          178   9e-46    
ref|XP_010492018.1|  PREDICTED: zinc finger CCCH domain-containin...    179   9e-46    
ref|XP_010453333.1|  PREDICTED: zinc finger CCCH domain-containin...    179   9e-46    
emb|CDX80350.1|  BnaC09g33920D                                          177   9e-46    
ref|XP_002316207.2|  zinc finger family protein                         179   9e-46    
ref|XP_010453982.1|  PREDICTED: zinc finger CCCH domain-containin...    179   9e-46    
ref|XP_010937003.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    179   1e-45    
ref|XP_006425080.1|  hypothetical protein CICLE_v10027883mg             179   1e-45    
ref|XP_006488540.1|  PREDICTED: zinc finger CCCH domain-containin...    179   1e-45    
ref|XP_006425079.1|  hypothetical protein CICLE_v10027883mg             179   1e-45    
gb|KDO66906.1|  hypothetical protein CISIN_1g005270mg                   179   1e-45    
ref|XP_011035926.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    178   1e-45    
ref|XP_010101427.1|  Zinc finger CCCH domain-containing protein 29      179   1e-45    
ref|XP_007208332.1|  hypothetical protein PRUPE_ppa002251mg             179   1e-45    
ref|XP_005843823.1|  hypothetical protein CHLNCDRAFT_139889             176   1e-45    
ref|XP_008789109.1|  PREDICTED: zinc finger CCCH domain-containin...    179   1e-45    
ref|XP_011025440.1|  PREDICTED: zinc finger CCCH domain-containin...    179   1e-45    
ref|NP_200670.1|  zinc finger CCCH domain-containing protein 66         178   1e-45    
ref|XP_009120378.1|  PREDICTED: zinc finger CCCH domain-containin...    177   1e-45    
ref|XP_006488539.1|  PREDICTED: zinc finger CCCH domain-containin...    179   1e-45    
ref|XP_007142204.1|  hypothetical protein PHAVU_008G260900g             176   1e-45    
ref|XP_010541453.1|  PREDICTED: zinc finger CCCH domain-containin...    178   2e-45    
ref|XP_008233766.1|  PREDICTED: zinc finger CCCH domain-containin...    178   2e-45    
ref|XP_004307657.1|  PREDICTED: zinc finger CCCH domain-containin...    178   2e-45    
ref|XP_006401060.1|  hypothetical protein EUTSA_v10012984mg             178   2e-45    
ref|XP_010109132.1|  Zinc finger CCCH domain-containing protein 54      171   2e-45    
ref|XP_010067533.1|  PREDICTED: zinc finger CCCH domain-containin...    178   2e-45    
ref|XP_007141759.1|  hypothetical protein PHAVU_008G223400g             178   2e-45    
ref|XP_010535372.1|  PREDICTED: zinc finger CCCH domain-containin...    177   2e-45    
ref|XP_010516193.1|  PREDICTED: zinc finger CCCH domain-containin...    177   2e-45    
gb|EPS73791.1|  hypothetical protein M569_00965                         176   2e-45    
ref|XP_006280195.1|  hypothetical protein CARUB_v10026101mg             177   2e-45    
gb|ACN25172.1|  unknown                                                 177   2e-45    
ref|XP_010504473.1|  PREDICTED: zinc finger CCCH domain-containin...    177   2e-45    
ref|XP_006355652.1|  PREDICTED: zinc finger CCCH domain-containin...    178   2e-45    
ref|XP_010097625.1|  Zinc finger CCCH domain-containing protein 66      178   2e-45    
ref|XP_004307656.1|  PREDICTED: zinc finger CCCH domain-containin...    178   2e-45    
gb|ADL36657.1|  C3HL domain class transcription factor                  178   2e-45    
gb|EMT02642.1|  Zinc finger CCCH domain-containing protein 67           176   2e-45    



>emb|CDP14823.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 209/395 (53%), Positives = 253/395 (64%), Gaps = 69/395 (17%)
 Frame = -1

Query  1361  MTSVCEFQNISYPF----YL-KKAMAELDVSPRKILSRRGAAEA-------DGFLDSPTK  1218
             MTSV   Q   + F    YL KK+  E+++ PRK+LSRR AA         D F+DSP K
Sbjct  127   MTSVFADQQQQHKFHQLSYLNKKSPREIEIPPRKLLSRRAAASGSMHLDSGDMFMDSP-K  185

Query  1217  IEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  1038
              E  + QKFLPYN+++D+D   D YS+DHFRMYEFKVR+CTRSRSHDWTDCPFAHPGEKA
Sbjct  186   AEEALLQKFLPYNNIDDDD--ADPYSSDHFRMYEFKVRKCTRSRSHDWTDCPFAHPGEKA  243

Query  1037  RRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKV  858
             RRRDPR++HYSGTVCSEFR+G C RGDNCE+AHGVFE WLHP+RYRTEACKDGKNCKRKV
Sbjct  244   RRRDPRRYHYSGTVCSEFRRGNCSRGDNCEYAHGVFECWLHPSRYRTEACKDGKNCKRKV  303

Query  857   CFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRK----NLCCH-------SPTSTLMG  711
             CFFAHS RQLR+LP N + T S SPV+ P EK  +     N CC        SPTSTLMG
Sbjct  304   CFFAHSPRQLRVLPANCHETAS-SPVNSPVEKQQQHHRNVNHCCMYCHSVAASPTSTLMG  362

Query  710   ISHSS-------------------PPLSPAKTPF-----CGYGMTAAKLIEMMSYKEALT  603
             +SH S                    P+S  K  F     CG     +  +  MSYK+AL 
Sbjct  363   MSHLSPPLSPPLSPPISPAKAAQFSPVSRYKDHFASVEPCGMAQFGSGGMGGMSYKDALA  422

Query  602   QLVNSLEQVNLNPLSP-ATTTINRMTRP-----FSGNDPIQFSLPNSPSTPGRHSSGSEF  441
             +L++S+E + +N  S  A  + N ++ P     F+G+D  QF L  SPSTP      S+F
Sbjct  423   ELMSSIEAMRVNESSSRAAASNNGISLPWIDVNFNGDDQQQFIL--SPSTPS--PGTSKF  478

Query  440   LT---PQRN----TAFSDNGGLTGIDLDWVNDLLT  357
             L+   P RN      F++N GL G DL+WVNDLLT
Sbjct  479   LSRNFPSRNFIEENKFTEN-GLAGPDLEWVNDLLT  512



>ref|XP_009595391.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Nicotiana tomentosiformis]
Length=428

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 203/297 (68%), Gaps = 46/297 (15%)
 Frame = -1

Query  1331  SYPFYL-KKAMAELDVSPRKILSRRGAAE----ADGFLDSPTKIEGGVFQKFLPYNDVED  1167
             S+  YL KK++ ++D+ PRK+LSRR        +D F+DSP      +FQKFLPYN + D
Sbjct  16    SHQLYLNKKSLRDIDIPPRKLLSRRSNLSVDPVSDMFMDSPKSDSDTLFQKFLPYNSL-D  74

Query  1166  EDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSE  987
             ED D D YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR+FHYSGTVCSE
Sbjct  75    ED-DSDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGTVCSE  133

Query  986   FRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNR  807
             FRKG C RGDNCEFAHGVFE WLHP RYRTEACKDGKNCKRKVCFFAH+ RQLR+LP + 
Sbjct  134   FRKGNCSRGDNCEFAHGVFECWLHPTRYRTEACKDGKNCKRKVCFFAHTPRQLRVLPPSC  193

Query  806   Y-STGS-----LSPVHDPAEKNLRKNLCCH-------SPTSTLMGISH------------  702
             + S+GS      SPVH+   +NL  N CC        SPTSTLMG+SH            
Sbjct  194   HESSGSGSSPRNSPVHEKKYRNL--NHCCMFCHSVSASPTSTLMGMSHMSPPMSPSLSPP  251

Query  701   --------SSPPLSPAKTPF----CGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLN  567
                     SSP +S     F      +GM       +MSYK+ALT+LV SLE +N+N
Sbjct  252   LSPAKTQFSSPMMSRYSDRFGSVESSFGMGQLDHAGLMSYKDALTELVTSLEAMNVN  308



>ref|XP_009789499.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Nicotiana sylvestris]
Length=430

 Score =   313 bits (802),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 197/293 (67%), Gaps = 40/293 (14%)
 Frame = -1

Query  1331  SYPFYL-KKAMAELDVSPRKILSRRGAAEAD----GFLDSPTKIEGGVFQKFLPYNDVED  1167
             S+  YL KK++ ++D+ PRK+LSRR    AD     F+DSP      +FQKFLPYN + D
Sbjct  16    SHQLYLNKKSLRDIDIPPRKLLSRRSNLSADPVSDMFMDSPKSDSDTLFQKFLPYNSL-D  74

Query  1166  EDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSE  987
             ED D D YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR+FHYSGTVCSE
Sbjct  75    ED-DSDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGTVCSE  133

Query  986   FRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP--V  813
             FRKG C RGDNCEFAHGVFE WLHP RYRTEACKDGKNCKRKVCFFAH+ RQLR+LP   
Sbjct  134   FRKGNCSRGDNCEFAHGVFECWLHPTRYRTEACKDGKNCKRKVCFFAHTPRQLRVLPPSC  193

Query  812   NRYSTGSLSPVHDPAEKNLRK-NLCCH-------SPTSTLMGISHS--------------  699
             +  S    SP + P EK  R  N CC        SPTSTLMG+SH               
Sbjct  194   HESSGPGSSPRNSPVEKKYRNLNHCCMFCHSVSASPTSTLMGMSHMSPPMSPSLSPPLSP  253

Query  698   -----SPPLSPAKTPFCGY----GMTAAKLIEMMSYKEALTQLVNSLEQVNLN  567
                  S P+S     F       GM       +MSYK+ALT+LV+SLE +N+N
Sbjct  254   AKTQFSSPMSRYSDRFGSVESSCGMGQLDHAGLMSYKDALTELVSSLEAMNVN  306



>ref|XP_002274948.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Vitis 
vinifera]
Length=360

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 224/363 (62%), Gaps = 54/363 (15%)
 Frame = -1

Query  1334  ISYPFYLKKAMAELDVSPRKILSRRGAA--EADGFLDSPTKIEGG---VFQKFLPYNDVE  1170
             +S+  + KK    +D+ PRK+LSRR  +   +D F DSP  +      +FQKFLP+N   
Sbjct  13    LSHQLFNKKT---IDIPPRKLLSRRANSLESSDIFSDSPKALGAAGETLFQKFLPFN--C  67

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
              +D++ D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++HYSGTVCS
Sbjct  68    GDDDESDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYSGTVCS  127

Query  989   EFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVN  810
             E+R+G C RGDNCEF+HGVFE WLHPARYRTEACKDGKNCKRKVCFFAHS +QLR+LP++
Sbjct  128   EYRRGGCSRGDNCEFSHGVFECWLHPARYRTEACKDGKNCKRKVCFFAHSRKQLRVLPLH  187

Query  809   RYSTGSLSPVHDPAEKNLRKNLCC------HSPTSTLMGISH---------SSPPLSPAK  675
               + G+      P  K    N CC       SPTSTLMG SH            P++   
Sbjct  188   SQTNGT------PDVKFSPLNHCCVFCHSATSPTSTLMGTSHFSPPASPSPPLSPVNATY  241

Query  674   TPFCGYGMTAAKLIE---------MMSY-KEALTQLVNSLEQVNLNPLSPATTTINRMTR  525
             +P   Y   +  L           M+SY K+ + +L++SLE +N+N  SP  T    +  
Sbjct  242   SPISRYNDRSTSLDSSNMSQFRHVMLSYNKDVVAELMSSLEAININEASPEHTNP-LVDS  300

Query  524   PFSGNDPIQFSLPNSPSTPGRHSSGSEFL--------TPQRNTAFSDNGGLTGIDLDWVN  369
              F+  D  QFSL  SPS P   +SGS           +   +   S+NG     DL WVN
Sbjct  301   CFASEDHQQFSL--SPSIPN--ASGSRHFFNGDCSSKSSIEDKLSSENGSWACPDLGWVN  356

Query  368   DLL  360
             DLL
Sbjct  357   DLL  359



>ref|XP_004243370.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Solanum 
lycopersicum]
Length=417

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/399 (48%), Positives = 231/399 (58%), Gaps = 82/399 (21%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAEADG-------FLDSPTKIEGGVFQKFLPYNDVEDEDED  1155
             KK++ ++D+ PRK+LSRR    +         F+DSP       FQKFLPYN ++D+D+ 
Sbjct  21    KKSLRDIDIPPRKLLSRRATLSSIDHVVSDVQFMDSPKSESDAQFQKFLPYNSLDDDDDA  80

Query  1154  GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKG  975
                 S+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR+FHYSGTVCSEFRKG
Sbjct  81    DPY-SSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGTVCSEFRKG  139

Query  974   KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTG  795
              C RGDNCEFAHGVFE WLHP RYRTEACKDGKNCKRK+CFFAH+ RQLR+LP   Y +G
Sbjct  140   NCSRGDNCEFAHGVFECWLHPTRYRTEACKDGKNCKRKICFFAHTPRQLRVLPPGCYESG  199

Query  794   SLSPVHDPAEKNLRK-NLCC-------HSPTSTLMGISHS--------------------  699
             S SP +  +EK  R  N CC        SPTSTL+G+SH                     
Sbjct  200   S-SPKNLNSEKKYRNLNHCCVFCHSVSASPTSTLIGMSHISPPMSPSLSPPLSPANRNQF  258

Query  698   SPPLSPAKTPFCGYGMTAAKLIEM-----MSYKEALTQLVNSLEQVNLN--PLSPATTTI  540
             S P+S     F     +++ + ++     MSYK+ALT+LV+SLE +N+N  P S A  + 
Sbjct  259   SSPISRYSERFGSVEASSSGMCQLDPSGLMSYKDALTELVSSLEAMNVNHEPNSSAAAST  318

Query  539   NRMTRPFSGN--------------DPIQFSLPNS-------------------PSTPGRH  459
             +  +  F GN              D  QF L  S                   PS     
Sbjct  319   HSHSVNFDGNLPWLDVNFNNSSYDDQQQFLLSPSTPSPSPISNSRTKFYAREFPSASPVS  378

Query  458   SSGSEFLTPQRNTA-----FSDNGGLTGIDLDWVNDLLT  357
             SS   F+    N       +SDNG   G DL WVNDLLT
Sbjct  379   SSRLSFVEELNNNNGTNRFYSDNGLSGGPDLGWVNDLLT  417



>gb|EPS67507.1| hypothetical protein M569_07268 [Genlisea aurea]
Length=343

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 231/360 (64%), Gaps = 42/360 (12%)
 Frame = -1

Query  1361  MTSVCEFQN----ISYPFYL-KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQ  1197
             M SVC  Q+     S+   L KK++ E+D+ PRK+L RRG   A     +  ++E   F 
Sbjct  1     MGSVCAEQHHKFHSSHQLNLSKKSLREIDIPPRKLLGRRGMVAA-----AAAEVEDAAFS  55

Query  1196  KFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRK  1017
             KFLP N VE+ED D D YS+DHFRM+EFKVR+C RSRSHDWTDCPFAHPGEKARRRDPR+
Sbjct  56    KFLPCNSVEEED-DSDPYSSDHFRMFEFKVRKCNRSRSHDWTDCPFAHPGEKARRRDPRR  114

Query  1016  FHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSS  837
             FHYSG VCS+FRKG CG+GDNCE AHGVFE WLHP+RYRTEACKDGKNCKRKVCFFAHS+
Sbjct  115   FHYSGNVCSDFRKGHCGKGDNCESAHGVFECWLHPSRYRTEACKDGKNCKRKVCFFAHST  174

Query  836   RQLRILPVNRYSTGSLSPVHDPAEKNLRKNLC--CH----SPTSTLMGISHSSPPLSPAK  675
             RQLRILP N  S    SP  +   +NL  N C  CH    SPTSTL+  S +SPP+SP  
Sbjct  175   RQLRILPENPPSPPLNSPNREKRYQNL-NNCCVFCHSVNPSPTSTLIHASRASPPMSPPI  233

Query  674   TPFCG--YGMTAAKLIE--MMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGND  507
             +P C   + +   +      ++YKEA+ +L+ S + +N+N  +P    +  +   F+  D
Sbjct  234   SPMCSPEFSLYGDRFGSPGGITYKEAMNELMASFDSMNVNAAAP--NNLPWLDVNFNFED  291

Query  506   PIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFS----------DNGGLTGIDLDWVNDLLT  357
               QF L  +P +P          T +R   FS          +NG L+G DL WVNDLLT
Sbjct  292   QPQFVLSPAPISPP--------TTLRRGNLFSIDDGGRYHGGENGNLSGPDLGWVNDLLT  343



>ref|XP_011029046.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Populus 
euphratica]
Length=382

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 188/392 (48%), Positives = 234/392 (60%), Gaps = 69/392 (18%)
 Frame = -1

Query  1361  MTSVCEFQNISY-PFYL---KKAMAELDVSPRKILSRRGAAEADGFLD-SPTKIEGGVFQ  1197
             M+++C  Q+  Y P  L   K+ + +L++ PRK+L+++   E+   LD SP +      Q
Sbjct  1     MSTICAEQHKPYTPHQLLSPKRPLRDLEILPRKLLTKKTHQES---LDMSPYETN---LQ  54

Query  1196  KFLPYNDVEDE---DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
             +FLPYND  +E   D + D YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD
Sbjct  55    RFLPYNDYSNEKVVDGELDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  114

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PR+FHYSGTVC EF++G C RG+NCEF+HGVFE WLHP+RYRTEACKDGKNCKRKVCFFA
Sbjct  115   PRRFHYSGTVCPEFKRGGCSRGENCEFSHGVFECWLHPSRYRTEACKDGKNCKRKVCFFA  174

Query  845   HSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLC--CH----SPTSTLMGISHSSPPLS  684
             HS RQLRILP       SL+    P       + C  CH    SPTSTL+G+SH SPPLS
Sbjct  175   HSPRQLRILPEVSSRNKSLA---SPCSSLNHSHCCVVCHSMTSSPTSTLLGMSHMSPPLS  231

Query  683   PAK---------------TPFCGYGMTAAKL-IEMMSYKEALTQLVNSLEQVNLNPLSPA  552
             P+                +P   Y  T +K    ++SYK+ LT++++SLE +N N  +  
Sbjct  232   PSLSPPLSPVKHQSLSGFSPISRYNETLSKFRAGVVSYKDVLTEVMSSLEAMNFNEGASV  291

Query  551   ---------------TTTINRMTRPFSGNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTA  417
                            +TT   +   FSG D  QF L  SPSTP   S+         N  
Sbjct  292   SSPMSSSTNHNRNVNSTTPWNIDVSFSGEDQPQFIL--SPSTPTPSSNFFNGDCSSNNGL  349

Query  416   FSD----------NGGLTGI---DLDWVNDLL  360
             F D          +GGL      DL WVN+LL
Sbjct  350   FVDDKINDHNNIGDGGLACTSDPDLGWVNELL  381



>ref|XP_006372730.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP50527.1| zinc finger family protein [Populus trichocarpa]
Length=382

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 189/392 (48%), Positives = 235/392 (60%), Gaps = 69/392 (18%)
 Frame = -1

Query  1361  MTSVCEFQNISY-PFYL---KKAMAELDVSPRKILSRRGAAEADGFLD-SPTKIEGGVFQ  1197
             M+++C  Q+  Y P  L   K+   +L++ P K+L+++   E    LD SP +      Q
Sbjct  1     MSTICAEQHKPYTPHQLLSPKRPFRDLEILPGKLLTKKTHQET---LDMSPYETN---LQ  54

Query  1196  KFLPYNDVEDE---DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
             +FLPYND  +E   D + D YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD
Sbjct  55    RFLPYNDYSNEKVLDGELDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  114

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PR+FHYSGTVC EF++G C RG+NCEF+HGVFE WLHP+RYRTEACKDGKNCKRKVCFFA
Sbjct  115   PRRFHYSGTVCPEFKRGGCSRGENCEFSHGVFECWLHPSRYRTEACKDGKNCKRKVCFFA  174

Query  845   HSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLC--CH----SPTSTLMGISHSSPPLS  684
             HS RQLRILP       SL+    P       + C  CH    SPTSTL+G+SH SPPLS
Sbjct  175   HSPRQLRILPEVSSRNKSLA---SPCSSLNHSHCCVVCHSMTSSPTSTLLGMSHMSPPLS  231

Query  683   PAK---------------TPFCGYGMTAAKL-IEMMSYKEALTQLVNSLEQVNLN-----  567
             P+                +P   Y  T +K    ++SYK+ L++L++SLE +N N     
Sbjct  232   PSLSPPLSPVKHQSLSGFSPISRYNETLSKFRAGVVSYKDVLSELMSSLEAMNFNEGASV  291

Query  566   --PLSPAT--------TTINRMTRPFSGNDPIQFSLPNSPSTP--------GRHSSGSEF  441
               P+S +T        TT   +   FSG D  QF L  SPSTP        G  SS    
Sbjct  292   SSPMSLSTNHNRNVNSTTPWNIDVSFSGEDQPQFIL--SPSTPTPSSKFFNGDCSSNKGL  349

Query  440   LTPQRNTAFSD--NGGLTGI---DLDWVNDLL  360
                 +    ++  +GGL      DL WVN+LL
Sbjct  350   FVDDKINDHNNIGDGGLACTSDPDLGWVNELL  381



>ref|XP_011100356.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Sesamum indicum]
Length=397

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 199/409 (49%), Positives = 243/409 (59%), Gaps = 85/409 (21%)
 Frame = -1

Query  1364  VMTSVCEFQ----NISYPFYL-KKAMAELDVSPRKILSRRGAA------EADGFLDSPTK  1218
             +M SVC  Q    + S+  YL KK++ E+D+ PRK+LSRR +A      +    +DSP K
Sbjct  1     MMGSVCAEQQHKFHHSHQLYLTKKSLREIDIPPRKLLSRRSSAPSPSPADMSFMMDSP-K  59

Query  1217  IEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  1038
              E  VF KFLP N+++D+D D   YS+DHFRMYEFKVR+C RSRSHDWTDCPFAHPGEKA
Sbjct  60    AEDTVFSKFLPCNNLDDDDSD--PYSSDHFRMYEFKVRKCNRSRSHDWTDCPFAHPGEKA  117

Query  1037  RRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKV  858
             RRRDPR++HYSGTVCSEFRKG C +GDNCEF+HGVFE WLHP RYRTEACKDGKNCKRKV
Sbjct  118   RRRDPRRYHYSGTVCSEFRKGHCSKGDNCEFSHGVFECWLHPTRYRTEACKDGKNCKRKV  177

Query  857   CFFAHSSRQLRILPVNRYSTGSLSPVHDP-------AEKNLRK-NLCC-------HSPTS  723
             CFFAHS+RQLRILP         SP H P        EK  R  N CC        SPTS
Sbjct  178   CFFAHSTRQLRILP-------ETSPPHSPRMNSPTTMEKKYRSLNQCCLFCHSMTASPTS  230

Query  722   TLMG-ISHSSPPLSPAKTPFC---------------GYGMTAAKLIEM------------  627
             TLMG +SH+SPPLSP  +P C                YG     L               
Sbjct  231   TLMGNMSHASPPLSPPISPVCSSDFSLYGDRYGNIEAYGDRFGNLGSCCTLPKLNGGGGT  290

Query  626   -MSYKEALTQLVNSLEQVNLN------PLSPATTTINRMTRPFSGNDPIQFSLPNSPSTP  468
              MSYK+ALT+L+ S E +N+N      P + ++  +  +   F+  +  QF L  SPSTP
Sbjct  291   GMSYKDALTELMASFEAMNVNHEAVSSPAAVSSGNLPWLDVNFNVEEQPQFLL--SPSTP  348

Query  467   GRHSSGS----------EF--LTPQRNTAFSDNGGLTGIDLDWVNDLLT  357
                ++ +          EF       ++ ++    L G DL WVNDLLT
Sbjct  349   TPTATAASRGHGKFFHGEFSGRNLMEDSRYNSESNLAGPDLGWVNDLLT  397



>ref|XP_007149822.1| hypothetical protein PHAVU_005G101500g [Phaseolus vulgaris]
 gb|ESW21816.1| hypothetical protein PHAVU_005G101500g [Phaseolus vulgaris]
Length=391

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 189/398 (47%), Positives = 235/398 (59%), Gaps = 72/398 (18%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL----KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQK  1194
             MTSVC  Q+  +P +     KK + E+D+ PRK+L+RR  A A G  D  +  +  + QK
Sbjct  1     MTSVCAQQHKFHPSHQFLSPKKTLREIDIPPRKLLTRRATA-ACGISDLFS--DDTMLQK  57

Query  1193  FLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             FLP N+++D DED D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++
Sbjct  58    FLPSNNLDDSDED-DPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRY  116

Query  1013  HYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSR  834
             HYSGTVC ++R+G C RGD CE+AHGVFE WLHPA+YRTEACKDGKNCKRKVCFFAH+ R
Sbjct  117   HYSGTVCPDYRRGGCNRGDACEYAHGVFECWLHPAKYRTEACKDGKNCKRKVCFFAHTPR  176

Query  833   QLRILPVNRYS------TGSLSPVHDPAEKNLRKNLC--CH-----------SPTSTLMG  711
             QLRILPV   S      T S++ + + A ++   N C  CH           SPTSTL  
Sbjct  177   QLRILPVTSPSSDDMSCTKSINKLFNHASRS-NNNCCLFCHCVSSSSSSTTASPTSTLFN  235

Query  710   ISHSSPPLSP-----------------AKTPFCGYGMTAAKLIE-MMSYKEALTQLVNSL  585
             ISH SPPLSP                 + +P   YG         ++SYKEA  + VNSL
Sbjct  236   ISHYSPPLSPSSSSSPPPSPLKPRNGVSVSPISRYGAANVNPHHGVVSYKEAFAEFVNSL  295

Query  584   EQVNLNPLSPAT-----------TTIN-----RMTRPFSGN-----DPIQFSL-PNSPST  471
             E ++LN  SP +            ++N     +  +P S +     DP QF   P S  T
Sbjct  296   EGLSLNEGSPVSGAKPLNLPWFDVSLNCEEQQQQRQPLSASSFGCEDPQQFIYSPPSTRT  355

Query  470   PGRHSSGSEFLTPQRNTAFSDNGGLTGI-DLDWVNDLL  360
             P      S       N      GG + + DL WVN+LL
Sbjct  356   PTNVKLCSNRFIGNDNKVV---GGESNVPDLAWVNELL  390



>ref|XP_004301223.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 181/408 (44%), Positives = 234/408 (57%), Gaps = 79/408 (19%)
 Frame = -1

Query  1361  MTSVC----EFQNISYPFYLKKA---MAELDVSPRKILSRRGAAEAD-----GFLDSP--  1224
             M+SVC    +F    +    KK+   + E+D+ PRK+L+RR AA  D        DSP  
Sbjct  1     MSSVCAEQHKFHTSHHLLSSKKSHHLLREVDIPPRKLLTRRSAAHQDISSSPDMYDSPRF  60

Query  1223  TKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
             +  +  V +KFLPYN  +D+D+     S+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE
Sbjct  61    SASDEAVLRKFLPYNSDDDDDDPY---SSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  117

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPR +HYSGTVC+++R+G C RGD+CEFAHGVFE WLHPARYRTEACKDGK+CKR
Sbjct  118   KARRRDPRCYHYSGTVCADYRRGGCSRGDSCEFAHGVFECWLHPARYRTEACKDGKHCKR  177

Query  863   KVCFFAHSSRQLRILPVNRYSTGS-----LSPVHDPAEKNLR----------KNLCCH--  735
             KVCFFAH+  QLRILPVN   + S     +SP     +K+ +             CC   
Sbjct  178   KVCFFAHTPHQLRILPVNHSRSSSPDEVVISPGSGCCKKSSKYLNNSANSPSSTHCCSFC  237

Query  734   -----SPTSTLMGISHSSPPLSPAKTPF-CGYGMTAAKLIEMMSYKEALTQLVNSLEQVN  573
                  SPTSTL+G+S  SP    +K  F  G+    A    M SYK+ L++L+ SLE++ 
Sbjct  238   RSVTCSPTSTLLGMSPMSPYGDESKCHFSSGFNQMHAGSAGMPSYKDVLSELMTSLEKMK  297

Query  572   LNPLSPATTTINRMT------------------RPFSGNDPIQFSL-PNSPSTPGRHSSG  450
             +N +  ATT ++                       F+ +   QF L PNS  +P   S+G
Sbjct  298   VNNMEAATTPVSSPISSVASSYRNTPWVDVSSYNAFAEDQQQQFILSPNSIPSPL--SAG  355

Query  449   SEFLT--------PQRNTAFSDNGGLTGI----------DLDWVNDLL  360
             + F +         +++  F +    T I          DL WVNDLL
Sbjct  356   TNFFSHRCSSGNGSRKSLVFDEQNKATDIYGGGCNSPDPDLGWVNDLL  403



>ref|XP_003540372.2| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Glycine max]
Length=486

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 222/404 (55%), Gaps = 83/404 (21%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL----KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQK  1194
             M+SVC  Q+  YP +     KK + E+D+ PRK+L+RR AA   G        E  + QK
Sbjct  95    MSSVCAKQHKFYPSHQLLSPKKTLREIDIPPRKLLTRRAAACVGG--TDVYSSEETMLQK  152

Query  1193  FLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             FLP ND    DED D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++
Sbjct  153   FLPSND---SDED-DPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRY  208

Query  1013  HYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSR  834
             HYSGTVC E+ +G C RGD CE+AHGVFE WLHP+RYRTEACKDG+NCKRKVCFFAH+ R
Sbjct  209   HYSGTVCPEYPRGGCSRGDACEYAHGVFECWLHPSRYRTEACKDGRNCKRKVCFFAHTPR  268

Query  833   QLRILPVNRYSTGSLSPVHDPAEKNLRKNL-------------CCH----------SPTS  723
             QLRILPV   +T S S    P +KNL K L             CC           SPTS
Sbjct  269   QLRILPV---TTSSPSSNDMPCKKNLNKLLNHASKSNNNNNNNCCLFCHCGASSSVSPTS  325

Query  722   TLMGISH----------------------SSPPLSPAKTPFCGYGMTAAKLIEMMSYKEA  609
             TL G+SH                         P+SP    +    M     +  +SYK+ 
Sbjct  326   TLFGMSHFSPPVSPSSSSSPPPSPLKPRSVVSPISPISR-YSAVNMNPHHGV--VSYKDM  382

Query  608   LTQLVNSLEQVNLNPLSPAT--TTINRMTRPFSGNDPIQFSLPNSPSTPGRHSSGSEFL-  438
               +LVNSLE ++ N  SP +     N      S  +  Q   P   S+ G     ++F+ 
Sbjct  383   FAELVNSLEGLSFNEGSPVSGAKAPNFPWLDVSLEEQQQQQNPFIVSSFGCEDKQNQFIF  442

Query  437   ------TPQRNTAFSDN----------GG--LTGIDLDWVNDLL  360
                   TP  N  F  N          GG  + G DL WVN+LL
Sbjct  443   SPPSIQTPT-NGKFCRNRFMGNDNKVVGGADVNGPDLAWVNELL  485



>ref|XP_007198967.1| hypothetical protein PRUPE_ppa015121mg [Prunus persica]
 gb|EMJ00166.1| hypothetical protein PRUPE_ppa015121mg [Prunus persica]
Length=429

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 206/332 (62%), Gaps = 58/332 (17%)
 Frame = -1

Query  1361  MTSVC-EFQNISYPFYL----KKAM--AELDVSPRKILSRRG------AAEADGFLDSPT  1221
             MTSVC E Q+  +P +     KK++    +D+ PRK+L+RR       ++  D +    +
Sbjct  1     MTSVCAEQQHKFHPSHQLLSSKKSLHNTTIDIPPRKLLTRRTQTQDFPSSSPDMYSPRFS  60

Query  1220  KIEGGVFQKFLPYNDVEDEDEDGDR-----YSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               +  + +KFLPYN   D+ ++ D      YS+DHFRM+EFKVRRCTRSRSHDWTDCPFA
Sbjct  61    TADEALLRKFLPYNAAADDSDEDDAHSSDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFA  120

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPR++HYSGTVC+++R+G C RGD+CEFAHGVFE WLHPARYRTEACKDGK
Sbjct  121   HPGEKARRRDPRRYHYSGTVCADYRRGSCSRGDSCEFAHGVFECWLHPARYRTEACKDGK  180

Query  875   NCKRKVCFFAHSSRQLRILPVNR---YSTGSLSPVHDPAEKNLRKN-----------LCC  738
              CKRKVCFFAH+  QLR+LPV     ++  +LSP       +L  +           L C
Sbjct  181   QCKRKVCFFAHTPHQLRVLPVQSSADHTAAALSPTPKKKYGHLSNSVGSPGSNQHCCLFC  240

Query  737   H------SPTSTLMGISHSSPPLSPA-----------KTPF--------CGYGMTAAKLI  633
             H      SPTSTL+G+SH SPPLSPA            +P          G     A   
Sbjct  241   HSAVTTSSPTSTLLGMSHLSPPLSPAGNHCSSVNGFHNSPVMSRCSGLGLGLDQMHASTG  300

Query  632   EMMSYKEALTQLVNSLEQVNLNPLSPATTTIN  537
              MMSYK+ L +LVNSLE V  +  + A++ IN
Sbjct  301   GMMSYKDVLAELVNSLEAVKFSEAA-ASSPIN  331



>gb|AJB84605.1| C3H zinc finger protein [Glycine max]
Length=391

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 176/401 (44%), Positives = 217/401 (54%), Gaps = 78/401 (19%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL----KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQK  1194
             M+ VC  Q+  YP +     KK + E+D+ PRK+L+RR A    G   +    E  + QK
Sbjct  1     MSGVCAEQHKFYPSHQLLSPKKTLREIDIPPRKLLTRRAAKCVGG---TDVYSEETMQQK  57

Query  1193  FLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             FLP ND    DED D YS+DHFRM+EFKVR+CTRSRSHDWTDCPFAHPGEKARRRDPR++
Sbjct  58    FLPSND---SDED-DPYSSDHFRMFEFKVRQCTRSRSHDWTDCPFAHPGEKARRRDPRRY  113

Query  1013  HYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSR  834
             HYSGTVC E+R+G C R D CE+AHGVFE WLHP+RYRTEACKDG+NCKRKVCFFAH+ R
Sbjct  114   HYSGTVCPEYRRGGCSRDDACEYAHGVFECWLHPSRYRTEACKDGRNCKRKVCFFAHTPR  173

Query  833   QLRILPVNRYSTGSLSPVHDPAEKNLRK--------------NLCCH-------SPTSTL  717
             QLRILPV    T S S    P +KNL++               L CH       SPTSTL
Sbjct  174   QLRILPV----TSSPSSNDMPCKKNLKQVLNHASKTNNNNNCCLFCHCGASSSASPTSTL  229

Query  716   MGISH---------------SSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLE  582
              G+SH               S      A +P   Y         ++SYK+  T+LVNSLE
Sbjct  230   FGMSHFSPPLSPSSSSSPPPSPLKPRNAVSPISRYSAVNVYPHHVVSYKDVFTELVNSLE  289

Query  581   QVNLNPLSPAT---------------------TTINRMTRPFSGNDPIQ------FSLPN  483
             +++ N  SP +                        N    P  G +  Q      FS P+
Sbjct  290   RLSFNEGSPVSGAKAPNFPWLDVSLNCEEQQQQQQNPFIVPSFGCEDQQQQNQFIFSPPS  349

Query  482   SPSTPGRHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLL  360
               +        + F+    N        + G DL WVN+LL
Sbjct  350   IQTPTNGKFCSNRFMGNDNNNKVVGGADVNGPDLAWVNELL  390



>ref|XP_010260283.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Nelumbo nucifera]
Length=388

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 173/393 (44%), Positives = 216/393 (55%), Gaps = 65/393 (17%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYLKKAMAELDVSPRKILSRR------GAAEADGFLDSPTKIE----  1212
             M+S+C   + S+    KK + ++D    K+LSRR           D F D+  K      
Sbjct  1     MSSLCAENHQSF-LSGKKGLGDIDAQSGKLLSRRVKLTVSSDTSPDLFGDAMEKPSFEET  59

Query  1211  GGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARR  1032
               +  KFLPYN    +D+D D YS D FRMYEFKVRRC RSRSHDWTDCPFAHPGEKARR
Sbjct  60    HHLVHKFLPYNG--GDDDDSDPYSNDEFRMYEFKVRRCMRSRSHDWTDCPFAHPGEKARR  117

Query  1031  RDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCF  852
             RDPR+FHYSG VC++FR+G C RGD CEFAHGVFE WLHPARYRT+ACKDGKNCKRKVCF
Sbjct  118   RDPRRFHYSGNVCTDFRRGGCRRGDACEFAHGVFECWLHPARYRTQACKDGKNCKRKVCF  177

Query  851   FAHSSRQLRILPVNRYSTGS------LSPV-HD----PAEKNLRKNLCC-------HSPT  726
             FAH+SRQLR+LP+    T +       SP+ HD        +   N CC        SPT
Sbjct  178   FAHTSRQLRVLPLRSVETQTSPSPTVTSPLGHDKYPISVFSDANSNHCCVFCHSAASSPT  237

Query  725   STLMGISHSS--------------------------PPLSPAKTPFCGYGMTAAKLIEMM  624
             STL   SH S                           PLS          +    L+  +
Sbjct  238   STLKDFSHLSPPLSPTLSPPLSPDGSLGNEGSMRGFSPLSRYNEHIDPIALNQF-LLGPL  296

Query  623   SYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGNDPIQFSLPNSPSTP-GRHSSGS  447
             +YK AL++LV+S+E ++L+  SP       ++   +  +  QF L  SPS P     SG+
Sbjct  297   NYKGALSELVSSMEAMDLSSTSPTCVNNRYLSSSANFEEQQQFVL--SPSNPQSSFGSGN  354

Query  446   EFLTPQRNTAFSD----NGGLTGIDLDWVNDLL  360
              F     +  F+D    N G    DLDWVN+L+
Sbjct  355   YFNEDCLSNGFTDEKTNNNGRCYPDLDWVNELV  387



>ref|XP_010070036.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Eucalyptus grandis]
 gb|KCW89555.1| hypothetical protein EUGRSUZ_A01839 [Eucalyptus grandis]
Length=370

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 161/340 (47%), Positives = 203/340 (60%), Gaps = 68/340 (20%)
 Frame = -1

Query  1202  FQKFLPYNDVEDEDEDGDR-YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
              Q+FLP+N+  D++++    YS+DHFRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRD
Sbjct  39    LQRFLPFNNGGDDEDEDSDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  98

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PRK+HYSGTVC+E+R+G C RGDNCEFAHGVFE WLHP++YRTEACKDGKNCKRKVCFFA
Sbjct  99    PRKYHYSGTVCAEYRRGSCSRGDNCEFAHGVFECWLHPSKYRTEACKDGKNCKRKVCFFA  158

Query  845   HSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKN---------------LCCH-----SPT  726
             HS+RQLR+LP         S  + P E NL K+               L CH     SPT
Sbjct  159   HSTRQLRLLPAQ-------SEPNSPQEINLEKSKFHSPVSPSSLPHCCLFCHSFTASSPT  211

Query  725   STLMGISHSSPPLSPAK-----------------TPFCGYG--MTAAKLIEMMSYKEALT  603
             STL+G+SH SPPLSP++                 +P   Y   +  + L + MSYK+ L 
Sbjct  212   STLLGMSHLSPPLSPSQSLSPPLSPLKGRSLSGFSPISRYADRLEPSCLSQGMSYKDVLN  271

Query  602   QLVNSLEQVNLNPLSPATTTI------NRMTRPF------SGNDPIQFSLPNSPSTPGRH  459
             +++ SL+ + ++ +SP   +       NR   P+         +  QF L  SPSTP   
Sbjct  272   EIMTSLDVMKMSEVSPPPHSSPLSSVKNRTAMPWVDVTTSVNEEQTQFIL--SPSTPNYP  329

Query  458   SSGSEFL--TPQRNTA-FSDN----GGLTGIDLDWVNDLL  360
                  F    P  N   F+D           D+ WVN+LL
Sbjct  330   QVPKNFFGSDPSSNEGIFADKVNEGNSCDDPDIGWVNELL  369



>gb|KDP24097.1| hypothetical protein JCGZ_25754 [Jatropha curcas]
Length=364

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 199/338 (59%), Gaps = 63/338 (19%)
 Frame = -1

Query  1361  MTSVCEFQNISYP----FYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQK  1194
             M++VC  Q+  YP    F  KK   +L++ PRK+ S++   E      SP        +K
Sbjct  1     MSTVCAEQHKLYPSHQLFSCKKPFKDLEIPPRKLFSKKILQENPDM--SPF---DSTLRK  55

Query  1193  FLPYNDVEDED----------EDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
             F+ +ND  + D          ED D YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE
Sbjct  56    FILFNDSNNGDHSNSHEKLSNEDLDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  115

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPRK+HYSG VC EFR+G C RGD CEFAHGVFE WLHP+RYRTEACK+GKNCKR
Sbjct  116   KARRRDPRKYHYSGAVCPEFRRGGCSRGDTCEFAHGVFECWLHPSRYRTEACKEGKNCKR  175

Query  863   KVCFFAHSSRQLRILP-----VNRYSTGSLSPVHDPAEKNLRKNLCC--------HSPTS  723
             K+CFFAHS +QLRILP       +Y     SP       +L    CC         SPTS
Sbjct  176   KICFFAHSPQQLRILPEVSSDTIKYDKSLASPC-----SSLNHGHCCCLSCHSVISSPTS  230

Query  722   TLMGISH--------SSPPLSPAKTPFCGYGMTAAKLIE----MMSYKEALTQLVNSLEQ  579
             TL+G+SH         SP    +     G+   + +L +    ++SYK+ LT+L++SLE 
Sbjct  231   TLLGMSHISPPLSPSWSPSPPLSPVKCHGFSRYSDRLSKPRSGLISYKDVLTELMSSLEA  290

Query  578   VNLNP--------------LSPATTTINRMTRPFSGND  507
             +N N               LSP+T+  + ++R F   D
Sbjct  291   MNFNDASLSEDQQQQTQMILSPSTSNPSGLSRNFWNGD  328



>ref|XP_002309749.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE90199.2| zinc finger family protein [Populus trichocarpa]
Length=383

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 214/369 (58%), Gaps = 59/369 (16%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAEADGFLD-SPTKIEGGVFQKFLPYNDVEDE---DEDGDR  1146
             K  + +L++ PRK+L+R+   E    LD SP + +    Q+FLPYND  +E   D++ D 
Sbjct  22    KPLIRDLEIPPRKLLTRKTHQET---LDVSPYETD---LQEFLPYNDSNNEIDIDDELDP  75

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD R+FHYSG VC EF +G C 
Sbjct  76    YSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDLRRFHYSGAVCPEFIRGGCN  135

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RG+NCEFAHGVFE WLHP RYRTEACKDGKNCKRKVCFFAHS RQLRILP       +L 
Sbjct  136   RGENCEFAHGVFECWLHPFRYRTEACKDGKNCKRKVCFFAHSPRQLRILPEGSSHNKTLG  195

Query  785   PVHDPAEKNLRKNLCC-------HSPTSTLMGISHSSPPLSPAK---------------T  672
                 P       + CC        SPTSTL+G+S  SPPLSP+                +
Sbjct  196   S--SPCSSLNHGHCCCAVCHSMTSSPTSTLLGMSPLSPPLSPSLTPSLSPVKHQSLSRFS  253

Query  671   PFCGYGMTAAKL-IEMMSYKEALTQLVNSLEQVNLNPLSPATT----------TINRMTR  525
             P   Y  T +K    ++SYK+  T+L++SLE +N N  +  ++           +N   R
Sbjct  254   PISRYSETLSKFRAGVVSYKDVFTELMSSLEAMNFNEAAGVSSPMSLYPNHKRNVNNTPR  313

Query  524   ----PFSGNDPIQFSLPNSPSTPGRH-------SSGSEFLTPQRNTAFSDNGGLTGI---  387
                  F G D  QF L  S  TP          S+   F+         +NGGL      
Sbjct  314   NIDVSFDGEDEPQFILSPSTPTPSSSFFNRDCSSNKGLFIDDIHKINDHNNGGLACTPDP  373

Query  386   DLDWVNDLL  360
             DL WVN+LL
Sbjct  374   DLGWVNELL  382



>ref|XP_008455280.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Cucumis melo]
Length=337

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 166/328 (51%), Positives = 204/328 (62%), Gaps = 52/328 (16%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
             + QKFLP+N  +  +EDGD YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD
Sbjct  15    LLQKFLPFNGEDKSEEDGDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  74

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PR+FHYSGT+C EFR+G CGRGD CEFAHGVFE WLHPARYRTEACKDGKNCKRKVCFFA
Sbjct  75    PRRFHYSGTMCPEFRRGGCGRGDGCEFAHGVFECWLHPARYRTEACKDGKNCKRKVCFFA  134

Query  845   HSSRQLRIL-PVNRYSTGSLSPVHDP--------AEKNLRKNLCC-----------HSPT  726
             HS R+LR+L PV+ Y +GS S  ++         A      N CC            SPT
Sbjct  135   HSPRELRLLPPVSNYQSGSCSSPNNKRSSSSLRSASTASASNHCCLFCHCGGAAATSSPT  194

Query  725   STLMGISHSS----------PPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQV  576
             STL G+SH S           P++   +P   Y    +KL  ++SYK+ALT+L++S+E +
Sbjct  195   STLFGMSHLSPPHSPPHSPGKPIN-GFSPISRYNPDQSKLNGVLSYKDALTELMSSIESM  253

Query  575   NLNPLSPATTTIN----------RMTRPF------SGNDPIQFSLPNSPSTPGRHSSGSE  444
             N++  +                 R T P+      +  D +QF L  SPSTP   ++   
Sbjct  254   NMDDANATLAAAAAAATAAASGPRQTIPWIDVSSLNNEDQLQFVL--SPSTPNVSTASVN  311

Query  443   FLTPQRNTAFSDNGGLTGIDLDWVNDLL  360
             F   Q N  ++     +  DL WVNDLL
Sbjct  312   FSVDQNNNGWA---SASDPDLGWVNDLL  336



>ref|XP_008381588.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Malus 
domestica]
Length=436

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 199/326 (61%), Gaps = 66/326 (20%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFY----LKKAM---AELDVSPRKILSRRGAAE-------ADGFLDSP  1224
             M+SVC+ Q+  +P +     KK +   +  D+ PRK+L+RR   E       A     SP
Sbjct  1     MSSVCDEQHNFHPSHQLQSFKKTLLRDSNTDIPPRKLLTRRSPQEFPSSDMYAAADCGSP  60

Query  1223  --TKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               +  +  + +KFLP N   D+DE  D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFAHP
Sbjct  61    RFSSADEALVRKFLPCNTGSDDDE-VDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHP  119

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPR+ HYSGTVC+++R+G C RGD+CEF+HGVFE WLHPARYRTEACKDGKNC
Sbjct  120   GEKARRRDPRRHHYSGTVCADYRRGSCSRGDSCEFSHGVFECWLHPARYRTEACKDGKNC  179

Query  869   KRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNL--------------RKNLCC--  738
             KRKVCFFAH+ RQLR+LP ++     LSP+    + +L               K  CC  
Sbjct  180   KRKVCFFAHTPRQLRVLPADQV----LSPMAGSKKYHLNNSSVGSPRSCSNNNKQYCCLF  235

Query  737   -------HSPTSTLM-GISHS-SPPLSPAK---------------TPFCGYGMTAAKLIE  630
                     SPTSTL+ G+SH  SPP+SPA                +P  G G+     + 
Sbjct  236   CHSAAATSSPTSTLLDGMSHHLSPPVSPAAKHCSSVDEFHNSPVMSPCGGLGLGCLDQVH  295

Query  629   -----MMSYKEALTQLVNSLEQVNLN  567
                  +MSY E + +L++SLE +  +
Sbjct  296   ASTGGLMSYNEVVAELMSSLEAMKFH  321



>ref|XP_007043650.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
 gb|EOX99481.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
Length=365

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 218/372 (59%), Gaps = 46/372 (12%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPY  1182
             M++ C  Q+   P + +    ++++ PRK+L      + +  +  P +      Q++LP 
Sbjct  1     MSTACAEQHKFQPSHPQLPFKDIEIPPRKLLLSHNHFQENATMQIPFE---ASLQQYLPS  57

Query  1181  N--DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHY  1008
             N  + EDE  D DRY+ DHFRMYEFKVRRCTRSRSHDWTDCPFAHP EKARRRDPR+F Y
Sbjct  58    NRNNAEDEGNDADRYATDHFRMYEFKVRRCTRSRSHDWTDCPFAHPNEKARRRDPRRFRY  117

Query  1007  SGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQ  831
             S TVCS+FR+ G C RGD+C+FAHGVFE WLHP RYRTEACKDGKNCKRK+CFFAHSSR+
Sbjct  118   SSTVCSDFRRGGGCPRGDDCDFAHGVFECWLHPTRYRTEACKDGKNCKRKICFFAHSSRE  177

Query  830   LRILPVN--RY-STGSLSPVHDPAEKNLRKNLCCH----SPTSTLMGISHSSPPLSPAK-  675
             LR+LP    +Y ++GS S    P  KN    L CH    SPTSTL+G+SH S   S +  
Sbjct  178   LRLLPDGSPKYKNSGSCSS--SPMNKNDHCCLFCHSVTSSPTSTLLGLSHLSRSPSLSPP  235

Query  674   -------------TPFCGYGMTAAKL-IEMMSYKEALTQLVNSLEQVNLNPLSPATTTIN  537
                          +P   YG   +K   EMMSYK+A  +L++SLE +N   +S     +N
Sbjct  236   LSPVKQRASLNGFSPVSRYGDRLSKFGTEMMSYKDAFNELMSSLETMNFCEVSSPVAGVN  295

Query  536   RMT-------RPFSGNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDNGGLTGI---  387
              +          F+G D  QF L  S  +    S   E+    +     +N    G+   
Sbjct  296   NLNANISWLDASFNGEDQQQFVLSPSRPS---PSESGEYFGATKEIGGYENLNENGVATD  352

Query  386   ---DLDWVNDLL  360
                DL WVN+LL
Sbjct  353   PDPDLGWVNELL  364



>ref|XP_011047672.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Populus euphratica]
Length=382

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 211/369 (57%), Gaps = 59/369 (16%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAEADGFLD-SPTKIEGGVFQKFLPYNDVEDE---DEDGDR  1146
             KK   +L++ PR +L+R+   E    LD SP +      Q+FLPYND  +E   D++ D 
Sbjct  21    KKLFRDLEIPPRTLLTRKTHQET---LDVSPYETN---LQEFLPYNDYNNEIDIDDELDP  74

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD R+FHYSG VC EF +G C 
Sbjct  75    YSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDLRRFHYSGAVCPEFIRGGCN  134

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RG+NCEFAHGVFE WLHP RYRTEACKDG+NCKRKVCFFAHS RQLRILP     + +L 
Sbjct  135   RGENCEFAHGVFECWLHPFRYRTEACKDGRNCKRKVCFFAHSPRQLRILPEGSSHSKTLG  194

Query  785   PVHDPAEKNLRKNLCC-------HSPTSTLMGISHSSPPLSPAK---------------T  672
                 P       + CC        SPTSTL+G+S  SPPLSP+                +
Sbjct  195   S--SPCSSLNHGHCCCAVSHSMTSSPTSTLLGMSPLSPPLSPSLTPSLSPVKHQSLSGFS  252

Query  671   PFCGYGMTAAKL-IEMMSYKEALTQLVNSLEQVNLNPLSPATT----------TINRMTR  525
             P   Y    +K    ++SY++  T+L++SLE  N N  +  ++           +N   R
Sbjct  253   PISRYSERLSKFRAGVVSYEDVFTELMSSLEATNFNEAAGVSSPMSLYPNHKRNVNNTPR  312

Query  524   P----FSGNDPIQFSLPNSPSTPGRH-------SSGSEFLTPQRNTAFSDNGGLTGI---  387
                  F G D  QF L  S  TP          S+   F+         +NGGL      
Sbjct  313   NIDVCFDGEDQPQFILSPSTPTPSSSFFNRDCSSNKGLFINDIHKINEHNNGGLACTPDP  372

Query  386   DLDWVNDLL  360
             DL WVN+LL
Sbjct  373   DLGWVNELL  381



>ref|XP_007132795.1| hypothetical protein PHAVU_011G125300g [Phaseolus vulgaris]
 gb|ESW04789.1| hypothetical protein PHAVU_011G125300g [Phaseolus vulgaris]
Length=362

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 221/369 (60%), Gaps = 43/369 (12%)
 Frame = -1

Query  1361  MTSVC-----EFQNISYPFYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQ  1197
             M+++C     + Q       LKK++ E+D+ PRK+L RR AA  D F D        +  
Sbjct  1     MSTICSEHKFQLQPSHQLLSLKKSLREIDIPPRKLLMRRAAA--DMFSDD------TLLH  52

Query  1196  KFLPYND---VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
             K+LP       +D D+ GD Y++D FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRD
Sbjct  53    KYLPNTKSMDSDDSDDVGDPYASDEFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  112

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PR+FHYSGTVC E+R+G+C  GD CEF+HGVFE WLHP+RYRTEACKDGKNCKRKVCFFA
Sbjct  113   PRRFHYSGTVCPEYRRGQCSSGDACEFSHGVFECWLHPSRYRTEACKDGKNCKRKVCFFA  172

Query  845   HSSRQLRILP----VNRYSTGSLSPVHDPAEKNLRKNLC--CH-----SPTSTLMGISHS  699
             H+ RQLR+LP    + +    ++SP +     N   + C  CH     SPTSTL G+SH 
Sbjct  173   HTPRQLRVLPPQDSIKKKKCTNMSPHNHNHNNNNSNHCCLFCHCSSTCSPTSTLFGMSHF  232

Query  698   SPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNL---------NPLSPATT  546
             SPPLSP+ +         +    ++SYK+  ++L+ S+E +N           P S +  
Sbjct  233   SPPLSPSSSSSSPSRFEPSHRHGVVSYKDVFSELMCSMEGLNFGETSYVSASKPHSLSWL  292

Query  545   TINRMTRPFSGNDPIQFSLPNSPSTPGRH--SSGSEFLTPQRNTAFS--DNGGLTGI---  387
              ++   + F+ + P   +  +  +   R     GS   +   N  FS  ++G +  +   
Sbjct  293   DVSEDNKQFNIHSPTIATCGSFSNNENRRFLREGSRSFSINGNGRFSREESGVVDDVIAP  352

Query  386   DLDWVNDLL  360
             DL WVNDLL
Sbjct  353   DLAWVNDLL  361



>ref|XP_004487266.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Cicer arietinum]
Length=392

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 187/298 (63%), Gaps = 46/298 (15%)
 Frame = -1

Query  1361  MTSVCE------FQNISYPFYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVF  1200
             MT++CE      F +   P   KK + E+D+ PRK+L+RR    AD F D        + 
Sbjct  1     MTTICEQQQQHKFHSSYQPLSPKKPLREIDIPPRKLLTRR---TADMFSDDT------IL  51

Query  1199  QKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR  1020
             QKFLP+ND + + +D   YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR
Sbjct  52    QKFLPHNDSDSDSDD--PYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR  109

Query  1019  KFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHS  840
             +FHYSG+VCSE+R+G C RGD CEFAHGVFE WLHPARYRTEACKDGKNCKRKVCFFAH+
Sbjct  110   RFHYSGSVCSEYRRGSCNRGDTCEFAHGVFECWLHPARYRTEACKDGKNCKRKVCFFAHT  169

Query  839   SRQLRILPV------NRYSTGSLSPVHDPAEKNLRKNLCC---------HSPTSTLMGIS  705
              RQLRILPV      +++S    +          + N CC         +SPTSTL G+S
Sbjct  170   PRQLRILPVTSSNSNDQFSCNKKNNKILNNHVGSKTNNCCLFCHCNGANNSPTSTLFGMS  229

Query  704   H-------SSPPLSP-----AKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLN  567
             H          P+ P     + +    YG  +      + Y++ L  L+ S E +N N
Sbjct  230   HFSPPASPPLSPMKPRNGVSSVSSLARYG--SVNNSNNLRYRDMLVDLLGSFEGLNFN  285



>ref|XP_008362440.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Malus domestica]
Length=439

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 197/324 (61%), Gaps = 59/324 (18%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL----KKAM---AELDVSPRKILSRRGAAE---------ADGFLD  1230
             M+SVC  Q+  +P +     KK +     +D+ PRK+L+RR   E         AD    
Sbjct  1     MSSVCAEQHKFHPSHQLLSSKKTLLRDTNIDIPPRKLLTRRSPQEFPSSDVYAAADYXSP  60

Query  1229  SPTKIEGGVFQKFLPYN--DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
             S +  +  + +KFLPYN    + +D++ D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFA
Sbjct  61    SFSSADEALLRKFLPYNTGSDDSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFA  120

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPR+ HYSGTVC+++R+G C RGD+CEFAHGVFE WLHPARYRTEACKDGK
Sbjct  121   HPGEKARRRDPRRHHYSGTVCADYRRGSCSRGDSCEFAHGVFECWLHPARYRTEACKDGK  180

Query  875   NCKRKVCFFAHSSRQLRILPVNRYSTGSLS-----------PVHDPAEKNLRKNLCC---  738
             NCKRKVCFFAH+ RQLRILP ++  + + S            V  P   +  K  CC   
Sbjct  181   NCKRKVCFFAHTXRQLRILPADQVLSPTASSKKLFHLNNHLSVGSPRSCSNNKQYCCLFC  240

Query  737   ------HSPTSTLM-GISHS-SPPLSPAKTPFCGYGMTAAKLIE----------------  630
                    SPTSTL+ G+SH  SPP+SPA          ++ ++                 
Sbjct  241   HPAAATSSPTSTLLAGMSHHLSPPVSPAGNCSSVSXFXSSPVMSRCGGLGLGGLDQVHAS  300

Query  629   ---MMSYKEALTQLVNSLEQVNLN  567
                +M+ KE + +L++S+E +  N
Sbjct  301   TGGLMTSKEVVAELMSSMEAMKFN  324



>ref|XP_004136841.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Cucumis sativus]
 ref|XP_004155466.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Cucumis sativus]
 gb|KGN43643.1| hypothetical protein Csa_7G049250 [Cucumis sativus]
Length=388

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 166/334 (50%), Positives = 206/334 (62%), Gaps = 59/334 (18%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
             + QKFLP+N  ++ +EDGD YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD
Sbjct  61    LLQKFLPFNGEDELEEDGDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  120

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PR+FHYSGT+C EFR+G CGRGD CEFAHGVFE WLHPARYRTEACKDGKNCKRKVCFFA
Sbjct  121   PRRFHYSGTMCPEFRRGGCGRGDGCEFAHGVFECWLHPARYRTEACKDGKNCKRKVCFFA  180

Query  845   HSSRQLRIL-PVNRYSTGSLSPVHDPAEKNLR--------KNLCC-----------HSPT  726
             HS R+LR+L PV+ + TGS S  ++    +           N CC            SPT
Sbjct  181   HSPRELRLLPPVSNFQTGSCSSPNNKRSSSSLRSPSTASASNHCCLFCHCGGAAVTSSPT  240

Query  725   STLMGISHSS----------PPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQV  576
             STL G+SH S           P++   +P   Y    +KL  ++SYK+ALT+L++S+E +
Sbjct  241   STLFGMSHLSPPHSPPHSPGKPIN-GFSPISRYNPDQSKLNGVLSYKDALTELMSSIESM  299

Query  575   NLNPLSPATTTIN------RMTRPF------SGNDPIQFSLPNSPSTPGRHSSGSEFLTP  432
             N++  +             R T P+      +  D +QF L  SPSTP   ++  +F   
Sbjct  300   NMDDANATLAAAAAAASGPRQTIPWIDVSSLNNEDQLQFVL--SPSTPNVSTASVKFSVE  357

Query  431   QRNTAFSDNGGLTGI----------DLDWVNDLL  360
               N    +NG  +            DL WVNDLL
Sbjct  358   NNN----NNGWASAYASASTSASDPDLGWVNDLL  387



>ref|XP_008342887.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Malus domestica]
Length=439

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 197/324 (61%), Gaps = 59/324 (18%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL----KKAM---AELDVSPRKILSRRGAAE---------ADGFLD  1230
             M+SVC  Q+  +P +     KK +     +D+ PRK+L+RR   E         AD    
Sbjct  1     MSSVCAEQHKFHPSHQLLSSKKTLLRDTNIDIPPRKLLTRRSPQEFPSSDVYAAADYRSP  60

Query  1229  SPTKIEGGVFQKFLPYN--DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
             S +  +  + +KFLPYN    + +D++ D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFA
Sbjct  61    SFSSADEALLRKFLPYNTGSDDSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFA  120

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPR+ HYSGTVC+++R+G C RGD+CEFAHGVFE WLHPARYRTEACKDGK
Sbjct  121   HPGEKARRRDPRRHHYSGTVCADYRRGSCSRGDSCEFAHGVFECWLHPARYRTEACKDGK  180

Query  875   NCKRKVCFFAHSSRQLRILPVNRYSTGSLS-----------PVHDPAEKNLRKNLCC---  738
             NCKRKVCFFAH+ RQLRILP ++  + + S            V  P   +  K  CC   
Sbjct  181   NCKRKVCFFAHTPRQLRILPADQVLSPTASSKKLFHLNNHLSVGSPRSCSNNKQYCCLFC  240

Query  737   ------HSPTSTLM-GISHS-SPPLSPAKTPFCGYGMTAAKLIE----------------  630
                    SPTSTL+ G+SH  SPP+SPA          ++ ++                 
Sbjct  241   HPAAATSSPTSTLLAGMSHHLSPPVSPAGNCSSVSXFXSSPVMSRCGGLGLGGLDQVHAS  300

Query  629   ---MMSYKEALTQLVNSLEQVNLN  567
                +M+ KE + +L++S+E +  N
Sbjct  301   TGGLMTSKEVVAELMSSMEAMKFN  324



>ref|XP_002517875.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44393.1| conserved hypothetical protein [Ricinus communis]
Length=236

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 149/207 (72%), Gaps = 24/207 (12%)
 Frame = -1

Query  1361  MTSVCEFQNISYP----FYLKKAMAELDVSPRKILSRRGAAEAD-GFLDSPTKIEGGVFQ  1197
             M++VC  Q+  YP    F   K+  +LD+ PRK+LS++   E+    L SP +       
Sbjct  1     MSTVCAEQHKLYPSHPLFSPNKSFKDLDIPPRKLLSKKTFQESSPDMLSSPFESH---LH  57

Query  1196  KFLPYNDV----------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
             KFLP ND+            +D+D D YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPG
Sbjct  58    KFLPCNDLISSDNNHDQRGSDDQDLDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  117

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKA RRDPRK+HYSG +C EFR+G C RGD+CEFAHGVFE WLHP+RYRTEACKDGKNCK
Sbjct  118   EKALRRDPRKYHYSGAICPEFRRGGCSRGDSCEFAHGVFECWLHPSRYRTEACKDGKNCK  177

Query  866   RKVCFFAHSSRQLRILP------VNRY  804
             RKVCFFAHS RQLRILP      +N+Y
Sbjct  178   RKVCFFAHSPRQLRILPEVSCGAINKY  204



>gb|ADL36652.1| C3HL domain class transcription factor [Malus domestica]
Length=439

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 197/328 (60%), Gaps = 67/328 (20%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFY----LKKAM---AELDVSPRKILSRRGAAE-------ADGFLDSP  1224
             M+SVC+ Q+  +P +     KK +   +  D  PRK+L+RR   E       A     SP
Sbjct  1     MSSVCDEQHNFHPSHQLQSFKKTLLRDSNTDFPPRKLLTRRIPQEFPSSDMYAAADRGSP  60

Query  1223  --TKIEGGVFQKFLPYN--DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               +  +  + +KFLP N    + +D++ D YS+DHFRM+EFKVRRCTRSRSHDWTDCPFA
Sbjct  61    RFSSADEALVRKFLPCNTGSDDSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFA  120

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPR+ HYSGTVC+++R+G C RGD+CEF+HGVFE WLHPARYRTEACKDGK
Sbjct  121   HPGEKARRRDPRRHHYSGTVCADYRRGSCSRGDSCEFSHGVFECWLHPARYRTEACKDGK  180

Query  875   NCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNL--------------RKNLCC  738
             NCKRKVCFFAH+ RQLR+LP ++     LSP+    + +L               K  CC
Sbjct  181   NCKRKVCFFAHTPRQLRVLPADQV----LSPMAGSKKYHLNNSSVGSPRSCSNNNKQYCC  236

Query  737   ---------HSPTSTLMG--ISHSSPPLSPAK---------------TPFCGYGMTAAKL  636
                       SPTSTL+G    H SPP+SPA                +P  G G+     
Sbjct  237   LFCHSAAATSSPTSTLLGGMSHHLSPPVSPAAKHCSSVDEFHNSPVMSPCGGLGLGCLDQ  296

Query  635   IE-----MMSYKEALTQLVNSLEQVNLN  567
             +      +MSY E + +L++SLE +  +
Sbjct  297   VHASTGGLMSYNEVVAELMSSLEAMKFH  324



>gb|EYU42142.1| hypothetical protein MIMGU_mgv1a008328mg [Erythranthe guttata]
Length=377

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 175/368 (48%), Positives = 221/368 (60%), Gaps = 65/368 (18%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAE---ADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRY  1143
             KK++ ++D+ PRK+L RR AA     D + DSP + E  VF KFLPYN+ + +++D   Y
Sbjct  26    KKSLRDIDIPPRKLLGRRSAAAAAAGDVYSDSP-RAEDAVFSKFLPYNNADADEDDDP-Y  83

Query  1142  SADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGR  963
             S+D FR+YEFKVR+C RSRSHDWTDCPFAHPGEKARRRDPR++ YSGTVCSEFRKG CG+
Sbjct  84    SSDQFRIYEFKVRKCNRSRSHDWTDCPFAHPGEKARRRDPRRYRYSGTVCSEFRKGHCGK  143

Query  962   GDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL--  789
             GDNCEF+HGVFE WLHP+RYRTEACKDGKNCKRKVCFFAHS+RQLRI+P     +     
Sbjct  144   GDNCEFSHGVFECWLHPSRYRTEACKDGKNCKRKVCFFAHSTRQLRIVPDTSSPSSPPSA  203

Query  788   ------SPVHDPAEKNLRKN----LCCH------SPTSTL-MGISHSSPPLSPAKTPFCG  660
                   SP    AEKN+ +N    + CH      SPTSTL MG+SH              
Sbjct  204   AAAMDHSPAAMAAEKNMYRNQNCCVFCHSVTTTASPTSTLMMGMSH--------------  249

Query  659   YGMTAAKLIEMMSYKEA-LTQLVNSLEQVNLNPLSPATTTINR--MTRPFSGNDPI-QFS  492
             +    A      +YK+A L +L+ S+E +N+N  + A    N   +   FS  +   QF 
Sbjct  250   HLSPPASPPISPAYKDAILNELMASVEAMNMNEAAQAAAKRNLPWLDVNFSAEEHQPQFV  309

Query  491   L-PNSPSTPGRH------SSGSEFLTPQRNTAFSDNGG----------------LTGIDL  381
             L P++P+T G        S  S+F++        D  G                + G DL
Sbjct  310   LSPSTPTTLGGRGHSKFMSGDSKFVSGDSKFYRGDFSGRNLMEDNRYNNNNEGNMVGPDL  369

Query  380   DWVNDLLT  357
              WVNDLLT
Sbjct  370   GWVNDLLT  377



>ref|XP_002889476.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65735.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   252 bits (643),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 193/328 (59%), Gaps = 62/328 (19%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  74    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  132

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  133   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  192

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S GS SP   PA KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  193   ENVSGGSASP--SPAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPVSPAHKAAAFSR  250

Query  635   IE--------------MMSYKEALTQLVNSLEQVNL------NPLSPATTTINRMT----  528
             +                ++YK+ L++LVNSL+ ++L      +  SP TT ++       
Sbjct  251   LRNRAASAVSAAAAAGSVNYKDVLSELVNSLDSMSLAEALQASSSSPVTTPVSAAAAAFA  310

Query  527   ------------RPFSGNDPIQFSLPNSPSTPGRHSSG------SEFLTPQRN-----TA  417
                         +    + P+QF+L  SPSTP   ++       S+  TP+R      TA
Sbjct  311   SSCGLSNQRLHLQNLQPSSPLQFAL--SPSTPSYLTNSPQANFFSDDFTPRRRQMNDFTA  368

Query  416   FS--------DNGGLTGIDLDWVNDLLT  357
              +        ++G     DL WVNDLLT
Sbjct  369   MAAVREKTSIEDGSCGDPDLGWVNDLLT  396



>ref|XP_006304480.1| hypothetical protein CARUB_v10011207mg [Capsella rubella]
 gb|EOA37378.1| hypothetical protein CARUB_v10011207mg [Capsella rubella]
Length=394

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 158/325 (49%), Positives = 189/325 (58%), Gaps = 58/325 (18%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  74    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  132

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  133   EFRRSGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  192

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S GS SP   PA KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  193   ENVSGGSGSP--SPAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPAHKAAAFSR  250

Query  635   IE--------------MMSYKEALTQLVNSL------EQVNLNPLSPATTTINRMTRPFS  516
             +                ++YK+ L++LVNSL      E + +   SP TT ++     F+
Sbjct  251   LRNRAASAVSAAAAAGSVNYKDVLSELVNSLDSMSLVEALQVGTSSPVTTPVSAAAAAFA  310

Query  515   -----GNDPIQ-----------FSL-PNSPS---------------TPGRHSSGSEFLTP  432
                   N  +            FSL P++PS               TP R    ++F T 
Sbjct  311   SSCGLSNQRLHLQQQQPSSPLQFSLSPSTPSYLTTSSPANFFGDEFTPRRRQMNNDFTTV  370

Query  431   QRNTAFSDNGGLTGIDLDWVNDLLT  357
             +  T+F D G     DL WVNDLLT
Sbjct  371   RDKTSFED-GSCGDPDLGWVNDLLT  394



>gb|KEH39169.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=415

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 183/304 (60%), Gaps = 48/304 (16%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL-------KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGV  1203
             MT++C  Q+  + F+        KK++ ++D+ PRK+L+RR    A       T     +
Sbjct  1     MTTICAEQHQQHKFHSSYQPLSPKKSLRDIDIPPRKLLTRRNTTAAVDIFSDDT-----I  55

Query  1202  FQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  1023
              QKFLP+ND + + +D   YS+DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP
Sbjct  56    LQKFLPHNDSDSDSDD--PYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  113

Query  1022  RKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAH  843
             R+FHYSGTVC E+R+G C RGD CEFAHGVFE WLHPARYRTEACKDGKNCKRKVCFFAH
Sbjct  114   RRFHYSGTVCPEYRRGGCNRGDTCEFAHGVFECWLHPARYRTEACKDGKNCKRKVCFFAH  173

Query  842   SSRQLRILPVNRYSTGSLS--------PVHDPAEKNLRKNLCCH--------------SP  729
             + RQLRILPV   S    S          +  A K+    L CH              SP
Sbjct  174   TPRQLRILPVTSSSNEHFSCNKKNNKLLNNHVASKSNNCCLFCHCGGNGNGNGNGANNSP  233

Query  728   TSTLMGI--------SHSSPPLSP--AKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQ  579
             TSTL G+        S    P+ P    +    YG +       + Y++ L  L+ S E 
Sbjct  234   TSTLFGMSHFSSPPASPPMSPMKPRNGVSSLSRYGSSINS--NNLRYRDMLIDLLGSFEG  291

Query  578   VNLN  567
             +N N
Sbjct  292   MNFN  295



>ref|XP_006418203.1| hypothetical protein EUTSA_v10007884mg [Eutrema salsugineum]
 gb|ESQ36556.1| hypothetical protein EUTSA_v10007884mg [Eutrema salsugineum]
Length=388

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 188/331 (57%), Gaps = 70/331 (21%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  68    DSDTD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  126

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  127   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  186

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCC----HSPTSTLMG-ISHSSPPLSPAKTPFCGYGMT  648
                S GS S    PA     KN CC     SPTSTL+G +SH S   S +      +   
Sbjct  187   ENVSGGSASA--SPA-----KNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPAHKAA  239

Query  647   AAKLIE--------------MMSYKEALTQLVNSLEQVNL------NPLSPATTTIN---  537
             A   +                ++YK+ L++LVNSL+ ++L      +  SP TT ++   
Sbjct  240   AFSRLRDRAASAVSAAAARGSVNYKDVLSELVNSLDSISLAEALQASSSSPVTTPVSAAA  299

Query  536   --------------RMTRPFSGNDPIQFSLPNSPSTPG-----------------RHSSG  450
                            + +    + P+QF+L  SPSTP                  R    
Sbjct  300   AAFASSCGLSNQRIHLQQQQQQSSPLQFAL--SPSTPSYLTNSPRGNIFGDDFTPRQRQM  357

Query  449   SEFLTPQRNTAFSDNGGLTGIDLDWVNDLLT  357
             ++F    R     D+G     DL WVNDLLT
Sbjct  358   NDFTAVVREKTSFDDGSCGDPDLGWVNDLLT  388



>ref|XP_003526267.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Glycine max]
Length=351

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 159/350 (45%), Positives = 203/350 (58%), Gaps = 51/350 (15%)
 Frame = -1

Query  1316  LKKAMAELD--VSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDR-  1146
             LKK++ ++D  V PRK+L+RR AA  DG  D            +LP++   D   D D  
Sbjct  21    LKKSLGDIDIPVPPRKLLTRRSAAVHDGSGDI-----------YLPHSGSTDSSTDDDSD  69

Query  1145  ---YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKG  975
                Y++D FRM+EFKVRRC+RSRSHDWTDCPF HPGEKARRRDPR+F+YSGTVC EFR+G
Sbjct  70    GDPYASDQFRMFEFKVRRCSRSRSHDWTDCPFVHPGEKARRRDPRRFYYSGTVCPEFRRG  129

Query  974   KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTG  795
             +C RGD CEF+HGVFE WLHP+RYRTEACKDGKNCKRKVCFFAH+ RQLR+   N  S  
Sbjct  130   QCDRGDACEFSHGVFECWLHPSRYRTEACKDGKNCKRKVCFFAHTPRQLRVFHSNDNSNK  189

Query  794   SLSPVHDPAEKNLRKNLC--CH------SPTSTLMGISHSSPPLSPAKTPFCGYGMTAAK  639
                    P   N   N C  CH      SPTSTL G+SH SPPLSP          T   
Sbjct  190   KKCTDISPHNNN---NCCLVCHCSNSTRSPTSTLFGMSHFSPPLSPPSPSSPSMFETNNH  246

Query  638   LIEMMSY-KEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGN------------DPIQ  498
                ++ Y K+  ++LV S+E +N +    A++ ++  ++P   N            +  Q
Sbjct  247   HHGVVKYNKDVFSELVCSMEGLNFD---EASSLLSAASKPHHHNNLSSWLDVSKDHNQKQ  303

Query  497   FSLPNSPSTPG----RHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLL  360
             F+  NSP+        ++    FL  +      D   +   DL WVN+LL
Sbjct  304   FNTLNSPTITACGSFSNNGNGGFLRAENGVVVDD---VIAPDLAWVNELL  350



>ref|XP_010457395.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Camelina 
sativa]
Length=398

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 184/328 (56%), Gaps = 62/328 (19%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  76    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  134

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  135   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  194

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S GS SP   PA KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  195   ENVSGGSGSP--SPAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPAHKAAAFSR  252

Query  635   IE--------------MMSYKEALTQLVNSL------EQVNLNPLSPATTTI--------  540
             +                ++YK+ L++LVNSL      E + +   SP TT +        
Sbjct  253   LRNRAASAVSAAAAAGSVNYKDVLSELVNSLDSMSLAEALQVTSSSPVTTPVSAAAAAFA  312

Query  539   ------NRMTRPFSGNDPIQFSLPNSPSTPGRHSS-------GSEFLTPQR---------  426
                   N+                 SPSTP   ++       G +F TP+R         
Sbjct  313   SSCGLSNQRLHLQQQQPSSPLQFALSPSTPSYLTNSPRANFFGDDF-TPRRRQMNDFSTV  371

Query  425   -----NTAFSDNGGLTGIDLDWVNDLLT  357
                   T+F D G     DL WVNDLLT
Sbjct  372   AAVREKTSFED-GSCGDPDLGWVNDLLT  398



>ref|XP_010475006.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
isoform X1 [Camelina sativa]
Length=398

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 184/328 (56%), Gaps = 62/328 (19%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  76    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  134

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  135   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  194

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S GS SP   PA KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  195   ENVSGGSGSP--SPAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPAHKAAAFSR  252

Query  635   IE--------------MMSYKEALTQLVNSL------EQVNLNPLSPATTTI--------  540
             +                ++YK+ L++LVNSL      E + +   SP TT +        
Sbjct  253   LRNRAASAVSAAAAAGSVNYKDVLSELVNSLDSMSLAEALQVTSSSPVTTPVSAAAAAFA  312

Query  539   ------NRMTRPFSGNDPIQFSLPNSPSTPGRHSS-------GSEFLTPQR---------  426
                   N+                 SPSTP   ++       G +F TP+R         
Sbjct  313   SSCGLSNQRLHLQQQQPSSPLQFALSPSTPSYLTNSPRANFFGDDF-TPRRRQLNDFSTV  371

Query  425   -----NTAFSDNGGLTGIDLDWVNDLLT  357
                   T+F D G     DL WVNDLLT
Sbjct  372   AAVRDKTSFED-GSCGDPDLGWVNDLLT  398



>dbj|BAC41895.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63406.1| At1g03790 [Arabidopsis thaliana]
Length=393

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 183/326 (56%), Gaps = 58/326 (18%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  71    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  129

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  130   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  189

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S  S SP   PA KN     C  SPTSTL+G +SH S   S +          A   
Sbjct  190   ENVSGVSASP--SPAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPANKAAAFSR  247

Query  635   IE--------------MMSYKEALTQLVNSLEQVNL------NPLSPATTTI--------  540
             +                M+YK+ L++LVNSL+ ++L      +  SP TT +        
Sbjct  248   LRNRAASAVSAAAAAGSMNYKDVLSELVNSLDSMSLAEALQASSSSPVTTPVSAAAAAFA  307

Query  539   ------NRMTRPFSGNDPIQFSLPNSPSTPGRHSSG------SEFLTPQRN--------T  420
                   N+                 SPSTP   ++       S+  TP+R         T
Sbjct  308   SSCGLSNQRLHLQQQQPSSPLQFALSPSTPSYLTNSPQANFFSDDFTPRRRQINDFTAMT  367

Query  419   AFSDN-----GGLTGIDLDWVNDLLT  357
             A  +N     G     DL WVNDLLT
Sbjct  368   AVRENTNIEDGSCGDPDLGWVNDLLT  393



>ref|NP_171875.1| CCCH-type zinc finger protein SOMNUS [Arabidopsis thaliana]
 sp|Q9ZWA1.1|C3H2_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 2; Short=AtC3H2; 
AltName: Full=Protein SOMNUS; Short=SOM [Arabidopsis 
thaliana]
 gb|AAD10689.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AEE27614.1| CCCH-type zinc finger protein SOMNUS [Arabidopsis thaliana]
Length=393

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 183/326 (56%), Gaps = 58/326 (18%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  71    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  129

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  130   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  189

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S  S SP   PA KN     C  SPTSTL+G +SH S   S +          A   
Sbjct  190   ENVSGVSASP--SPAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPANKAAAFSR  247

Query  635   IE--------------MMSYKEALTQLVNSLEQVNL------NPLSPATTTI--------  540
             +                M+YK+ L++LVNSL+ ++L      +  SP TT +        
Sbjct  248   LRNRAASAVSAAAAAGSMNYKDVLSELVNSLDSMSLAEALQASSSSPVTTPVSAAAAAFA  307

Query  539   ------NRMTRPFSGNDPIQFSLPNSPSTPGRHSSG------SEFLTPQRN--------T  420
                   N+                 SPSTP   ++       S+  TP+R         T
Sbjct  308   SSCGLSNQRLHLQQQQPSSPLQFALSPSTPSYLTNSPQANFFSDDFTPRRRQMNDFTAMT  367

Query  419   AFSDN-----GGLTGIDLDWVNDLLT  357
             A  +N     G     DL WVNDLLT
Sbjct  368   AVRENTNIEDGSCGDPDLGWVNDLLT  393



>ref|XP_010475007.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
isoform X2 [Camelina sativa]
Length=361

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 176/313 (56%), Gaps = 69/313 (22%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  76    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  134

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  135   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  194

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLI  633
                S GS SP   PA KN     C  SPTSTL+  + +                      
Sbjct  195   ENVSGGSGSP--SPAAKNPCCLFCSSSPTSTLLAAAAAG---------------------  231

Query  632   EMMSYKEALTQLVNSL------EQVNLNPLSPATTTI--------------NRMTRPFSG  513
               ++YK+ L++LVNSL      E + +   SP TT +              N+       
Sbjct  232   -SVNYKDVLSELVNSLDSMSLAEALQVTSSSPVTTPVSAAAAAFASSCGLSNQRLHLQQQ  290

Query  512   NDPIQFSLPNSPSTPGRHSS-------GSEFLTPQR--------------NTAFSDNGGL  396
                       SPSTP   ++       G +F TP+R               T+F D G  
Sbjct  291   QPSSPLQFALSPSTPSYLTNSPRANFFGDDF-TPRRRQLNDFSTVAAVRDKTSFED-GSC  348

Query  395   TGIDLDWVNDLLT  357
                DL WVNDLLT
Sbjct  349   GDPDLGWVNDLLT  361



>gb|KFK42723.1| zinc finger ccch domain-containing protein 2-like [Arabis alpina]
Length=393

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 149/216 (69%), Gaps = 19/216 (9%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  70    DSDTD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  128

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  129   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  188

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S GS SP   P  KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  189   ENVSGGSASP--SPGGKNPCCMFCSSSPTSTLLGNLSHLSRSPSLSPPLSPAHKAAAFSR  246

Query  635   IE--------------MMSYKEALTQLVNSLEQVNL  570
             +                ++YK+ L++LVNSL+ ++L
Sbjct  247   LRNRAASAVSAAAAAGSVNYKDVLSELVNSLDSMSL  282



>ref|XP_006447247.1| hypothetical protein CICLE_v10015314mg [Citrus clementina]
 ref|XP_006469930.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Citrus sinensis]
 gb|ESR60487.1| hypothetical protein CICLE_v10015314mg [Citrus clementina]
Length=429

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 202/364 (55%), Gaps = 71/364 (20%)
 Frame = -1

Query  1241  GFLDSPTKIEGGVFQ-KFLPYNDVEDEDEDGDR-YSADHFRMYEFKVRRCTRSRSHDWTD  1068
              +L  P + E  +   KFLP+N+ + + +     Y++DHFRMYEFK+RRCTRSRSHDWTD
Sbjct  68    SYLFYPDQQEMNILHNKFLPFNNTDADSDPDSDPYASDHFRMYEFKIRRCTRSRSHDWTD  127

Query  1067  CPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK-CGRGDNCEFAHGVFESWLHPARYRTEA  891
             CPFAHP EKARRRDPR++HYSG VCSE+R+G  C  GD+CEFAHGVFE WLHP+RYRTEA
Sbjct  128   CPFAHPSEKARRRDPRRYHYSGAVCSEYRRGGGCSLGDDCEFAHGVFECWLHPSRYRTEA  187

Query  890   CKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLC--CH------  735
             CKDGKNCKRKVCFFAHS RQLRILP       S     +   + +  + C  CH      
Sbjct  188   CKDGKNCKRKVCFFAHSPRQLRILPEISSQYSSSPSSVNNNNQKISSHCCMYCHHHSVNS  247

Query  734   SPTSTLMG-ISHSSPPLSPAK----------TPFCGYGMT----AAKLIEM-------MS  621
             SPTSTL+G +SH S   S +           +P   Y  T    A +L +        MS
Sbjct  248   SPTSTLLGNMSHLSRSPSLSPPLSPVKHGLISPISRYSATTPVPADRLSKFSNSSEMSMS  307

Query  620   YKEALTQLVNSLEQVNLNPLS-PATTT----INRM----TRPFSGNDPIQFSLPNSPSTP  468
             YK+ L +L+ S++ ++ N +S P + T    +N         F+  D  QF L  SPSTP
Sbjct  308   YKDVLNELMTSMDAISFNEVSSPMSLTPSNDVNACPWIDVSSFNVEDQQQFVL--SPSTP  365

Query  467   G--------------RHSSGSEFLTPQR------NTAFSDNGGLTGI-------DLDWVN  369
                             + S   FL   +      N   +++ G   +       DL WVN
Sbjct  366   SPSAGSIMNPVAAHHDYFSNKSFLDDDQKMINYHNHIHNNSNGSCQLASDTPDPDLGWVN  425

Query  368   DLLT  357
             +LLT
Sbjct  426   ELLT  429



>ref|XP_003539940.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Glycine max]
Length=356

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 202/345 (59%), Gaps = 36/345 (10%)
 Frame = -1

Query  1316  LKKAMAELD--VSPRKILSRRGAAEADGFLDSPTKIEGGVF------QKFLPYNDVEDED  1161
             LKK++ ++D  V PRK+L+RR AA  D        + G +F       K+LP+N   D  
Sbjct  21    LKKSLRDIDIPVPPRKLLTRRSAAVHD--------VSGDMFSDDTLRHKYLPHNGSTDSS  72

Query  1160  EDGDR--YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSE  987
             +D     Y++D FRM+EFKVRRCTRSRSHDWTDCPF HPGEKARRRDPR+FHYS TVC E
Sbjct  73    DDDSGDPYASDQFRMFEFKVRRCTRSRSHDWTDCPFVHPGEKARRRDPRRFHYSATVCPE  132

Query  986   FRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNR  807
             FR+G+C RGD CEF+HGVFE WLHP+RYRTEACKDG+NCKRKVCFFAH+ RQLR+L  N 
Sbjct  133   FRRGQCDRGDACEFSHGVFECWLHPSRYRTEACKDGRNCKRKVCFFAHTPRQLRVLHSNE  192

Query  806   YSTGSLSPVHDPAEKNLRKNLCC---------HSPTSTLMGISHSSPPLSPAKTPFCGYG  654
              S         P   N   N CC          SPTSTL G+SH SPPLSP         
Sbjct  193   NSNKKKCTNMSPHNNNNNTNNCCLVCHCSSSTRSPTSTLFGMSHFSPPLSPPSPSSPSRF  252

Query  653   MTAAKLIEMMSYKEALTQLVNSLEQVNLNP---LSPATTTINRMTRPF---SGNDPIQFS  492
              T      +   K+ L++L+ S+E +N      LS A+   N ++        ++  QFS
Sbjct  253   ETNHHHGVVKYNKDVLSELMCSMEGLNFGEASLLSAASKPHNNLSSWLDVSEDHNQKQFS  312

Query  491   -LPNSPSTPGRHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLL  360
              L  + +  G  S+       +  +   D+  +   DL WVN+LL
Sbjct  313   TLSPTITACGSFSNNGNGRFLREESGVVDD--VISPDLAWVNELL  355



>gb|KDO42121.1| hypothetical protein CISIN_1g036437mg [Citrus sinensis]
Length=431

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 202/363 (56%), Gaps = 71/363 (20%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQ-KFLPYNDVEDEDEDGDR-YSADHFRMYEFKVRRCTRSRSHDWTDC  1065
             +L  P + E  +   KFLP+N+ + + +     Y++DHFRMYEFK+RRCTRSRSHDWTDC
Sbjct  71    YLFYPDQQEMNILHNKFLPFNNTDADSDPDSDPYASDHFRMYEFKIRRCTRSRSHDWTDC  130

Query  1064  PFAHPGEKARRRDPRKFHYSGTVCSEFRKGK-CGRGDNCEFAHGVFESWLHPARYRTEAC  888
             PFAHP EKARRRDPR++HYSG VCSE+R+G  C  GD+CEFAHGVFE WLHP+RYRTEAC
Sbjct  131   PFAHPSEKARRRDPRRYHYSGAVCSEYRRGGGCSLGDDCEFAHGVFECWLHPSRYRTEAC  190

Query  887   KDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLC--CH------S  732
             KDGKNCKRKVCFFAHS RQLRILP       S     +   + +  + C  CH      S
Sbjct  191   KDGKNCKRKVCFFAHSPRQLRILPEISSQYSSSPSSVNNNNQKISSHCCMYCHHHSVNSS  250

Query  731   PTSTLMG-ISHSSPPLSPAK----------TPFCGYGMT----AAKLIEM-------MSY  618
             PTSTL+G +SH S   S +           +P   Y  T    A +L +        MSY
Sbjct  251   PTSTLLGNMSHLSRSPSLSPPLSPVKHGLISPISRYSATTPVPADRLSKFSNSSEMSMSY  310

Query  617   KEALTQLVNSLEQVNLNPLS-PATTT----INRM----TRPFSGNDPIQFSLPNSPSTPG  465
             K+ L +L+ S++ ++ N +S P + T    +N         F+  D  QF L  SPSTP 
Sbjct  311   KDVLNELMTSMDAISFNEVSSPMSLTPSNDVNACPWIDVSSFNVEDQQQFVL--SPSTPS  368

Query  464   --------------RHSSGSEFLTPQR------NTAFSDNGGLTGI-------DLDWVND  366
                            + S   FL   +      N   +++ G   +       DL WVN+
Sbjct  369   PSAGSIMNPFAAHHDYFSNKSFLDDDQKMINYHNHIHNNSNGSCQLASDTPDPDLGWVNE  428

Query  365   LLT  357
             LLT
Sbjct  429   LLT  431



>ref|XP_010556843.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Tarenaya 
hassleriana]
Length=399

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 154/345 (45%), Positives = 191/345 (55%), Gaps = 89/345 (26%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y+ADHFRMYEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC 
Sbjct  70    DSDSD-DPYAADHFRMYEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYSYSGEVCP  128

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             E+R+ G C RGD+C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  129   EYRRGGDCSRGDDCSFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  188

Query  812   NRYSTG-----------SLSPVHDPAEKNLRKNLCCH----SPTSTLMGISHSSPPLSPA  678
                S G           SLSP    +    R  L CH    SPTS L+G+SH +      
Sbjct  189   EDVSAGSCGDASMTSAVSLSPASVLSGGKNRCCLFCHHGVGSPTSPLLGLSHLT------  242

Query  677   KTPFCGYGMTAAKLIEMMS----------YKEALTQLVNSLEQVNLNPL-----SPATTT  543
             ++P     ++ AK   ++S          YK+ L++L++SL+ + L  +     SP TT 
Sbjct  243   RSPSVSPPLSPAKKTAVLSRLRSQLGSAAYKDVLSELMSSLDSMTLAEVLAGSSSPVTTP  302

Query  542   INRMTRPFSGNDP------------------------IQFSLPNSPSTPGRHSSGSEFLT  435
             +   +   S                            +QF+   SPS+P      S   +
Sbjct  303   VATSSALISAGTTNHRVPWLDVGFGGERDIQQQQQSHLQFAF--SPSSP------SFLNS  354

Query  434   PQRNTAFSDN----GGL--------------TGI-DLDWVNDLLT  357
             P+    FSD+    GGL               G+ DL WVNDLLT
Sbjct  355   PKPANLFSDDSSPHGGLRDRPMAASAAFEDGCGVPDLGWVNDLLT  399



>emb|CDY18184.1| BnaC05g02070D [Brassica napus]
Length=394

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 149/324 (46%), Positives = 177/324 (55%), Gaps = 57/324 (18%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  75    DSDTD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  133

Query  989   EFRKG-KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+G  C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  134   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  193

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAA---  642
                S GS +       +N     C  SPTSTL+G          +  P       AA   
Sbjct  194   ENDSGGSSASTSQAKNQNPCCLFCSGSPTSTLLGNLSHLSRSPSSSPPLSPAHKAAAFSR  253

Query  641   --------KLIEMMSYKEALTQLVNSLEQVNL----------------------NPLSPA  552
                          ++YK+ L  LVNSL+ + L                      N  S  
Sbjct  254   LRSCAASAAAAGSVNYKDVLNDLVNSLDSITLAEALQVSSPSPSPVSAAAAAFANASSCG  313

Query  551   TTTINRMTRPFSGNDPIQFSLPNSPSTPG------RHSSGSEFLTPQR------------  426
              +T     +    + P+QF+L  SPS+P       R S  S+  TP++            
Sbjct  314   LSTQRLHIQQQQQSSPLQFAL--SPSSPSYLTNSPRASFFSDDYTPRQREVNEFTPSAVR  371

Query  425   -NTAFSDNGGLTGIDLDWVNDLLT  357
               T F D G     D+ WVNDLLT
Sbjct  372   EKTRFED-GSCGDPDIGWVNDLLT  394



>gb|AAX20386.1| putative CCCH-type zinc finger transcription factor [Gossypium 
hirsutum]
Length=339

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 181/307 (59%), Gaps = 42/307 (14%)
 Frame = -1

Query  1202  FQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  1023
               K+LP N  ED+D   D Y  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP
Sbjct  48    LHKYLPSN--EDDDGTDDPYGTDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  105

Query  1022  RKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
              ++ YS T+CS+FR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGKNCKRKVCFFA
Sbjct  106   TRYQYSSTICSDFRRGGGCPRGDDCEFAHGVFECWLHPTRYRTEACKDGKNCKRKVCFFA  165

Query  845   HSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCC-----------HSPTSTLMGISHS  699
             HSSR+LR+LP ++       P +  ++KN   N CC            SPTSTL+G+SH 
Sbjct  166   HSSRELRLLPESQ-------PPYKNSDKNY--NHCCLFCRSVTSSSSLSPTSTLLGLSHF  216

Query  698   SPPLS----------PAKTPFCGYGMTAAKLIEMM-SYKEALTQLVNS-LEQVNLNPLSP  555
             S   S            +TP  G    +    EM  SY + L + V S L  +NL+ +S 
Sbjct  217   SRSPSLSPPLSPLKHQQRTPRYGGDRISKFGTEMTSSYDDVLLKEVMSYLGTMNLSEVSS  276

Query  554   ATTTINRMTRPFSGNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDNGGLTGIDLD-  378
                T      P+        S   +PST     SG  F     +   + NG +   DLD 
Sbjct  277   PMATTANTNIPW-----FDVSFKGAPSTVSPSGSGEYFNGGGDDEKNNGNGVVLDHDLDL  331

Query  377   -WVNDLL  360
              WVN+LL
Sbjct  332   GWVNELL  338



>gb|KFK31654.1| hypothetical protein AALP_AA6G141300 [Arabis alpina]
Length=372

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 174/328 (53%), Gaps = 58/328 (18%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR F Y+G VC 
Sbjct  46    DSDSD-DPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRLFQYTGEVCP  104

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR  G C  G+ C FAHGVFE WLHP RYRTEACKDGK+C RKVCFFAHS RQLR+LP 
Sbjct  105   EFRHGGDCSLGNECGFAHGVFECWLHPNRYRTEACKDGKHCNRKVCFFAHSPRQLRVLPP  164

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCC-----HSPTSTLMGISHSSPPLSPAKTPFCGYGMT  648
                 +G +S     A      N CC     HSPTSTL+G+SH S   S +          
Sbjct  165   ENVISGGVSSPAVTALSGKNNNQCCLFCNSHSPTSTLLGLSHFSRSPSSSPPLSPANKAA  224

Query  647   AAKLIE----MMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFS------------  516
             A   +      + YKEAL +L++SL+ ++L       ++ + +T P S            
Sbjct  225   AFSRLSRHRLAVGYKEALNELISSLDSISLTEALAVASSASTVTMPVSTAVMLSNHHHHR  284

Query  515   -------GNDPIQ----FSLPNSPSTPGRHSSGSEFLTPQRNTAFSDN------------  405
                    G+  +Q        +SPSTP    S  +   P   + FSD             
Sbjct  285   IPPWLDVGDRDLQLHSSLQFGHSPSTPSYLHSQLQLQQPPPPSFFSDAFTPRGGRISDFT  344

Query  404   ------------GGLTGIDLDWVNDLLT  357
                         G     DL WVNDLLT
Sbjct  345   AAASAFAAAKEVGSSGDPDLRWVNDLLT  372



>emb|CDY15473.1| BnaA08g27570D [Brassica napus]
Length=399

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 182/341 (53%), Gaps = 74/341 (22%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y+++HFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YS  VC 
Sbjct  63    DSDTD-DPYASEHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSAEVCP  121

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  122   EFRRDGDCSRGDECEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  181

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                S G  +     A KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  182   ENVSGGGSASGSPAAAKNPCCMFCSSSPTSTLLGNLSHLSRSPSLSPPLSPAHKAAAFSR  241

Query  635   IE------------------MMSYKEALTQLVNSLEQVNL------NPLSPATTTI----  540
             +                    ++Y + L +LVNSL+ +NL      +  SP TT +    
Sbjct  242   LRNRAASAVSEAVSAAAAAGSVNYNDVLNELVNSLDSINLAEALHVSSSSPVTTPVSAAA  301

Query  539   -----------NRMTRPFSGNDPIQFSLPNSPSTPG------------------------  465
                         R+      + P+QF+L  SPSTP                         
Sbjct  302   AAFASSCGLSNQRLHLQQQQSSPLQFAL--SPSTPSYLATSFSPSSPSYLTNSPRANIFS  359

Query  464   -----RHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLLT  357
                  R    +EF   +  T+F D G     DL WVNDLLT
Sbjct  360   GEITPRQRQKNEFTAVRDKTSFED-GSCGDPDLGWVNDLLT  399



>ref|XP_010689060.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Beta vulgaris subsp. vulgaris]
Length=403

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 160/384 (42%), Positives = 208/384 (54%), Gaps = 74/384 (19%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSAD  1134
             KKA+ +L++ PRK+LSRR  ++A  +    ++    +  KFLP N        G   + D
Sbjct  27    KKALQDLNIPPRKLLSRR--SDAAEYYSPSSEAAASLMHKFLPCNGDSSPTGGGSDDAFD  84

Query  1133  ---------HFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFR  981
                       FRMYEFKVR+CTRSRSHDWTDCPF+HPGEKARRRDPR+FHYSGTVC E+R
Sbjct  85    PDDDPYSSDEFRMYEFKVRKCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYSGTVCPEYR  144

Query  980   K-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNR-  807
             + G C RGD+C+FAHGVFE WLHPARYRTEACKDGKNCKRKVCFFAHS R+LR+LP    
Sbjct  145   RSGSCSRGDDCDFAHGVFECWLHPARYRTEACKDGKNCKRKVCFFAHSPRELRVLPAEED  204

Query  806   ------YSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISH------------SSPPLSP  681
                    S    +  H   +   R   C  SPTSTL+G+S+             SP  + 
Sbjct  205   GEERENCSQRGHNGKHQHQQHCCRY-CCALSPTSTLLGLSNFSPPMSPSLSPPMSPMKAV  263

Query  680   AKTPFCGYGMTAAKLI----EMMSYKE-ALTQLVNSLEQVNLN-PLSPATTTINR--MTR  525
             +     G+   + +++    + MSY++  +  L+ SLE ++L+  +SPA    +   +  
Sbjct  264   SARGLSGFSRYSDRVVACGSKGMSYEDMVIADLLGSLEGMSLSEAMSPANKAGHSRGLWV  323

Query  524   PFSGND--------------PIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDNGGLTGI  387
                G D               +QFSL  SPSTP  + S     T  RN   + N   +  
Sbjct  324   DVGGYDNGVGEDYQQQLPHQQMQFSL--SPSTPINNQSA---FTSSRNYFSAANADSSVS  378

Query  386   ---------------DLDWVNDLL  360
                            DL WVNDLL
Sbjct  379   GVVNNNNNNSFDESPDLGWVNDLL  402



>ref|XP_010482518.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Camelina sativa]
Length=399

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 186/331 (56%), Gaps = 67/331 (20%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  76    DSDSD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  134

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  135   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  194

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKL  636
                +    S     A KN     C  SPTSTL+G +SH S   S +      +   A   
Sbjct  195   E--NVSGGSGSPSSAAKNPCCLFCSSSPTSTLLGNLSHLSRSPSLSPPMSPAHKAAAFSR  252

Query  635   IE--------------MMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFS------  516
             +                ++YK+ L++LVNSL+ ++L      T++ + +T P S      
Sbjct  253   LRNRAASAVSAAAAADSVNYKDVLSELVNSLDSMSLAEALQVTSSSSPVTTPVSAAAAAF  312

Query  515   ------GNDPIQ-----------FSLPNSPST-------PGRHSSGSEFLTPQR------  426
                    N  +            F+L  SPST       P  +  G +F TP+R      
Sbjct  313   ASSCGLSNQRLHLQQQQPSSPLQFAL--SPSTLSYLTNSPRANFFGDDF-TPRRRQMNDF  369

Query  425   --------NTAFSDNGGLTGIDLDWVNDLLT  357
                      T+F D G     DL WVNDLLT
Sbjct  370   STVAAVRDKTSFED-GSCGDPDLGWVNDLLT  399



>emb|CDX86670.1| BnaC08g00330D [Brassica napus]
Length=373

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 153/238 (64%), Gaps = 31/238 (13%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y+++HFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YS  VC 
Sbjct  65    DSDTD-DPYASEHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSAEVCP  123

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+ G C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  124   EFRRDGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  183

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAA--  642
                S GS S    PA KN     C  SPTSTL+G +SH S   S +          AA  
Sbjct  184   ENVSGGSASA--SPA-KNPCCMFCSSSPTSTLLGNLSHLSRSPSLSPPLSPASHKAAAFS  240

Query  641   -----------------KLIEMMSYKEALTQLVNSLEQVNL------NPLSPATTTIN  537
                                   ++Y + LT+LVNSL+ +NL      +  SP TT ++
Sbjct  241   RLRNRAASTVSEAVSAAAAAGSVNYNDVLTELVNSLDSINLAEALHVSSSSPVTTPVS  298



>emb|CDX89867.1| BnaA10g02150D [Brassica napus]
Length=390

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 150/328 (46%), Positives = 183/328 (56%), Gaps = 65/328 (20%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  71    DSDTD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  129

Query  989   EFRKG-KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+G  C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRKVCFFAHS RQLR+LP 
Sbjct  130   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKVCFFAHSPRQLRVLPP  189

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG----------------ISHSSPPLSP  681
                S GS +       +N     C  SPTSTL+G                 +H +   S 
Sbjct  190   ENDSGGSSASASPAKNQNPCCLFCSGSPTSTLLGNLSHLSRSPSSSPPLSPAHKAAAFSR  249

Query  680   AKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNL----------------------N  567
              ++  C     AA  +   +YK+ L +LVNSL+ + L                      N
Sbjct  250   LRS--CAASAAAAGSV---NYKDVLNELVNSLDSITLAEALQVSSPSPSPVSAAAAAFAN  304

Query  566   PLSPATTTINRMTRPFSGNDPIQFSLPNSPSTPG------RHSSGSEFLTPQ--------  429
               S   +T     +    + P+QF+L  SPSTP       R S  S+  TP+        
Sbjct  305   ASSCGLSTQRLHIQQQQQSSPLQFAL--SPSTPSYLANSPRASFFSDDYTPRQREVNEFT  362

Query  428   ----RNTAFSDNGGLTGIDLDWVNDLLT  357
                 R+    ++G     D+ WVNDLLT
Sbjct  363   PAAVRDKTRFEDGSCGDPDIGWVNDLLT  390



>ref|XP_006403122.1| hypothetical protein EUTSA_v10003231mg [Eutrema salsugineum]
 gb|ESQ44575.1| hypothetical protein EUTSA_v10003231mg [Eutrema salsugineum]
Length=377

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 151/218 (69%), Gaps = 10/218 (5%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKC  969
             Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EFR  G C
Sbjct  50    YAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGEVCPEFRHGGDC  109

Query  968   GRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP-----VNRY  804
              RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRK+CFFAHS RQLR+LP     ++  
Sbjct  110   SRGDECGFAHGVFECWLHPSRYRTEACKDGKHCKRKICFFAHSPRQLRVLPPPEKFISGG  169

Query  803   STGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPF-CGYGMTAAKLIEM  627
             + GS S +   ++ N     C HSPTSTL G++ S     P             ++    
Sbjct  170   NGGSASML--SSKSNGCCMFCSHSPTSTLFGLTRSPSSSPPLSPANKSAVFSRLSRRRSS  227

Query  626   MSYKEALTQLVNSLEQVNLN-PLSPATTTINRMTRPFS  516
             ++YKE L +L+NSL+ V+L   L+ A+++   +T P S
Sbjct  228   VAYKEVLNELINSLDSVSLTEALAVASSSSCPVTMPVS  265



>ref|XP_009111142.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Brassica rapa]
Length=399

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 158/399 (40%), Positives = 200/399 (50%), Gaps = 94/399 (24%)
 Frame = -1

Query  1295  LDVSPRKILSRRGAAEADGFLDSPTKIE-GGVFQKFLPYNDVEDEDEDG-----------  1152
             +D+ PRK+L    +  +     SP K          +  ++ E+++EDG           
Sbjct  9     VDIPPRKLLLAESSPRS-----SPRKHNWNNKVSNKIATSEHEEDNEDGNNKETKEYCYD  63

Query  1151  ----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEF  984
                 D Y+++HFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YS  VC EF
Sbjct  64    SDTDDPYASEHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSAEVCPEF  123

Query  983   RK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNR  807
             R+ G C RG+ CEFAHGVFE WLHP RYRTEACKDGK+CKRK CFFAHS RQLR+LP   
Sbjct  124   RRDGDCSRGEECEFAHGVFECWLHPIRYRTEACKDGKHCKRKGCFFAHSPRQLRVLPPEN  183

Query  806   YSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG-ISHSSPPLSPAKTPFCGYGMTAAKLIE  630
              S G  +       KN     C  SPTSTL+G +SH S   S +      +   A   + 
Sbjct  184   VSGGGSASGSPAVAKNPCCMFCSSSPTSTLLGNLSHLSRSPSLSPPLSPAHKAAAFSRLR  243

Query  629   ------------------MMSYKEALTQLVNSLEQVNL------NPLSPATTTI------  540
                                ++Y + L +LVNSL+ +NL      +  SP TT +      
Sbjct  244   NRAASAVSEAVSAAAAAGSVNYNDVLNELVNSLDSINLAEALHVSSSSPVTTPVSAAAAA  303

Query  539   ---------NRMTRPFSGNDPIQFSLPNSPSTPG--------------------------  465
                       R+      + P+QF+L  SPSTP                           
Sbjct  304   FASSCGLSNQRLHLQQQQSSPLQFAL--SPSTPSYLATSFSPSSPSYLTNSPRANIFSGE  361

Query  464   ---RHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLLT  357
                R    +EF   +  T+F D G     DL WVNDLLT
Sbjct  362   ITPRQRQKNEFTAVRDKTSFED-GSCGDPDLGWVNDLLT  399



>ref|XP_009119364.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Brassica rapa]
Length=390

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 182/328 (55%), Gaps = 65/328 (20%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y++DHFRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+F YSG VC 
Sbjct  71    DSDTD-DPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  129

Query  989   EFRKG-KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR+G  C RGD+CEFAHGVFE WLHP RYRTEACKDGK+CKRK+CFFAHS RQLR+LP 
Sbjct  130   EFRRGGDCSRGDDCEFAHGVFECWLHPIRYRTEACKDGKHCKRKLCFFAHSPRQLRVLPP  189

Query  812   NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMG----------------ISHSSPPLSP  681
                S GS +       +N     C  SPTSTL+G                 +H +   S 
Sbjct  190   ENDSGGSSASASPAKNQNPCCLFCSGSPTSTLLGNLSHLSRSPSSSPPLSPAHKAAAFSR  249

Query  680   AKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNL----------------------N  567
              ++  C     AA  +   +YK+ L  LVNSL+ + L                      N
Sbjct  250   LRS--CAASAAAAGSV---NYKDVLNDLVNSLDSITLAEALQVSSPSPSPVSAAAAAFAN  304

Query  566   PLSPATTTINRMTRPFSGNDPIQFSLPNSPSTPG------RHSSGSEFLTPQ--------  429
               S   +T     +    + P+QF+L  SPSTP       R S  S+  TP+        
Sbjct  305   ASSCGLSTQRLHIQQQQQSSPLQFAL--SPSTPSYLANSPRASFFSDDYTPRQREVNEFT  362

Query  428   ----RNTAFSDNGGLTGIDLDWVNDLLT  357
                 R+    ++G     D+ WVNDLLT
Sbjct  363   PAAVRDKTRFEDGSCGDPDIGWVNDLLT  390



>ref|XP_009791791.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana sylvestris]
Length=386

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 166/276 (60%), Gaps = 28/276 (10%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDV-----------EDEDEDGDRYSADHFRMYEFKVRRCTR  1092
             FL + T ++    Q++LP+NDV           +D D   D YS D FRMYEFKVR+C R
Sbjct  55    FLQNDTGLK--ALQRYLPFNDVVGDFDFEYGEGKDIDLPVDAYSCDQFRMYEFKVRKCAR  112

Query  1091  SRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHP  912
              +SHDWT+CP+AHPGEKARRRDPRK+HYSGT C EFRKG C +GD CEFAHGVFE WLHP
Sbjct  113   GKSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEFRKGNCRKGDGCEFAHGVFECWLHP  172

Query  911   ARYRTEACKDGKNCKRKVCFFAHSSRQLRIL-PVNRYSTGSLSPVHDPAEKNLRKNLCCH  735
             ARYRT+ CKDG NCKR+VCFFAHS  Q+R+L P      GS S      E    KNL  H
Sbjct  173   ARYRTQPCKDGLNCKRRVCFFAHSPEQIRVLSPRADSFDGSPSISRYGFEG---KNL--H  227

Query  734   SPTSTLMGISHSSPPL-SPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLS  558
               TS   G    SPP  SP  +P      + + L   +    ++ ++V SL Q+ LN + 
Sbjct  228   FITSPESG----SPPCESPPMSPMTQTTNSVSSLSRSLGSNYSINEMVASLRQLQLNKVK  283

Query  557   PATTTIN-RMTRPFSGNDPIQFSLP---NSPSTPGR  462
                ++ N +M  P  G+  I  + P   + PSTP R
Sbjct  284   SMPSSWNLQMGSPVLGSPRIPVNRPGFCSLPSTPTR  319



>gb|KFK40348.1| hypothetical protein AALP_AA3G362300 [Arabis alpina]
Length=350

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 153/260 (59%), Gaps = 33/260 (13%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEK  1041
               Q++LP N+ + + + G     D YS DHFRMYEFKVRRC R RSHDWT+CP+AHPGEK
Sbjct  42    ALQRYLPCNESDLDSDLGPDSPIDAYSCDHFRMYEFKVRRCARGRSHDWTECPYAHPGEK  101

Query  1040  ARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRK  861
             ARRRDPRKFHYSG  C EFRKG C RGD CEF+HGVFE WLHPARYRT+ CKDG  C+R+
Sbjct  102   ARRRDPRKFHYSGVACPEFRKGGCKRGDGCEFSHGVFECWLHPARYRTQPCKDGGGCRRR  161

Query  860   VCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNL-CCHSPTSTLMGISHSSPPLS  684
             VCFFAHS  QLR+LP+N+      SP    + + LR+      SPTS        SPP+S
Sbjct  162   VCFFAHSPDQLRVLPINQ------SPDRVDSFEGLRRGFQFSISPTS-------GSPPVS  208

Query  683   PAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGNDP  504
             P         +T   L   +    ++  +V S   + LN +    + I      F    P
Sbjct  209   PRDD---SVDVTQCSLSRSLG-SNSVNDVVASFRNLQLNKM---KSHIGCYGSGFGSGSP  261

Query  503   IQ-------FSLPNSPSTPG  465
                       SLPN+P+ PG
Sbjct  262   RGSVLGPGFLSLPNTPTRPG  281



>emb|CDX94766.1| BnaC07g17750D [Brassica napus]
Length=380

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 172/330 (52%), Gaps = 72/330 (22%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKC  969
             Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EFR  G C
Sbjct  56    YAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGDVCPEFRHGGDC  115

Query  968   GRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL  789
              RGD C FAHGVFE WLHP+RYRTEACKDGK C RK+CFFAHS  QLR+LP         
Sbjct  116   SRGDECGFAHGVFECWLHPSRYRTEACKDGKQCTRKICFFAHSPPQLRVLPPPESFVSGG  175

Query  788   SPVHDPAEKNLRKN-------LCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLI-  633
                   +  ++  N        C HSPTS L+G++HS     P         + A   + 
Sbjct  176   GGSALSSPASVLSNKSNGCCVFCSHSPTSPLLGLAHSPSSSPPLSP---ANKVAAVSRLS  232

Query  632   ---EMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFS------------------  516
                  + YKE L +L+NSL+   L     A +  + +T P S                  
Sbjct  233   SHRSAVKYKEVLNELINSLDSFGLTQALTAASPSSMVTMPVSTASMLASSSLSNHYHHRL  292

Query  515   ------GNDPIQFSLPNSPSTPGRHSSG--------------SEFLTPQ-----------  429
                   G+  +QF+L  SPS+   + +G              SE  TP+           
Sbjct  293   PPWLDVGDRDLQFAL--SPSSTPSYLNGQLQLQLQPPPPSFFSEEFTPRGGRVSDFTATA  350

Query  428   ------RNTAFSDNGGLTGIDLDWVNDLLT  357
                   R+ +  + G    +DL WVNDLLT
Sbjct  351   TAAAEARDKSSFEIGSNGDLDLGWVNDLLT  380



>ref|XP_009408887.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=395

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 148/234 (63%), Gaps = 24/234 (10%)
 Frame = -1

Query  1205  VFQKFLPYN---------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
               Q++LP N         +V++ D   D YS+D FRMYEFKVRRC R RSHDWT+CPFAH
Sbjct  56    ALQRYLPCNIDEPGAEEEEVDEPDAAVDVYSSDEFRMYEFKVRRCARGRSHDWTECPFAH  115

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSG  C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG  
Sbjct  116   PGEKARRRDPRKYHYSGAACPDFRKGGCKRGDACEFAHGVFECWLHPARYRTQPCKDGTA  175

Query  872   CKRKVCFFAHSSRQLRILPVNRYS-TGSLSPV---------HDPAEKNLRKNLCCHSPTS  723
             C+R+VCFFAH+  QLR+LP  + + T + + V         H   E  L K++   SPTS
Sbjct  176   CRRRVCFFAHTPDQLRVLPQQQQTPTKAAAAVESYDGSPLRHQAMESYLSKHIMSSSPTS  235

Query  722   TLMGISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPL  561
             TL+    S P  SP  +P      TAA        + +L ++V SL Q+ LN +
Sbjct  236   TLISPPISPPSDSPPMSP-----STAAIRRASWPMRSSLNEVVASLRQLQLNKV  284



>ref|XP_009381212.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=401

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 122/184 (66%), Gaps = 20/184 (11%)
 Frame = -1

Query  1205  VFQKFLPYN--------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q++LP N        DVE+ D   D YS+D FRMYEFKVRRC R RSHDWT+CPFAHP
Sbjct  60    ALQRYLPCNGEETVAEEDVEEPDAAVDVYSSDEFRMYEFKVRRCARGRSHDWTECPFAHP  119

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRK+HYSG  C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG  C
Sbjct  120   GEKARRRDPRKYHYSGAACPDFRKGGCKRGDACEFAHGVFECWLHPARYRTQPCKDGTAC  179

Query  869   KRKVCFFAHSSRQLRILPVNRYSTGSLSPV------------HDPAEKNLRKNLCCHSPT  726
             +R+VCFFAH++ QLRILP  +       P                 E  L K+L   SPT
Sbjct  180   RRRVCFFAHTADQLRILPQQQQQQTPTKPAVAGESYDGSPLRQQALETYLSKHLMSSSPT  239

Query  725   STLM  714
             STL+
Sbjct  240   STLI  243



>ref|XP_009608132.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana tomentosiformis]
Length=386

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 159/266 (60%), Gaps = 28/266 (11%)
 Frame = -1

Query  1205  VFQKFLPYNDV-----------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
               Q++LP+NDV           +D D   D YS D FRMYEFKVR+C R +SHDWT+CP+
Sbjct  64    ALQRYLPFNDVVGDFDFEYGEGKDIDLPVDAYSCDQFRMYEFKVRKCARGKSHDWTECPY  123

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  124   AHPGEKARRRDPRKYHYSGTACPDFRKGNCRKGDGCEFAHGVFECWLHPARYRTQPCKDG  183

Query  878   KNCKRKVCFFAHSSRQLRIL-PVNRYSTGSLSPVHDPAE-KNLRKNLCCHSPTSTLMGIS  705
              NCKR+VCFFAHS  Q+R+L P      GS S      E KN+       SP S      
Sbjct  184   LNCKRRVCFFAHSPEQIRVLSPRADSFDGSPSISRYGFEGKNMH---FIQSPES------  234

Query  704   HSSPPL-SPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTIN-RM  531
               SPP  SP  +P      + + L   +    ++ ++V SL Q+ LN +    ++ N +M
Sbjct  235   -GSPPCESPPMSPMTQTTNSVSSLSRSLGSNYSINEMVASLRQLQLNKVKSMPSSWNLQM  293

Query  530   TRPFSGNDPIQFSLP---NSPSTPGR  462
               P  G+  +  + P   + PSTP R
Sbjct  294   GSPVLGSPRLPVNRPGFCSLPSTPTR  319



>ref|XP_002863601.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39860.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 120/160 (75%), Gaps = 11/160 (7%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D + D Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+FHY+G VC 
Sbjct  49    DSDSE-DPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYTGEVCP  107

Query  989   EFRK--GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             EF +  G C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAHS RQLR+LP
Sbjct  108   EFSRHGGDCSRGDECGFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAHSPRQLRVLP  167

Query  815   V---NRYSTGSLSPVHDPAEKNLRKN-----LCCHSPTST  720
                 N  S    SP+  PA     KN      C HSPTST
Sbjct  168   PSPGNLVSGCGGSPLSSPASVLSSKNNRCCLFCSHSPTST  207



>ref|XP_009403103.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=307

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 158/271 (58%), Gaps = 29/271 (11%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSAD  1134
             K+A+  LD+ PR++L R G +           +     +           DE+ D YS+D
Sbjct  16    KRALLNLDLPPRRLLQRPGLS-----------VVLPEEEDEEEDGGEGSVDEEVDVYSSD  64

Query  1133  HFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKCGRGD  957
              FRMYEFKVRRC R RSHDWTDCPFAHPGEKARRRDPR++HYSG VC +FR+ G C RGD
Sbjct  65    EFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGVVCPDFRRCGSCSRGD  124

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS-PV  780
             +CE AHGVFE WLHPARYRT  CKDG+ C+RKVCFFAH  RQLR+LP +  +    S P 
Sbjct  125   DCELAHGVFECWLHPARYRTMPCKDGRRCRRKVCFFAHFPRQLRVLPSHSNNDEKPSAPC  184

Query  779   HDPAEKNLRK-NLCCHSPTSTLMGISHSSPPLSPA--KTPFCGYGMTAAKLIEM------  627
             +     N         SPTSTLM     SPP+SP+  +    G  +    +  +      
Sbjct  185   YGFWSANDNSVAAAAFSPTSTLMSF---SPPISPSVGELQLSGNDIKQRNMRGINRNNNP  241

Query  626   ---MSYKEALTQLVNSLEQVNLNPLSPATTT  543
                M Y     +L NSLE + L+  SP T++
Sbjct  242   SGAMDYDGLCEELTNSLEAMELSA-SPVTSS  271



>emb|CDY13114.1| BnaA09g17030D [Brassica napus]
Length=375

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 152/226 (67%), Gaps = 11/226 (5%)
 Frame = -1

Query  1169  DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCS  990
             D D D D Y+ DHFRMYEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++HY+G VC 
Sbjct  46    DSDSD-DPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYTGEVCP  104

Query  989   EFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPV  813
             EFR  G C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRK+CFFAHS RQLR+LP 
Sbjct  105   EFRNGGDCSRGDMCGFAHGVFECWLHPSRYRTEACKDGKHCKRKICFFAHSPRQLRVLPP  164

Query  812   NRYSTGSLSPVHDPAEKNLRKN-------LCCHSPTSTLMGISHSSPPLSPAKTPFCGYG  654
             +             +  ++  N        C HSPTSTL+ +S SSPPLSPA        
Sbjct  165   SENFVSGGGGSAASSPASVLSNKNNRCCVFCSHSPTSTLLDLSPSSPPLSPANKSAVFSR  224

Query  653   MTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFS  516
             M+  +    +++K+ L +L+NSL+  +      A +  + +T P +
Sbjct  225   MS--RRHSALAHKQVLHELINSLDSFSFKEALTAASLSSPVTMPVT  268



>ref|XP_007204367.1| hypothetical protein PRUPE_ppa007297mg [Prunus persica]
 gb|EMJ05566.1| hypothetical protein PRUPE_ppa007297mg [Prunus persica]
Length=374

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 150/263 (57%), Gaps = 33/263 (13%)
 Frame = -1

Query  1205  VFQKFLPYND----------VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
              FQ++LP N+          V + D   D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  62    TFQRYLPSNETDPDSDSDISVRESDSPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  121

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  122   HPGEKARRRDPRKYHYSGTACPDFRKGHCKKGDACEFAHGVFECWLHPARYRTQPCKDGT  181

Query  875   NCKRKVCFFAHSSRQLRILPVNR-YSTGSLSPVH----DPAEKNLRKNLCCHSPTSTLMG  711
             +CKR+VCFFAH+  QLR+LP      + SLS        P  + +     C      L  
Sbjct  182   SCKRRVCFFAHTPEQLRVLPQQSPRGSNSLSTAESYDGSPLRQAIEAAASCGKTLPFLSS  241

Query  710   ISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRM  531
                 SP +SP  +P     MT +    + S   ++ ++V SL  + L  +    ++ N  
Sbjct  242   TPEESPEISPPVSP-----MTRSLSRSLGS--NSVNEVVASLRNLQLGKVKSLPSSWN--  292

Query  530   TRPFSGNDPIQFSLPNSPSTPGR  462
                      +Q      PSTP R
Sbjct  293   ---------VQVGSSGLPSTPTR  306



>ref|XP_010429604.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Camelina sativa]
Length=306

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 132/187 (71%), Gaps = 15/187 (8%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
             FLDS T +      ++LP N++ ++ ++      D F MYEFK+RRC RSRSHDWT+CPF
Sbjct  48    FLDSFTSL-----YRYLPSNELTNDSDESSL--TDEFHMYEFKIRRCARSRSHDWTECPF  100

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRKFHYSGT C EFRKG C RGD+CEFAHGVFE WLHP+RYRT+ CKDG
Sbjct  101   AHPGEKARRRDPRKFHYSGTACPEFRKGSCRRGDSCEFAHGVFECWLHPSRYRTQPCKDG  160

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS  699
              +C+R++CFFAH++ QLR+LP       SL P  D       K+    SPTSTL      
Sbjct  161   TSCRRRICFFAHTTEQLRVLPC------SLDP--DLGGFFSSKSGLATSPTSTLGSPHSE  212

Query  698   SPPLSPA  678
             SPPLSP+
Sbjct  213   SPPLSPS  219



>ref|XP_004505556.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Cicer arietinum]
Length=331

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 157/286 (55%), Gaps = 24/286 (8%)
 Frame = -1

Query  1157  DGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK  978
             D D YS+D FRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP K+ YSG VC ++R+
Sbjct  49    DEDPYSSDQFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPLKYQYSGEVCPDYRR  108

Query  977   GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL----PVN  810
             G C RGD CEF+HGVFE WLHP+RYRTEACKDGKNCKRK+CFFAH+ RQLR+L    P +
Sbjct  109   GNCERGDACEFSHGVFECWLHPSRYRTEACKDGKNCKRKICFFAHTPRQLRVLLLTPPQH  168

Query  809   RYSTGSLSPVHDPAEKNLRKNLCC---HSPTSTLMGISH---------SSPPLSPAKTPF  666
               +  + +              CC    SPTSTL   SH         S    S + T  
Sbjct  169   NNNNNNNNKKSHNNNNCCSYCHCCSANSSPTSTLFSGSHFSKSNSPPLSPSSSSSSPTTL  228

Query  665   CGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGNDPIQFS--  492
               Y      L E+M   E  + L + +    L  L      ++    PF   D  Q    
Sbjct  229   SRYSKNMHVLNELMRSIELESALNSPVSATKLPWLD---VNVSDQYSPFGCEDHSQNHVI  285

Query  491   --LPNSPSTPGRHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLL  360
               LP         S  +EF+  QR     D+  +   D  WVNDLL
Sbjct  286   DVLPTMNCGKYYSSDDAEFVREQRKVV-GDDDVIAVPDFGWVNDLL  330



>ref|XP_009397189.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=304

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 156/267 (58%), Gaps = 42/267 (16%)
 Frame = -1

Query  1313  KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDG------  1152
             KKA+++LD+  RK+L R                        LP  DVED+  DG      
Sbjct  17    KKALSDLDLPHRKLLQR------------------PRLSVLLP--DVEDDSGDGAVDEVV  56

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-G  975
             D YS+D FRMYEFKVRRC R RSHDWTDCPFAHPGEKARRRDPR++HYSG VC EFR+ G
Sbjct  57    DVYSSDEFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGAVCPEFRRSG  116

Query  974   KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNR--YS  801
              C +GD CE AHGVFE WLHPARYRT  CKDG+ C+RK+CFFAH  RQLRILP ++   +
Sbjct  117   SCPKGDACELAHGVFECWLHPARYRTMPCKDGRRCRRKICFFAHFPRQLRILPSHKDDET  176

Query  800   TGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPF------CGYGMTAAK  639
               S S     +  +        SPTSTLM     SPP+SP+            +G+    
Sbjct  177   NYSQSCYGFCSANDNSAAASGFSPTSTLMSF---SPPISPSAGEMHYDSKQMNFGLINRY  233

Query  638   L----IEMMSYKEALTQLVNSLEQVNL  570
             +      ++ Y     +L+NSL+ + L
Sbjct  234   IGNNTGRVIDYDVVCEELMNSLDAMEL  260



>ref|XP_010417368.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Camelina sativa]
Length=304

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 18/188 (10%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
             FLDS T +      ++LP N++ ++ ++      D FRMYEFK+RRC R RSHDWT+CPF
Sbjct  47    FLDSFTSL-----YRYLPSNELTNDSDESSL--TDEFRMYEFKIRRCARGRSHDWTECPF  99

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRKFHYSGT C EFRKG C RGD+CEFAHGVFE WLHP+RYRT+ CKDG
Sbjct  100   AHPGEKARRRDPRKFHYSGTACPEFRKGSCRRGDSCEFAHGVFECWLHPSRYRTQPCKDG  159

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNL-RKNLCCHSPTSTLMGISH  702
              +C+R++CFFAH++ QLR+LP +           DP       K+    SPTS L+    
Sbjct  160   TSCRRRICFFAHTTEQLRVLPCSL----------DPDLGFFSSKSGSATSPTSILVSPQS  209

Query  701   SSPPLSPA  678
              SPPLSP+
Sbjct  210   ESPPLSPS  217



>ref|XP_010267090.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nelumbo nucifera]
Length=387

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 122/178 (69%), Gaps = 14/178 (8%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q +LP NDV+ D D  G       + ++ D FRMYEFKVRRC R RSHDWT+CPFAH
Sbjct  61    AALQCYLPSNDVDADSDLSGRESDMPINVHTCDEFRMYEFKVRRCARGRSHDWTECPFAH  120

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRKFHYSGT C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG +
Sbjct  121   PGEKARRRDPRKFHYSGTACPDFRKGNCKRGDACEFAHGVFECWLHPARYRTQPCKDGTS  180

Query  872   CKRKVCFFAHSSRQLRILPVNRYSTG------SLSPVHDPAEKNLRKNLCCHSPTSTL  717
             C+R+VCFFAH+  QLR+LP     T         SP+    +   +KN    SPTSTL
Sbjct  181   CRRRVCFFAHTPEQLRVLPQQSPRTPVSPESYDGSPLRQALDSYFQKNTVISSPTSTL  238



>ref|XP_004288807.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Fragaria vesca subsp. vesca]
Length=215

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 7/158 (4%)
 Frame = -1

Query  1208  GVFQKFLPYNDV---EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  1038
                +++LP N+     D D   D YS DHFRM+EFKVRRC R RSHDWTDCPFAHPGE+A
Sbjct  22    AALRRYLPSNNEGSDPDPDSPVDAYSGDHFRMFEFKVRRCARGRSHDWTDCPFAHPGEEA  81

Query  1037  RRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKV  858
             +RRDPRKFHYSG+ C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG +CKR+V
Sbjct  82    QRRDPRKFHYSGSACPDFRKGHCKKGDSCEFAHGVFECWLHPARYRTQPCKDGTSCKRRV  141

Query  857   CFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNL  744
             CFFAH+  QLR+LP  +   GS SP   P  +++ ++L
Sbjct  142   CFFAHTPEQLRVLP-QQSPRGSNSP---PMTRSVSRSL  175



>ref|XP_008242454.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Prunus mume]
Length=397

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 143/238 (60%), Gaps = 22/238 (9%)
 Frame = -1

Query  1205  VFQKFLPYND----------VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
              FQ++LP N+          V + D   D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  62    TFQRYLPSNETDPDSDSDISVRESDSPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  121

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  122   HPGEKARRRDPRKYHYSGTACPDFRKGHCKKGDACEFAHGVFECWLHPARYRTQPCKDGT  181

Query  875   NCKRKVCFFAHSSRQLRILPVNR-YSTGSLSPVH----DPAEKNLRKNLCCHSPTSTLMG  711
             +CKR+VCFFAH+  QLR+LP      + SLS        P  + +     C      L  
Sbjct  182   SCKRRVCFFAHTPEQLRVLPQQSPRGSNSLSTAESYDGSPLRQAIEAAASCGKTLPFLSS  241

Query  710   ISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTIN  537
                 SP +SP  +P     MT +    + S   ++ ++V SL  + L  +    ++ N
Sbjct  242   TPEESPEISPPVSP-----MTRSLSRSLGS--NSVNEMVASLRNLQLGKVKSLPSSWN  292



>gb|KHN40356.1| Zinc finger CCCH domain-containing protein 20 [Glycine soja]
Length=332

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 7/139 (5%)
 Frame = -1

Query  1205  VFQKFLPYNDVE-DEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
               Q+FLP N+ + D D +       D YS DHFRMYEFKVRRC R RSHDWT+CP+AHPG
Sbjct  26    ALQRFLPSNETDADSDTEAQPDAAVDAYSCDHFRMYEFKVRRCARGRSHDWTECPYAHPG  85

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRKFHYSG  C EFRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG +C+
Sbjct  86    EKARRRDPRKFHYSGAACPEFRKGNCKKGDTCEFAHGVFECWLHPARYRTQPCKDGTSCR  145

Query  866   RKVCFFAHSSRQLRILPVN  810
             R+VCFFAH+  QLR+LP+ 
Sbjct  146   RRVCFFAHTPEQLRVLPMQ  164



>ref|XP_010925500.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Elaeis guineensis]
Length=394

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 123/191 (64%), Gaps = 28/191 (15%)
 Frame = -1

Query  1205  VFQKFLPYNDV----EDEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q+FLP N++    ED DE        D YS D FRMYEFKVRRC R RSHDWT+CP+A
Sbjct  60    ALQRFLPCNEIYAAGEDTDESEPADAPVDAYSCDEFRMYEFKVRRCARGRSHDWTECPYA  119

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRK+HYSGT C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  120   HPGEKARRRDPRKYHYSGTACPDFRKGNCKRGDACEFAHGVFECWLHPARYRTQPCKDGT  179

Query  875   NCKRKVCFFAHSSRQLRILP-----------------VNRYSTGSLSPVHDPAEKNLRKN  747
              C+R+VCFFAH+  QLR+LP                  + Y    L   H   E    KN
Sbjct  180   ACRRRVCFFAHTPEQLRVLPQQQQQQQLQQSPRTLAATDSYDGSPLRHQHT-LEGYFSKN  238

Query  746   LCCHSPTSTLM  714
             L   SPTSTL+
Sbjct  239   LMSSSPTSTLI  249



>ref|XP_003529068.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 1 [Glycine max]
Length=359

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 7/139 (5%)
 Frame = -1

Query  1205  VFQKFLPYNDVE-DEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
               Q+FLP N+ + D D +       D YS DHFRMYEFKVRRC R RSHDWT+CP+AHPG
Sbjct  53    ALQRFLPSNETDADSDTEAQPDAAVDAYSCDHFRMYEFKVRRCARGRSHDWTECPYAHPG  112

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRKFHYSG  C EFRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG +C+
Sbjct  113   EKARRRDPRKFHYSGAACPEFRKGNCKKGDTCEFAHGVFECWLHPARYRTQPCKDGTSCR  172

Query  866   RKVCFFAHSSRQLRILPVN  810
             R+VCFFAH+  QLR+LP+ 
Sbjct  173   RRVCFFAHTPEQLRVLPMQ  191



>ref|XP_009388582.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 156/267 (58%), Gaps = 24/267 (9%)
 Frame = -1

Query  1181  NDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSG  1002
              DVE+     D YS+D FRMYEFKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSG
Sbjct  81    EDVEEPASAVDVYSSDEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSG  140

Query  1001  TVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRI  822
               C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+
Sbjct  141   AACPDFRKGGCKRGDACEFAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRV  200

Query  821   LPVNRYSTGSLSP----------VHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKT  672
             LP  + +  + S           +    E  + K+L   SPTSTLM    SSP  SP  +
Sbjct  201   LPQQQQTPTNASATVESYDGSPLLQQAMESYISKHLMSSSPTSTLMSPPISSPSNSPPMS  260

Query  671   PFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPL--SPATTTINRMTRPF-------  519
                    TAA      S   +  ++V S+ Q+ L+    +P++      +  F       
Sbjct  261   -----PSTAALGRASWSVGTSPNEIVASMRQLQLSKAKSAPSSWGFQLGSTLFGSPRGTG  315

Query  518   SGNDPIQFSLPNSPSTPGRHSSGSEFL  438
             +G       LP+ P+TPG    G  +L
Sbjct  316   TGFRADLCGLPSIPTTPGTCVGGLAWL  342



>ref|XP_010909936.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Elaeis guineensis]
Length=345

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               Q+FLP N+   +D D       D +S D FRMYEFKVRRC R RSHDWT+CP+AHPGE
Sbjct  45    ALQRFLPSNNEPLDDSDEPLDSALDAFSCDEFRMYEFKVRRCPRGRSHDWTECPYAHPGE  104

Query  1043  KARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             KARRRDPR+FHYSG  C+EFRK G+C RGD C+ AHGVFESWLHP RYRT+ CKDG  C+
Sbjct  105   KARRRDPRRFHYSGAACTEFRKTGRCERGDACDLAHGVFESWLHPTRYRTQFCKDGTACR  164

Query  866   RKVCFFAHSSRQLRILPVNRYSTGSLSP-VHDPAEKNLRKNLCCHSPTSTLMGISHS---  699
             R+VCFFAH+  QLR+LP +  S    +P  +D +     KNL   SP STL+  S S   
Sbjct  165   RRVCFFAHTPNQLRVLPQSPRSPTQPAPESYDGSPARRSKNL-ISSPRSTLISPSVSPTS  223

Query  698   -SPPLSPAKTPFCGYGMTAAKLIEMMSYK  615
              SPP+SP         +TA + +++   K
Sbjct  224   ESPPVSPVGEQAMNEVLTAIRNLQLSKAK  252



>emb|CBI20604.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 132/206 (64%), Gaps = 15/206 (7%)
 Frame = -1

Query  1235  LDSPTKIEGGV--FQKFLPYNDVEDEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHD  1077
             + SP  + G     Q++LP N+   E  D      D +S D FRM+EFKVRRC R RSHD
Sbjct  28    MGSPFPVSGAFSSLQRYLPSNEFGTESGDESETVVDAFSCDQFRMFEFKVRRCARGRSHD  87

Query  1076  WTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRT  897
             WT+CP+AHPGEKARRRDPRKFHYSGT C EFRKG C +GD+CEFAHGVFE WLHPARYRT
Sbjct  88    WTECPYAHPGEKARRRDPRKFHYSGTACPEFRKGNCKKGDSCEFAHGVFECWLHPARYRT  147

Query  896   EACKDGKNCKRKVCFFAHSSRQLRILPV----NRYSTGSL--SPVHDPAEKNLRKNLCCH  735
             + CKDG  C+R+VCFFAH+  QLR+LP     N  S  S   SP+    + NL+      
Sbjct  148   QPCKDGSGCRRRVCFFAHTPEQLRVLPQQSPRNHGSAESYDGSPLRLAFDPNLQVGKAKM  207

Query  734   SPTS--TLMGISHSSPPLSPAKTPFC  663
             SP S    MG    SP  S  +  FC
Sbjct  208   SPQSWGVQMGSGFGSPRGSTLRPGFC  233



>ref|XP_004287502.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   215 bits (548),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 109/145 (75%), Gaps = 14/145 (10%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE--------------DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
                +++LP N+V               D D   D YS DHFRM+EFKVRRC R RSHDWT
Sbjct  58    ATLRRYLPSNEVSDPDPDPYPDSEFDLDNDSPVDAYSCDHFRMFEFKVRRCARGRSHDWT  117

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             DCPFAHPGEKARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  118   DCPFAHPGEKARRRDPRKFHYSGTACPDFRKGHCKKGDSCEFAHGVFECWLHPARYRTQP  177

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG +CKR+VCFFAH+  QLR+LP
Sbjct  178   CKDGTSCKRRVCFFAHTPEQLRVLP  202



>ref|XP_002886019.1| hypothetical protein ARALYDRAFT_480488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62278.1| hypothetical protein ARALYDRAFT_480488 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 107/138 (78%), Gaps = 8/138 (6%)
 Frame = -1

Query  1205  VFQKFLPYN--------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q++LP N        D+   D   D YS DHFRMYEFKVRRC R RSHDWT+CP+AHP
Sbjct  46    ALQRYLPSNEPDPDSDPDLSGPDSPIDAYSCDHFRMYEFKVRRCARGRSHDWTECPYAHP  105

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRKFHYSGT C EFRKG C RGD CEF+HGVFE WLHPARYRT+ CKDG NC
Sbjct  106   GEKARRRDPRKFHYSGTACPEFRKGGCKRGDACEFSHGVFECWLHPARYRTQPCKDGGNC  165

Query  869   KRKVCFFAHSSRQLRILP  816
             +R+VCFFAHS  QLR+LP
Sbjct  166   RRRVCFFAHSPDQLRVLP  183



>ref|XP_002275926.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Vitis 
vinifera]
Length=379

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 122/174 (70%), Gaps = 11/174 (6%)
 Frame = -1

Query  1202  FQKFLPYNDVEDEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  1038
              Q++LP N+   E  D      D +S D FRM+EFKVRRC R RSHDWT+CP+AHPGEKA
Sbjct  63    LQRYLPSNEFGTESGDESETVVDAFSCDQFRMFEFKVRRCARGRSHDWTECPYAHPGEKA  122

Query  1037  RRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKV  858
             RRRDPRKFHYSGT C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG  C+R+V
Sbjct  123   RRRDPRKFHYSGTACPEFRKGNCKKGDSCEFAHGVFECWLHPARYRTQPCKDGSGCRRRV  182

Query  857   CFFAHSSRQLRILPV----NRYSTGSL--SPVHDPAEKNLRKNLCCHSPTSTLM  714
             CFFAH+  QLR+LP     N  S  S   SP+    +  L K     SPTSTL+
Sbjct  183   CFFAHTPEQLRVLPQQSPRNHGSAESYDGSPLRLAFDPYLSKGSFISSPTSTLI  236



>emb|CAN83255.1| hypothetical protein VITISV_036981 [Vitis vinifera]
Length=426

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 122/174 (70%), Gaps = 11/174 (6%)
 Frame = -1

Query  1202  FQKFLPYNDVEDEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  1038
              Q++LP N+   E  D      D +S D FRM+EFKVRRC R RSHDWT+CP+AHPGEKA
Sbjct  110   LQRYLPSNEFGTESGDESETVVDAFSCDQFRMFEFKVRRCARGRSHDWTECPYAHPGEKA  169

Query  1037  RRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKV  858
             RRRDPRKFHYSGT C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG  C+R+V
Sbjct  170   RRRDPRKFHYSGTACPEFRKGNCKKGDSCEFAHGVFECWLHPARYRTQPCKDGSGCRRRV  229

Query  857   CFFAHSSRQLRILPV----NRYSTGSL--SPVHDPAEKNLRKNLCCHSPTSTLM  714
             CFFAH+  QLR+LP     N  S  S   SP+    +  L K     SPTSTL+
Sbjct  230   CFFAHTPEQLRVLPQQSPRNHGSAESYDGSPLRLAFDPYLSKGSFISSPTSTLI  283



>ref|XP_007152945.1| hypothetical protein PHAVU_004G173600g [Phaseolus vulgaris]
 gb|ESW24939.1| hypothetical protein PHAVU_004G173600g [Phaseolus vulgaris]
Length=354

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = -1

Query  1205  VFQKFLPYNDVE-DEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
               Q++LP N+ + D D +       D YS DHFRMYEFK+RRC R RSHDWT+CP+AHPG
Sbjct  53    ALQRYLPANETDADSDSEAQPDAPVDAYSCDHFRMYEFKIRRCARGRSHDWTECPYAHPG  112

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRKFHYSG  C EFRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG +C+
Sbjct  113   EKARRRDPRKFHYSGAACPEFRKGSCKKGDTCEFAHGVFECWLHPARYRTQPCKDGTSCR  172

Query  866   RKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTS  723
             R+VCFFAH+  QLR++P+    +   S    P  + L+      SP +
Sbjct  173   RRVCFFAHTPEQLRLVPMQSPRSSGESYDGSPMRQILQSTAFMSSPAA  220



>ref|XP_010540993.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Tarenaya hassleriana]
Length=363

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 145/265 (55%), Gaps = 29/265 (11%)
 Frame = -1

Query  1208  GVFQKFLPYN--------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N        D    D   D YS DHFRMYEFKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEPDPDYDPDFSGPDSPVDAYSCDHFRMYEFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG N
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGGCRKGDSCEFAHGVFECWLHPARYRTQPCKDGVN  165

Query  872   CKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSP  693
             C+R+VCFFAHS  QLRILP              P   +      C  P    +     SP
Sbjct  166   CRRRVCFFAHSPDQLRILPQQSPDRVDCFDGSSPIRHS------CAMPFQFSLSPVSGSP  219

Query  692   PLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSG  513
             P+SP           + + +       ++  +V SL  + LN +    ++ +   R +  
Sbjct  220   PVSPRAD------SESTQSLSRSFGSSSVNDVVASLRNLQLNKVKSLPSSWSTQMRCYPS  273

Query  512   N---------DPIQFSLPNSPSTPG  465
                        P   SLP +P+ PG
Sbjct  274   GFGSPRGSVLGPGVRSLPTTPTRPG  298



>ref|XP_010481761.1| PREDICTED: zinc finger CCCH domain-containing protein 61 [Camelina 
sativa]
Length=367

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 148/339 (44%), Positives = 178/339 (53%), Gaps = 69/339 (20%)
 Frame = -1

Query  1184  YNDVEDEDEDGDR---YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             Y D  D   D D    Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+F
Sbjct  35    YKDQSDYSYDSDSEDPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRF  94

Query  1013  HYSGTVCSEFRK---GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAH  843
             HY G VC E+ +   G C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAH
Sbjct  95    HYIGEVCPEYSRQGGGDCSRGDQCGFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAH  154

Query  842   SSRQLRILP-------VNRYSTGSLSPVHDPAEKNLRKNLCC----HSPTSTLMGISHSS  696
             S RQLRILP       ++    GS S        N + N CC    HSPTSTL+G+S S 
Sbjct  155   SPRQLRILPPSSPENYISGGCGGSASSSPASVLSN-KNNRCCLFCSHSPTSTLLGLSRSP  213

Query  695   PPLSPAKTPFCGYGMTAAKLIEMMSYKEA-LTQLVNSLEQVNLNPL------SPATTTIN  537
                 P           AA    +   + A L +L++SL+  +L         SP T  ++
Sbjct  214   SSSPPLSP-----ADKAAAFSRLSRRRTAVLNELISSLDSFSLTEALAASSSSPVTMPVS  268

Query  536   RMTRPFSGN-------------------------DPIQFSLPNSPSTPGRHSSGS-----  447
                   S N                          P+QF+L  S +    HS  S     
Sbjct  269   TAAMIASANLGNHHQNRIPPWLDVGDRDLQLHQGSPLQFALSPSSTPSYLHSQPSSSFFS  328

Query  446   EFLTPQ---------RNTAFSDNGGLTGIDLDWVNDLLT  357
             +  TP+         R+    + G    +DL WVNDLLT
Sbjct  329   DEFTPRGGLFTAAKARDKNSFEVGSSGDLDLGWVNDLLT  367



>ref|XP_010472617.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Camelina sativa]
Length=304

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
             FLDS + +      ++LP N++ ++ ++      D FRMYEFK+RRC R  SHDWT+CPF
Sbjct  47    FLDSFSSL-----YRYLPSNELTNDSDESSL--TDEFRMYEFKIRRCARGGSHDWTECPF  99

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRKFHYSGT C EFRKG C RGD+CEFAHGVFE WLHP+RYRT+ CKDG
Sbjct  100   AHPGEKARRRDPRKFHYSGTACPEFRKGSCRRGDSCEFAHGVFECWLHPSRYRTQPCKDG  159

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS  699
              +C+R++CFFAH++ QLR+LP       SL P  D    + +  L   SPTS L+     
Sbjct  160   TSCRRRICFFAHTTEQLRVLPC------SLDP--DLGFFSSKSGLAT-SPTSILVSPQSE  210

Query  698   SPPLSP  681
             SPPLSP
Sbjct  211   SPPLSP  216



>ref|XP_009352588.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Pyrus x bretschneideri]
Length=389

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 110/140 (79%), Gaps = 10/140 (7%)
 Frame = -1

Query  1205  VFQKFLPYNDVE-DEDED---------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
              FQ++LP N+ + D D D          D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  62    TFQRYLPSNETDPDSDSDISGRESDAPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  121

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  122   HPGEKARRRDPRKYHYSGTACPDFRKGHCKKGDACEFAHGVFECWLHPARYRTQPCKDGT  181

Query  875   NCKRKVCFFAHSSRQLRILP  816
             +CKR+VCFFAH+  QLR+LP
Sbjct  182   SCKRRVCFFAHTPEQLRVLP  201



>gb|AGL76984.1| zinc finger CCCH domain-containing protein [Cucumis melo]
Length=385

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 159/260 (61%), Gaps = 15/260 (6%)
 Frame = -1

Query  1283  PRKILSRRGAAEADGFLDSPTKIEGGV--FQKFLPYNDVEDEDEDGDR--------YSAD  1134
             P   +S      A+G   SP  ++  +   Q++   +++E + E   R        YS D
Sbjct  37    PLSGISVSSDGNANGGDYSPYYLQEALAALQRYTNESEIESDSELSGREADVPLNAYSCD  96

Query  1133  HFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDN  954
             HFR++EFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C +GD+
Sbjct  97    HFRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDS  156

Query  953   CEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHD  774
             CEFAHGVFE WLHPARYRT+ CKDG NC+R+VCFFAH+  QLR+LP     + +    +D
Sbjct  157   CEFAHGVFECWLHPARYRTQPCKDGTNCRRRVCFFAHTPEQLRVLPQQSPRSANSPESYD  216

Query  773   PAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMT-AAKLIEMMSYKEALTQL  597
               E  LR+++    P S  M    S   +SP  TP     ++  A+ +       ++ ++
Sbjct  217   --ESPLRQSV--DGPCSKSMPFMSSPVSVSPTATPVDSPPLSPMARSLGRSLGSSSINEM  272

Query  596   VNSLEQVNLNPLSPATTTIN  537
             V SL  ++L+ +    ++ N
Sbjct  273   VASLRNLHLSKVKSLPSSWN  292



>ref|XP_009113932.1| PREDICTED: zinc finger CCCH domain-containing protein 61 [Brassica 
rapa]
Length=377

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 137/201 (68%), Gaps = 9/201 (4%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKC  969
             Y+ DHFRMYEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++HY+G VC EFR  G C
Sbjct  53    YAGDHFRMYEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYTGEVCPEFRNGGDC  112

Query  968   GRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL  789
              RGD C FAHG+FE WLHP+RYRTEACKDGK+CKRK+CFFAHS RQLR+LP +       
Sbjct  113   SRGDMCGFAHGIFECWLHPSRYRTEACKDGKHCKRKICFFAHSPRQLRVLPPSENFVSGG  172

Query  788   SPVHDPAEKNL---RKNLCC----HSPTSTLMGISHSSPPLSPAKTPFCGYGMT-AAKLI  633
                   +  ++   + N CC    HSPTSTL+ +S S     P          +  ++  
Sbjct  173   GGSAASSPASVLSYKNNRCCVFCSHSPTSTLLDLSRSPTSSPPLSPANKSAVFSRMSRRH  232

Query  632   EMMSYKEALTQLVNSLEQVNL  570
               +++K+ L +L+NSL+  + 
Sbjct  233   SALAHKQVLHELINSLDSFSF  253



>ref|XP_006853780.1| hypothetical protein AMTR_s00056p00207550 [Amborella trichopoda]
 gb|ERN15247.1| hypothetical protein AMTR_s00056p00207550 [Amborella trichopoda]
Length=446

 Score =   214 bits (546),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 113/140 (81%), Gaps = 6/140 (4%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG--DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARR  1032
               Q++LP N  ED++ +   D YS D FRMY+FKVRRC R RSHDWT+CP+AHPGEKARR
Sbjct  106   ALQRYLPSN-YEDQEPNAAIDAYSCDEFRMYDFKVRRCVRGRSHDWTECPYAHPGEKARR  164

Query  1031  RDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCF  852
             RDPRKFHYSGT C +FRKG C RGD+CEFAHGVFE WLHPARYRT+ CKDG +C+R+VCF
Sbjct  165   RDPRKFHYSGTACPDFRKGNCKRGDSCEFAHGVFECWLHPARYRTQPCKDGTSCRRRVCF  224

Query  851   FAHSSRQLRILPVN---RYS  801
             FAH+  QLR+LP N   RYS
Sbjct  225   FAHTPEQLRVLPQNPSPRYS  244



>ref|XP_010086901.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
 gb|EXB24692.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
Length=387

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 148/242 (61%), Gaps = 31/242 (13%)
 Frame = -1

Query  1325  PFYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDR  1146
             P+YL +A+          LS   A +AD   DS ++I G             + D   D 
Sbjct  54    PYYLHEALT--------ALSPYMAGDADA--DSDSEISG------------RESDSPVDA  91

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C 
Sbjct  92    YSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGHCK  151

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             +GD+CEFAHGVFE WLHPARYRT+ CKDG +C+R+VCFFAH+  QLR+LP  +   GS S
Sbjct  152   KGDSCEFAHGVFECWLHPARYRTQPCKDGTSCRRRVCFFAHTPDQLRVLPPQQSPKGSNS  211

Query  785   PVHDPAEKNLRKN-----LCCHSPTSTLMGIS--HSSPPLSPAKTPFCGYGMTAAKLIEM  627
              V       LR+          SPTS     S    SPP+SP  T      + ++ + EM
Sbjct  212   -VDSYDGSPLRQGKTLPFFSSFSPTSISPPTSPPAESPPMSPM-TQVLSRSLGSSSVNEM  269

Query  626   MS  621
             ++
Sbjct  270   VA  271



>ref|XP_007012951.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
 gb|EOY30570.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
Length=404

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 147/241 (61%), Gaps = 26/241 (11%)
 Frame = -1

Query  1343  FQNISYPFYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDE  1164
               N   PFYL++A+A L    R + S     E+D  L                 + +++ 
Sbjct  42    LNNSGTPFYLQEALAALQ---RYLPSNEPDVESDSEL-----------------SGLDNP  81

Query  1163  DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEF  984
             D   D YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  82    DSPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  141

Query  983   RKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRY  804
             RKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG NC+R+VCFFAH+  QLR+  VN  
Sbjct  142   RKGNCRKGDSCEFAHGVFECWLHPARYRTQPCKDGPNCRRRVCFFAHTPDQLRV--VNSA  199

Query  803   STGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLIEMM  624
              +  +SP      K L       S +  +   + SSPP+SP         + +A + EM+
Sbjct  200   DSYDVSPS---CAKTLTFWSSPGSGSPPVSPRAESSPPVSPMAQSL-SRSLGSASINEMV  255

Query  623   S  621
             +
Sbjct  256   A  256



>ref|XP_006297982.1| hypothetical protein CARUB_v10014025mg [Capsella rubella]
 gb|EOA30880.1| hypothetical protein CARUB_v10014025mg [Capsella rubella]
Length=363

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 8/138 (6%)
 Frame = -1

Query  1205  VFQKFLPYN--------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q++LP N        D+   D   D YS DHFRMYEFKVRRC R RSHDWT+CP+AHP
Sbjct  47    ALQRYLPSNEPDPDSDPDLSGPDSPIDAYSCDHFRMYEFKVRRCARGRSHDWTECPYAHP  106

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRK+HYSGT C +FRKG C RGD CEF+HGVFE WLHPARYRT+ CKDG NC
Sbjct  107   GEKARRRDPRKYHYSGTACPDFRKGGCKRGDACEFSHGVFECWLHPARYRTQPCKDGANC  166

Query  869   KRKVCFFAHSSRQLRILP  816
             +R+VCFFAHS  Q+R+LP
Sbjct  167   RRRVCFFAHSPDQIRVLP  184



>ref|XP_004135688.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis sativus]
Length=382

 Score =   213 bits (541),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 150/243 (62%), Gaps = 27/243 (11%)
 Frame = -1

Query  1283  PRKILSRRGAAEADGFLDSPTKIEGGV--FQKFLPYNDVEDEDEDGDR--------YSAD  1134
             P   +S      A+G   SP  ++  +   Q++   +++E + E   R        YS D
Sbjct  34    PLSGISVSSDGNANGGDYSPYYLQEALAALQRYTNESEIESDSELSGREADVPLNAYSCD  93

Query  1133  HFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDN  954
             HFR++EFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C +GD+
Sbjct  94    HFRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDS  153

Query  953   CEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP------VNRYSTGS  792
             CEFAHGVFE WLHPARYRT+ CKDG NC+R+VCFFAH+  QLR+LP       N   +  
Sbjct  154   CEFAHGVFECWLHPARYRTQPCKDGTNCRRRVCFFAHTPEQLRVLPQQSPRSANSPDSYD  213

Query  791   LSPVHDPAEKNLRKNL------CCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLIE  630
              SP+    + +  K L         SPT+T +     SPPLSP  T   G  + +  + E
Sbjct  214   ESPLRQSVDGSCSKTLPFLSSPVSVSPTATPV----DSPPLSPM-TRSLGRSLGSTSINE  268

Query  629   MMS  621
             M++
Sbjct  269   MVA  271



>ref|XP_010526073.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Tarenaya 
hassleriana]
Length=350

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 130/182 (71%), Gaps = 13/182 (7%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDVEDE------DEDG-DRYSADHFRMYEFKVRRCTRSRSH  1080
             +LDS   +      ++LP N+   +      DE G D ++ D FRMYEFKVRRC+RSRSH
Sbjct  46    YLDSIASL-----YRYLPSNEFAADSDSLSGDESGADAFACDDFRMYEFKVRRCSRSRSH  100

Query  1079  DWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYR  900
             DWT+CPFAHPGEKARRRDPRK+HYSGT C EFRKG C +GD+CEFAHGVFE WLHPARYR
Sbjct  101   DWTECPFAHPGEKARRRDPRKYHYSGTACPEFRKGSCRKGDSCEFAHGVFECWLHPARYR  160

Query  899   TEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTST  720
             T+ CKDG +C+R+VCFFAH+  QLR+L  +  S   L  V +  E +  K++   SPTS 
Sbjct  161   TQPCKDGTSCQRRVCFFAHTPEQLRVLSGSGESDLGLC-VRNRFESHFSKSVIASSPTSI  219

Query  719   LM  714
             L+
Sbjct  220   LV  221



>ref|XP_004141305.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis sativus]
 ref|XP_004167716.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis sativus]
Length=349

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 174/317 (55%), Gaps = 28/317 (9%)
 Frame = -1

Query  1247  ADGFLDSPTKIEGGVFQKFLPYNDVEDE----DEDGDRYSADHFRMYEFKVRRCTRSRSH  1080
              D F+DS + I      ++LP     DE     E  D +S DHFRM+EFK+RRC R RSH
Sbjct  39    VDSFIDSFSSI-----HRYLPSAADSDELDGVGEAVDGFSCDHFRMFEFKIRRCARGRSH  93

Query  1079  DWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYR  900
             DWT+CP+AHPGEKARRRDPRK+HYSGT C EFRKG C +GD+C+FAHG+FE WLHPARYR
Sbjct  94    DWTECPYAHPGEKARRRDPRKYHYSGTACPEFRKGNCKKGDSCDFAHGIFECWLHPARYR  153

Query  899   TEACKDGKNCKRKVCFFAHSSRQLRIL-------PVNRYSTGSLSPVHDPAEKNLRKNLC  741
             T+ CKDG  C+R+VCFFAH+  QLR+L       PV+  S    S +    +    K   
Sbjct  154   TQPCKDGLACRRRVCFFAHTPEQLRVLPQQSPRTPVSADSVDGSSRIAHAFDSYFSKGSF  213

Query  740   CHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNL--N  567
               SPTS L     S P  SP  +P C +      +  M + +    +      ++ L  N
Sbjct  214   VTSPTSILSTPPVSPPSDSPPLSPNCPFNSVNGLVSCMRNLQLGKLKATPHWGRIQLGQN  273

Query  566   PLSPATTTI-NRMTRPFSGNDPIQFSLPNSPSTP-------GRHSSGSEFLTPQRNTAFS  411
             PLSP+++ + N  + P +GN   +    N    P       GR      +    ++ +  
Sbjct  274   PLSPSSSGLYNLPSTPTTGN--YELWGKNYEEEPAMERVESGRDLRAQMYAKLSKDNSVK  331

Query  410   DNGGLTGIDLDWVNDLL  360
             +   +   D+ WV++LL
Sbjct  332   EMDPILTPDVGWVSELL  348



>ref|XP_003516267.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=350

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 108/142 (76%), Gaps = 11/142 (8%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG----------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q+FLP N+  D D D           D Y+ DHFRMYEFKVRRC R RSHDWT+CP+A
Sbjct  53    ALQRFLPSNET-DADSDSSEAAQPDAAVDAYTCDHFRMYEFKVRRCARGRSHDWTECPYA  111

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPR+FHYSG  C EFRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  112   HPGEKARRRDPRRFHYSGVACPEFRKGNCRKGDACEFAHGVFECWLHPARYRTQPCKDGT  171

Query  875   NCKRKVCFFAHSSRQLRILPVN  810
             +C+R+VCFFAH+  QLR+LP+ 
Sbjct  172   SCRRRVCFFAHTPEQLRVLPMQ  193



>ref|XP_010244375.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Nelumbo 
nucifera]
Length=391

 Score =   212 bits (540),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 127/172 (74%), Gaps = 12/172 (7%)
 Frame = -1

Query  1202  FQKFLPYNDVE-DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
              Q++LP NDV+ D D  G       + ++ D FRMYEFKVRRC R RSHDWT+CP+AHPG
Sbjct  67    LQRYLPSNDVDADSDIPGRESDMPINAHTCDEFRMYEFKVRRCARGRSHDWTECPYAHPG  126

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRKFHYSGT C +FRKG C RGD+CEFAHGVFE WLHPARYRT+ CKDG +C+
Sbjct  127   EKARRRDPRKFHYSGTACPDFRKGNCKRGDSCEFAHGVFECWLHPARYRTQPCKDGTSCR  186

Query  866   RKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKN-LRKNLCCHSPTSTLM  714
             R+VCFFAH+  QLR+LP  +     +SP  D  + + LR+ L C+ P  +L+
Sbjct  187   RRVCFFAHTPEQLRVLP-QQSPRAPVSP--DSYDGSPLRQALDCYFPKGSLI  235



>ref|XP_009102134.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Brassica 
rapa]
Length=357

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVEDE--------DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + +        D   D YS DHFRMYEFKVRRCTR RSHDWT+CP+AH
Sbjct  44    AALQRYLPSNEPDPDSDPELSGPDSAIDTYSCDHFRMYEFKVRRCTRGRSHDWTECPYAH  103

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C EFRKG C +GD CEF+HGVFE WLHPARYRT+ CKDG N
Sbjct  104   PGEKARRRDPRKYHYSGTACPEFRKGGCKKGDACEFSHGVFECWLHPARYRTQPCKDGGN  163

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAHS  Q+R+LP
Sbjct  164   CRRRVCFFAHSPDQIRVLP  182



>emb|CDY35891.1| BnaA07g00960D [Brassica napus]
Length=324

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVEDE--------DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + +        D   D YS DHFRMYEFKVRRCTR RSHDWT+CP+AH
Sbjct  44    AALQRYLPSNEPDPDSDPELSGPDSAIDTYSCDHFRMYEFKVRRCTRGRSHDWTECPYAH  103

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C EFRKG C +GD CEF+HGVFE WLHPARYRT+ CKDG N
Sbjct  104   PGEKARRRDPRKYHYSGTACPEFRKGGCKKGDACEFSHGVFECWLHPARYRTQPCKDGGN  163

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAHS  Q+R+LP
Sbjct  164   CRRRVCFFAHSPDQIRVLP  182



>emb|CDX82728.1| BnaC07g01380D [Brassica napus]
Length=351

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 8/138 (6%)
 Frame = -1

Query  1205  VFQKFLPYND--------VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q++LP N+        +   D   D YS DHFRMYEFKVRRCTR RSHDWT+CP+AHP
Sbjct  45    ALQRYLPSNEPDLDSDPELSGPDSAIDTYSCDHFRMYEFKVRRCTRGRSHDWTECPYAHP  104

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRK+HYSGT C EFRKG C +GD CEF+HGVFE WLHPARYRT+ CKDG NC
Sbjct  105   GEKARRRDPRKYHYSGTACPEFRKGGCKKGDACEFSHGVFECWLHPARYRTQPCKDGGNC  164

Query  869   KRKVCFFAHSSRQLRILP  816
             +R+VCFFAHS  Q+R+LP
Sbjct  165   RRRVCFFAHSPDQIRVLP  182



>ref|XP_002867421.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43680.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 107/139 (77%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYN--------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N        D+   D   D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEPDPDSDPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG N
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGN  165

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+RKVCFFAHS  QLR LP
Sbjct  166   CRRKVCFFAHSPDQLRFLP  184



>ref|XP_008794080.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=404

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 116/165 (70%), Gaps = 13/165 (8%)
 Frame = -1

Query  1271  LSRRGAAEADGFLDSPTKIEG---GVFQKFLPYNDV----EDEDEDG------DRYSADH  1131
             L   G A A G   SP  +        Q+FLP N++    ED DE        D YS D 
Sbjct  35    LPMSGVAGAGGGDCSPYTLAEPSLAALQRFLPCNEIYAAGEDTDESEPADAPVDAYSCDE  94

Query  1130  FRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNC  951
             FRMYEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKFHYSGT C +FRKG C RGD C
Sbjct  95    FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDFRKGNCKRGDAC  154

Query  950   EFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             E+AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  155   EYAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPEQLRVLP  199



>ref|NP_179571.1| oxidation-related zinc Finger 1 [Arabidopsis thaliana]
 sp|O82199.1|C3H20_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 20; 
Short=AtC3H20 [Arabidopsis thaliana]
 gb|AAC62135.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM60847.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM97061.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAN72125.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC06929.1| oxidation-related zinc Finger 1 [Arabidopsis thaliana]
Length=359

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 107/137 (78%), Gaps = 8/137 (6%)
 Frame = -1

Query  1202  FQKFLPYN--------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
              Q++LP N        D+   D   D Y+ DHFRMYEFKVRRC R RSHDWT+CP+AHPG
Sbjct  47    LQRYLPSNEPDPDSDPDLSGPDSPIDAYTCDHFRMYEFKVRRCARGRSHDWTECPYAHPG  106

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRKFHYSGT C EFRKG C RGD CEF+HGVFE WLHPARYRT+ CKDG NC+
Sbjct  107   EKARRRDPRKFHYSGTACPEFRKGCCKRGDACEFSHGVFECWLHPARYRTQPCKDGGNCR  166

Query  866   RKVCFFAHSSRQLRILP  816
             R+VCFFAHS  Q+R+LP
Sbjct  167   RRVCFFAHSPDQIRVLP  183



>ref|XP_008450813.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis melo]
Length=382

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 139/216 (64%), Gaps = 14/216 (6%)
 Frame = -1

Query  1283  PRKILSRRGAAEADGFLDSPTKIEGGV--FQKFLPYNDVEDEDEDGDR--------YSAD  1134
             P   +S      A+G   SP  ++  +   Q++   +++E + E   R        YS D
Sbjct  34    PLSGISVSSDGNANGGDYSPYYLQEALAALQRYTNESEIESDSELSGREADVPLNAYSCD  93

Query  1133  HFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDN  954
             HFR++EFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C +GD+
Sbjct  94    HFRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDS  153

Query  953   CEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHD  774
             CEFAHGVFE WLHPARYRT+ CKDG NC+R+VCFFAH+  QLR+LP     + +    +D
Sbjct  154   CEFAHGVFECWLHPARYRTQPCKDGTNCRRRVCFFAHTPEQLRVLPQQSPRSANSPESYD  213

Query  773   PAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPF  666
               E  LR+++    P S  M    S   +SP  TP 
Sbjct  214   --ESPLRQSV--DGPCSKSMPFMSSPVSVSPTATPV  245



>ref|XP_004158434.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 2 [Cucumis sativus]
Length=352

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 12/206 (6%)
 Frame = -1

Query  1283  PRKILSRRGAAEADGFLDSPTKIEGGV--FQKFLPYNDVEDEDEDGDR--------YSAD  1134
             P   +S      A+G   SP  ++  +   Q++   +++E + E   R        YS D
Sbjct  34    PLSGISVSSDGNANGGDYSPYYLQEALAALQRYTNESEIESDSELSGREADVPLNAYSCD  93

Query  1133  HFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDN  954
             HFR++EFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C +GD+
Sbjct  94    HFRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDS  153

Query  953   CEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHD  774
             CEFAHGVFE WLHPARYRT+ CKDG NC+R+VCFFAH+  QLR+LP     + +    +D
Sbjct  154   CEFAHGVFECWLHPARYRTQPCKDGTNCRRRVCFFAHTPEQLRVLPQQSPRSANSPDSYD  213

Query  773   PAEKNLRKNLCCHSPTSTLMGISHSS  696
               E  LR+++   +P  +   I H S
Sbjct  214   --ESPLRQSVATATPVDSPPVIPHDS  237



>ref|XP_007012220.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
 gb|EOY29839.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
Length=377

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 119/173 (69%), Gaps = 14/173 (8%)
 Frame = -1

Query  1202  FQKFLPYNDVEDEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEK  1041
               ++LP ND E +          D +S DHFRMYEFKVRRC R RSHDWT+CP+AHPGEK
Sbjct  66    LHRYLPSNDFESDSLSDDSDLPVDAFSCDHFRMYEFKVRRCARGRSHDWTECPYAHPGEK  125

Query  1040  ARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRK  861
             ARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG +CKR+
Sbjct  126   ARRRDPRKFHYSGTACPDFRKGNCKKGDSCEFAHGVFECWLHPARYRTQPCKDGTSCKRR  185

Query  860   VCFFAHSSRQLRILPV-----NRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTL  717
             VCFFAH+  QLR+LP      N   +G L  V  P    L       SPTS L
Sbjct  186   VCFFAHTPEQLRVLPQQSPRGNGAGSGDLDYVGSPIRHRLD---FVSSPTSIL  235



>ref|XP_010441910.1| PREDICTED: zinc finger CCCH domain-containing protein 61 [Camelina 
sativa]
Length=375

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 149/347 (43%), Positives = 179/347 (52%), Gaps = 77/347 (22%)
 Frame = -1

Query  1184  YNDVEDEDEDGDR---YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             Y D  D   D D    Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+F
Sbjct  35    YKDQRDYSYDSDSEDPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRF  94

Query  1013  HYSGTVCSEFRK---GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAH  843
             HY G VC E+ +   G C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAH
Sbjct  95    HYIGEVCPEYSRQGGGDCSRGDQCGFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAH  154

Query  842   SSRQLRILP-------VNRYSTGSLSPVHDPAEKNLRKNLCC----HSPTSTLMGISHSS  696
             S RQLRILP       ++    GS S        N + N CC    HSPTSTL+G+S S 
Sbjct  155   SPRQLRILPPSSPENYISGGCGGSASSSPASVLSN-KNNRCCLFCSHSPTSTLLGLSRSP  213

Query  695   PPLSPAKTPFCGYGMTAAKLIEMMSYKEA-LTQLVNSLEQVNLNPL------SPATTTIN  537
                 P           AA    +   + A L +L++SL+  +L         SP T  ++
Sbjct  214   SSSPPLSP-----ANKAAAFSRLSRRRTAVLNELISSLDSFSLTEALAASSSSPVTMPVS  268

Query  536   RMTRPFSGN-------------------------DPIQFSLPNSPSTPGRHSSGS-----  447
                   S N                          P+QF+L  S +    HS  S     
Sbjct  269   TTAMIASANLSNHHQHRVPPWLDVGERDLQLHQGSPLQFALSPSSTPSYLHSQPSSSFFS  328

Query  446   EFLTPQ-----------------RNTAFSDNGGLTGIDLDWVNDLLT  357
             + LTP+                 R+    + G    +DL WVNDLLT
Sbjct  329   DGLTPRGGRLSDFTAASAAAAEARDKNSFEVGSNGDLDLGWVNDLLT  375



>ref|XP_002455022.1| hypothetical protein SORBIDRAFT_03g003110 [Sorghum bicolor]
 gb|EES00142.1| hypothetical protein SORBIDRAFT_03g003110 [Sorghum bicolor]
Length=350

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 117/162 (72%), Gaps = 16/162 (10%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y  D FRMYEFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  37    DGYGCDEFRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGG  96

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C RGDNC+FAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP  ++   S
Sbjct  97    CKRGDNCDFAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPTTQHQQSS  156

Query  791   ---------------LSPVHDPAEKNLR-KNLCCHSPTSTLM  714
                             SP+   A ++ R K++   SPTSTLM
Sbjct  157   PRGAAACSPLADSYDGSPLRRQAVESFRTKSIMSSSPTSTLM  198



>emb|CBI27968.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 121/170 (71%), Gaps = 16/170 (9%)
 Frame = -1

Query  1205  VFQKFLPYNDV----------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q++LP NDV           + D   D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  42    ALQRYLPSNDVDVDSDSDISGREADIPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  101

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  102   HPGEKARRRDPRKFHYSGTACPDFRKGNCKKGDSCEFAHGVFECWLHPARYRTQPCKDGP  161

Query  875   NCKRKVCFFAHSSRQLRILPVNRYST-GSL-----SPVHDPAEKNLRKNL  744
             NC+R+VCFFAH++ QLR+LP     T GS+     SP+    E +  K L
Sbjct  162   NCRRRVCFFAHTAEQLRVLPQQSPRTPGSVESYDGSPLRQALEASCAKTL  211



>ref|XP_009101727.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Brassica rapa]
Length=378

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/328 (41%), Positives = 172/328 (52%), Gaps = 70/328 (21%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKC  969
             Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EFR  G C
Sbjct  56    YAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGEVCPEFRHGGDC  115

Query  968   GRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL  789
              RGD C FAHGVFE WLHP+RYRTEACKDGK+C RK+CFFAHS  QLR+ P         
Sbjct  116   SRGDECGFAHGVFECWLHPSRYRTEACKDGKHCTRKICFFAHSPPQLRVPPPPESLVSGG  175

Query  788   SPVHDPAEKNLRKN-------LCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLI-  633
                   +  ++  N        C +SPTS L G++HS     P         +TA   + 
Sbjct  176   GGSALSSPASVLSNKSNGCCVFCSNSPTSPLFGLAHSPSSSPPLSP---ANKVTAVSRLS  232

Query  632   ---EMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFS------------------  516
                  ++YKE L +++NSL+  +L     A ++ + +T P S                  
Sbjct  233   RHRSAVTYKEVLNEMINSLDSFSLTQPLTAASSASMVTMPVSTASMLASSSLSNHYHHRL  292

Query  515   ------GNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDN-----------------  405
                   G+  +QF+L  SPS+   + +G   L P   + FS+                  
Sbjct  293   PPWLDVGDRDLQFAL--SPSSTPSYLNGQIQLQPPPPSFFSEEFTPRGGRVSDFTAAATA  350

Query  404   ------------GGLTGIDLDWVNDLLT  357
                         G    +DL WVNDLLT
Sbjct  351   AAEARDKSSFEIGSSGDLDLGWVNDLLT  378



>ref|XP_006451362.1| hypothetical protein CICLE_v10008633mg [Citrus clementina]
 gb|ESR64602.1| hypothetical protein CICLE_v10008633mg [Citrus clementina]
Length=381

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 12/154 (8%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE----------DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
                 ++LP ND +          D D   D YS DHFRMYEFKVR+C R RSHDWT+CP+
Sbjct  57    AALHRYLPSNDPDLDSDSDMSGLDPDSPVDAYSCDHFRMYEFKVRKCARGRSHDWTECPY  116

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  117   AHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDACEFAHGVFECWLHPARYRTQPCKDG  176

Query  878   KNCKRKVCFFAHSSRQLRILPVN--RYSTGSLSP  783
               CKR+VCFFAH+  QLRILP    R ++ S SP
Sbjct  177   GGCKRRVCFFAHTPDQLRILPQQSPRSASASDSP  210



>ref|XP_006475367.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Citrus sinensis]
 gb|KDO55907.1| hypothetical protein CISIN_1g016862mg [Citrus sinensis]
Length=381

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 12/154 (8%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE----------DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
                 ++LP ND +          D D   D YS DHFRMYEFKVR+C R RSHDWT+CP+
Sbjct  57    AALHRYLPSNDPDLDSDSDMSGLDPDSPVDAYSCDHFRMYEFKVRKCARGRSHDWTECPY  116

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  117   AHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDACEFAHGVFECWLHPARYRTQPCKDG  176

Query  878   KNCKRKVCFFAHSSRQLRILPVN--RYSTGSLSP  783
               CKR+VCFFAH+  QLRILP    R ++ S SP
Sbjct  177   GGCKRRVCFFAHTPDQLRILPQQSPRSASASDSP  210



>ref|XP_011081722.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Sesamum 
indicum]
Length=366

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 146/259 (56%), Gaps = 44/259 (17%)
 Frame = -1

Query  1208  GVFQKFLPYN----------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
                Q++LP N          D +D D   D +S D+FRM+EFKV++C R+RSHDWT+CPF
Sbjct  54    AALQRYLPSNKDDIVQAGDEDSDDFDVPVDAFSCDNFRMFEFKVKKCARARSHDWTECPF  113

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRK+HYSG  C +FRKG C RGD CE+AHGVFE WLHPARYRT+ CKDG
Sbjct  114   AHPGEKARRRDPRKYHYSGNACPDFRKGSCKRGDACEYAHGVFECWLHPARYRTQPCKDG  173

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTL----MG  711
              +C+R+VCFFAH+  QLR+LP         SP   P   +        SP STL    + 
Sbjct  174   THCRRRVCFFAHTPEQLRVLP--------YSPEASPGRTHDSFMSIGSSPKSTLYSPPLS  225

Query  710   ISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRM  531
              +  SPPLSP  +                    +L +L  S+  + LN +         M
Sbjct  226   PTSGSPPLSPGGS-------------------LSLGRLTESMRGLQLNKMKMGLGMGLSM  266

Query  530   TRPFSGNDPIQFSLPNSPS  474
             + P  G   + F  P SPS
Sbjct  267   SPPSWG---LGFGSPRSPS  282



>ref|XP_008452695.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cucumis melo]
Length=351

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 175/321 (55%), Gaps = 28/321 (9%)
 Frame = -1

Query  1256  AAEADGFLDSPTKIEGGVFQKFLPYNDVEDE----DEDGDRYSADHFRMYEFKVRRCTRS  1089
             A   D F+DS + I      ++LP     DE     E  D +S DHFRM+EFK+RRC R 
Sbjct  36    AGGVDSFIDSFSSI-----HRYLPSAADSDELDGVGEAVDGFSCDHFRMFEFKIRRCARG  90

Query  1088  RSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPA  909
             RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EFRKG C +GD+C+FAHG+FE WLHPA
Sbjct  91    RSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEFRKGNCKKGDSCDFAHGIFECWLHPA  150

Query  908   RYRTEACKDGKNCKRKVCFFAHSSRQLRIL-------PVNRYSTGSLSPVHDPAEKNLRK  750
             RYRT+ CKDG  C+R+VCFFAH+  QLR+L       PV+  S    S V    +    K
Sbjct  151   RYRTQPCKDGLACRRRVCFFAHTPEQLRVLPQQSPRTPVSADSVDGSSRVAHAFDSYFSK  210

Query  749   NLCCHSPTSTLMGISHSSPPLSPAKTPFCGY----GMTAAKLIEMMSYKEALTQLVNSLE  582
                  SPTS L     S P  SP  +P C +    G+ +      +   +A       ++
Sbjct  211   GSFVTSPTSILSTPPVSPPSDSPPLSPNCPFNSMNGLVSCMRNLQLGKLKATGPHWGRIQ  270

Query  581   QVNLNPLSPATTTI-NRMTRPFSGNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDN  405
               + NPLSP+ + + N  + P +GN  +            R  SG + L  Q     S +
Sbjct  271   LGSQNPLSPSGSGLYNLPSTPTTGNYELWGKNYEEEPAMERVESGRD-LRAQMYAKLSKD  329

Query  404   GGLTGI------DLDWVNDLL  360
               +  +      D+ WV++LL
Sbjct  330   NSVKEMDSTLTPDVGWVSELL  350



>ref|XP_008798608.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=395

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 124/187 (66%), Gaps = 26/187 (14%)
 Frame = -1

Query  1199  QKFLP----YNDVEDEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
             Q++LP    Y+  ED DE        D YS D FRMYEFKVRRC R RSHDWT+CP+AHP
Sbjct  58    QRYLPCNEPYSAGEDSDESELADAPVDAYSCDEFRMYEFKVRRCARGRSHDWTECPYAHP  117

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRK+HYSGT C +FRKG C RGD CEFAHGVFE WLHP+RYRT+ CKDG  C
Sbjct  118   GEKARRRDPRKYHYSGTACPDFRKGNCKRGDACEFAHGVFECWLHPSRYRTQPCKDGTAC  177

Query  869   KRKVCFFAHSSRQLRILP---------------VNRYSTGSLSPVHDPAEKNLRKNLCCH  735
             +R+VCFFAH+  QLR+LP               ++ Y    L   H   E  + KNL   
Sbjct  178   RRRVCFFAHTPEQLRVLPEQQQQQQLSPRTAAAMDSYDGSPLRHQHT-FEPYVSKNLFSS  236

Query  734   SPTSTLM  714
             SPTSTL+
Sbjct  237   SPTSTLI  243



>ref|XP_011078221.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Sesamum indicum]
Length=353

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 109/144 (76%), Gaps = 15/144 (10%)
 Frame = -1

Query  1205  VFQKFLPYN--------DVEDEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWT  1071
               Q+FLP N         V D D  G       D +S DHFRM+EFKVR+CTR RSHDWT
Sbjct  55    ALQRFLPSNSNDAVAEFQVPDSDNGGTGDFLPVDAHSCDHFRMFEFKVRKCTRGRSHDWT  114

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CPFAHPGEKARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  115   ECPFAHPGEKARRRDPRKFHYSGTACPDFRKGNCRKGDSCEFAHGVFECWLHPARYRTQP  174

Query  890   CKDGKNCKRKVCFFAHSSRQLRIL  819
             CKDG NCKR+VCFFAHS  QLR+L
Sbjct  175   CKDGMNCKRRVCFFAHSPDQLRVL  198



>ref|XP_001781195.1| predicted protein [Physcomitrella patens]
 ref|XP_001781215.1| predicted protein [Physcomitrella patens]
 gb|EDQ53980.1| predicted protein [Physcomitrella patens]
 gb|EDQ54000.1| predicted protein [Physcomitrella patens]
Length=137

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYNDVEDEDEDG-DRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
             + SPT     +F KFLP N+ ++E     D Y  D FRM+EFKVRRC R RSHDWT+CPF
Sbjct  1     MGSPT-FSDALFNKFLPSNNEDEEAWPAVDMYGCDQFRMFEFKVRRCMRGRSHDWTECPF  59

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPR+FHYSGT C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  60    AHPGEKARRRDPRRFHYSGTACPDFRKGSCRRGDMCEFAHGVFECWLHPARYRTQPCKDG  119

Query  878   KNCKRKVCFFAHSSRQLR  825
             +NC+R+VCFFAH+  QLR
Sbjct  120   RNCRRRVCFFAHTPEQLR  137



>gb|KDP33764.1| hypothetical protein JCGZ_07335 [Jatropha curcas]
Length=387

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 135/215 (63%), Gaps = 20/215 (9%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE----------DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
                Q++LP N+ +          + D   D +S DHFRM+EFKVRRC R RSHDWT+CP+
Sbjct  57    AALQRYLPSNEPDFDSDSEVSGLEPDSPVDAFSCDHFRMFEFKVRRCARGRSHDWTECPY  116

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHP RYRT+ CKDG
Sbjct  117   AHPGEKARRRDPRKYHYSGTACPDFRKGNCKKGDACEFAHGVFECWLHPGRYRTQPCKDG  176

Query  878   KNCKRKVCFFAHSSRQLRILP------VNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTL  717
              NC+R+VCFFAH+  QLR+LP      VN   +   SP     E +  K+L   S   ++
Sbjct  177   TNCRRRVCFFAHTPEQLRVLPQQSPRSVNSVESYDGSPFRQAIEASCAKSLPFLSSPGSI  236

Query  716   MGIS---HSSPPLSPAKTPFCGYGMTAAKLIEMMS  621
                +     SPP+SP  T      + +  + EMM+
Sbjct  237   SPPATPPADSPPMSPM-TQCLSRSVGSNSINEMMA  270



>ref|XP_006280675.1| hypothetical protein CARUB_v10026640mg [Capsella rubella]
 gb|EOA13573.1| hypothetical protein CARUB_v10026640mg [Capsella rubella]
Length=364

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 178/343 (52%), Gaps = 77/343 (22%)
 Frame = -1

Query  1181  NDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSG  1002
              D   + +  D Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+FHY+G
Sbjct  31    QDYSYDSDSEDPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYTG  90

Query  1001  TVCSEFRK--GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQL  828
              VC EF +  G C RGD C F+HGVFE WLHP+RYRTEACKDGK+CKRKVCFFAHS RQL
Sbjct  91    EVCPEFSRHGGDCSRGDECVFSHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAHSPRQL  150

Query  827   RILPVN---RYSTGSLSPVHDPAEKNLRKNLCC----HSPTSTLMGISHSSPPLSPAKTP  669
             R+LP +    + +G  +     +    + N CC    HSPTSTL+G+S S     P    
Sbjct  151   RVLPPSPPENFISGGSASSSPASVLGHKNNRCCLFCSHSPTSTLLGLSRSPSSSPPLSP-  209

Query  668   FCGYGMTAAKLIEMMSYKEA-LTQLVNSLEQVNLNPL-------SPATTTINRMTRPFSG  513
                    AA    +   + A L +L++SL+  +L          SP T  ++      S 
Sbjct  210   ----ADKAAAFSRLSRRRTAVLNELISSLDSFSLTEALASSSSSSPGTMPVSTAAMIASA  265

Query  512   N----------------------DPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDN--  405
             N                       P+QFS   S +    HS     L P  ++ FSD+  
Sbjct  266   NLSNHRIPPWLDVGDRDLQIQQTSPLQFSHSPSSTPSYLHSQ----LQPPLSSFFSDDFT  321

Query  404   ---------------------------GGLTGIDLDWVNDLLT  357
                                        G  + +DL WVNDLLT
Sbjct  322   PRGGRVSDFTAAASAAAEAKYKTSFEVGSSSDLDLGWVNDLLT  364



>ref|XP_010548687.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Tarenaya hassleriana]
Length=363

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 155/270 (57%), Gaps = 39/270 (14%)
 Frame = -1

Query  1208  GVFQKFLPYNDVEDEDEDGD---------RYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
                Q++LP ++  D D D D          YS+DHFRMYEFKVRRC R RSHDWT+CP+ 
Sbjct  46    AALQRYLPSSE-PDPDSDPDISGPESPVHAYSSDHFRMYEFKVRRCGRGRSHDWTECPYV  104

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPR++HYSGT C +FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  105   HPGEKARRRDPRQYHYSGTSCPDFRKGGCRKGDACEFAHGVFECWLHPARYRTQPCKDGG  164

Query  875   NCKRKVCFFAHSSRQLRILPV---NRYSTGSL-SPVHDPAEKNLRKNLCCHSPTSTLMGI  708
             NC+R+VCFFAHS  QLRILP    +R  +  L SP+   + +  + +L   SP S     
Sbjct  165   NCRRRVCFFAHSPDQLRILPQQSPDRVDSFELSSPIRHSSARAFQFSL---SPIS-----  216

Query  707   SHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMT  528
                SPP+SP           + + +        +  +V SL  + LN +    ++ N   
Sbjct  217   --GSPPVSPRTD------SESTQSLSRSFGSSPVNDVVASLRNLQLNKVKSLPSSWNTQF  268

Query  527   RPFSGN---------DPIQFSLPNSPSTPG  465
             R +             P   SLP +P+ PG
Sbjct  269   RRYRSGFGSPRGSVLGPGFRSLPTTPTRPG  298



>dbj|BAJ33902.1| unnamed protein product [Thellungiella halophila]
Length=365

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 107/139 (77%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEPDPDSDSDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHP RYRT+ CKDG N
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGSCKKGDTCEFAHGVFECWLHPLRYRTQPCKDGGN  165

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+RKVCFFAHS  QLR LP
Sbjct  166   CRRKVCFFAHSPDQLRYLP  184



>gb|KDP34137.1| hypothetical protein JCGZ_07708 [Jatropha curcas]
Length=371

 Score =   209 bits (533),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYND----VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS T +      ++LP N+     +D D   D +S DHFRMYEFKVRRC R RSHDWT
Sbjct  44    FLDSLTAL-----HRYLPSNEPDSLSDDLDFAVDAFSCDHFRMYEFKVRRCARGRSHDWT  98

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDPR++HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  99    ECPYAHPGEKARRRDPRRYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQP  158

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  159   CKDGPACRRRVCFFAHTPDQLRVLP  183



>ref|XP_003530556.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=355

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 143/236 (61%), Gaps = 29/236 (12%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  68    DAYSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGS  127

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R+VCFFAH+  QLR+LP     +  
Sbjct  128   CKKGDACEYAHGVFECWLHPARYRTQPCKDGTSCRRRVCFFAHTPEQLRVLPQQSPRSAD  187

Query  791   L---SPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPL-SPAKTPFCGYGMTAAKLIEMM  624
                 SP+    E +  K L   +P   +      SPPL SP  +P     MT        
Sbjct  188   SYDGSPLRHAIESSCAKTL---APAPFVSSPGSVSPPLESPPMSP-----MTV-------  232

Query  623   SYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGND------PIQFSLPNSPS  474
                 ++ ++V SL  + L  +    ++ N M     G+       P  FSLP +P+
Sbjct  233   ----SVNEMVASLRNLQLGKVKSLPSSWNVMGPSGFGSPRGPMIRPGFFSLPTTPT  284



>ref|XP_004960911.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Setaria italica]
Length=390

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 130/187 (70%), Gaps = 23/187 (12%)
 Frame = -1

Query  1205  VFQKFLPYNDV----EDEDEDG----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               + +LP N+     +++DE+     D Y+ D FRMYEFKVRRC+R RSHDWTDCP+AHP
Sbjct  36    ALRHYLPSNEAAAAYDEDDEEALAAVDAYACDEFRMYEFKVRRCSRGRSHDWTDCPYAHP  95

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPR++HYSGT C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG  C
Sbjct  96    GEKARRRDPRRYHYSGTACPDFRKGGCKRGDACEFAHGVFECWLHPARYRTQPCKDGTAC  155

Query  869   KRKVCFFAHSSRQLRILPVNRYST----GSLSPVHDPAEKN-LRKN----------LCCH  735
             +R+VCFFAH+  QLR+LP  + S+     + SP+ +  + + LR+           +   
Sbjct  156   RRRVCFFAHTPDQLRVLPPQQQSSPRGGAASSPLAESYDGSPLRRQAFESYLTKSGIMSS  215

Query  734   SPTSTLM  714
             SPTSTL+
Sbjct  216   SPTSTLV  222



>gb|ACU23866.1| unknown [Glycine max]
Length=355

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 143/236 (61%), Gaps = 29/236 (12%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  68    DAYSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGS  127

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R+VCFFAH+  QLR+LP     +  
Sbjct  128   CKKGDACEYAHGVFECWLHPARYRTQPCKDGTSCRRRVCFFAHTPEQLRVLPQQSPRSAD  187

Query  791   L---SPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPL-SPAKTPFCGYGMTAAKLIEMM  624
                 SP+    E +  K L   +P   +      SPPL SP  +P     MT        
Sbjct  188   SYDGSPLRHAIESSCAKTL---APAPFVSSPGSVSPPLESPPMSP-----MTV-------  232

Query  623   SYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGND------PIQFSLPNSPS  474
                 ++ ++V SL  + L  +    ++ N M     G+       P  FSLP +P+
Sbjct  233   ----SVNEMVASLRNLQLGKVKSLPSSWNVMGPSGFGSPRGPMIRPGFFSLPTTPT  284



>ref|NP_001042276.1| Os01g0192000 [Oryza sativa Japonica Group]
 sp|Q9FU27.1|C3H2_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 2; Short=OsC3H2; 
AltName: Full=Protein DELAY OF THE ONSET OF SENESCENCE; 
Short=OsDOS [Oryza sativa Japonica Group]
 dbj|BAB12694.1| CCCH-type zinc finger protein -like [Oryza sativa Japonica Group]
 dbj|BAF04190.1| Os01g0192000 [Oryza sativa Japonica Group]
 dbj|BAG94757.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60249.1| C3H transcription factor [Oryza sativa Japonica Group]
Length=386

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 112/153 (73%), Gaps = 12/153 (8%)
 Frame = -1

Query  1136  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGD  957
             D FRMYEFKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG C RGD
Sbjct  75    DEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGGCKRGD  134

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL----  789
              CE+AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP  + S  S+    
Sbjct  135   ACEYAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPAQQSSPRSVASSP  194

Query  788   -------SPVHDPA-EKNLRKNLCCHSPTSTLM  714
                    SP+   A E  L K +   SPTSTLM
Sbjct  195   LAESYDGSPLRRQAFESYLTKTIMSSSPTSTLM  227



>ref|XP_002440755.1| hypothetical protein SORBIDRAFT_09g006050 [Sorghum bicolor]
 gb|EES19185.1| hypothetical protein SORBIDRAFT_09g006050 [Sorghum bicolor]
Length=399

 Score =   210 bits (534),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 13/149 (9%)
 Frame = -1

Query  1205  VFQKFLPYNDV--------EDEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHDWTDC  1065
               Q +LP N+V        ED++E       D Y+ D FRMYEFKVRRC+R RSHDWTDC
Sbjct  35    ALQHYLPSNEVSAAAAPYDEDDEEAALAAGVDAYACDEFRMYEFKVRRCSRGRSHDWTDC  94

Query  1064  PFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACK  885
             P+AHPGEKARRRDPR++HYSG  C +FRKG C RGD CE+AHGVFE WLHP+RYRT+ CK
Sbjct  95    PYAHPGEKARRRDPRRYHYSGAACPDFRKGGCKRGDACEYAHGVFECWLHPSRYRTQPCK  154

Query  884   DGKNCKRKVCFFAHSSRQLRILPVNRYST  798
             DG  C+R+VCFFAH+  QLR+LP  + S+
Sbjct  155   DGTGCRRRVCFFAHTPDQLRVLPQQQQSS  183



>ref|XP_002283114.2| PREDICTED: zinc finger CCCH domain-containing protein 20 [Vitis 
vinifera]
Length=428

 Score =   211 bits (536),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 121/170 (71%), Gaps = 16/170 (9%)
 Frame = -1

Query  1205  VFQKFLPYNDV----------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q++LP NDV           + D   D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  104   ALQRYLPSNDVDVDSDSDISGREADIPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  163

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  164   HPGEKARRRDPRKFHYSGTACPDFRKGNCKKGDSCEFAHGVFECWLHPARYRTQPCKDGP  223

Query  875   NCKRKVCFFAHSSRQLRILPVNRYST-GSL-----SPVHDPAEKNLRKNL  744
             NC+R+VCFFAH++ QLR+LP     T GS+     SP+    E +  K L
Sbjct  224   NCRRRVCFFAHTAEQLRVLPQQSPRTPGSVESYDGSPLRQALEASCAKTL  273



>ref|XP_010438328.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Camelina 
sativa]
 ref|XP_010438329.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Camelina 
sativa]
 ref|XP_010438330.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Camelina 
sativa]
Length=356

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+++ D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEMDPDSDPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG  
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGG  165

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAHS  QLR LP
Sbjct  166   CRRRVCFFAHSPDQLRFLP  184



>ref|XP_008795482.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Phoenix dactylifera]
Length=351

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 130/188 (69%), Gaps = 13/188 (7%)
 Frame = -1

Query  1205  VFQKFLPYND--VEDEDEDGD----RYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               Q+FLP N+  +ED DE  D     +S D FRMYEFKVRRC R RSHDWT+CP+AHPGE
Sbjct  45    ALQRFLPSNNESLEDSDEPQDLVVDAFSCDEFRMYEFKVRRCPRGRSHDWTECPYAHPGE  104

Query  1043  KARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             KARRRDPR+FHYSG  C EFRK G+C RGD C+ AHGVFESWLHPARYRT+ CKDG +C+
Sbjct  105   KARRRDPRRFHYSGDACPEFRKTGRCERGDACDLAHGVFESWLHPARYRTQPCKDGTSCR  164

Query  866   RKVCFFAHSSRQLRILPVNRYSTGSLS-PVHDPAEKNLRKNLCCHSPTSTL----MGISH  702
             R+VCFFAH+  QLR L  +  S   ++   +D A     KNL   SP STL    M  + 
Sbjct  165   RRVCFFAHTPAQLRFLAQSPRSPPQVALESYDGALARRSKNL-ISSPRSTLISTPMSPTS  223

Query  701   SSPPLSPA  678
              SPP+SP 
Sbjct  224   ESPPVSPV  231



>gb|EAY72862.1| hypothetical protein OsI_00733 [Oryza sativa Indica Group]
Length=386

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 112/153 (73%), Gaps = 12/153 (8%)
 Frame = -1

Query  1136  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGD  957
             D FRMYEFKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG C RGD
Sbjct  75    DEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGGCKRGD  134

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL----  789
              CE+AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP  + S  S+    
Sbjct  135   ACEYAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPAQQSSPRSVASSP  194

Query  788   -------SPVHDPA-EKNLRKNLCCHSPTSTLM  714
                    SP+   A E  L K +   SPTSTLM
Sbjct  195   LAESYDGSPLRRQAFESYLTKTIMSSSPTSTLM  227



>ref|NP_199239.1| zinc finger CCCH domain-containing protein 61 [Arabidopsis thaliana]
 sp|Q9FKW2.1|C3H61_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 61; 
Short=AtC3H61 [Arabidopsis thaliana]
 dbj|BAB10111.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59423.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13124.1| unknown protein [Arabidopsis thaliana]
 gb|AED95082.1| zinc finger CCCH domain-containing protein 61 [Arabidopsis thaliana]
Length=381

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEF-RKG  975
             D Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+FHY+G VC EF R G
Sbjct  54    DPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYTGEVCPEFSRHG  113

Query  974   KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
              C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAHS RQLR+LP
Sbjct  114   DCSRGDECGFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAHSPRQLRVLP  166



>ref|XP_007160259.1| hypothetical protein PHAVU_002G306100g [Phaseolus vulgaris]
 gb|ESW32253.1| hypothetical protein PHAVU_002G306100g [Phaseolus vulgaris]
Length=359

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 142/235 (60%), Gaps = 27/235 (11%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  74    DAYSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGS  133

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R+VCFFAH+  QLR+LP     +  
Sbjct  134   CKKGDACEYAHGVFECWLHPARYRTQPCKDGTSCRRRVCFFAHTPEQLRVLPQQSPRSAD  193

Query  791   L---SPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLIEMMS  621
                 SP+    E +        SP S    +   SPP+SP         MT +  +    
Sbjct  194   SYDGSPLRHAVESSKTVAPFVSSPGSVSPPV--ESPPMSP---------MTRSGSV----  238

Query  620   YKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGND------PIQFSLPNSPS  474
                 + ++V SL  + L  +    +  N +  P  G+       P  FSLP++P+
Sbjct  239   ---CVNEMVASLRNLQLGKVKSLPSCWNVIGSPGFGSPRGPVIRPGFFSLPSTPT  290



>ref|XP_010447881.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Camelina sativa]
Length=356

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+++ D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEMDPDSDPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG  
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGG  165

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAHS  QLR LP
Sbjct  166   CRRRVCFFAHSPDQLRFLP  184



>ref|XP_001774473.1| predicted protein [Physcomitrella patens]
 gb|EDQ60697.1| predicted protein [Physcomitrella patens]
Length=137

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 110/141 (78%), Gaps = 8/141 (6%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYNDVEDEDEDG----DRYSADHFRMYEFKVRRCTRSRSHDWTD  1068
             + SPT     +F KFLP N+   EDE+     D Y  D FRM+EFKVRRC R RSHDWT+
Sbjct  1     MGSPT-FSDALFNKFLPSNN---EDEEAWPVVDMYGCDQFRMFEFKVRRCMRGRSHDWTE  56

Query  1067  CPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEAC  888
             CPFAHPGEKARRRDPR++HYSGT C +FRKG C RGD CEFAHGVFE WLHPARYRT+ C
Sbjct  57    CPFAHPGEKARRRDPRRYHYSGTACPDFRKGSCRRGDACEFAHGVFECWLHPARYRTQPC  116

Query  887   KDGKNCKRKVCFFAHSSRQLR  825
             KDG+NC+R+VCFFAH+  QLR
Sbjct  117   KDGRNCRRRVCFFAHTPEQLR  137



>ref|XP_006412868.1| hypothetical protein EUTSA_v10025226mg [Eutrema salsugineum]
 gb|ESQ54321.1| hypothetical protein EUTSA_v10025226mg [Eutrema salsugineum]
Length=439

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 107/139 (77%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  120   AALQRYLPSNEPDPDSDSDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  179

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHP RYRT+ CKDG N
Sbjct  180   PGEKARRRDPRKYHYSGTACPDFRKGSCKKGDTCEFAHGVFECWLHPLRYRTQPCKDGGN  239

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+RKVCFFAHS  QLR LP
Sbjct  240   CRRKVCFFAHSPDQLRYLP  258



>ref|XP_010943958.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Elaeis guineensis]
Length=336

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 140/214 (65%), Gaps = 15/214 (7%)
 Frame = -1

Query  1322  FYLKKAMAELDVSPRKILSRRGAA--EADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGD  1149
             +Y +  + +LDV PRKIL R G      D   D   K      +      + E+E+E+ D
Sbjct  13    YYGRNPLLDLDVPPRKILHRPGLTIYVPDDDQDQEPKFNEEGKEIDG-EEEGEEEEEEVD  71

Query  1148  RYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GK  972
              YS D FRMYEFKVRRC R RSHDWTDCPFAHPGEKARRRDPR++HYSG +C +FR+ G 
Sbjct  72    TYSCDEFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGAICPDFRRSGA  131

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C RGD CEFAHGVFE WLHPARYRT  CKDG+ C+RKVCFFAHS RQLR LP    +T  
Sbjct  132   CPRGDACEFAHGVFECWLHPARYRTMPCKDGRRCRRKVCFFAHSPRQLRRLPSPASAT--  189

Query  791   LSPVHDPAEKNLRKNLCC------HSPTSTLMGI  708
              +P+  P+ +   K+ CC       SPTS L G 
Sbjct  190   -TPI--PSPRLPHKHSCCAGWPVASSPTSPLTGF  220



>ref|XP_003607493.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES89690.1| zinc finger C-x8-C-x5-C-x3-H type family protein [Medicago truncatula]
Length=317

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 116/157 (74%), Gaps = 22/157 (14%)
 Frame = -1

Query  1292  DVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEF  1113
             ++ PRK+L+RR          SPT               V D   D D +S+DHFRMYEF
Sbjct  29    NIPPRKLLTRR----------SPTTTA------------VTDMFSDEDPFSSDHFRMYEF  66

Query  1112  KVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGV  933
             K+RRCTRSRSHDWTDCPFAHPGEKARRRDP ++ YSG VC ++R+G C RG+ CEF+HGV
Sbjct  67    KIRRCTRSRSHDWTDCPFAHPGEKARRRDPLRYQYSGEVCPDYRRGNCDRGEACEFSHGV  126

Query  932   FESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRI  822
             FE WLHP+RYRTEACKDGKNCKRK+CFFAH+ RQLR+
Sbjct  127   FECWLHPSRYRTEACKDGKNCKRKICFFAHTPRQLRV  163



>ref|XP_006408900.1| hypothetical protein EUTSA_v10002026mg [Eutrema salsugineum]
 gb|ESQ50353.1| hypothetical protein EUTSA_v10002026mg [Eutrema salsugineum]
Length=359

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 120/175 (69%), Gaps = 10/175 (6%)
 Frame = -1

Query  1310  KAMAELDVSPRKILSRRGAAEADGFLDSP-TKIEG-GVFQKFLPYN--------DVEDED  1161
             +A   + + P        AA+ +G  D   + IE     Q +LP N        D+   D
Sbjct  8     RAYPTVHIPPWPFFDDLTAADFNGSPDGGNSMIEALAALQHYLPSNEPDPDSDPDLSGPD  67

Query  1160  EDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFR  981
                D YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FR
Sbjct  68    SPIDAYSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFR  127

Query  980   KGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             KG C +GD CEF+HGVFE WLHPARYRT+ CKDG +C+R+VCFFAHS  QLR+LP
Sbjct  128   KGNCPKGDTCEFSHGVFECWLHPARYRTQPCKDGGHCRRRVCFFAHSPDQLRVLP  182



>ref|XP_011019549.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Populus euphratica]
Length=390

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 112/145 (77%), Gaps = 10/145 (7%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYND----VEDE-DEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             LDS T +      ++LP ND     EDE D   D +S DHFRMYEFKV+RC R RSHDWT
Sbjct  48    LDSLTSL-----HRYLPSNDPDPSFEDELDLPVDAFSCDHFRMYEFKVKRCARGRSHDWT  102

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDPR++HYSGT C EFRKG C +GD CEFAHGVFE WLHPARYRT+ 
Sbjct  103   ECPYAHPGEKARRRDPRRYHYSGTACPEFRKGGCKKGDACEFAHGVFECWLHPARYRTQP  162

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C+R+VCFFAH+  QLRILP
Sbjct  163   CKDGPACRRRVCFFAHTPEQLRILP  187



>ref|XP_010433125.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Camelina sativa]
Length=356

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNETDPDSDPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG  
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGG  165

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAHS  QLR LP
Sbjct  166   CRRRVCFFAHSPDQLRYLP  184



>gb|ABR16884.1| unknown [Picea sitchensis]
Length=581

 Score =   213 bits (543),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 107/134 (80%), Gaps = 7/134 (5%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  1038
                K+LP N+   EDE      D YS D FRMYEFKVRRC R RSHDWT+CPFAHPGEKA
Sbjct  131   ALHKYLPSNN---EDEASWPAVDAYSCDEFRMYEFKVRRCMRGRSHDWTECPFAHPGEKA  187

Query  1037  RRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKV  858
             RRRDPR+FHYSGT C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG+NC+R+V
Sbjct  188   RRRDPRRFHYSGTACPDFRKGSCRRGDACEFAHGVFECWLHPARYRTQPCKDGRNCRRRV  247

Query  857   CFFAHSSRQLRILP  816
             CFFAH+  QLR+LP
Sbjct  248   CFFAHTPEQLRLLP  261



>emb|CAN81808.1| hypothetical protein VITISV_013303 [Vitis vinifera]
Length=460

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 121/170 (71%), Gaps = 16/170 (9%)
 Frame = -1

Query  1205  VFQKFLPYNDV----------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q++LP NDV           + D   D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  104   ALQRYLPSNDVDVDSDSDISGREADIPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  163

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG 
Sbjct  164   HPGEKARRRDPRKFHYSGTACPDFRKGNCKKGDSCEFAHGVFECWLHPARYRTQPCKDGP  223

Query  875   NCKRKVCFFAHSSRQLRILPVNRYST-GSL-----SPVHDPAEKNLRKNL  744
             NC+R+VCFFAH++ QLR+LP     T GS+     SP+    E +  K L
Sbjct  224   NCRRRVCFFAHTAEQLRVLPQQSPRTPGSVESYDGSPLRQALEASCAKTL  273



>ref|XP_010494430.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Camelina sativa]
Length=375

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 148/346 (43%), Positives = 175/346 (51%), Gaps = 75/346 (22%)
 Frame = -1

Query  1184  YNDVEDEDEDGDR---YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             Y D  D   D D    Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+F
Sbjct  35    YKDQRDYSYDSDSEDPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRF  94

Query  1013  HYSGTVCSEFRK---GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAH  843
             HY G VC E+ +   G C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAH
Sbjct  95    HYIGEVCPEYSRQGGGDCSRGDQCGFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAH  154

Query  842   SSRQLRIL----PVNRYSTGSLSPVHDPAEKNL--RKNLCC----HSPTSTLMGISHSSP  693
             S RQLRIL    P N  S G            L  + N CC    HSPTSTL+G+S S  
Sbjct  155   SPRQLRILLPSSPENYISGGCGGSASSSPASVLSNKNNRCCLFCSHSPTSTLLGLSRSPS  214

Query  692   PLSPAKTPFCGYGMTAAKLIEMMSYKEA-LTQLVNSLEQVNLNPL------SPATTTINR  534
                P           AA    +   + A L +L++SL+  +L         SP T  ++ 
Sbjct  215   SSPPLSP-----ADKAAAFSRLSRRRTAVLNELISSLDSFSLTEALAASSSSPVTMPVST  269

Query  533   MTRPFSGN-------------------------DPIQFSLPNSPSTPGRHSSGS-----E  444
                  S N                          P+QF+L  S +    HS  S     +
Sbjct  270   AAMIASANLSNHHQHRIPPWLDVGERDLQLQQGSPLQFALSPSSTPSYLHSQPSSSFFSD  329

Query  443   FLTPQ-----------------RNTAFSDNGGLTGIDLDWVNDLLT  357
              LTP                  +     + G    +DL WVNDLLT
Sbjct  330   GLTPHGGRLSDLTAASAAAAEAKGKNSFEVGSSGDLDLGWVNDLLT  375



>ref|XP_008337620.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Malus domestica]
Length=397

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 10/140 (7%)
 Frame = -1

Query  1205  VFQKFLPYNDV----------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q++LP N+            + D   D YS DHFRM+EFKVRRC R RSHDWT+CP+A
Sbjct  62    TLQRYLPSNEXDXDSDSDISGRESDAPVDAYSCDHFRMFEFKVRRCARGRSHDWTECPYA  121

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHP+RYRT+ CKDG 
Sbjct  122   HPGEKARRRDPRKYHYSGTACPDFRKGHCKKGDACEFAHGVFECWLHPSRYRTQPCKDGT  181

Query  875   NCKRKVCFFAHSSRQLRILP  816
             +CKR+VCFFAH+  QLR+LP
Sbjct  182   SCKRRVCFFAHTPEQLRVLP  201



>dbj|BAJ34229.1| unnamed protein product [Thellungiella halophila]
Length=359

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 119/175 (68%), Gaps = 10/175 (6%)
 Frame = -1

Query  1310  KAMAELDVSPRKILSRRGAAEADGFLDSP-TKIEG-GVFQKFLPYN--------DVEDED  1161
             +A   + + P        AA  +G  D   + IE     Q +LP N        D+   D
Sbjct  8     RAYPTVHIPPWPFFDDLTAAAFNGSPDGGNSMIEALAALQHYLPSNEPDPDSDPDLSGPD  67

Query  1160  EDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFR  981
                D YS DHFRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FR
Sbjct  68    SPIDAYSCDHFRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFR  127

Query  980   KGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             KG C +GD CEF+HGVFE WLHPARYRT+ CKDG +C+R+VCFFAHS  QLR+LP
Sbjct  128   KGNCPKGDTCEFSHGVFECWLHPARYRTQPCKDGGHCRRRVCFFAHSPDQLRVLP  182



>ref|NP_194648.1| protein OXIDATION-RELATED ZINC FINGER 2 [Arabidopsis thaliana]
 sp|Q9M0G2.1|C3H49_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 49; 
Short=AtC3H49 [Arabidopsis thaliana]
 emb|CAB79677.1| putative protein [Arabidopsis thaliana]
 gb|AAK76644.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85054.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62857.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AEE85600.1| zinc finger CCCH domain-containing protein 49 [Arabidopsis thaliana]
Length=356

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 106/136 (78%), Gaps = 8/136 (6%)
 Frame = -1

Query  1202  FQKFLPYNDVEDE--------DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
              Q++LP N+ + E        D   D YS DHFRMY+FKVRRC R RSHDWT+CP+AHPG
Sbjct  48    LQRYLPSNEPDPESYPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAHPG  107

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG NC 
Sbjct  108   EKARRRDPRKYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGNCL  167

Query  866   RKVCFFAHSSRQLRIL  819
             RK+CFFAHS  QLR L
Sbjct  168   RKICFFAHSPDQLRFL  183



>emb|CDY22300.1| BnaA06g36220D [Brassica napus]
Length=391

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 170/327 (52%), Gaps = 70/327 (21%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKC  969
             Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EFR  G C
Sbjct  56    YAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGEVCPEFRHGGDC  115

Query  968   GRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL  789
              RGD C FAHGVFE WLHP+RYRTEACKDGK+C RK+CFFAHS  QLR+ P         
Sbjct  116   SRGDECGFAHGVFECWLHPSRYRTEACKDGKHCTRKICFFAHSPPQLRVPPPPESFVSGG  175

Query  788   SPVHDPAEKNLRKN-------LCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLI-  633
                   +  ++  N        C +SPTS L G++HS     P         +TA   + 
Sbjct  176   GGSALSSPASVLSNKSNGCCVFCSNSPTSPLFGLAHSPSSSPPLSP---ANKVTAVSRLS  232

Query  632   ---EMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFS------------------  516
                  ++YKE L +++NSL+  +L     A ++ +  T P S                  
Sbjct  233   RHRSAVTYKEVLNEMINSLDSFSLTQPLTAASSASMATMPVSTASMLASSSLSNHYHHRL  292

Query  515   ------GNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDN-----------------  405
                   G+  +QF+L  SPS+   + +G   L P   + FS+                  
Sbjct  293   PPWLDVGDRDLQFAL--SPSSTPSYLNGQIQLQPPPPSFFSEEFTPRGGRVSDFTAAATA  350

Query  404   ------------GGLTGIDLDWVNDLL  360
                         G    +DL WVNDLL
Sbjct  351   AAEARDKSSFEIGSSGDLDLGWVNDLL  377



>ref|XP_004503514.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cicer arietinum]
Length=385

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 136/210 (65%), Gaps = 18/210 (9%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDED--------EDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q ++P N+ +D+         E  D YS D+FRM+EFK+RRC R RSHDWT+CP+AHP
Sbjct  52    ALQHYIPSNEHDDDSDSDAIPSHESVDVYSCDNFRMFEFKIRRCARGRSHDWTECPYAHP  111

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRKFHYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG +C
Sbjct  112   GEKARRRDPRKFHYSGTACPDFRKGSCKKGDSCEFAHGVFECWLHPARYRTQPCKDGTSC  171

Query  869   KRKVCFFAHSSRQLRI------LPVNRYSTGSLSPVHDPAEKNLRKNL-CCHSPTSTLMG  711
             +R+VCFFAH+S QLR         VN   +   SP+    E +  K+L    SP S    
Sbjct  172   RRRVCFFAHTSEQLRTPTQQSPRSVNSTDSYDGSPLRLAIESSCVKSLPFMSSPGSVSPP  231

Query  710   ISHSSPPLSPAKTPFC-GYGMTAAKLIEMM  624
             +   SPP+SP  +     +G  +  + EM+
Sbjct  232   V--ESPPMSPLTSSLGRSFGFGSVNVNEMV  259



>ref|XP_002978806.1| hypothetical protein SELMODRAFT_443970 [Selaginella moellendorffii]
 ref|XP_002984720.1| hypothetical protein SELMODRAFT_446000 [Selaginella moellendorffii]
 gb|EFJ14365.1| hypothetical protein SELMODRAFT_446000 [Selaginella moellendorffii]
 gb|EFJ20253.1| hypothetical protein SELMODRAFT_443970 [Selaginella moellendorffii]
Length=383

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = -1

Query  1259  GAAEAD-GFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRS  1083
             G+  AD G  DSPT +  G   KFLP N+ ED       Y+ D FRM+EFKVRRC R RS
Sbjct  17    GSVSADSGSCDSPTSM--GALHKFLPSNN-EDSWSPEHLYACDEFRMFEFKVRRCMRGRS  73

Query  1082  HDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARY  903
             HDWT+CPFAHPGEKARRRDPR+FHYSGT C +FRKG C  GD+C+ AHGVFE WLHPARY
Sbjct  74    HDWTECPFAHPGEKARRRDPRRFHYSGTSCPDFRKGCCKNGDSCDLAHGVFECWLHPARY  133

Query  902   RTEACKDGKNCKRKVCFFAHSSRQLR  825
             RT+ CKDG+NCKRKVCFFAH+  QLR
Sbjct  134   RTQPCKDGRNCKRKVCFFAHTPEQLR  159



>ref|XP_003525299.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=353

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 141/232 (61%), Gaps = 24/232 (10%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D YS DHFRM+EFKVRRC R RSHDWTDCP+AHPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  68    DAYSCDHFRMFEFKVRRCARCRSHDWTDCPYAHPGEKARRRDPRKYHYSGTACPDFRKGS  127

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R+VCFFAH+  QLR+LP  + S  S
Sbjct  128   CKKGDACEYAHGVFECWLHPARYRTQPCKDGTSCRRRVCFFAHTPDQLRVLP--QQSPRS  185

Query  791   LSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKE  612
                      ++  ++ C  S        S SSP  SP  +P     MT            
Sbjct  186   ADSYDGSPLRHAIESSCAKSHPFVASPGSASSPVESPPMSP-----MTV-----------  229

Query  611   ALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGND------PIQFSLPNSPS  474
             ++ ++V SL  + L  +    ++ N M     G+       P  FSLP +P+
Sbjct  230   SVNEMVASLRNLQLGKVKSLPSSWNVMGSSGFGSPRGPMIRPGFFSLPTTPT  281



>ref|XP_006285735.1| hypothetical protein CARUB_v10007208mg [Capsella rubella]
 gb|EOA18633.1| hypothetical protein CARUB_v10007208mg [Capsella rubella]
Length=361

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 8/138 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+++ D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEMDPDSDPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+HYSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG +
Sbjct  106   PGEKARRRDPRKYHYSGTACPDFRKGGCSKGDSCEFAHGVFECWLHPARYRTQPCKDGGS  165

Query  872   CKRKVCFFAHSSRQLRIL  819
             C+R+VCFFAHS  QLR L
Sbjct  166   CRRRVCFFAHSPDQLRFL  183



>ref|XP_009784195.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana sylvestris]
Length=353

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 6/138 (4%)
 Frame = -1

Query  1205  VFQKFLPYN------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               Q++LP N      D +  D   D +S D+FRMYEFKVR+C R RSHDWT+CP+AHPGE
Sbjct  53    ALQRYLPSNANDVLLDSDGLDIPVDAFSCDNFRMYEFKVRKCARGRSHDWTECPYAHPGE  112

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPRK+HYSGT C +FRKG C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R
Sbjct  113   KARRRDPRKYHYSGTACPDFRKGLCKKGDACEYAHGVFECWLHPARYRTQPCKDGTHCRR  172

Query  863   KVCFFAHSSRQLRILPVN  810
             +VCFFAH+  QLR+LP N
Sbjct  173   RVCFFAHTPEQLRVLPQN  190



>ref|XP_006408830.1| hypothetical protein EUTSA_v10002045mg [Eutrema salsugineum]
 gb|ESQ50283.1| hypothetical protein EUTSA_v10002045mg [Eutrema salsugineum]
Length=316

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 118/163 (72%), Gaps = 8/163 (5%)
 Frame = -1

Query  1154  GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKG  975
              D ++ D FRMYEFKVRRC+R RSHDWT+CPFAHPGEKARRRDP K+HYSGT C EFR+G
Sbjct  77    ADSFACDEFRMYEFKVRRCSRGRSHDWTECPFAHPGEKARRRDPTKYHYSGTACPEFRRG  136

Query  974   KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTG  795
              C RGD+CEFAHGVFE WLHPARYRT+ CKDG +C+R++CFFAH+  QLR L  +     
Sbjct  137   SCRRGDSCEFAHGVFECWLHPARYRTQPCKDGTSCRRRICFFAHTPEQLRFLANSAEPDL  196

Query  794   SLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS----SPPLSPA  678
              LS + +    +  K+    SPTS L+    S    SPPLSP+
Sbjct  197   GLSSIRN----HFSKSATATSPTSILISPPFSPQSESPPLSPS  235



>ref|XP_002972737.1| hypothetical protein SELMODRAFT_441947 [Selaginella moellendorffii]
 gb|EFJ25958.1| hypothetical protein SELMODRAFT_441947 [Selaginella moellendorffii]
Length=581

 Score =   212 bits (539),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG-DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRR  1029
             V  +FLP N+ ++      D YS D FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRR
Sbjct  90    VLHRFLPSNNSDEATWSAEDVYSCDEFRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRR  149

Query  1028  DPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFF  849
             DPR+FHYSGT C +FRKG C  GD CE AHGVFE WLHPARYRT+ CKDG++CKR+VCFF
Sbjct  150   DPRRFHYSGTACPDFRKGSCKNGDACELAHGVFECWLHPARYRTQPCKDGRSCKRRVCFF  209

Query  848   AHSSRQLRILP  816
             AH+S QLR+LP
Sbjct  210   AHTSEQLRLLP  220



>ref|XP_009402941.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Musa acuminata subsp. malaccensis]
Length=375

 Score =   207 bits (526),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 149/255 (58%), Gaps = 15/255 (6%)
 Frame = -1

Query  1181  NDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSG  1002
              DVE+ D   D YS+D FRMYEFKVRRC R RSHDWT+CPF HPGEKARRRDPRK+HYS 
Sbjct  68    EDVEEPDSAVDVYSSDEFRMYEFKVRRCARGRSHDWTECPFVHPGEKARRRDPRKYHYSS  127

Query  1001  TVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRI  822
               C +FRKG C RGD CEFAHGVFE WLHPARYRT+ CKDG  C R+VCFFAH+  QLR+
Sbjct  128   AACPDFRKGGCKRGDACEFAHGVFECWLHPARYRTQPCKDGTTCARRVCFFAHAPDQLRV  187

Query  821   LPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAA  642
             L  ++ +T +L  V       LR+        S  +  S +S  +SP  +P      TA 
Sbjct  188   LSQHQQTT-TLPAVESYDGSPLRQQQALECYISKKLMSSKTSTLMSPPVSPPMSPSRTAL  246

Query  641   KLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTIN-----------RMTRPFSGNDPIQF  495
             +         +L ++V +L Q+ L   +PA +  N           R T   SG +    
Sbjct  247   RRAS-WPVGTSLNEIVAALRQLQLTQANPAPSCWNLQLGDGLFGSPRCTA--SGFNAGFC  303

Query  494   SLPNSPSTPGRHSSG  450
             SLP++P+  G    G
Sbjct  304   SLPSTPTMAGTSGGG  318



>ref|XP_002993351.1| hypothetical protein SELMODRAFT_449116 [Selaginella moellendorffii]
 gb|EFJ05536.1| hypothetical protein SELMODRAFT_449116 [Selaginella moellendorffii]
Length=581

 Score =   212 bits (539),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG-DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRR  1029
             V  +FLP N+ ++      D YS D FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRR
Sbjct  89    VLHRFLPSNNSDEATWSAEDVYSCDEFRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRR  148

Query  1028  DPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFF  849
             DPR+FHYSGT C +FRKG C  GD CE AHGVFE WLHPARYRT+ CKDG++CKR+VCFF
Sbjct  149   DPRRFHYSGTACPDFRKGSCKNGDACELAHGVFECWLHPARYRTQPCKDGRSCKRRVCFF  208

Query  848   AHSSRQLRILP  816
             AH+S QLR+LP
Sbjct  209   AHTSEQLRLLP  219



>ref|XP_004158433.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 1 [Cucumis sativus]
Length=363

 Score =   206 bits (525),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 142/221 (64%), Gaps = 27/221 (12%)
 Frame = -1

Query  1325  PFYLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDR  1146
             P+YL++A+A L         +R   E++  ++S +++ G             + D   + 
Sbjct  53    PYYLQEALAAL---------QRYTNESE--IESDSELSG------------READVPLNA  89

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS DHFR++EFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C 
Sbjct  90    YSCDHFRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCK  149

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             +GD+CEFAHGVFE WLHPARYRT+ CKDG NC+R+VCFFAH+  QLR+LP     + +  
Sbjct  150   KGDSCEFAHGVFECWLHPARYRTQPCKDGTNCRRRVCFFAHTPEQLRVLPQQSPRSANSP  209

Query  785   PVHDPAEKNLRKNL--CCHSPTSTLMGISHSSPPLSPAKTP  669
               +D  E  LR+++   C      L      SP  +P  +P
Sbjct  210   DSYD--ESPLRQSVDGSCSKTLPFLSSPVSVSPTATPVDSP  248



>ref|XP_006294702.1| hypothetical protein CARUB_v10023740mg [Capsella rubella]
 gb|EOA27600.1| hypothetical protein CARUB_v10023740mg [Capsella rubella]
Length=298

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = -1

Query  1202  FQKFLPYNDV-EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
               ++LP N++ ED DE       D FRMYEFK+RRC+R RSHDWT+CP+AHPGEKARRRD
Sbjct  50    LHRYLPSNELTEDSDEPS---LTDEFRMYEFKIRRCSRGRSHDWTECPYAHPGEKARRRD  106

Query  1025  PRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFA  846
             PRK HYSGT C EFRKG C RGD CEFAHGVFE WLHP+RYRT+ CKDG +C+R++CFFA
Sbjct  107   PRKVHYSGTACPEFRKGSCRRGDTCEFAHGVFECWLHPSRYRTQPCKDGTSCRRRICFFA  166

Query  845   HSSRQLRILP  816
             H++ QLR+LP
Sbjct  167   HTTEQLRVLP  176



>ref|XP_002309525.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE93048.2| zinc finger family protein [Populus trichocarpa]
Length=390

 Score =   207 bits (526),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 127/193 (66%), Gaps = 27/193 (14%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYND----VEDE-DEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             LDS T +      ++LP N+     EDE D   D +S DHFRMYEFKV+RC R RSHDWT
Sbjct  48    LDSLTSL-----HRYLPSNEPDPTFEDELDLPVDAFSCDHFRMYEFKVKRCARGRSHDWT  102

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDPR++HYSGT C EFRKG C +GD CEFAHGVFE WLHPARYRT+ 
Sbjct  103   ECPYAHPGEKARRRDPRRYHYSGTACPEFRKGGCKKGDACEFAHGVFECWLHPARYRTQP  162

Query  890   CKDGKNCKRKVCFFAHSSRQLRILPVN--------------RYSTGSLSPVHDPAEKNLR  753
             CKDG  C+R+VCFFAH+  QLR+LP                 Y  G  SPV  P +  + 
Sbjct  163   CKDGPACRRRVCFFAHTPEQLRLLPQQSPKGNGSGSGLGSGEYDFG--SPVIHPFDSYMT  220

Query  752   K-NLCCHSPTSTL  717
             K  +   SPTS L
Sbjct  221   KAGIFVSSPTSIL  233



>ref|XP_004245129.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Solanum lycopersicum]
Length=320

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 6/138 (4%)
 Frame = -1

Query  1205  VFQKFLPYN------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               Q++LP N      D +  D   D +S D+FRMYEFKVR+C R RSHDWT+CP+AHPGE
Sbjct  43    ALQRYLPSNGNDVIFDSDGLDIPVDAFSCDNFRMYEFKVRKCARGRSHDWTECPYAHPGE  102

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPRK+HYSGT C +FRKG+C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R
Sbjct  103   KARRRDPRKYHYSGTSCPDFRKGQCKKGDACEYAHGVFECWLHPARYRTQPCKDGTHCRR  162

Query  863   KVCFFAHSSRQLRILPVN  810
             +VCFFAH+  QLR+LP N
Sbjct  163   RVCFFAHTPEQLRVLPQN  180



>ref|XP_004513076.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cicer arietinum]
Length=365

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 10/138 (7%)
 Frame = -1

Query  1205  VFQKFLPYNDVE----------DEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q++LP N+++          + D   D YS DHFRMYEFK+RRC R RSHDWT+CP+A
Sbjct  51    ALQRYLPSNELDADSDSEFPGRESDSPVDAYSCDHFRMYEFKIRRCARGRSHDWTECPYA  110

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRKFHYSGT C +FRKG C +GD CE+AHGVFE WLHPARYRT+ CKDG 
Sbjct  111   HPGEKARRRDPRKFHYSGTACPDFRKGNCKKGDACEYAHGVFECWLHPARYRTQPCKDGT  170

Query  875   NCKRKVCFFAHSSRQLRI  822
             +C+R+VCFFAH+  Q+R+
Sbjct  171   SCRRRVCFFAHTPEQIRL  188



>ref|XP_009128959.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Brassica rapa]
Length=361

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  46    AALQRYLPSNEPDPDSDPDLFGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  105

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDPRK+ YSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG N
Sbjct  106   PGEKARRRDPRKYSYSGTACPDFRKGGCVKGDSCEFAHGVFECWLHPARYRTQPCKDGGN  165

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAHS  QLR LP
Sbjct  166   CRRRVCFFAHSPDQLRYLP  184



>emb|CDP03218.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 111/150 (74%), Gaps = 21/150 (14%)
 Frame = -1

Query  1205  VFQKFLPYN--------DVED----EDEDG---------DRYSADHFRMYEFKVRRCTRS  1089
               Q+FLP N         +ED    E++DG         D YS DHFRM+EFKVR+C R 
Sbjct  60    ALQRFLPSNLKTSLTDLVLEDLDAAENDDGFGKDLDLPVDAYSCDHFRMFEFKVRKCMRG  119

Query  1088  RSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPA  909
             RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHPA
Sbjct  120   RSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDACEFAHGVFECWLHPA  179

Query  908   RYRTEACKDGKNCKRKVCFFAHSSRQLRIL  819
             RYRT+ CKDG NCKR+VCFFAHS  QLR+L
Sbjct  180   RYRTQPCKDGLNCKRRVCFFAHSPEQLRVL  209



>ref|XP_010668905.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Beta vulgaris subsp. vulgaris]
Length=386

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 128/183 (70%), Gaps = 11/183 (6%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               +++LP ++ +DE ++       D ++ D+FRMYEFK+R+C R RSHDWT+CP+AHPGE
Sbjct  38    ALRRYLPSSEFDDESDNESSDLPFDSFTCDNFRMYEFKIRKCARGRSHDWTECPYAHPGE  97

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPRK+HYSGT C EFR+G C +GD+CEFAHGVFE WLHPARYRT+ CKDG +CKR
Sbjct  98    KARRRDPRKYHYSGTACPEFRRGSCRKGDSCEFAHGVFECWLHPARYRTQPCKDGPHCKR  157

Query  863   KVCFFAHSSRQLRILPVNRYS-TGSLSPVHDPAEKNLRKN----LCCHSPTSTLMGISHS  699
             +VCFFAHS  QLR+LP +  S  G  S + D     L  +    +   SP S L  I   
Sbjct  158   RVCFFAHSPDQLRVLPESPTSRLGCDSLIRDSPPGRLGYDSVLRVLPESPPSRLGCIVPE  217

Query  698   SPP  690
             SPP
Sbjct  218   SPP  220



>ref|XP_009380460.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Musa acuminata subsp. malaccensis]
Length=370

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/344 (40%), Positives = 177/344 (51%), Gaps = 58/344 (17%)
 Frame = -1

Query  1259  GAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDG--DRYSADHFRMYEFKVRRCTRSR  1086
             G A  DG LD  T +     Q +L   +   ED     D Y++D FRMYEFKVRRC+R R
Sbjct  40    GVATGDGVLDEDTVV---TMQLYLGLQEGAGEDAPPVVDAYASDEFRMYEFKVRRCSRGR  96

Query  1085  SHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPA  909
             +HDWT+CPFAHPGEKARRRDPRK  YSG  C +FRK G C RGD C+ AHGVFE WLHP 
Sbjct  97    AHDWTECPFAHPGEKARRRDPRKHRYSGAPCPDFRKAGGCKRGDACDLAHGVFECWLHPE  156

Query  908   RYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPV-------------HDPA  768
             RYRT+ CKDG  C+R+VCFFAH+  QLR++P     + S SPV               PA
Sbjct  157   RYRTQPCKDGTTCRRRVCFFAHTPDQLRLVPPQPQQS-STSPVAASAESYDGSPLRQQPA  215

Query  767   EKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKL-IEMMSYKEALTQLVN  591
              ++         P STL+    S P  SP  +P        AKL  +      ++ ++V 
Sbjct  216   SQSYVSKNLVSPPASTLISPPTSPPAKSPPISP------NGAKLRRDSWQQSSSVNEIVA  269

Query  590   SLEQVNLN-----PLSPATTTIN------RMTRPFSGNDPIQFSLPNSPSTP--------  468
             SL Q+ L+     P S +  T+N      R T   +G +    SLP++P+          
Sbjct  270   SLRQLQLSRGKSVPSSWSLQTVNDGFASPRGT--LAGFNTAFCSLPSTPTVATAGWLEEV  327

Query  467   --------GRHSSGSEFLTPQRNTAFSDNGGLTGIDLDWVNDLL  360
                     GR      F    +++ F D    T  D+ WV+DLL
Sbjct  328   EPAERVESGRALRAKMFERLSKDSVF-DKAEATP-DVGWVSDLL  369



>ref|XP_011094664.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Sesamum indicum]
Length=369

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 160/287 (56%), Gaps = 35/287 (12%)
 Frame = -1

Query  1208  GVFQKFLPYND-----------VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCP  1062
                Q++LP N            ++D D   D +S D+FRM+EFKV++C  +RSHDWT+CP
Sbjct  52    AALQRYLPSNKDDVVPSEHDDCIDDFDVPVDAFSCDNFRMFEFKVKKCALARSHDWTECP  111

Query  1061  FAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKD  882
             FAHPGEKARRRDPRK+HYSG+ C +FR+G C RGD CE+AHGVFE WLHPARYRT+ CKD
Sbjct  112   FAHPGEKARRRDPRKYHYSGSACPDFRRGACKRGDACEYAHGVFECWLHPARYRTQPCKD  171

Query  881   GKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISH  702
             G +C+R+VCFFAH+  QLR+LP    ++   SP     +  L   L   SP STL    +
Sbjct  172   GVHCRRRVCFFAHTPEQLRVLPYT--TSPDASPGRVVQDSFLPMGLFGSSPNSTL----Y  225

Query  701   SSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRP  522
             S PP SP        G         MS   ++ +L  S+  + LN +        +M   
Sbjct  226   SPPPSSPTT------GSPPVSPTGSMSLN-SVNKLTESMRCLQLNKM--------KMGLG  270

Query  521   FSGNDPIQFSLPNSPSTPGRHSSGSEFLTPQRNTAFSDNG-GLTGID  384
              SG+ P       SP +P     G  F++P      +  G GL+  D
Sbjct  271   LSGSPPSWALGIGSPRSPPTIRPG--FMSPPSTPIRAQVGPGLSAFD  315



>ref|NP_180161.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 ref|NP_001189604.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 sp|O82307.1|C3H23_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 23; 
Short=AtC3H23; AltName: Full=Protein ATCTH [Arabidopsis thaliana]
 gb|AAK43909.1|AF370590_1 putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAK52987.1|AF375403_1 At2g25900/F17H15.7 [Arabidopsis thaliana]
 gb|AAC42256.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM91054.1| At2g25900/F17H15.7 [Arabidopsis thaliana]
 dbj|BAC41945.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 gb|AEC07769.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 gb|AEC07770.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
Length=315

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D +S+D FR+YEFK+RRC R RSHDWT+CPFAHPGEKARRRDPRKFHYSGT C EFRKG 
Sbjct  84    DSFSSDEFRIYEFKIRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYSGTACPEFRKGS  143

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVN  810
             C RGD+CEF+HGVFE WLHP+RYRT+ CKDG +C+R++CFFAH++ QLR+LP +
Sbjct  144   CRRGDSCEFSHGVFECWLHPSRYRTQPCKDGTSCRRRICFFAHTTEQLRVLPCS  197



>ref|XP_008810557.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=334

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 114/155 (74%), Gaps = 10/155 (6%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-G  975
             D YS D FRMYEFKVRRC R RSHDWTDCPFAHPGEKARRRDPR++HYSG +C +FR+ G
Sbjct  57    DTYSCDEFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGAICPDFRRSG  116

Query  974   KCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTG  795
              C RGD CEFAHGVFE WLHPARYRT  CKDG+ C+RKVCFFAH  RQLR LP    +T 
Sbjct  117   ACPRGDFCEFAHGVFECWLHPARYRTMPCKDGRRCRRKVCFFAHCPRQLRRLPSPSSATA  176

Query  794   SLSPVHDPAEKNLRKNLCC------HSPTSTLMGI  708
             + +P+  P+ +  RK  CC       SPTS LM  
Sbjct  177   T-TPI--PSPRLPRKPSCCAVWPAASSPTSPLMAF  208



>ref|XP_006355306.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Solanum tuberosum]
Length=350

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 6/138 (4%)
 Frame = -1

Query  1205  VFQKFLPYN------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               Q++LP N      D +  D   D +S D+FRMYEFKVR+C R RSHDWT+CP+AHPGE
Sbjct  43    ALQRYLPSNGNDVIFDSDGLDIPVDAFSCDNFRMYEFKVRKCARGRSHDWTECPYAHPGE  102

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPRK+HYSGT C +FRKG+C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R
Sbjct  103   KARRRDPRKYHYSGTSCPDFRKGQCKKGDACEYAHGVFECWLHPARYRTQPCKDGTHCRR  162

Query  863   KVCFFAHSSRQLRILPVN  810
             +VCFFAH+  QLR+LP N
Sbjct  163   RVCFFAHTPEQLRVLPQN  180



>ref|XP_003620782.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES77000.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=377

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 105/138 (76%), Gaps = 10/138 (7%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDG----------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q++LP N+  D D +           D YS DHFRMYEFK+RRC R RSHDWT+CP+A
Sbjct  69    ALQRYLPSNEFNDSDLESPATAAADSTVDAYSCDHFRMYEFKIRRCARGRSHDWTECPYA  128

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRKFHYSGT C +FRKG C +GD CE AHGVFE WLHPARYRT+ CKDG 
Sbjct  129   HPGEKARRRDPRKFHYSGTACPDFRKGNCKKGDACEHAHGVFECWLHPARYRTQPCKDGT  188

Query  875   NCKRKVCFFAHSSRQLRI  822
             +C+R+VCFFAH+  QLR+
Sbjct  189   SCRRRVCFFAHTPEQLRL  206



>gb|EYU20391.1| hypothetical protein MIMGU_mgv1a008351mg [Erythranthe guttata]
Length=376

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 135/214 (63%), Gaps = 33/214 (15%)
 Frame = -1

Query  1208  GVFQKFLPYNDV------------EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDC  1065
                Q++LP N              ++ D   D +S D+FRM+EFKV++C R+RSHDWT+C
Sbjct  56    AALQRYLPSNQDDDVVVQADDEDSDNFDFPVDAFSCDNFRMFEFKVKKCARARSHDWTEC  115

Query  1064  PFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACK  885
             PFAHPGEKARRRDPRK+HYSG+ C +FRKG C RGD CE+AHGVFE WLHPARYRT+ CK
Sbjct  116   PFAHPGEKARRRDPRKYHYSGSACPDFRKGACVRGDTCEYAHGVFECWLHPARYRTQPCK  175

Query  884   DGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPV---HDPAEKNLRKNLCCHSPTSTLM  714
             DG +C+R VCFFAH+  QLR+LP N  S+   SP    HDP        L   SP STL 
Sbjct  176   DGTHCRRHVCFFAHTPDQLRVLPYN--SSPDASPARTGHDPF------ILVGSSPKSTLY  227

Query  713   GISHS----SPPLSPAKTPFCGYGMTAAKLIEMM  624
                 S    SPP+SP      G  +  ++L E M
Sbjct  228   SPPSSPTTASPPVSP------GGSLRLSQLTESM  255



>ref|XP_010451167.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Camelina sativa]
Length=221

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 108/143 (76%), Gaps = 9/143 (6%)
 Frame = -1

Query  1184  YNDVEDEDEDGDR---YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             Y D  D   D D    Y+ DHFRMYEFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+F
Sbjct  35    YKDQRDYSYDSDSEDPYAGDHFRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRF  94

Query  1013  HYSGTVCSEFRK---GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAH  843
             HY G VC E+ +   G C RGD C FAHGVFE WLHP+RYRTEACKDGK+CKRKVCFFAH
Sbjct  95    HYIGEVCPEYSRQGGGDCSRGDQCGFAHGVFECWLHPSRYRTEACKDGKHCKRKVCFFAH  154

Query  842   SSRQLRIL---PVNRYSTGSLSP  783
             S RQLRIL   P   +  G + P
Sbjct  155   SPRQLRILXRDPRRFHYIGEVCP  177


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = -1

Query  1067  CPFAHPGEKAR--RRDPRKFHYSGTVCSEFRK---GKCGRGDNCEFAHGVFESWLHPARY  903
             C FAH   + R   RDPR+FHY G VC E+ +   G C RGD C FAHGVFE WLHP+RY
Sbjct  150   CFFAHSPRQLRILXRDPRRFHYIGEVCPEYSRQGGGDCSRGDQCGFAHGVFECWLHPSRY  209

Query  902   RTEACK  885
             RTEACK
Sbjct  210   RTEACK  215



>ref|XP_006353579.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Solanum tuberosum]
Length=402

 Score =   205 bits (522),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 101/131 (77%), Gaps = 10/131 (8%)
 Frame = -1

Query  1181  NDVEDEDE----------DGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARR  1032
             ND ED DE            D Y+ D+FRMYEFKV+RC R RSHDWT+CP+ HPGEKARR
Sbjct  91    NDAEDIDEFELENREIELPVDVYACDNFRMYEFKVKRCGRGRSHDWTECPYVHPGEKARR  150

Query  1031  RDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCF  852
             RDPRKFHYSGT C EFRKG C RGD CE+AHGVFE WLHP RYRT+ CKDG NCKR+VCF
Sbjct  151   RDPRKFHYSGTACPEFRKGNCNRGDGCEYAHGVFECWLHPGRYRTQPCKDGGNCKRRVCF  210

Query  851   FAHSSRQLRIL  819
             FAHS  QLR+L
Sbjct  211   FAHSPEQLRVL  221



>gb|AGL40443.1| C3H-type zinc finger protein [Glycine max]
Length=353

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 140/232 (60%), Gaps = 24/232 (10%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D YS DHFRM+EFKVRRC R RSHDWTDCP+AHPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  68    DAYSCDHFRMFEFKVRRCARCRSHDWTDCPYAHPGEKARRRDPRKYHYSGTACPDFRKGS  127

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+ +VCFFAH+  QLR+LP  + S  S
Sbjct  128   CKKGDACEYAHGVFECWLHPARYRTQPCKDGTSCRPRVCFFAHTPDQLRVLP--QQSPRS  185

Query  791   LSPVHDPAEKNLRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKE  612
                      ++  ++ C  S        S SSP  SP  +P     MT            
Sbjct  186   ADSYDGSPLRHAIESSCAKSHPFVASPGSASSPVESPPMSP-----MTV-----------  229

Query  611   ALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGND------PIQFSLPNSPS  474
             ++ ++V SL  + L  +    ++ N M     G+       P  FSLP +P+
Sbjct  230   SVNEMVASLRNLQLGKVKSLPSSWNVMGSSGFGSPRGPMIRPGFFSLPTTPT  281



>ref|XP_004251650.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Solanum 
lycopersicum]
Length=405

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 102/131 (78%), Gaps = 10/131 (8%)
 Frame = -1

Query  1181  NDVEDEDE----------DGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARR  1032
             ND ED DE            D Y+ D+FRMYEFKVRRC R RSHDWT+CP+ HPGEKARR
Sbjct  90    NDAEDIDEFELENREIELPVDVYACDNFRMYEFKVRRCGRGRSHDWTECPYVHPGEKARR  149

Query  1031  RDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCF  852
             RDPRKFHYSGT C EFRKG C RGD+CE+AHGVFE WLHP RYRT+ CKDG NCKR+VCF
Sbjct  150   RDPRKFHYSGTACPEFRKGNCNRGDSCEYAHGVFECWLHPGRYRTQPCKDGGNCKRRVCF  209

Query  851   FAHSSRQLRIL  819
             FAHS  QLR+L
Sbjct  210   FAHSPEQLRVL  220



>gb|EPS65346.1| hypothetical protein M569_09425, partial [Genlisea aurea]
Length=155

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = -1

Query  1205  VFQKFLPYN--DV-----EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
               Q+FLP N  DV     ED D   D +S D+FRM+EFKV++C  +RSHDWT CPFAHPG
Sbjct  8     ALQRFLPSNSDDVVVEEGEDFDVPVDAFSCDNFRMFEFKVKKCALARSHDWTACPFAHPG  67

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRK+HYSG+ C +FRKG C RGD CE+AHGVFE WLHPARYRT+ CKDG +C+
Sbjct  68    EKARRRDPRKYHYSGSACPDFRKGACKRGDACEYAHGVFECWLHPARYRTQPCKDGTHCR  127

Query  866   RKVCFFAHSSRQLRILP  816
             R+VCFFAH+  QLR+LP
Sbjct  128   RRVCFFAHTQEQLRVLP  144



>ref|XP_010924475.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Elaeis guineensis]
Length=351

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 120/172 (70%), Gaps = 9/172 (5%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDE------DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
               Q+FLP N+   E      D   D +S D FRMYEFKVRRC R RSHDWT+CP+AHPGE
Sbjct  45    ALQRFLPSNNESLEASEEPLDLAVDAFSCDEFRMYEFKVRRCPRGRSHDWTECPYAHPGE  104

Query  1043  KARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             KARRRDPR+FHYSG  C EFRK G+C RGD C+ AHGVFESWLHPARYRT+ CKDG  C+
Sbjct  105   KARRRDPRRFHYSGDACPEFRKTGRCERGDACDLAHGVFESWLHPARYRTQPCKDGTACR  164

Query  866   RKVCFFAHSSRQLRILPVNRYSTGSLS-PVHDPAEKNLRKNLCCHSPTSTLM  714
             R+VCFFAH+  QLR LP +  S   ++   +D A     KNL   SP STL+
Sbjct  165   RRVCFFAHTPAQLRFLPQSPRSQPQVALESYDGAPARRSKNLIT-SPRSTLI  215



>ref|XP_008799753.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Phoenix dactylifera]
Length=381

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 138/211 (65%), Gaps = 14/211 (7%)
 Frame = -1

Query  1208  GVFQKFLPYND--VEDEDEDGDR----YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
                Q+FLP N+  ++D DE  D     +S D FRMYEFKVRRC R RSHDWT+CP+AHPG
Sbjct  75    AALQRFLPSNNEPLDDSDEPMDSLLDAFSCDEFRMYEFKVRRCPRGRSHDWTECPYAHPG  134

Query  1046  EKARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             EKARRRDPR+FHYSGT C EFRK  +C RGD CE AHGVFESWLHP RYRT+ CKDG  C
Sbjct  135   EKARRRDPRRFHYSGTACPEFRKTARCERGDACELAHGVFESWLHPTRYRTQFCKDGTAC  194

Query  869   KRKVCFFAHSSRQLRILPVNRYSTGSLSP--VHDPAEKNLRKNLCCHSPTSTLMGISHS-  699
             +R+VCFFAH+  QLR+LP++  S         +D A   + K L   SP STL+  + S 
Sbjct  195   RRRVCFFAHTPDQLRVLPLSPRSPPPRPAPESYDGAPPRMSKIL-ISSPRSTLISPAMSP  253

Query  698   ---SPPLSPAKTPFCGYGMTAAKLIEMMSYK  615
                SPP+SP         +TA + +++   K
Sbjct  254   TAESPPVSPVGEAAMNEVLTAIRKLQLSKAK  284



>gb|EPS57796.1| hypothetical protein M569_17020, partial [Genlisea aurea]
Length=368

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 7/148 (5%)
 Frame = -1

Query  1205  VFQKFLPYN-------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
               Q+FLP N       + ED D   D +S D+FRM+EFKV++C  +RSHDWT CPFAHPG
Sbjct  57    ALQRFLPSNSDDAFVAEGEDFDVPVDAFSCDNFRMFEFKVKKCALARSHDWTACPFAHPG  116

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRK HYSGT C EFRKG C RGD CE++HGVFE WLHPARYRT+ CKDG +C+
Sbjct  117   EKARRRDPRKCHYSGTACPEFRKGACKRGDACEYSHGVFECWLHPARYRTQPCKDGTHCR  176

Query  866   RKVCFFAHSSRQLRILPVNRYSTGSLSP  783
             R+VCFFAH+  QLR+LP +  ++   SP
Sbjct  177   RRVCFFAHTPEQLRVLPYSSAASPEASP  204



>gb|ACO54858.1| zinc finger protein ZF3 [Cicer arietinum]
Length=385

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 135/210 (64%), Gaps = 18/210 (9%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDED--------EDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q ++P N+ +D+         E  D YS D+FRM+EFK+RRC R RSHDWT+CP+AHP
Sbjct  52    ALQHYIPSNEHDDDSDSDAIPSHESVDVYSCDNFRMFEFKIRRCARGRSHDWTECPYAHP  111

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRK+HYSGT C +FRKG   +GD+CEFAHGVFE WLHPARYRT+ CKDG +C
Sbjct  112   GEKARRRDPRKYHYSGTACPDFRKGSSKKGDSCEFAHGVFECWLHPARYRTQPCKDGTSC  171

Query  869   KRKVCFFAHSSRQLRI------LPVNRYSTGSLSPVHDPAEKNLRKNL-CCHSPTSTLMG  711
             +R+VCFFAH+S QLR         VN   +   SP+    E +  K+L    SP S    
Sbjct  172   RRRVCFFAHTSEQLRTPTQQSPRSVNSTDSYDGSPLRLAIESSCVKSLPFMSSPGSVSPP  231

Query  710   ISHSSPPLSPAKTPFC-GYGMTAAKLIEMM  624
             +   SPP+SP  +     +G  +  + EM+
Sbjct  232   V--ESPPMSPLTSSLGRSFGFGSVNVNEMV  259



>ref|XP_007223349.1| hypothetical protein PRUPE_ppa007432mg [Prunus persica]
 gb|EMJ24548.1| hypothetical protein PRUPE_ppa007432mg [Prunus persica]
Length=368

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDVEDEDEDGDR----YSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS   +      ++LP N+ +   +D D      S D FRM+EFKVRRC R RSHDWT
Sbjct  55    FLDSLAAL-----HRYLPSNESDSLGDDPDMPMNPISCDQFRMFEFKVRRCARGRSHDWT  109

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDPRK+HYSG  C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  110   ECPYAHPGEKARRRDPRKYHYSGAACPEFRKGHCAKGDSCEFAHGVFECWLHPARYRTQP  169

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C R+VCFFAH+  QLR+LP
Sbjct  170   CKDGLGCHRRVCFFAHTPEQLRVLP  194



>ref|XP_009361457.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Pyrus x bretschneideri]
Length=373

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYND----VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS   +      ++LP N+     ED D   +  S D FRM+EFKVRRC R RSHDWT
Sbjct  56    FLDSLAAL-----HRYLPSNESDSLAEDPDIPMNPISCDQFRMFEFKVRRCARGRSHDWT  110

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             DCP+AHPGEKARRRDPRK+HYSG  C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  111   DCPYAHPGEKARRRDPRKYHYSGAACPDFRKGHCPKGDSCEFAHGVFECWLHPARYRTQP  170

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C R+VCFFAH+  QLR+LP
Sbjct  171   CKDGLGCNRRVCFFAHTPEQLRVLP  195



>ref|XP_003564747.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Brachypodium distachyon]
Length=385

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             Y  D FRMY+FKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG C 
Sbjct  74    YGGDEFRMYDFKVRRCVRGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGGCK  133

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RGD CE+AHGVFE WLHPARYRT+ACKDG  C+R+VCFFAH+  QLR +P  ++S+   +
Sbjct  134   RGDACEYAHGVFECWLHPARYRTQACKDGTACRRRVCFFAHTREQLREMPAPQHSSPRST  193

Query  785   PVHDPAEKN----LR----------KNLCCHSPTSTLM  714
             P+   AE      LR          K +   SPTST +
Sbjct  194   PLSPLAESYDGSPLRRQVFESYLNNKGIVSSSPTSTYL  231



>gb|ABK92961.1| unknown [Populus trichocarpa]
Length=384

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 10/145 (7%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYND----VEDE-DEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             LDS T +      ++LP N+     EDE D   D +S DHFRMY FKVRRC R RSHDWT
Sbjct  46    LDSLTAL-----HRYLPSNEPDPSFEDELDLPVDAFSCDHFRMYVFKVRRCGRGRSHDWT  100

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDP+++HYSGT C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  101   ECPYAHPGEKARRRDPQRYHYSGTACPEFRKGGCKKGDSCEFAHGVFECWLHPARYRTQP  160

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  161   CKDGPACRRRVCFFAHTPEQLRLLP  185



>ref|XP_002324748.2| hypothetical protein POPTR_0018s04720g [Populus trichocarpa]
 gb|EEF03313.2| hypothetical protein POPTR_0018s04720g [Populus trichocarpa]
Length=384

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 10/145 (7%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYND----VEDE-DEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             LDS T +      ++LP N+     EDE D   D +S DHFRMY FKVRRC R RSHDWT
Sbjct  46    LDSLTAL-----HRYLPSNEPDPSFEDELDLPVDAFSCDHFRMYVFKVRRCGRGRSHDWT  100

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDP+++HYSGT C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  101   ECPYAHPGEKARRRDPQRYHYSGTACPEFRKGGCKKGDSCEFAHGVFECWLHPARYRTQP  160

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  161   CKDGPACRRRVCFFAHTPEQLRLLP  185



>gb|AAM65505.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
Length=315

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D +S+D FR+YEFK+RRC R RSHDWT+CPFAHPGEKARRRDPRKFHYSGT C EFRKG 
Sbjct  84    DSFSSDEFRIYEFKIRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYSGTACPEFRKGS  143

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVN  810
             C RG +CEF+HGVFE WLHP+RYRT+ CKDG +C+R++CFFAH++ QLR+LP +
Sbjct  144   CRRGHSCEFSHGVFECWLHPSRYRTQPCKDGTSCRRRICFFAHTTEQLRVLPCS  197



>ref|XP_010049593.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Eucalyptus grandis]
 gb|KCW82283.1| hypothetical protein EUGRSUZ_C03701 [Eucalyptus grandis]
Length=384

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 113/164 (69%), Gaps = 18/164 (11%)
 Frame = -1

Query  1256  AAEADGFLDSPTKIEGGVFQ-------KFLPYNDVE-DEDEDG----------DRYSADH  1131
             A    G   SP+    G FQ       +FLP N  + D D D           D YS D+
Sbjct  42    AGYGGGCDSSPSAAGPGHFQDVMAALRRFLPSNRPDTDPDPDMTSSREADFPMDVYSCDN  101

Query  1130  FRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNC  951
             FRMYEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EFRKG C +GD C
Sbjct  102   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEFRKGSCRKGDAC  161

Query  950   EFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL  819
             EFAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR++
Sbjct  162   EFAHGVFECWLHPARYRTQPCKDGAGCRRRVCFFAHTPEQLRVV  205



>ref|XP_009137834.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Brassica 
rapa]
Length=366

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 115/166 (69%), Gaps = 23/166 (14%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE-DEDED-------GDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAH  1053
                Q++LP N+ + D D D        D YS DHFRMY+FKVRRC R RSHDWT+CP+AH
Sbjct  63    AALQRYLPSNEPDPDSDPDLFGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAH  122

Query  1052  PGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             PGEKARRRDP K++YSGT C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ CKDG N
Sbjct  123   PGEKARRRDPAKYNYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGN  182

Query  872   CKRKVCFFAHSSRQLRIL---------------PVNRYSTGSLSPV  780
             C+R+VCFFAHS  QLR L               PV R    S+SPV
Sbjct  183   CRRRVCFFAHSPDQLRCLHNRSPDRVDSFDVSSPVRRAFQLSVSPV  228



>ref|XP_009372717.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Pyrus x bretschneideri]
Length=500

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 128/291 (44%), Positives = 162/291 (56%), Gaps = 37/291 (13%)
 Frame = -1

Query  1205  VFQKFLPYNDVE---DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
               Q +LP N+ +   D D  G       D YS DH RM+EFKVRRC R  SHDWT+CP+A
Sbjct  60    TLQCYLPSNETDLDSDSDISGRESDAPIDAYSCDHVRMFEFKVRRCARGPSHDWTECPYA  119

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGEKARRRDPRK+HYSGT C +FRKG C +GD CEFAHGVFE WLHP+RYRT+ CKDG 
Sbjct  120   HPGEKARRRDPRKYHYSGTGCPDFRKGHCKKGDACEFAHGVFEYWLHPSRYRTQPCKDGT  179

Query  875   NCKRKVCFFAHSSRQLRILPVN--RYSTGSLSPVHDPAEKNLRKNL--CCHSPTSTLMGI  708
             +CKR+VCFFAH+  QLR+LP    R    SL+         LR+ +     S   T+  +
Sbjct  180   SCKRRVCFFAHTPEQLRVLPQQSPRGGGNSLNEAESYEGSPLRQAMEAAAASCVKTMPFV  239

Query  707   S---HSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNL-------NPLS  558
             S     SPP+SP   P  G G     +    + +    +  +S   V         +P+S
Sbjct  240   SSRPEESPPVSPMSGPL-GLGSINEMVASRRNLQFGKVKSFSSSRNVRTGGSSGFGSPVS  298

Query  557   PA-TTTINRMTRP-FSGNDPIQFSLPNSPS-TPGRHSSGSEFLTPQRNTAF  414
             P   +    M RP FS       SLP++P+  P R  SG  +L  Q+  A 
Sbjct  299   PGFGSPCGSMVRPEFS-------SLPSTPTRVPSR--SGISYLPRQQEEAL  340



>ref|NP_001146853.1| nucleic acid binding protein [Zea mays]
 gb|ACG23956.1| nucleic acid binding protein [Zea mays]
 tpg|DAA53030.1| TPA: nucleic acid binding protein [Zea mays]
Length=370

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 112/160 (70%), Gaps = 16/160 (10%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y  D FRMYEFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRK+HYSG  C +FRKG 
Sbjct  66    DGYGCDEFRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDFRKGG  125

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C RGD C+ AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH++ QLR+LP       S
Sbjct  126   CKRGDGCDMAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTADQLRVLPPTPQQQSS  185

Query  791   ---------LSPVHDPA-------EKNLRKNLCCHSPTST  720
                      L+  +D +       E  L K++ C SPTST
Sbjct  186   PRGAACSSPLAESYDGSPLRRQAFESYLTKSIMCSSPTST  225



>ref|XP_002878901.1| hypothetical protein ARALYDRAFT_481444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55160.1| hypothetical protein ARALYDRAFT_481444 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  1136  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGD  957
             D FRMYEFK+RRC R RSHDWT+CPFAHPGEKARRRDPRKFHY+GT C EFRKG C RGD
Sbjct  89    DEFRMYEFKIRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYAGTACPEFRKGSCRRGD  148

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             +CEFAHGVFE WLHP+RYRT+ CKDG +C+R++CFFAH++ QLR+LP
Sbjct  149   SCEFAHGVFECWLHPSRYRTQPCKDGTSCRRRICFFAHTTEQLRVLP  195



>gb|AGT16143.1| nucleic acid binding protein [Saccharum hybrid cultivar R570]
Length=387

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             Y  D FRMYEFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG C 
Sbjct  72    YGCDEFRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGGCK  131

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             RGDNC+ AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP  ++   S
Sbjct  132   RGDNCDLAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPTTQHQQSS  189



>ref|XP_010049147.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 2 [Eucalyptus grandis]
Length=415

 Score =   202 bits (515),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 112/149 (75%), Gaps = 8/149 (5%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDGD--------RYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               ++FLP N  +DE+++ D            D FRMYEFKVR+C R RSHDWT+CP+AHP
Sbjct  72    ALRRFLPSNHHQDEEDEEDGRAPGEDGVLGCDEFRMYEFKVRKCARGRSHDWTECPYAHP  131

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPR+F YSGT C +FRKG C +GD+CEFAHGVFE WLHP RYRT+ACKDG++C
Sbjct  132   GEKARRRDPRRFFYSGTACPDFRKGACKKGDSCEFAHGVFECWLHPERYRTQACKDGQSC  191

Query  869   KRKVCFFAHSSRQLRILPVNRYSTGSLSP  783
             +R+VCFFAHS  QLR+LP ++      SP
Sbjct  192   RRRVCFFAHSPDQLRVLPAHQQQQQQHSP  220



>ref|XP_010097108.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
 gb|EXB66909.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
Length=347

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 6/126 (5%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D +S DHFRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRK HYSGT C+EFRKG 
Sbjct  89    DAFSCDHFRMFEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKHHYSGTACAEFRKGN  148

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL-----PVNR  807
             C +GD+CEFAHGVFE WLHP RYRT+ CKDG +C+R+VCFFAH+  QLR+L     PV R
Sbjct  149   CKKGDSCEFAHGVFECWLHPGRYRTQPCKDGLSCRRRVCFFAHTPEQLRVLSPTDSPV-R  207

Query  806   YSTGSL  789
              S GS 
Sbjct  208   LSNGSF  213



>ref|XP_009337135.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Pyrus x bretschneideri]
Length=372

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYND----VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS   +      ++LP N+     ED D   +  S D FRM+EFKVRRC   RSHDWT
Sbjct  59    FLDSLAAL-----HRYLPSNESDSLAEDPDMPMNPISCDQFRMFEFKVRRCAHGRSHDWT  113

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             DCP+AHPGEKARRRDPRK+HYSG  C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  114   DCPYAHPGEKARRRDPRKYHYSGAACPDFRKGHCPKGDSCEFAHGVFECWLHPARYRTQP  173

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C R+VCFFAH+  QLR+LP
Sbjct  174   CKDGLRCNRRVCFFAHTPEQLRVLP  198



>ref|XP_009610482.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana tomentosiformis]
Length=352

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 106/138 (77%), Gaps = 6/138 (4%)
 Frame = -1

Query  1205  VFQKFLPYN------DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGE  1044
                ++LP N      D +  D   D +S D+FRMYEFKVR+C R RSHDWT+CP+AHPGE
Sbjct  53    ALHRYLPSNANDVMFDSDGLDIPVDAFSCDNFRMYEFKVRKCARGRSHDWTECPYAHPGE  112

Query  1043  KARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKR  864
             KARRRDPRK+ YSGT C +FRKG C +GD CE+AHGVFE WLHPARYRT+ CKDG +C+R
Sbjct  113   KARRRDPRKYFYSGTACPDFRKGLCKKGDACEYAHGVFECWLHPARYRTQPCKDGTHCRR  172

Query  863   KVCFFAHSSRQLRILPVN  810
             +VCFFAH+  QLR+LP N
Sbjct  173   RVCFFAHTPEQLRVLPQN  190



>gb|ADL36656.1| C3HL domain class transcription factor [Malus domestica]
Length=369

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYND----VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS   +      ++LP N+     +D D   +  S D FRM+EFKVRRC R RSHDWT
Sbjct  56    FLDSLAAL-----HRYLPSNESDSLADDPDMPMNPISCDQFRMFEFKVRRCARGRSHDWT  110

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             DCP+AHPGEKARRRDPRK+HYSG  C +FRKG C +GD CEFAHGVFE WLHPARYRT+ 
Sbjct  111   DCPYAHPGEKARRRDPRKYHYSGAACPDFRKGHCPKGDLCEFAHGVFECWLHPARYRTQP  170

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C R+VCFFAH+  QLR+LP
Sbjct  171   CKDGLGCNRRVCFFAHTPEQLRVLP  195



>ref|XP_011012777.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Populus euphratica]
Length=387

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 112/145 (77%), Gaps = 10/145 (7%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYND----VEDE-DEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             LDS T +      ++LP N+     EDE D   D +S DHFRMY FKVRRC R RSHDWT
Sbjct  49    LDSLTAL-----HRYLPSNEPDPSFEDELDLPVDAFSCDHFRMYVFKVRRCGRGRSHDWT  103

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDP++++YSGT C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  104   ECPYAHPGEKARRRDPQRYNYSGTACPEFRKGGCKKGDSCEFAHGVFECWLHPARYRTQP  163

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  164   CKDGPACRRRVCFFAHTPEQLRVLP  188



>gb|AFW80253.1| hypothetical protein ZEAMMB73_899917 [Zea mays]
Length=296

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y  D FRMYEFKVRRC R+RSHDWT+CPFAHPGEKARRRDPR++HYSG  C +FRKG 
Sbjct  66    DGYGCDEFRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRRYHYSGAACPDFRKGG  125

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             C RGD C+FAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  126   CRRGDACDFAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLP  177



>ref|XP_009802285.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana sylvestris]
Length=343

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y+ D+FRM+EFKVR C R RSHDWT+CP+ HPGEKARRRDPRK+HYSGT C +FRKG 
Sbjct  64    DMYACDNFRMFEFKVRNCARGRSHDWTECPYLHPGEKARRRDPRKYHYSGTACPDFRKGN  123

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVN  810
             C RGD CEFAHGVFE WLHPARYRT+ CKDG NCKR+VCFFAHS+ QLR+L  N
Sbjct  124   CLRGDGCEFAHGVFECWLHPARYRTQPCKDGVNCKRRVCFFAHSADQLRVLSPN  177



>ref|XP_010526424.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Tarenaya hassleriana]
Length=341

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 152/270 (56%), Gaps = 39/270 (14%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDE--------DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               Q++LP N++  E        D   D YS DHFRMYEFKVR C   R+HDWT+CP+AHP
Sbjct  47    ALQRYLPSNELSPESDTDFPGPDSPVDVYSCDHFRMYEFKVRPCAHGRNHDWTECPYAHP  106

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPRK+HYSG  C +FRKG C +GD+CEFAHGVFE WLHP RYRT+ CKD  NC
Sbjct  107   GEKARRRDPRKYHYSGMACPDFRKGGCRKGDSCEFAHGVFECWLHPDRYRTQPCKDSGNC  166

Query  869   KRKVCFFAHSSRQLRILP------VNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGI  708
             +R+VCFFAHS   LRI+P      V+ +   S  P+     +  + +L   S + ++   
Sbjct  167   RRRVCFFAHSLDHLRIVPQQSPDRVDSFDGSSSPPIRHSCSRAFQFSLSPASSSPSVSPR  226

Query  707   SHSSPPLSPAKTPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMT  528
             + S                 + +L+   S   ++  +V SL  + LN +    ++ N   
Sbjct  227   ADSE----------------STQLLSRSSGSSSVNDVVASLRNLQLNKVKSLPSSWNTQV  270

Query  527   RPF-----SGNDPIQ----FSLPNSPSTPG  465
             R +     S  DP+     +SLP +P+ PG
Sbjct  271   RCYPSGLGSPRDPVVGLGFWSLPTTPTRPG  300



>emb|CDP08206.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D +S D FRM+EFKVRRC R+RSHDWT+CP+AHPGEKARRRDPRK+HYSG+ C +FRKG 
Sbjct  81    DAFSCDQFRMFEFKVRRCARARSHDWTECPYAHPGEKARRRDPRKYHYSGSACPDFRKGA  140

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C +GD+CEFAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP      GS
Sbjct  141   CKKGDSCEFAHGVFECWLHPARYRTQPCKDGTQCRRRVCFFAHTPDQLRVLPQTECYDGS  200

Query  791   LS  786
              S
Sbjct  201   PS  202



>gb|KEH21327.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=381

 Score =   199 bits (507),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 105/134 (78%), Gaps = 7/134 (5%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDED-------EDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPG  1047
              FQ ++  N+  D D       E  D YS DHFRM+EFK+RRC R RSHDWT+CPF+HPG
Sbjct  50    AFQHYVNENNDSDSDSEIFPTHESVDSYSNDHFRMFEFKIRRCARGRSHDWTECPFSHPG  109

Query  1046  EKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCK  867
             EKARRRDPRK++YSGT C +FRKG C +GD+CEFAHGVFE WLHP+RYRT+ CKDG +C+
Sbjct  110   EKARRRDPRKYNYSGTSCPDFRKGSCKKGDSCEFAHGVFECWLHPSRYRTQPCKDGTSCR  169

Query  866   RKVCFFAHSSRQLR  825
             R VCFFAH++ QLR
Sbjct  170   RPVCFFAHTTEQLR  183



>ref|XP_003568774.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Brachypodium distachyon]
Length=384

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = -1

Query  1205  VFQKFLPYN----DVEDEDEDG----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               + +LP+N    D +DE+ED     D Y+ D FRMYEFKVRRCTR RSHDWTDCPFAHP
Sbjct  40    ALRHYLPWNEPSGDAQDEEEDAVASADAYACDEFRMYEFKVRRCTRGRSHDWTDCPFAHP  99

Query  1049  GEKARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKN  873
             GEKARRRDPR++ YSG  C +FRK G C RGD CE AHGVFE WLHPARYRT+ CKDG  
Sbjct  100   GEKARRRDPRRYCYSGAACPDFRKGGACKRGDACEHAHGVFECWLHPARYRTQPCKDGTA  159

Query  872   CKRKVCFFAHSSRQLRILP  816
             C+R+VCFFAH+  QLR  P
Sbjct  160   CRRRVCFFAHTPEQLRSPP  178



>ref|XP_008655700.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Zea mays]
 gb|AFT82650.1| C3H47 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW80254.1| hypothetical protein ZEAMMB73_899917 [Zea mays]
 gb|AFW80255.1| hypothetical protein ZEAMMB73_899917 [Zea mays]
Length=378

 Score =   199 bits (505),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y  D FRMYEFKVRRC R+RSHDWT+CPFAHPGEKARRRDPR++HYSG  C +FRKG 
Sbjct  66    DGYGCDEFRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRRYHYSGAACPDFRKGG  125

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
             C RGD C+FAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP
Sbjct  126   CRRGDACDFAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLP  177



>gb|EYU30674.1| hypothetical protein MIMGU_mgv1a009490mg [Erythranthe guttata]
Length=340

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D ++ D+FRM+EFKVRRCTR RSHDWT+CPFAHPGEKARRRDPR+FHYSGT C +FRKG 
Sbjct  93    DAHTCDNFRMFEFKVRRCTRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTACPDFRKGN  152

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL  819
             C +GD CE+AHGVFE WLHPARYRT+ CKDG +CKR+VCFFAHS  QLR+L
Sbjct  153   CFKGDACEYAHGVFECWLHPARYRTQPCKDGMSCKRRVCFFAHSPDQLRVL  203



>ref|XP_008377933.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Malus domestica]
Length=372

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 106/145 (73%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYND----VEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS   +      ++LP N+     ED D   +  S D FRM+EFKVRRC   RSHDWT
Sbjct  59    FLDSLAAL-----HRYLPSNESDSLAEDPDMPMNPISCDQFRMFEFKVRRCAHGRSHDWT  113

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             DCP+AHPGEKARRRDPRK+HYSG  C +FRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  114   DCPYAHPGEKARRRDPRKYHYSGAACPDFRKGHCPKGDSCEFAHGVFECWLHPARYRTQP  173

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKD   C R+VCFFAH+  QLR+LP
Sbjct  174   CKDXLRCNRRVCFFAHTPEQLRVLP  198



>ref|XP_009620041.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Nicotiana 
tomentosiformis]
Length=364

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y+ D+FRM+EFKVR+C R RSHDWT+CP+ H GEKARRRDPRK+HYSGT C +FRKG 
Sbjct  90    DMYACDNFRMFEFKVRKCARGRSHDWTECPYLHHGEKARRRDPRKYHYSGTACPDFRKGN  149

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVN  810
             C RGD CEFAHGVFE WLHPARYRT+ CKDG NCKR+VCFFAHS+ QLR+L  N
Sbjct  150   CLRGDGCEFAHGVFECWLHPARYRTQPCKDGVNCKRRVCFFAHSADQLRVLSPN  203



>ref|XP_008220427.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Prunus 
mume]
Length=368

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 107/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  1238  FLDSPTKIEGGVFQKFLPYNDVEDEDEDGDR----YSADHFRMYEFKVRRCTRSRSHDWT  1071
             FLDS   +      ++LP N+ +   +D D      S D FRM+EFKVRRC R RSHD T
Sbjct  55    FLDSLAAL-----HRYLPSNESDSLGDDPDMPMNPISCDQFRMFEFKVRRCARGRSHDCT  109

Query  1070  DCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEA  891
             +CP+AHPGEKARRRDPRK+HYSG  C EFRKG C +GD+CEFAHGVFE WLHPARYRT+ 
Sbjct  110   ECPYAHPGEKARRRDPRKYHYSGAACPEFRKGHCAKGDSCEFAHGVFECWLHPARYRTQP  169

Query  890   CKDGKNCKRKVCFFAHSSRQLRILP  816
             CKDG  C R+VCFFAH+  QLR+LP
Sbjct  170   CKDGLGCHRRVCFFAHTPEQLRVLP  194



>gb|EAY96854.1| hypothetical protein OsI_18775 [Oryza sativa Indica Group]
Length=404

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 115/168 (68%), Gaps = 25/168 (15%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             Y+ D FRMYEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++ YSGT C +FRKG C 
Sbjct  73    YACDEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRRYCYSGTACPDFRKGGCK  132

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RGD CEFAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP ++   GS S
Sbjct  133   RGDACEFAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPPSQ-QQGSNS  191

Query  785   P-----------------VHDPA-------EKNLRKNLCCHSPTSTLM  714
             P                  +D +       E  L K++   SPTSTL+
Sbjct  192   PRGCGGGGAGAAASPLAESYDGSPLRRQAFESYLTKSIMSSSPTSTLV  239



>ref|NP_001054861.1| Os05g0195200 [Oryza sativa Japonica Group]
 sp|Q6L4N4.1|C3H35_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 35; 
Short=OsC3H35; AltName: Full=Protein DELAY OF THE ONSET OF SENESCENCE-like 
[Oryza sativa Japonica Group]
 gb|AAT38071.1| putative zinc finger transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF16775.1| Os05g0195200 [Oryza sativa Japonica Group]
Length=402

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 115/168 (68%), Gaps = 25/168 (15%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             Y+ D FRMYEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++ YSGT C +FRKG C 
Sbjct  73    YACDEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRRYCYSGTACPDFRKGGCK  132

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RGD CEFAHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR+LP ++   GS S
Sbjct  133   RGDACEFAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPPSQ-QQGSNS  191

Query  785   P-----------------VHDPA-------EKNLRKNLCCHSPTSTLM  714
             P                  +D +       E  L K++   SPTSTL+
Sbjct  192   PRGCGGGGAGAAASPLAESYDGSPLRRQAFESYLTKSIMSSSPTSTLV  239



>emb|CDM81668.1| unnamed protein product [Triticum aestivum]
Length=387

 Score =   197 bits (500),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 2/126 (2%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             Y+ D FRMY+FKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG C 
Sbjct  73    YACDEFRMYDFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGGCK  132

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS--  792
             RGD CE+AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR +P    S  S  
Sbjct  133   RGDACEYAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRAMPSQHSSPRSTP  192

Query  791   LSPVHD  774
             LSP+ +
Sbjct  193   LSPLAE  198



>ref|XP_009409364.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=371

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 125/211 (59%), Gaps = 19/211 (9%)
 Frame = -1

Query  1259  GAAEADGFLDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSH  1080
             G A  DG LD  T     ++         E+     D Y++D FRMYEFKVRRC R R+H
Sbjct  40    GVATGDGLLDEATLAALQLYLGCEEEAAAEEAPAVVDAYASDEFRMYEFKVRRCARGRTH  99

Query  1079  DWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARY  903
             DWT+CP AHPGEKARRRDPRK  YSGT C++FRK G C RGD CE AHGVFE WLHP RY
Sbjct  100   DWTECPLAHPGEKARRRDPRKHRYSGTPCADFRKTGGCKRGDACELAHGVFECWLHPERY  159

Query  902   RTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYST-------------GSLSPVHDPAEK  762
             RT+ CKD   C+R+VCFFAH+  QLR+LP     T             GS        + 
Sbjct  160   RTQPCKDSTACRRRVCFFAHTPDQLRVLPSQHQQTTTSASATAVESYDGSPLRQQSSMQS  219

Query  761   NLRKNLCCHSPTSTLMG----ISHSSPPLSP  681
              L KN  C S T+TL+      + +SPP+SP
Sbjct  220   YLSKNFVC-STTATLISPPKTPTTASPPISP  249



>ref|XP_009385782.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Musa acuminata subsp. malaccensis]
Length=377

 Score =   196 bits (498),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 151/262 (58%), Gaps = 31/262 (12%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D Y++D FRMYEFKVRRC R R+HDWT+CPFAHPGEKARRRDPRK  YSGT C +FRK  
Sbjct  77    DAYASDEFRMYEFKVRRCARGRAHDWTECPFAHPGEKARRRDPRKHRYSGTSCPDFRKTT  136

Query  971   -CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP----VNR  807
              C RGD CE AHGVFE WLHP RYRT+ CKDG  C+R+VCFFAH+  QLR++P     N 
Sbjct  137   GCKRGDACELAHGVFECWLHPDRYRTQPCKDGTTCRRRVCFFAHTPDQLRVVPPQHRKNS  196

Query  806   YSTGSLSPVHD--PAEKN------LRKNLCCHSPTSTLMGISHSSPPLSPAKTPFCGYGM  651
              ST + +  +D  P  ++      L KN+   SPTSTL+   +S P  SP  +P      
Sbjct  197   PSTATAADSYDGSPPRRHSSLHSYLPKNIAA-SPTSTLISPPNSPPTESPPISP------  249

Query  650   TAAKLIEMMSYK-EALTQLVNSLEQVNLNPLSPATTTINRMT----------RPFSGNDP  504
               AKL     +   ++ ++V SL Q+ L+    A  +                 F+G + 
Sbjct  250   DGAKLRRGSWHAGSSVNEIVASLRQLQLSRAESAPISWGSRVGSVGFASPRGASFAGFNA  309

Query  503   IQFSLPNSPSTPGRHSSGSEFL  438
                 LP++P+ P      S +L
Sbjct  310   GFCGLPSTPTAPAMTCGDSRWL  331



>gb|KHN27902.1| Zinc finger CCCH domain-containing protein 2 [Glycine soja]
Length=362

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 193/404 (48%), Gaps = 113/404 (28%)
 Frame = -1

Query  1361  MTSVCEFQNISYPFYL----KKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGVFQK  1194
             M+SVC  Q+  YP +     KK + E+D+ PRK+L+RR AA   G        E  + QK
Sbjct  1     MSSVCAKQHKFYPSHQLLSPKKTLREIDIPPRKLLTRRAAACVGG--TDVYSSEETMLQK  58

Query  1193  FLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKF  1014
             FLP ND    DED D YS+DHFRM+EFKVR+CTR                          
Sbjct  59    FLPSND---SDED-DPYSSDHFRMFEFKVRQCTR--------------------------  88

Query  1013  HYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSR  834
                 TVC E+R+G C R D CE+AHGVFE WLHP+RYRTEACKDG+NCKRKVCFFAH+ R
Sbjct  89    ----TVCPEYRRGGCSRDDACEYAHGVFECWLHPSRYRTEACKDGRNCKRKVCFFAHTPR  144

Query  833   QLRILPVNRYSTGSLSPVHDPAEKNLRKNL-------------CCH----------SPTS  723
             QLRILPV   +T S S    P +KNL K L             CC           SPTS
Sbjct  145   QLRILPV---TTSSPSSNDMPCKKNLNKLLNHASKSNNNNNNNCCLFCHCGASSSVSPTS  201

Query  722   TLMGISH----------------------SSPPLSPAKTPFCGYGMTAAKLIEMMSYKEA  609
             TL G+SH                         P+SP  + +    M     +  +SYK+ 
Sbjct  202   TLFGMSHFSPPVSPSSSSSPPPSPLKPRSVVSPISPI-SRYSAVNMNPHHGV--VSYKDM  258

Query  608   LTQLVNSLEQVNLNPLSPAT--TTINRMTRPFSGNDPIQFSLPNSPSTPGRHSSGSEFL-  438
               +LVNSLE ++ N  SP +     N      S  +  Q   P   S+ G     ++F+ 
Sbjct  259   FAELVNSLEGLSFNEGSPVSGAKAPNFPWLDVSLEEQQQQQNPFIVSSFGCEDKQNQFIF  318

Query  437   ------TPQRNTAFSDN----------GG--LTGIDLDWVNDLL  360
                   TP  N  F  N          GG  + G DL WVN+LL
Sbjct  319   SPPSIQTPT-NGKFCRNRFMGNDNKVVGGADVNGPDLAWVNELL  361



>gb|KFK32533.1| hypothetical protein AALP_AA6G255600 [Arabis alpina]
Length=291

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 115/163 (71%), Gaps = 10/163 (6%)
 Frame = -1

Query  1196  KFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRK  1017
             ++LP ND      + D    D FRMYEFKVRRCTR RSHDW +CPFAH GEKARRRDPRK
Sbjct  44    RYLPSND-----SNSDESVLDSFRMYEFKVRRCTRGRSHDWCECPFAHQGEKARRRDPRK  98

Query  1016  FHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSS  837
             +HYSGT C EFRKG C +GD+CEF+HGVFE WLHP RYRT+ CKDG +CKR++CFFAH+ 
Sbjct  99    YHYSGTSCPEFRKGVCRKGDSCEFSHGVFECWLHPDRYRTQPCKDGTSCKRRICFFAHTH  158

Query  836   RQLRI-LPVNRYSTGSLSPVHDPAEKNLRK-NLCCHSPTSTLM  714
              QLR+ L ++    G +    +  E  L K  +   SPTS L+
Sbjct  159   EQLRVDLDLD---LGGIDSFRNRFESRLSKLVIASTSPTSILV  198



>dbj|BAJ85837.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95980.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88325.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -1

Query  1136  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGD  957
             D FRMY+FKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +FRKG C RGD
Sbjct  69    DEFRMYDFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDFRKGGCKRGD  128

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS--LSP  783
              CE+AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH+  QLR +P    S  S  LSP
Sbjct  129   ACEYAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRAMPSQHSSPRSTPLSP  188

Query  782   VHD  774
             + +
Sbjct  189   LAE  191



>ref|XP_006855265.1| hypothetical protein AMTR_s00183p00052730 [Amborella trichopoda]
 gb|ERN16732.1| hypothetical protein AMTR_s00183p00052730 [Amborella trichopoda]
Length=361

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = -1

Query  1172  EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVC  993
             ++ED+  D Y++D FRM++FKV++C R RSHDWT+CPFAHPGEKARRRDPR+FHYSG VC
Sbjct  66    DEEDDFMDPYASDAFRMFDFKVKKCARGRSHDWTECPFAHPGEKARRRDPRRFHYSGVVC  125

Query  992   SEFRKGK-CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
              +FRKG  C RG+ CEFAHGVFE WLHPARYRT+ CKDG++C R++CFFAH+  QLR+LP
Sbjct  126   PDFRKGSGCRRGEACEFAHGVFECWLHPARYRTQPCKDGRSCTRRICFFAHTPAQLRVLP  185



>gb|KCW79588.1| hypothetical protein EUGRSUZ_C00948 [Eucalyptus grandis]
Length=317

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = -1

Query  1169  DEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYS  1005
             D D DG     D Y++DHFRMYEFKVRRC R +SHDWT+CP+AHPGEKARRRDPR+  YS
Sbjct  67    DPDSDGPDSPVDLYTSDHFRMYEFKVRRCARGKSHDWTECPYAHPGEKARRRDPRRHGYS  126

Query  1004  GTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLR  825
             G  C +FR G C +GD CE AHGVFE WLHP+RYRT+ CKDG NC R+VCFFAH+  QLR
Sbjct  127   GAACPDFRSGHCPKGDACELAHGVFECWLHPSRYRTQPCKDGLNCSRRVCFFAHTPEQLR  186

Query  824   ILPVNRYSTGSL  789
             ++P  + S  S+
Sbjct  187   VVPGQQQSPRSV  198



>gb|EYU29305.1| hypothetical protein MIMGU_mgv1a008957mg [Erythranthe guttata]
Length=357

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = -1

Query  1151  DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGK  972
             D +S D+FRM+EFKV++C  +RSHDWT+CPFAHPGEKARRRDPR++HYSG+ C +FR+G+
Sbjct  75    DAFSCDNFRMFEFKVKKCALARSHDWTECPFAHPGEKARRRDPRRYHYSGSACPDFRRGE  134

Query  971   CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS  792
             C RGD CE+AHGVFESWLHPARYRT  CKDG +C R+VCFFAH+  QLR+L  +  ++  
Sbjct  135   CRRGDACEYAHGVFESWLHPARYRTLPCKDGTHCHRRVCFFAHTPDQLRVL-THSATSPE  193

Query  791   LSPVHDPAEKNLRKNLCCHSPTSTL---MGISHSSPPLSPAKTPFCGYGMTAAKLIEM  627
              SP     +      +   SP STL   +  +  SPP+SP         M   +L +M
Sbjct  194   ASPSRIGHDSLSAMPMFGSSPKSTLFSPLSPTTGSPPVSPNSVNQLAESMRYMQLNKM  251



>ref|XP_009109049.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Brassica rapa]
Length=352

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -1

Query  1163  DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEF  984
             D   D YS DHFRMY+FKV RC+R RSHDWT+CP+AHPGEKARRRDP K++YSGT C EF
Sbjct  68    DSPVDAYSCDHFRMYDFKVLRCSRGRSHDWTECPYAHPGEKARRRDPTKYNYSGTACPEF  127

Query  983   RKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL  819
             RKG C +GD+CEFAHGVFE WLHP+RYRT+ CKDG  C+RKVCFFAHS  QLR +
Sbjct  128   RKGGCKKGDSCEFAHGVFECWLHPSRYRTQPCKDGGGCRRKVCFFAHSPEQLRYV  182



>gb|ACF82790.1| unknown [Zea mays]
Length=296

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 107/151 (71%), Gaps = 16/151 (11%)
 Frame = -1

Query  1124  MYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEF  945
             MYEFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRK+HYSG  C +FRKG C RGD C+ 
Sbjct  1     MYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDFRKGGCKRGDGCDM  60

Query  944   AHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGS---------  792
             AHGVFE WLHPARYRT+ CKDG  C+R+VCFFAH++ QLR+LP       S         
Sbjct  61    AHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTADQLRVLPPTPQQQSSPRGAACSSP  120

Query  791   LSPVHDPA-------EKNLRKNLCCHSPTST  720
             L+  +D +       E  L K++ C SPTST
Sbjct  121   LAESYDGSPLRRQAFESYLTKSIMCSSPTST  151



>ref|XP_010047645.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Eucalyptus 
grandis]
Length=336

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = -1

Query  1169  DEDEDG-----DRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYS  1005
             D D DG     D Y++DHFRMYEFKVRRC R +SHDWT+CP+AHPGEKARRRDPR+  YS
Sbjct  67    DPDSDGPDSPVDLYTSDHFRMYEFKVRRCARGKSHDWTECPYAHPGEKARRRDPRRHGYS  126

Query  1004  GTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLR  825
             G  C +FR G C +GD CE AHGVFE WLHP+RYRT+ CKDG NC R+VCFFAH+  QLR
Sbjct  127   GAACPDFRSGHCPKGDACELAHGVFECWLHPSRYRTQPCKDGLNCSRRVCFFAHTPEQLR  186

Query  824   ILPVNRYSTGSL  789
             ++P  + S  S+
Sbjct  187   VVPGQQQSPRSV  198



>gb|EPS73621.1| hypothetical protein M569_01136, partial [Genlisea aurea]
Length=299

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 111/156 (71%), Gaps = 16/156 (10%)
 Frame = -1

Query  1229  SPTKIEGGVF---QKFLPYN--DVEDEDEDG-----------DRYSADHFRMYEFKVRRC  1098
             SP  +  G F   Q++LP N  DV  E+  G           D +S D FRM+EFKV+ C
Sbjct  40    SPDSVCDGAFSALQRYLPSNKDDVAAEEGGGEIDGDDFGIPVDAFSCDDFRMFEFKVKGC  99

Query  1097  TRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWL  918
              R++SHDWT+CPF H GEKARRRDPR++ YSG+ C +FRKG C RGD CE+AHGVFE WL
Sbjct  100   ARAKSHDWTECPFVHHGEKARRRDPRRYKYSGSACPDFRKGACARGDACEYAHGVFECWL  159

Query  917   HPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVN  810
             HPARYRT+ CKDG +C+R+VCFFAHS  QLRIL V+
Sbjct  160   HPARYRTQICKDGTHCRRRVCFFAHSPDQLRILAVD  195



>ref|XP_001417127.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95420.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=556

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = -1

Query  1166  EDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSE  987
             +D D D   +D FRMYEFK+RRC+R+R+HDWT+CP+ HPGEKARRRDPR+F+Y GT C E
Sbjct  179   QDPDDDTLMSDEFRMYEFKIRRCSRTRAHDWTECPYTHPGEKARRRDPRRFNYCGTACPE  238

Query  986   FRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNR  807
             FRKG C +GD CE+AHGVFE WLHP+RYRT+ CKDG  C R+ CFFAH + QLR+ P + 
Sbjct  239   FRKGSCPQGDVCEYAHGVFECWLHPSRYRTQLCKDGAACDRRACFFAHHTSQLRV-PTDA  297

Query  806   YS--TGSLSP  783
             Y   TG+LSP
Sbjct  298   YGNPTGNLSP  307



>gb|KCW81630.1| hypothetical protein EUGRSUZ_C02990 [Eucalyptus grandis]
Length=355

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 8/134 (6%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDGD--------RYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHP  1050
               ++FLP N  +DE+++ D            D FRMYEFKVR+C R RSHDWT+CP+AHP
Sbjct  72    ALRRFLPSNHHQDEEDEEDGRAPGEDGVLGCDEFRMYEFKVRKCARGRSHDWTECPYAHP  131

Query  1049  GEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNC  870
             GEKARRRDPR+F YSGT C +FRKG C +GD+CEFAHGVFE WLHP RYRT+ACKDG++C
Sbjct  132   GEKARRRDPRRFFYSGTACPDFRKGACKKGDSCEFAHGVFECWLHPERYRTQACKDGQSC  191

Query  869   KRKVCFFAHSSRQL  828
             +R+VCFFAHS  QL
Sbjct  192   RRRVCFFAHSPDQL  205



>ref|XP_003522232.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=233

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             +S+DHFRM++FKVR C R RSHDWT+CP+AHP EKARRRDPRK+HYSGT C ++RKG C 
Sbjct  32    FSSDHFRMFQFKVRNCPRGRSHDWTECPYAHPAEKARRRDPRKYHYSGTSCPDYRKGNCK  91

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLR  825
             RGD C+FAHGVFE WLHP+RYRT+ CKDG NC+R+VCFFAH+S QLR
Sbjct  92    RGDTCQFAHGVFECWLHPSRYRTQLCKDGTNCRRRVCFFAHTSDQLR  138



>ref|XP_004141037.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 20-like [Cucumis sativus]
Length=375

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 150/228 (66%), Gaps = 22/228 (10%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE---DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
              + +++LP N+ E   D D  G       D YS+D FRMYEFK+++CTR RSHDWT+CPF
Sbjct  46    AMLKRYLPSNEAEMDSDIDVSGKEIDSPLDAYSSDQFRMYEFKIKKCTRGRSHDWTECPF  105

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPR+++YSGT C++FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  106   AHPGEKARRRDPRRYYYSGTACADFRKGSCVKGDACEFAHGVFECWLHPARYRTQPCKDG  165

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS  699
              +C+R+VCFFAH+  QLR+LP     + S  P +D +   LR+ +   +     +    +
Sbjct  166   TSCRRRVCFFAHTPEQLRVLPQQSPRSTSSIPSYDGSP--LRQAIEACAKQMPYLSSPGT  223

Query  698   SPPLSP-AKTPFCGYGMTAAKLIEMMSYKEA---LTQLVNSLEQVNLN  567
             SPP+SP  ++P        + +I+ ++   A   + ++V SL  + LN
Sbjct  224   SPPVSPRIESP------PQSPIIKSLNRPHAPSSIKEMVASLRNLQLN  265



>ref|XP_004157905.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 2 [Cucumis sativus]
Length=378

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 150/228 (66%), Gaps = 22/228 (10%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE---DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
              + +++LP N+ E   D D  G       D YS+D FRMYEFK+++CTR RSHDWT+CPF
Sbjct  46    AMLKRYLPSNEAEMDSDIDVSGKEIDSPLDAYSSDQFRMYEFKIKKCTRGRSHDWTECPF  105

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPR+++YSGT C++FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  106   AHPGEKARRRDPRRYYYSGTACADFRKGSCVKGDACEFAHGVFECWLHPARYRTQPCKDG  165

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS  699
              +C+R+VCFFAH+  QLR+LP     + S  P +D +   LR+ +   +     +    +
Sbjct  166   TSCRRRVCFFAHTPEQLRVLPQQSPRSTSSIPSYDGSP--LRQAIEACAKQMPYLSSPGT  223

Query  698   SPPLSP-AKTPFCGYGMTAAKLIEMMSYKEA---LTQLVNSLEQVNLN  567
             SPP+SP  ++P        + +I+ ++   A   + ++V SL  + LN
Sbjct  224   SPPVSPRIESP------PQSPIIKSLNRPHAPSSIKEMVASLRNLQLN  265



>ref|XP_009395218.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Musa acuminata subsp. malaccensis]
Length=293

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 117/181 (65%), Gaps = 18/181 (10%)
 Frame = -1

Query  1205  VFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  1026
               Q FL      D D   D Y+ D FRMYEFKVRRC R R HDWT+CP+AH GEKARRRD
Sbjct  44    AMQHFL-LGSSADLDLAADEYACDEFRMYEFKVRRCPRGRVHDWTECPYAHSGEKARRRD  102

Query  1025  PRKFHYSGTVCSEFRK-GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFF  849
             PR+F YSG+ C +FR+ G C  GD C+ AHGVFE+WLHPARYRT+ CKDG  C R+VCFF
Sbjct  103   PRRFQYSGSPCPDFRRGGGCRLGDACDLAHGVFETWLHPARYRTQPCKDGTACSRRVCFF  162

Query  848   AHSSRQLRI-LPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGI---SHSSPPLSP  681
             AH+  QLRI LP +  S+G +         N+       SPTSTL  +   S  SPPLSP
Sbjct  163   AHTPEQLRIVLPPSPTSSGKIG-------VNMFS-----SPTSTLALLSSPSDGSPPLSP  210

Query  680   A  678
              
Sbjct  211   V  211



>gb|ACN34007.1| unknown [Zea mays]
 gb|AFT82649.1| C3H39 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW77468.1| hypothetical protein ZEAMMB73_138519 [Zea mays]
 gb|AFW77469.1| hypothetical protein ZEAMMB73_138519 [Zea mays]
Length=394

 Score =   192 bits (487),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  1136  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGD  957
             D FRMYEFKVRRC+R R+HDWT CP+AHPGEKARRRDPR++HYSG  C +FRKG C RGD
Sbjct  72    DEFRMYEFKVRRCSRGRNHDWTACPYAHPGEKARRRDPRRYHYSGAACPDFRKGGCKRGD  131

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
              CEFAHGVFE WLHP+RYRT+ CKDG  C+R+VCFFAH+  QLR+ P
Sbjct  132   ACEFAHGVFECWLHPSRYRTQPCKDGTGCRRRVCFFAHTPDQLRVPP  178



>ref|XP_004157904.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 1 [Cucumis sativus]
Length=396

 Score =   191 bits (486),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 150/228 (66%), Gaps = 22/228 (10%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE---DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
              + +++LP N+ E   D D  G       D YS+D FRMYEFK+++CTR RSHDWT+CPF
Sbjct  64    AMLKRYLPSNEAEMDSDIDVSGKEIDSPLDAYSSDQFRMYEFKIKKCTRGRSHDWTECPF  123

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPR+++YSGT C++FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  124   AHPGEKARRRDPRRYYYSGTACADFRKGSCVKGDACEFAHGVFECWLHPARYRTQPCKDG  183

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS  699
              +C+R+VCFFAH+  QLR+LP     + S  P +D +   LR+ +   +     +    +
Sbjct  184   TSCRRRVCFFAHTPEQLRVLPQQSPRSTSSIPSYDGSP--LRQAIEACAKQMPYLSSPGT  241

Query  698   SPPLSP-AKTPFCGYGMTAAKLIEMMSYKEA---LTQLVNSLEQVNLN  567
             SPP+SP  ++P        + +I+ ++   A   + ++V SL  + LN
Sbjct  242   SPPVSPRIESP------PQSPIIKSLNRPHAPSSIKEMVASLRNLQLN  283



>ref|XP_008459142.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cucumis melo]
Length=396

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 150/228 (66%), Gaps = 22/228 (10%)
 Frame = -1

Query  1208  GVFQKFLPYNDVE---DEDEDG-------DRYSADHFRMYEFKVRRCTRSRSHDWTDCPF  1059
              + +++LP N+ E   D D  G       D YS+D FRMYEFK+++CTR RSHDWT+CPF
Sbjct  65    AMLKRYLPSNEAEMDSDIDVSGKEMDSPVDAYSSDQFRMYEFKIKKCTRGRSHDWTECPF  124

Query  1058  AHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDG  879
             AHPGEKARRRDPR+++YSGT C++FRKG C +GD CEFAHGVFE WLHPARYRT+ CKDG
Sbjct  125   AHPGEKARRRDPRRYYYSGTACADFRKGSCVKGDACEFAHGVFECWLHPARYRTQPCKDG  184

Query  878   KNCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHS  699
              +C+R+VCFFAH+  QLR+LP     + +  P +D +   LR+ +   +     +    +
Sbjct  185   TSCRRRVCFFAHTPEQLRVLPQQSPRSTTSIPSYDGSP--LRQAIEACAKQMPYLSSPGT  242

Query  698   SPPLSP-AKTPFCGYGMTAAKLIEMMSYKEA---LTQLVNSLEQVNLN  567
             SPP+SP  ++P        + +I+ ++   A   + +++ SL  + LN
Sbjct  243   SPPVSPRIESP------PQSPIIKSLNRPHAPSSINEMIASLRNLQLN  284



>ref|NP_001144558.1| uncharacterized protein LOC100277562 [Zea mays]
 gb|ACG41357.1| hypothetical protein [Zea mays]
Length=391

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  1136  DHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGD  957
             D FRMYEFKVRRC+R R+HDWT CP+AHPGEKARRRDPR++HYSG  C +FRKG C RGD
Sbjct  71    DEFRMYEFKVRRCSRGRNHDWTACPYAHPGEKARRRDPRRYHYSGAACPDFRKGGCKRGD  130

Query  956   NCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
              CE AHGVFE WLHP+RYRT+ CKDG  C+R+VCFFAH+  QLR+ P
Sbjct  131   ACELAHGVFECWLHPSRYRTQPCKDGTGCRRRVCFFAHTPDQLRVPP  177



>ref|XP_009415367.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 132/216 (61%), Gaps = 22/216 (10%)
 Frame = -1

Query  1172  EDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVC  993
             ED     D Y++D FRMYEFKVRRC R R+HDWT+CPFAHP EKARRRDPRK  YSG+ C
Sbjct  53    EDNARLVDAYASDEFRMYEFKVRRCARGRAHDWTECPFAHPAEKARRRDPRKHRYSGSPC  112

Query  992   SEFRKGK-CGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILP  816
              +FRK   C RGD C+ AHGVFE WLHP RYRT+ CKDG  C+R+VCFFAH+  QLR++P
Sbjct  113   PDFRKASGCKRGDVCDLAHGVFECWLHPDRYRTQPCKDGTACRRRVCFFAHTPDQLRVVP  172

Query  815   VNRYSTGSLS-----------PVHDPA--EKNLRKNLCCHSPTSTLMGISHSSPPLSPAK  675
              +   +   +           P+H  +  +  L KNL   SPTS  +   +S P  SP  
Sbjct  173   PHHQQSSPTAAAAGVDSYDGLPLHQQSFMQPYLPKNLVS-SPTSVRISPPNSPPTESPPI  231

Query  674   TPFCGYGMTAAKLIEMMSYKEALTQLVNSLEQVNLN  567
             +P        A+L    +   ++ ++V SL Q+ L+
Sbjct  232   SP------NGAQLGSWHA-GSSVNEIVASLRQLQLS  260



>emb|CDP18658.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   194 bits (493),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS D FRMY FKVR C+R+ SHDWT+CPF HPGE ARRRDPRKFHYS   C +FRKG C 
Sbjct  231   YSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGTCR  290

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSL-  789
             RGD CE+AHGVFE WLHPA+YRT  CKDG +C R+VCFFAH+  ++R L V   STGS  
Sbjct  291   RGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCNRRVCFFAHTQEEMRPLYV---STGSAV  347

Query  788   -SPVHDPAEKNLRK----NLCCHSPTS-TLMGISHSSPPLSPAKTPFCGYG  654
              SP   P+  N       N    SP+S T+M  S  +PP+SP+       G
Sbjct  348   PSPRTGPSSTNAVDFAGMNFLPGSPSSVTMMSPSPFTPPMSPSTNGIANMG  398



>ref|XP_009411222.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=324

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 135/211 (64%), Gaps = 26/211 (12%)
 Frame = -1

Query  1319  YLKKAMAELDVSPRKILSRRGAAEADGFLDSPTKIEGGV----FQKFLPYNDVED----E  1164
             Y   +MA +   P  +L   G A      D P  + G V    FQ+FLP ND       +
Sbjct  20    YSDNSMAAIQHYP--VLPVSGVAGLSA--DLPPHLLGEVGFAAFQRFLPRNDGSSSSAAD  75

Query  1163  DEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEF  984
                 D Y+ D FRMYEFKVRRC R RSHDWT+CP+AHPGEKARRRDPR+FHYSG++C +F
Sbjct  76    PTAADAYACDEFRMYEFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRRFHYSGSLCPDF  135

Query  983   -RKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLR-ILPVN  810
              R G C RG++C+ AHGVFE+WLHPARYRT+ CKDG  C+R+VCFFAHS  QLR +LP  
Sbjct  136   RRGGGCRRGESCDLAHGVFETWLHPARYRTQPCKDGAACRRRVCFFAHSPEQLRLVLPP-  194

Query  809   RYSTGSLSPVHDPAEKNLRKNLCCHSPTSTL  717
                    SP+  P+E   R +    SPTSTL
Sbjct  195   -------SPI-SPSEGGARVS---SSPTSTL  214



>ref|XP_011033310.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
Length=732

 Score =   193 bits (491),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 118/178 (66%), Gaps = 16/178 (9%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS D FRMY FKVR C+R+ SHDWT+CPF HPGE ARRRDPRKFHYS   C +FRKG C 
Sbjct  259   YSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACR  318

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RGD CE+AHGVFE WLHPA+YRT  CKDG NC R+VCFFAH+  +LR L V   STGS  
Sbjct  319   RGDLCEYAHGVFECWLHPAQYRTRLCKDGTNCARRVCFFAHTVEELRPLYV---STGSAV  375

Query  785   P-----VHDPAEKNLRK--NLCCHSPT-STLMGISHSSPPLSPAKTPFCGYGMTAAKL  636
             P         A  +     NL   SP+ +++M  S  +PP+SP+     G GM+ + L
Sbjct  376   PSPRSGTSGAAAMDFASAMNLLPGSPSAASIMSPSSFTPPMSPS-----GNGMSHSSL  428



>ref|XP_002323312.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF05073.1| zinc finger family protein [Populus trichocarpa]
Length=732

 Score =   193 bits (491),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 118/178 (66%), Gaps = 16/178 (9%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS D FRMY FKVR C+R+ SHDWT+CPF HPGE ARRRDPRKFHYS   C +FRKG C 
Sbjct  259   YSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACR  318

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RGD CE+AHGVFE WLHPA+YRT  CKDG NC R+VCFFAH+  +LR L V   STGS  
Sbjct  319   RGDMCEYAHGVFECWLHPAQYRTRLCKDGTNCARRVCFFAHTVEELRPLYV---STGSAV  375

Query  785   P-----VHDPAEKNLRK--NLCCHSPT-STLMGISHSSPPLSPAKTPFCGYGMTAAKL  636
             P         A  +     NL   SP+ +++M  S  +PP+SP+     G GM+ + L
Sbjct  376   PSPRSGTSGAAAMDFASAMNLLPGSPSAASIMSPSSFTPPMSPS-----GNGMSHSSL  428



>ref|XP_006349561.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Solanum tuberosum]
Length=695

 Score =   193 bits (490),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 113/174 (65%), Gaps = 15/174 (9%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             YS D FRM+ FK+R C+R+ SHDWT+CPF HPGE ARRRDPRK+HYS   C EFRK  C 
Sbjct  235   YSTDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKYHYSCVPCPEFRKVACQ  294

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             +GD CE++HGVFESWLHPA+YRT  CKDG NC R+VCFFAH+  +LR L V   STGS  
Sbjct  295   QGDMCEYSHGVFESWLHPAQYRTRLCKDGTNCNRRVCFFAHTQEELRPLYV---STGSAV  351

Query  785   PVHDPAEKNLRKN---------LCCHSPTST-LMGISHSSPPLSPAKTPFCGYG  654
             P   P   N   N         L   SP+S  +M  SH +PP+SP+       G
Sbjct  352   P--SPRSNNSAVNAMDFAATMGLIPGSPSSVRVMSPSHFTPPISPSANGISNMG  403



>ref|XP_006293740.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
 gb|EOA26638.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
Length=721

 Score =   193 bits (490),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 120/200 (60%), Gaps = 11/200 (6%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
             LDSP K++   F+K  P  D    D     Y+ D FRMY FKVR C+R+ SHDWT+CPF 
Sbjct  228   LDSPFKLKSTEFKKEYPV-DPSLPDIKNSIYATDEFRMYSFKVRPCSRAYSHDWTECPFV  286

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGE ARRRDPRKFHYS   C +FRKG C RGD CE+AHGVFE WLHPA+YRT  CKDG 
Sbjct  287   HPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGT  346

Query  875   NCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSS  696
              C R+VCFFAH+  +LR L     STGS  P       + R N    +  S L G     
Sbjct  347   GCARRVCFFAHTPEELRPL---YASTGSAVP-------SPRSNADYAAALSLLPGSPSGV  396

Query  695   PPLSPAKTPFCGYGMTAAKL  636
               +SP      G GM+ + +
Sbjct  397   SVMSPLSPSAAGNGMSHSNM  416



>ref|XP_006293739.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
 gb|EOA26637.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
Length=746

 Score =   193 bits (490),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 120/200 (60%), Gaps = 11/200 (6%)
 Frame = -1

Query  1235  LDSPTKIEGGVFQKFLPYNDVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFA  1056
             LDSP K++   F+K  P  D    D     Y+ D FRMY FKVR C+R+ SHDWT+CPF 
Sbjct  253   LDSPFKLKSTEFKKEYPV-DPSLPDIKNSIYATDEFRMYSFKVRPCSRAYSHDWTECPFV  311

Query  1055  HPGEKARRRDPRKFHYSGTVCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGK  876
             HPGE ARRRDPRKFHYS   C +FRKG C RGD CE+AHGVFE WLHPA+YRT  CKDG 
Sbjct  312   HPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGT  371

Query  875   NCKRKVCFFAHSSRQLRILPVNRYSTGSLSPVHDPAEKNLRKNLCCHSPTSTLMGISHSS  696
              C R+VCFFAH+  +LR L     STGS  P       + R N    +  S L G     
Sbjct  372   GCARRVCFFAHTPEELRPL---YASTGSAVP-------SPRSNADYAAALSLLPGSPSGV  421

Query  695   PPLSPAKTPFCGYGMTAAKL  636
               +SP      G GM+ + +
Sbjct  422   SVMSPLSPSAAGNGMSHSNM  441



>ref|XP_002504751.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66009.1| predicted protein [Micromonas sp. RCC299]
Length=351

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -1

Query  1157  DGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRK  978
             D +   +D FRMYEFKVRRC+R+R+HDWT+CPF HPGEKARRRDPR+F+Y GT C EFRK
Sbjct  32    DAETRLSDDFRMYEFKVRRCSRTRAHDWTECPFTHPGEKARRRDPRRFNYCGTACPEFRK  91

Query  977   GKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLR  825
             G C RGD CEFAHGVFE WLHP+RYRT+ CKDG  C R+ CFFAH+S QLR
Sbjct  92    GSCPRGDACEFAHGVFECWLHPSRYRTQLCKDGLQCARRACFFAHASHQLR  142



>ref|XP_003525974.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Glycine max]
Length=253

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             +S+DHFRM++FKVR C R RSHDWT+CP+AHP EKARRRDPRK+HYSGT C +++KG C 
Sbjct  35    FSSDHFRMFQFKVRICPRGRSHDWTECPYAHPAEKARRRDPRKYHYSGTACPDYQKGNCK  94

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRI  822
             RGD C+F+HGVFE WLHP+RYRT  CKDG  C+R+VCFFAH++ QLR+
Sbjct  95    RGDTCQFSHGVFECWLHPSRYRTHLCKDGTTCRRRVCFFAHTTEQLRL  142



>ref|XP_008443126.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Cucumis 
melo]
Length=701

 Score =   192 bits (488),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 114/175 (65%), Gaps = 11/175 (6%)
 Frame = -1

Query  1178  DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGT  999
             D+   D     YS D FRMY FKVR C+R+ SHDWT+CPF HPGE ARRRDPRKFHYS  
Sbjct  216   DLSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCV  275

Query  998   VCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL  819
              C +FRKG C RGD CE+AHGVFE WLHPA+YRT  CKDG NC R+VCFFAH++ +LR L
Sbjct  276   PCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTNCSRRVCFFAHTTDELRPL  335

Query  818   PVNRYSTGSLSPV-------HDPAEKNLRKNLCCHSPTST-LMGISHSSPPLSPA  678
              V   STGS  P            +     NL   SP+S  +M  S  +PP+SP+
Sbjct  336   YV---STGSAVPSPRSCTSGASAMDYTTVMNLLPGSPSSVPVMSPSPFTPPMSPS  387



>ref|XP_004136593.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis sativus]
 ref|XP_004165487.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform 1 [Cucumis sativus]
 ref|XP_004165488.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform 2 [Cucumis sativus]
 gb|KGN59348.1| hypothetical protein Csa_3G812200 [Cucumis sativus]
Length=701

 Score =   192 bits (488),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 114/175 (65%), Gaps = 11/175 (6%)
 Frame = -1

Query  1178  DVEDEDEDGDRYSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGT  999
             D+   D     YS D FRMY FKVR C+R+ SHDWT+CPF HPGE ARRRDPRKFHYS  
Sbjct  216   DLSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCV  275

Query  998   VCSEFRKGKCGRGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRIL  819
              C +FRKG C RGD CE+AHGVFE WLHPA+YRT  CKDG NC R+VCFFAH++ +LR L
Sbjct  276   PCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTNCSRRVCFFAHTTDELRPL  335

Query  818   PVNRYSTGSLSPV-------HDPAEKNLRKNLCCHSPTST-LMGISHSSPPLSPA  678
              V   STGS  P            +     NL   SP+S  +M  S  +PP+SP+
Sbjct  336   YV---STGSAVPSPRSCTSGASAMDYTTVMNLLPGSPSSVPVMSPSPFTPPMSPS  387



>emb|CAN74402.1| hypothetical protein VITISV_043632 [Vitis vinifera]
Length=718

 Score =   192 bits (488),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 143/258 (55%), Gaps = 34/258 (13%)
 Frame = -1

Query  1145  YSADHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKFHYSGTVCSEFRKGKCG  966
             Y+ D FRMY FK+R C+R+ SHDWT+CPF HPGE ARRRDPRKFHYS   C EFRKG C 
Sbjct  252   YATDEFRMYSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPEFRKGACR  311

Query  965   RGDNCEFAHGVFESWLHPARYRTEACKDGKNCKRKVCFFAHSSRQLRILPVNRYSTGSLS  786
             RGD CE+AHGVFE WLHPA+YRT  CKDG +C R+VCFFAH+S++LR L ++  S G  S
Sbjct  312   RGDLCEYAHGVFECWLHPAQYRTRLCKDGTSCMRRVCFFAHTSKELRPLYMSTGS-GVAS  370

Query  785   PVHDPAEKNLRKNLCCH--SPTS-TLMGISHSSPPLSPAKTPFC----------------  663
             P       ++   L     SP++ + M  S  +PP+SPA                     
Sbjct  371   PRSAANAMDMASALSLFPGSPSAVSAMSPSPFTPPMSPAGVAISHSSMAWPQQSIPTLHL  430

Query  662   -GYGMTAAKLIEMMSYKEALTQLVNSLEQVNLNPLSPATTTINRMTRPFSGNDPIQFSLP  486
              G  +  ++L   +S ++ L +  N L+  ++              +    ND   F+ P
Sbjct  431   PGSNLQTSRLRSSLSARDMLVEEFNVLQDFDVQ-------------QQQLLNDLSHFTQP  477

Query  485   NSPSTPGRHSSGSEFLTP  432
             N  S  G  S  S+ LTP
Sbjct  478   NLSSASGNLSVRSKALTP  495



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3804414986880