BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30611_g1_i1 len=1221 path=[1199:0-1220]

Length=1221
                                                                      Score     E

ref|XP_009627753.1|  PREDICTED: uncharacterized protein LOC104118249    263   1e-82   
ref|XP_006362323.1|  PREDICTED: uncharacterized protein LOC102583586    263   2e-82   
ref|XP_009773646.1|  PREDICTED: uncharacterized protein LOC104223842    260   3e-81   
ref|XP_004248519.1|  PREDICTED: uncharacterized protein LOC101254...    257   3e-80   
ref|XP_011091982.1|  PREDICTED: uncharacterized protein LOC105172296    245   2e-75   
emb|CDP16535.1|  unnamed protein product                                243   1e-74   
ref|XP_007010649.1|  Uncharacterized protein isoform 2                  236   1e-71   
ref|XP_002310962.1|  hypothetical protein POPTR_0008s01280g             234   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011032959.1|  PREDICTED: uncharacterized protein LOC105131615    234   6e-71   
ref|XP_006487513.1|  PREDICTED: uncharacterized protein LOC102628...    234   9e-71   
gb|KHN26440.1|  hypothetical protein glysoja_030394                     232   1e-70   
ref|XP_006487515.1|  PREDICTED: uncharacterized protein LOC102628...    232   2e-70   
ref|XP_007010648.1|  Uncharacterized protein isoform 1                  231   6e-70   
gb|EPS68193.1|  hypothetical protein M569_06579                         230   7e-70   
ref|NP_001234981.1|  uncharacterized protein LOC100306178               231   7e-70   
ref|XP_004499602.1|  PREDICTED: uncharacterized protein LOC101511339    229   2e-69   
ref|XP_006423773.1|  hypothetical protein CICLE_v10029282mg             228   7e-69   
gb|KHG27165.1|  hypothetical protein F383_02294                         227   1e-68   
ref|XP_010907489.1|  PREDICTED: uncharacterized protein C19orf60 ...    227   2e-68   
emb|CBI29132.3|  unnamed protein product                                226   3e-68   
ref|XP_002274914.1|  PREDICTED: uncharacterized protein LOC100255669    226   3e-68   Vitis vinifera
ref|XP_008811764.1|  PREDICTED: uncharacterized protein LOC103722845    226   4e-68   
gb|KHN48489.1|  hypothetical protein glysoja_040620                     226   5e-68   
gb|KEH32828.1|  hypothetical protein MTR_3g006790                       225   1e-67   
ref|XP_010558238.1|  PREDICTED: uncharacterized protein LOC104826955    224   3e-67   
ref|XP_010031339.1|  PREDICTED: uncharacterized protein C19orf60 ...    224   4e-67   
gb|KDP41061.1|  hypothetical protein JCGZ_03167                         223   5e-67   
ref|XP_009391634.1|  PREDICTED: uncharacterized protein LOC103977756    220   6e-66   
ref|XP_004135056.1|  PREDICTED: uncharacterized protein LOC101210078    220   7e-66   
ref|XP_007141036.1|  hypothetical protein PHAVU_008G161900g             219   3e-65   
ref|XP_008446706.1|  PREDICTED: protein Daple                           217   1e-64   
ref|XP_010666652.1|  PREDICTED: uncharacterized protein LOC104883787    216   2e-64   
emb|CDX98801.1|  BnaC09g50340D                                          216   4e-64   
gb|EYU42899.1|  hypothetical protein MIMGU_mgv1a0140421mg               213   1e-63   
ref|XP_007010650.1|  Uncharacterized protein isoform 3                  213   5e-63   
ref|XP_010247157.1|  PREDICTED: uncharacterized protein LOC104590267    213   6e-63   
gb|KCW50600.1|  hypothetical protein EUGRSUZ_J00312                     211   3e-62   
ref|XP_008231903.1|  PREDICTED: uncharacterized protein LOC103331067    209   2e-61   
ref|XP_006829871.1|  hypothetical protein AMTR_s00119p00136700          206   2e-61   
ref|XP_007218386.1|  hypothetical protein PRUPE_ppa011354mg             209   3e-61   
ref|XP_008346101.1|  PREDICTED: uncharacterized protein LOC103409057    207   8e-61   
emb|CDX70185.1|  BnaA10g25340D                                          207   1e-60   
ref|XP_006398947.1|  hypothetical protein EUTSA_v10014633mg             207   1e-60   
ref|XP_009122552.1|  PREDICTED: uncharacterized protein LOC103847244    207   1e-60   
gb|ABV89667.1|  hypothetical protein at5g04910                          204   7e-60   Brassica rapa
ref|XP_009355057.1|  PREDICTED: uncharacterized protein LOC103946147    204   2e-59   
ref|XP_009350994.1|  PREDICTED: uncharacterized protein LOC103942535    204   2e-59   
ref|XP_002871123.1|  hypothetical protein ARALYDRAFT_487277             204   2e-59   
ref|XP_006578408.1|  PREDICTED: uncharacterized protein LOC100818042    203   4e-59   
ref|NP_196111.2|  uncharacterized protein                               203   4e-59   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28681.1|  unknown                                                 202   7e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24931.1|  hypothetical protein AALP_AA8G043600                    202   1e-58   
ref|XP_010423517.1|  PREDICTED: uncharacterized protein LOC104708622    200   5e-58   
ref|XP_010452393.1|  PREDICTED: uncharacterized protein LOC104734498    200   6e-58   
ref|XP_006288639.1|  hypothetical protein CARUB_v10001943mg             200   6e-58   
ref|XP_010491020.1|  PREDICTED: uncharacterized protein LOC104768688    199   2e-57   
ref|XP_002526323.1|  hypothetical protein RCOM_0720210                  195   6e-56   Ricinus communis
ref|XP_007218385.1|  hypothetical protein PRUPE_ppa011354mg             192   3e-55   
ref|XP_004306436.1|  PREDICTED: uncharacterized protein LOC101315374    191   1e-54   
gb|AGT16097.1|  hypothetical protein SHCRBa_261_O20_R_210               191   2e-54   
dbj|BAB11513.1|  unnamed protein product                                189   7e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248520.1|  PREDICTED: uncharacterized protein LOC101254...    187   9e-54   
gb|EAZ11347.1|  hypothetical protein OsJ_01214                          189   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457615.1|  hypothetical protein SORBIDRAFT_03g010370          189   1e-53   Sorghum bicolor [broomcorn]
ref|NP_001042671.1|  Os01g0265700                                       189   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967763.1|  PREDICTED: uncharacterized protein LOC101773260    189   2e-53   
ref|XP_009355155.1|  PREDICTED: uncharacterized protein LOC103946223    187   4e-53   
ref|XP_006645743.1|  PREDICTED: uncharacterized protein LOC102722266    186   2e-52   
ref|XP_006279453.1|  hypothetical protein CARUB_v10007893mg             181   2e-51   
gb|ACG48423.1|  hypothetical protein                                    183   3e-51   Zea mays [maize]
ref|NP_001145494.1|  uncharacterized protein LOC100278893               182   5e-51   Zea mays [maize]
dbj|BAK07146.1|  predicted protein                                      182   6e-51   
emb|CDM80735.1|  unnamed protein product                                179   1e-49   
ref|XP_003565625.1|  PREDICTED: uncharacterized protein LOC100822108    179   6e-49   
ref|XP_010103997.1|  hypothetical protein L484_020251                   174   2e-47   
gb|EMT04033.1|  hypothetical protein F775_28484                         166   2e-44   
gb|EMS57326.1|  hypothetical protein TRIUR3_22005                       164   4e-44   
ref|XP_001762946.1|  predicted protein                                  126   2e-30   
gb|KDO42411.1|  hypothetical protein CISIN_1g0386972mg                  121   8e-30   
ref|XP_010327276.1|  PREDICTED: uncharacterized protein LOC101254...    119   2e-28   
ref|XP_002962136.1|  hypothetical protein SELMODRAFT_403688             117   2e-27   
ref|XP_010907490.1|  PREDICTED: uncharacterized protein C19orf60 ...    105   1e-23   
gb|KCW50601.1|  hypothetical protein EUGRSUZ_J00312                     101   3e-22   
gb|AFB34090.1|  hypothetical protein CL2438Contig1_03                 99.4    6e-22   
gb|AFG60421.1|  hypothetical protein CL2438Contig1_03                 99.0    8e-22   
gb|AEW08954.1|  hypothetical protein CL2438Contig1_03                 98.6    1e-21   
gb|AFG60423.1|  hypothetical protein CL2438Contig1_03                 96.3    7e-21   
ref|XP_002965038.1|  hypothetical protein SELMODRAFT_406136           96.7    3e-20   
tpg|DAA54073.1|  TPA: hypothetical protein ZEAMMB73_165181            83.6    1e-15   
ref|XP_007148750.1|  hypothetical protein PHAVU_005G010900g           67.4    4e-10   
ref|XP_002952830.1|  hypothetical protein VOLCADRAFT_62922            68.6    1e-09   
gb|KDO42412.1|  hypothetical protein CISIN_1g0386971mg                62.4    1e-08   
ref|XP_005849152.1|  hypothetical protein CHLNCDRAFT_143776           64.7    1e-08   
tpg|DAA54074.1|  TPA: hypothetical protein ZEAMMB73_165181            55.8    3e-06   
ref|XP_001698871.1|  hypothetical protein CHLREDRAFT_195671           56.6    1e-05   Chlamydomonas reinhardtii
ref|XP_006485569.1|  PREDICTED: uncharacterized protein LOC102609786  53.9    2e-05   
ref|XP_008405327.1|  PREDICTED: uncharacterized protein C19orf60 ...  50.8    3e-04   
ref|XP_007577286.1|  PREDICTED: uncharacterized protein C19orf60 ...  50.4    3e-04   
ref|XP_005795673.1|  PREDICTED: uncharacterized protein C19orf60 ...  50.4    3e-04   
ref|XP_007233329.1|  PREDICTED: uncharacterized protein C19orf60 ...  49.3    8e-04   



>ref|XP_009627753.1| PREDICTED: uncharacterized protein LOC104118249 [Nicotiana tomentosiformis]
Length=213

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFED+MVSGVES YQ+LCSEITVEFNDCSKQVLEMESQFL+P CFREDLA LLRS+Q 
Sbjct  58   KRGFEDFMVSGVESTYQQLCSEITVEFNDCSKQVLEMESQFLTPHCFREDLAHLLRSIQN  117

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEK KL LTATIQVLKKAGRPSERLVSHENCR+SKP  HECVHIQKITEASGTEEAEADA
Sbjct  118  QEKIKLQLTATIQVLKKAGRPSERLVSHENCRYSKPTVHECVHIQKITEASGTEEAEADA  177

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            E+DNAL+EAI+GVQDAVT INEHLEEVRYEIAALED
Sbjct  178  EFDNALKEAIQGVQDAVTTINEHLEEVRYEIAALED  213



>ref|XP_006362323.1| PREDICTED: uncharacterized protein LOC102583586 [Solanum tuberosum]
Length=206

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFEDYM SGVES YQ+LCSEIT EFNDCSKQVLEMESQFL+  CFREDL+ LLRSVQ 
Sbjct  51   KRGFEDYMASGVESTYQQLCSEITAEFNDCSKQVLEMESQFLTAHCFREDLSLLLRSVQN  110

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEK KL LTATIQVLK+AGRPSERLVSHENCRFSKP GHECVHIQKITEASGTEEAEADA
Sbjct  111  QEKMKLQLTATIQVLKRAGRPSERLVSHENCRFSKPTGHECVHIQKITEASGTEEAEADA  170

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            E+DNAL+EAI GVQDAVT INEHLEEVRYEIAALED
Sbjct  171  EFDNALKEAINGVQDAVTAINEHLEEVRYEIAALED  206



>ref|XP_009773646.1| PREDICTED: uncharacterized protein LOC104223842 [Nicotiana sylvestris]
Length=213

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 188/218 (86%), Gaps = 5/218 (2%)
 Frame = -3

Query  1039  MNQTTVEAEFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqaya  860
             MN +TVE EFEKKV I ++M         ++   E+++ KI  LLRRFLA+QQRRAQAYA
Sbjct  1     MNPSTVE-EFEKKVVITERM----SMEEEADNCPENDSFKIVELLRRFLAVQQRRAQAYA  55

Query  859   rLKRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSV  680
             RLKRGFED+MVSGVES YQKLCSEITVEF DCSKQVLEMESQFL+P CFREDLA LLRSV
Sbjct  56    RLKRGFEDFMVSGVESTYQKLCSEITVEFGDCSKQVLEMESQFLTPHCFREDLAHLLRSV  115

Query  679   QTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaea  500
             Q QEK KL LTATIQVLKKAGRPSERLVSHENCR+SKP  HECVHIQKITEASGTEEAEA
Sbjct  116   QNQEKIKLQLTATIQVLKKAGRPSERLVSHENCRYSKPTVHECVHIQKITEASGTEEAEA  175

Query  499   daeydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
             DAE+DNAL++AI+GVQ AVT INEHLEEVRYEIAALE+
Sbjct  176   DAEFDNALKDAIQGVQGAVTTINEHLEEVRYEIAALEE  213



>ref|XP_004248519.1| PREDICTED: uncharacterized protein LOC101254136 isoform X1 [Solanum 
lycopersicum]
Length=206

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFEDYM SGVES YQ+LCSEIT EFNDCSKQVLEMESQFL+  CFREDL+ LLRSVQ 
Sbjct  51   KRGFEDYMASGVESTYQQLCSEITDEFNDCSKQVLEMESQFLTAHCFREDLSLLLRSVQN  110

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEK KL LTATIQVLK+AGRPSER VSHENCRFSKP GHECVHIQKITEASGTEEAEADA
Sbjct  111  QEKMKLQLTATIQVLKRAGRPSERPVSHENCRFSKPTGHECVHIQKITEASGTEEAEADA  170

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            E+DNAL+EAI GVQDAVT IN+HLEEVRYEIAALED
Sbjct  171  EFDNALKEAINGVQDAVTAINDHLEEVRYEIAALED  206



>ref|XP_011091982.1| PREDICTED: uncharacterized protein LOC105172296 [Sesamum indicum]
Length=215

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFEDYMVSG E AYQ+LCSEIT+EFNDCSKQVLEMES F+SPDC REDLA LLRSVQ 
Sbjct  59   KRGFEDYMVSGGELAYQQLCSEITLEFNDCSKQVLEMESLFVSPDCCREDLARLLRSVQA  118

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEK+KL+LTATIQVLKKAGRPSERLVSHENCRF +  GHECVHIQ+ITEASGTEEAEADA
Sbjct  119  QEKEKLHLTATIQVLKKAGRPSERLVSHENCRFRQSTGHECVHIQQITEASGTEEAEADA  178

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAAL  392
            +YDNAL+EAI+GVQ AV  INE+LEEVRYEIAAL
Sbjct  179  QYDNALKEAIRGVQHAVIAINEYLEEVRYEIAAL  212



>emb|CDP16535.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GFEDYMVSG ESAYQ+LCSEITVEFNDCS++VL++ES F S D FREDLA LL+SVQT
Sbjct  41   KSGFEDYMVSGSESAYQQLCSEITVEFNDCSREVLDLESLFRSADFFREDLACLLKSVQT  100

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL LTATIQVLKK GRPSERLVSHENCRF++ +GH+CVHI KITEASGTEEAEADA
Sbjct  101  QEKQKLQLTATIQVLKKVGRPSERLVSHENCRFNRAIGHQCVHINKITEASGTEEAEADA  160

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAIKGVQ+AV  INEHLEEVRYEIAALE
Sbjct  161  EYDNALKEAIKGVQNAVITINEHLEEVRYEIAALE  195



>ref|XP_007010649.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY19459.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=218

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +YM SG E AYQ+LCSEITV+F DCSKQVLEMES FLSPD  R DLA LLRSVQT
Sbjct  62   KTGFSEYMNSGGELAYQQLCSEITVKFKDCSKQVLEMESLFLSPDYCRVDLAQLLRSVQT  121

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKAGRPSERLVSHENC F KPM HECVH+ +ITEASGTE+AEA+A
Sbjct  122  QEKQKLHLTATIQLLKKAGRPSERLVSHENCLFKKPMEHECVHVHEITEASGTEDAEANA  181

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  182  EYDNALKEAIRGVQDAVTAINEHLEEVRYEIAALE  216



>ref|XP_002310962.1| hypothetical protein POPTR_0008s01280g [Populus trichocarpa]
 gb|EEE88329.1| hypothetical protein POPTR_0008s01280g [Populus trichocarpa]
Length=216

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K+GF +YMVSG E AYQ+LCS+IT EFNDCSKQV+EMES FL+PD  R DLA LLR +QT
Sbjct  60   KQGFSEYMVSGGELAYQQLCSKITEEFNDCSKQVIEMESLFLNPDHDRVDLAHLLRDIQT  119

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKAGRPSERLV+HENCRFS+PM HECVH+ +ITEASGTEEAEADA
Sbjct  120  QEKQKLHLTATIQLLKKAGRPSERLVNHENCRFSRPMEHECVHLHEITEASGTEEAEADA  179

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQD+VT INEHLEE++YEIAALE
Sbjct  180  EYDNALKEAIRGVQDSVTTINEHLEEIKYEIAALE  214



>ref|XP_011032959.1| PREDICTED: uncharacterized protein LOC105131615 [Populus euphratica]
Length=216

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K+GF +YMVSG E AYQ+LCS+IT EFNDCSKQV+EMES FL+PD  R DLA LLR +QT
Sbjct  60   KQGFSEYMVSGGELAYQQLCSKITEEFNDCSKQVIEMESLFLNPDHDRVDLAHLLRDIQT  119

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKAGRPSERLV+HENCRF KPM HECVH+ +ITEASGTEEAEADA
Sbjct  120  QEKQKLHLTATIQLLKKAGRPSERLVNHENCRFPKPMEHECVHLHEITEASGTEEAEADA  179

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQD+VT INEHLEE++YEIAALE
Sbjct  180  EYDNALKEAIRGVQDSVTTINEHLEEIKYEIAALE  214



>ref|XP_006487513.1| PREDICTED: uncharacterized protein LOC102628770 isoform X1 [Citrus 
sinensis]
 ref|XP_006487514.1| PREDICTED: uncharacterized protein LOC102628770 isoform X2 [Citrus 
sinensis]
Length=225

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 181/220 (82%), Gaps = 5/220 (2%)
 Frame = -3

Query  1048  QNPMNQTTVEAEFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraq  869
             QN  N+  ++ +FEKKV I D ME           +  + +SK   LLR FL +QQRRAQ
Sbjct  9     QNQRNEERMD-DFEKKVTITDAME----MEEMDIEQANNNSSKTLQLLRTFLDIQQRRAQ  63

Query  868   ayarLKRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALL  689
             AYA+LKRGF +YM+SG E AYQ+LCSEIT EFNDCSKQVLE+ES FL+PDC R DLA LL
Sbjct  64    AYAKLKRGFSEYMISGGELAYQQLCSEITSEFNDCSKQVLEIESLFLNPDCCRVDLAQLL  123

Query  688   RSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTee  509
             R+VQTQEKQKL+LTATIQ+LKKAGRPSERLVSHENC+F +P  HECVH+Q+ITEA+GTEE
Sbjct  124   RAVQTQEKQKLHLTATIQLLKKAGRPSERLVSHENCKFREPKKHECVHVQEITEAAGTEE  183

Query  508   aeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
             AEADAEYDNAL+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  184   AEADAEYDNALKEAIRGVQDAVTAINEHLEEVRYEIAALE  223



>gb|KHN26440.1| hypothetical protein glysoja_030394 [Glycine soja]
Length=192

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF DYM SG E AY++LCSEIT+EFN+CSK+VLEMES F SPD  R DLA LLR+VQ 
Sbjct  36   KSGFSDYMASGGELAYKQLCSEITIEFNNCSKKVLEMESLFRSPDYCRVDLAQLLRAVQD  95

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL LTATIQVLKKAGRPSERLVSHENC+F+KP  HECVH+Q+ITEASGTEEAEADA
Sbjct  96   QEKQKLQLTATIQVLKKAGRPSERLVSHENCKFTKPAEHECVHVQEITEASGTEEAEADA  155

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAV  INEHLEEVRYEIAALE
Sbjct  156  EYDNALKEAIRGVQDAVMAINEHLEEVRYEIAALE  190



>ref|XP_006487515.1| PREDICTED: uncharacterized protein LOC102628770 isoform X3 [Citrus 
sinensis]
Length=209

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 175/209 (84%), Gaps = 4/209 (2%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             +FEKKV I D ME           +  + +SK   LLR FL +QQRRAQAYA+LKRGF +
Sbjct  3     DFEKKVTITDAME----MEEMDIEQANNNSSKTLQLLRTFLDIQQRRAQAYAKLKRGFSE  58

Query  835   YMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQEKQKL  656
             YM+SG E AYQ+LCSEIT EFNDCSKQVLE+ES FL+PDC R DLA LLR+VQTQEKQKL
Sbjct  59    YMISGGELAYQQLCSEITSEFNDCSKQVLEIESLFLNPDCCRVDLAQLLRAVQTQEKQKL  118

Query  655   NLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaeydnAL  476
             +LTATIQ+LKKAGRPSERLVSHENC+F +P  HECVH+Q+ITEA+GTEEAEADAEYDNAL
Sbjct  119   HLTATIQLLKKAGRPSERLVSHENCKFREPKKHECVHVQEITEAAGTEEAEADAEYDNAL  178

Query  475   REAIKGVQDAVTVINEHLEEVRYEIAALE  389
             +EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  179   KEAIRGVQDAVTAINEHLEEVRYEIAALE  207



>ref|XP_007010648.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19458.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=219

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQV-LEMESQFLSPDCFREDLAALLRSVQ  677
            K GF +YM SG E AYQ+LCSEITV+F DCSKQV LEMES FLSPD  R DLA LLRSVQ
Sbjct  62   KTGFSEYMNSGGELAYQQLCSEITVKFKDCSKQVVLEMESLFLSPDYCRVDLAQLLRSVQ  121

Query  676  TQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaead  497
            TQEKQKL+LTATIQ+LKKAGRPSERLVSHENC F KPM HECVH+ +ITEASGTE+AEA+
Sbjct  122  TQEKQKLHLTATIQLLKKAGRPSERLVSHENCLFKKPMEHECVHVHEITEASGTEDAEAN  181

Query  496  aeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            AEYDNAL+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  182  AEYDNALKEAIRGVQDAVTAINEHLEEVRYEIAALE  217



>gb|EPS68193.1| hypothetical protein M569_06579, partial [Genlisea aurea]
Length=182

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFEDY+VSG ESAY +LCSEIT+EFNDCSKQVLE+ESQF +PDC REDLA LLRSVQ 
Sbjct  29   KRGFEDYIVSGGESAYLQLCSEITLEFNDCSKQVLEIESQFTNPDCRREDLARLLRSVQE  88

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEK+KL+LTA IQV+KK+GRPSERLVSH+NCRF +P  HECVHIQ+ITEA GTEEAEADA
Sbjct  89   QEKEKLHLTARIQVMKKSGRPSERLVSHDNCRFREPTRHECVHIQQITEALGTEEAEADA  148

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAAL  392
            +YD  L+ AIKGVQDAV  IN+++EEVRYEIA L
Sbjct  149  QYDGDLKAAIKGVQDAVVAINDYMEEVRYEIAGL  182



>ref|NP_001234981.1| uncharacterized protein LOC100306178 [Glycine max]
 gb|ACU14238.1| unknown [Glycine max]
Length=216

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF DYM SG E AY++LCSEIT+EFN+CSK+VLEMES F SPD  R DLA LLR+VQ 
Sbjct  60   KSGFSDYMASGGELAYKQLCSEITIEFNNCSKKVLEMESLFRSPDYCRVDLAQLLRAVQD  119

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL LT TIQVLKKAGRPSERLVSHENC+F+KP  HECVH+Q+ITEASGTEEAEADA
Sbjct  120  QEKQKLQLTTTIQVLKKAGRPSERLVSHENCKFTKPAEHECVHVQEITEASGTEEAEADA  179

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAV  INEHLEEVRYEIAALE
Sbjct  180  EYDNALKEAIRGVQDAVMAINEHLEEVRYEIAALE  214



>ref|XP_004499602.1| PREDICTED: uncharacterized protein LOC101511339 [Cicer arietinum]
Length=204

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 172/209 (82%), Gaps = 12/209 (6%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             +FEKKV+I D MEEV+++            +KI VLLR FL +QQRRAQAY++LK GF D
Sbjct  6     DFEKKVSINDTMEEVIDS------------TKIVVLLRDFLEIQQRRAQAYSKLKSGFSD  53

Query  835   YMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQEKQKL  656
             YM SG E AYQKLCSEIT+EFN CSK+VLEMES F SPD  R DLA +LR+VQ QEKQKL
Sbjct  54    YMTSGGELAYQKLCSEITIEFNVCSKKVLEMESLFQSPDYSRVDLAQILRAVQDQEKQKL  113

Query  655   NLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaeydnAL  476
             +LTATIQ+LKKAG PSERLVSHENC+F+KP  HECV++++ITEASGTEEAEADAEYDNAL
Sbjct  114   HLTATIQLLKKAGPPSERLVSHENCKFTKPTEHECVNVKEITEASGTEEAEADAEYDNAL  173

Query  475   REAIKGVQDAVTVINEHLEEVRYEIAALE  389
              EAI+ VQDAV  INEHLEEVRYEIAALE
Sbjct  174   NEAIRSVQDAVMAINEHLEEVRYEIAALE  202



>ref|XP_006423773.1| hypothetical protein CICLE_v10029282mg [Citrus clementina]
 gb|ESR37013.1| hypothetical protein CICLE_v10029282mg [Citrus clementina]
Length=209

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 174/209 (83%), Gaps = 4/209 (2%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             +FEKKV I D ME           +  + +SK   LLR FL +QQRRAQAYA+LKRGF +
Sbjct  3     DFEKKVTITDAME----MEEMDIEQANNNSSKTLQLLRTFLDIQQRRAQAYAKLKRGFSE  58

Query  835   YMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQEKQKL  656
             YM+SG E AYQ+LCSEIT EFNDCSKQVLE+ES FL+PD  R DLA LLR+VQTQEKQKL
Sbjct  59    YMISGGELAYQQLCSEITSEFNDCSKQVLEIESLFLNPDFCRVDLAQLLRAVQTQEKQKL  118

Query  655   NLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaeydnAL  476
             +LTATIQ+LKKAGRPSERLVSHENC+F +P  HECVH+Q+ITEA+GTEEAEADAEYDNAL
Sbjct  119   HLTATIQLLKKAGRPSERLVSHENCKFREPKKHECVHVQEITEAAGTEEAEADAEYDNAL  178

Query  475   REAIKGVQDAVTVINEHLEEVRYEIAALE  389
             +EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  179   KEAIRGVQDAVTAINEHLEEVRYEIAALE  207



>gb|KHG27165.1| hypothetical protein F383_02294 [Gossypium arboreum]
Length=207

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +YM SG E AYQ+LCSEITVEFNDCSKQVLEMES FL+PD  R DLA LLR++QT
Sbjct  51   KTGFSEYMKSGGELAYQQLCSEITVEFNDCSKQVLEMESLFLNPDYCRVDLAELLRAIQT  110

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQVLKKAGRPSERLV+HENC F KPM HECVH+Q+ITEA+GTEEAEA+A
Sbjct  111  QEKQKLHLTATIQVLKKAGRPSERLVNHENCSFKKPMEHECVHLQEITEAAGTEEAEANA  170

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  171  EYDNALKEAIRGVQDAVTAINEHLEEVRYEIAALE  205



>ref|XP_010907489.1| PREDICTED: uncharacterized protein C19orf60 homolog isoform X1 
[Elaeis guineensis]
Length=204

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQ LC EIT EFNDCSKQVLEMES  L PD +R+DLA LLR+VQ 
Sbjct  48   QRGFSEYMTNGGELAYQNLCGEITAEFNDCSKQVLEMESLLLMPDLYRDDLAGLLRAVQE  107

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTA IQ+LKKAGRPSERLVSHE+CRF +P  HECVH++KITEA+GTE+AEADA
Sbjct  108  QEKQKLHLTARIQILKKAGRPSERLVSHEHCRFDQPQQHECVHVRKITEAAGTEDAEADA  167

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+GVQDAVT IN+HLEE+RYEI ALE
Sbjct  168  EYDGALKEAIRGVQDAVTSINDHLEEIRYEIEALE  202



>emb|CBI29132.3| unnamed protein product [Vitis vinifera]
Length=190

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF DYMVSG ESAYQ+LC+EITVEFN+CSKQVLEMES FL PD  R+DLA LLRSVQ 
Sbjct  34   RRGFADYMVSGGESAYQQLCNEITVEFNECSKQVLEMESLFLDPDYGRDDLAHLLRSVQN  93

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKAGRPSERLVSHE C+F  P GHECVH+ +ITEA+GTEEAEADA
Sbjct  94   QEKQKLHLTATIQLLKKAGRPSERLVSHEKCKFKNPEGHECVHVHEITEAAGTEEAEADA  153

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL EAI+GVQDAVT IN+HLEE++YEIAALE
Sbjct  154  EYDNALNEAIRGVQDAVTTINDHLEEIKYEIAALE  188



>ref|XP_002274914.1| PREDICTED: uncharacterized protein LOC100255669 [Vitis vinifera]
 emb|CAN69816.1| hypothetical protein VITISV_026899 [Vitis vinifera]
Length=203

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF DYMVSG ESAYQ+LC+EITVEFN+CSKQVLEMES FL PD  R+DLA LLRSVQ 
Sbjct  47   RRGFADYMVSGGESAYQQLCNEITVEFNECSKQVLEMESLFLDPDYGRDDLAHLLRSVQN  106

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKAGRPSERLVSHE C+F  P GHECVH+ +ITEA+GTEEAEADA
Sbjct  107  QEKQKLHLTATIQLLKKAGRPSERLVSHEKCKFKNPEGHECVHVHEITEAAGTEEAEADA  166

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL EAI+GVQDAVT IN+HLEE++YEIAALE
Sbjct  167  EYDNALNEAIRGVQDAVTTINDHLEEIKYEIAALE  201



>ref|XP_008811764.1| PREDICTED: uncharacterized protein LOC103722845 [Phoenix dactylifera]
 ref|XP_008811765.1| PREDICTED: uncharacterized protein LOC103722845 [Phoenix dactylifera]
Length=204

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  850  RGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQ  671
            RGF +YM +G E +YQ+LC EITVEFNDCSKQVLEMES  L PD  R+DLA LLR VQ Q
Sbjct  49   RGFSEYMTNGGELSYQQLCGEITVEFNDCSKQVLEMESLLLMPDLCRDDLAGLLRDVQAQ  108

Query  670  EKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadae  491
            EKQKL+LTA+IQ+LKKAGRPSERLVSHE+CRF+KP  HECVH++KITE +GTE+AEADAE
Sbjct  109  EKQKLHLTASIQILKKAGRPSERLVSHEHCRFNKPQQHECVHVRKITEDAGTEDAEADAE  168

Query  490  ydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            YD AL+EAI+GVQDAVT INEHLEEVRYEI ALE
Sbjct  169  YDGALKEAIRGVQDAVTSINEHLEEVRYEIEALE  202



>gb|KHN48489.1| hypothetical protein glysoja_040620 [Glycine soja]
Length=205

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQE  668
            GF DYM SG E AY++LCSEIT+EFNDCSK+VLEMES F SPD  R DLA LLR+VQ QE
Sbjct  51   GFSDYMASGGELAYKQLCSEITIEFNDCSKKVLEMESLFTSPDYCRVDLAQLLRAVQDQE  110

Query  667  KQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaey  488
            K KL LTATIQVLKKAGRPSERLVSHENC+F+KP  HECVH+Q+ITEASGTEEAEADAEY
Sbjct  111  KLKLQLTATIQVLKKAGRPSERLVSHENCKFTKPAEHECVHVQEITEASGTEEAEADAEY  170

Query  487  dnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            DNAL+EAI+GVQDAV  INE +EEVRYEIAALE
Sbjct  171  DNALKEAIRGVQDAVMAINERMEEVRYEIAALE  203



>gb|KEH32828.1| hypothetical protein MTR_3g006790 [Medicago truncatula]
Length=204

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 169/209 (81%), Gaps = 12/209 (6%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             +F KKV+I D   EVV++            +KI VLLR FL +QQRRAQAY++LK GF D
Sbjct  6     DFGKKVSINDDTMEVVDS------------TKIVVLLRSFLDIQQRRAQAYSKLKSGFSD  53

Query  835   YMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQEKQKL  656
             YM SG E AYQ+LC  IT EFNDCSK+V EMES F SPD  R DLA +LR+VQ QEKQKL
Sbjct  54    YMTSGGELAYQQLCGGITSEFNDCSKKVREMESLFQSPDYSRIDLAQILRAVQEQEKQKL  113

Query  655   NLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaeydnAL  476
             +LTAT+Q+LKKAGRPSERLVSHENC+F+KP  HECVH+++ITEASGTEEAEADAEYDNAL
Sbjct  114   HLTATLQLLKKAGRPSERLVSHENCKFTKPTEHECVHVKEITEASGTEEAEADAEYDNAL  173

Query  475   REAIKGVQDAVTVINEHLEEVRYEIAALE  389
              EAI+GVQDAV VINEHLEEVRYEIAALE
Sbjct  174   NEAIRGVQDAVNVINEHLEEVRYEIAALE  202



>ref|XP_010558238.1| PREDICTED: uncharacterized protein LOC104826955 [Tarenaya hassleriana]
Length=218

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +YM +G ES YQKLCSEITVEF DCSKQV EME+ FL+P+  R DLA LLR++QT
Sbjct  62   KRGFSEYMETGAESPYQKLCSEITVEFGDCSKQVREMETLFLNPELGRADLAELLRNIQT  121

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQVLKKAGRPSER+++HE C+F KPM HECVH+ +ITEA GTE+AEADA
Sbjct  122  QEKQKLHLTATIQVLKKAGRPSERVLTHEKCKFKKPMEHECVHLHEITEAVGTEDAEADA  181

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            EYDNAL+EAI+GVQ+AVT INE LEE+RYEIAALED
Sbjct  182  EYDNALKEAIRGVQEAVTSINESLEEIRYEIAALED  217



>ref|XP_010031339.1| PREDICTED: uncharacterized protein C19orf60 homolog [Eucalyptus 
grandis]
Length=210

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +YMVSG E AYQ+LC EIT EFNDCSKQV+EMES F++PD  R DLA +LR+VQ 
Sbjct  54   KSGFAEYMVSGGEVAYQQLCGEITAEFNDCSKQVIEMESLFMAPDYGRVDLAQMLRAVQV  113

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKA RPSERLVSHENC F KPM H CVH+ +ITEA GTEE EADA
Sbjct  114  QEKQKLHLTATIQLLKKASRPSERLVSHENCTFKKPMQHNCVHLHEITEAEGTEEVEADA  173

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL EAI+GVQDAVT INEHLEEVRYEI ALE
Sbjct  174  EYDNALNEAIRGVQDAVTTINEHLEEVRYEIEALE  208



>gb|KDP41061.1| hypothetical protein JCGZ_03167 [Jatropha curcas]
Length=211

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF++YMVSG E AYQ+LCSEITVEFNDCSKQVLEMES F +PD  R DLA LLR+VQT
Sbjct  55   KRGFDEYMVSGGELAYQQLCSEITVEFNDCSKQVLEMESLFQNPDFSRHDLAQLLRAVQT  114

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EKQKL+LTATIQVLKKAGRPSERLVSHENCRF KP+ HECVH+ +ITEA+GTEEAEADA
Sbjct  115  YEKQKLDLTATIQVLKKAGRPSERLVSHENCRFKKPLEHECVHVHEITEAAGTEEAEADA  174

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQD V  INEH+EEV+YEIAAL+
Sbjct  175  EYDNALKEAIRGVQDVVIAINEHIEEVKYEIAALD  209



>ref|XP_009391634.1| PREDICTED: uncharacterized protein LOC103977756 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQ+LC EITVEFNDCSK+VLEMES  L PD  R DLA LL++VQ 
Sbjct  49   RRGFTEYMSNGGELAYQQLCKEITVEFNDCSKEVLEMESLLLMPDLSRGDLADLLKAVQA  108

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTA IQ+LKKAGRPSERLVSHENCRF KP  HECVH+ +ITEA+GTE+AEADA
Sbjct  109  QEKQKLHLTARIQILKKAGRPSERLVSHENCRFEKPTEHECVHVHEITEAAGTEDAEADA  168

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI GVQDAVT INEHLEEVRYEI ALE
Sbjct  169  EYDGALKEAICGVQDAVTNINEHLEEVRYEIEALE  203



>ref|XP_004135056.1| PREDICTED: uncharacterized protein LOC101210078 [Cucumis sativus]
 ref|XP_004162723.1| PREDICTED: uncharacterized LOC101210078 [Cucumis sativus]
 gb|KGN52147.1| hypothetical protein Csa_5G612270 [Cucumis sativus]
Length=203

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF++YM SG E +YQ+LCSEIT EF++CSKQV+++ES F S D  R +LA  LRSVQ 
Sbjct  47   KRGFDEYMTSGREISYQQLCSEITTEFSNCSKQVIDIESNFRSSDHNRLELANQLRSVQE  106

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTA IQ+LKKAGRPSERLVSHENCRF+ P  HECVH+ +ITEASGTEEAEADA
Sbjct  107  QEKQKLHLTAQIQLLKKAGRPSERLVSHENCRFNAPREHECVHVHEITEASGTEEAEADA  166

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            EYDNAL+EAIKGVQDAVT INEH+EEVRYEI ALED
Sbjct  167  EYDNALKEAIKGVQDAVTTINEHMEEVRYEIEALED  202



>ref|XP_007141036.1| hypothetical protein PHAVU_008G161900g [Phaseolus vulgaris]
 gb|ESW13030.1| hypothetical protein PHAVU_008G161900g [Phaseolus vulgaris]
Length=213

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF DYM +G E AY++LCSE+T+EFNDCSK+VLEME  F S D  REDLA LLR+VQ 
Sbjct  56   KRGFSDYMANGGELAYKQLCSEMTIEFNDCSKKVLEMEGLFRSSDYCREDLAQLLRAVQD  115

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQ L LT TIQ+LKKAGRPSERLVSHENC+F+KP  HECV++Q+ITEASGTEEAEADA
Sbjct  116  QEKQNLLLTVTIQMLKKAGRPSERLVSHENCKFTKPTEHECVNVQEITEASGTEEAEADA  175

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALEDC  383
            EYDNAL E+I+GVQD V  INEHLEEVRYEIAAL++ 
Sbjct  176  EYDNALNESIRGVQDVVMTINEHLEEVRYEIAALDNA  212



>ref|XP_008446706.1| PREDICTED: protein Daple [Cucumis melo]
Length=203

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF++YM SG E +YQ+LCSEIT EF++CSKQV+++ES F + D  R +LA LLRSVQ 
Sbjct  47   KRGFDEYMTSGREISYQQLCSEITTEFSNCSKQVIDIESNFRNSDHNRLELANLLRSVQE  106

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTA IQ+LKKAGRPSERLVSHENCR + P  HECVH+ +ITEASGTEEAEADA
Sbjct  107  QEKQKLHLTAQIQLLKKAGRPSERLVSHENCRINAPREHECVHVHEITEASGTEEAEADA  166

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            EYDNAL+EAIKGVQDAVT IN+H+EEVRYEI ALED
Sbjct  167  EYDNALKEAIKGVQDAVTTINDHMEEVRYEIEALED  202



>ref|XP_010666652.1| PREDICTED: uncharacterized protein LOC104883787 [Beta vulgaris 
subsp. vulgaris]
Length=206

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            + GF  Y +SG ES YQ+LCSEITVEF+DCSKQV E+ESQFL PDC R+DLA LLR+VQ 
Sbjct  50   RDGFAAYTISGAESTYQQLCSEITVEFSDCSKQVCEVESQFLKPDCSRDDLARLLRAVQE  109

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             E+ KL LTA +QVLKKAGRPSERLV+HENC + KP  HECVH+ ++T+A+GTEEAEADA
Sbjct  110  LERVKLQLTARMQVLKKAGRPSERLVTHENCSYKKPAQHECVHVHELTDAAGTEEAEADA  169

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            +YDNA++EAIKGVQ+AVT INEHLEEVRYEIAALE
Sbjct  170  DYDNAVKEAIKGVQEAVTSINEHLEEVRYEIAALE  204



>emb|CDX98801.1| BnaC09g50340D [Brassica napus]
Length=216

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +Y+ +  E+ YQKLCSEIT EFN+CSKQV EME+ FL+PD  R DLA LL  +QT
Sbjct  60   KRGFSEYVETSGEALYQKLCSEITAEFNECSKQVREMETLFLTPDVGRSDLAQLLSDIQT  119

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITE +GTEEAEADA
Sbjct  120  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEDAGTEEAEADA  179

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE+VRYEIAALE
Sbjct  180  EFDNALKEAIRGVQDAVTCINEYLEDVRYEIAALE  214



>gb|EYU42899.1| hypothetical protein MIMGU_mgv1a0140421mg, partial [Erythranthe 
guttata]
Length=145

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 10/153 (7%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQE  668
            GFED M          LCSEIT+EFNDCSKQVLEMES F+SPDC REDLA LL+SVQ QE
Sbjct  1    GFEDNM----------LCSEITLEFNDCSKQVLEMESLFVSPDCCREDLANLLKSVQAQE  50

Query  667  KQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaey  488
            K+KL+LTATIQVLKK+GRPSERLVSHENC   +  GHEC+HIQ+ITEASGTEEAEADA+Y
Sbjct  51   KEKLHLTATIQVLKKSGRPSERLVSHENCTIRQSTGHECMHIQQITEASGTEEAEADAQY  110

Query  487  dnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            D+AL+EAIKGVQDAV  INE+LEE+RYEIAALE
Sbjct  111  DSALKEAIKGVQDAVVAINEYLEEIRYEIAALE  143



>ref|XP_007010650.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY19460.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=209

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 131/155 (85%), Gaps = 9/155 (6%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +YM SG E AYQ+LCSEITV         LEMES FLSPD  R DLA LLRSVQT
Sbjct  62   KTGFSEYMNSGGELAYQQLCSEITV---------LEMESLFLSPDYCRVDLAQLLRSVQT  112

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKAGRPSERLVSHENC F KPM HECVH+ +ITEASGTE+AEA+A
Sbjct  113  QEKQKLHLTATIQLLKKAGRPSERLVSHENCLFKKPMEHECVHVHEITEASGTEDAEANA  172

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173  EYDNALKEAIRGVQDAVTAINEHLEEVRYEIAALE  207



>ref|XP_010247157.1| PREDICTED: uncharacterized protein LOC104590267 [Nelumbo nucifera]
Length=210

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YMV G +SAYQ+LC+EITVEFNDCSK VLEMES  L+P+  R DLA LLR VQ 
Sbjct  54   RRGFAEYMVGGRDSAYQQLCNEITVEFNDCSKHVLEMESLLLNPEYCRNDLAHLLRLVQE  113

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTA IQVLKK GRPSER+VSHE+CRF   + HECVH+ +ITEA+GTEEAEADA
Sbjct  114  QEKQKLHLTAKIQVLKKIGRPSERIVSHEHCRFRNLVEHECVHVHEITEATGTEEAEADA  173

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            +YDNAL+EAI+GVQDAVT INE+LEEVRYEI ALE
Sbjct  174  DYDNALKEAIRGVQDAVTSINEYLEEVRYEIDALE  208



>gb|KCW50600.1| hypothetical protein EUGRSUZ_J00312 [Eucalyptus grandis]
Length=201

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +YMVSG E AYQ+LC EIT EFNDCSKQV+EMES F++PD  R DLA +LR+VQ 
Sbjct  54   KSGFAEYMVSGGEVAYQQLCGEITAEFNDCSKQVIEMESLFMAPDYGRVDLAQMLRAVQV  113

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LTATIQ+LKKA RPSERLVSHENC F KPM H CVH+ +ITEA GTEE EADA
Sbjct  114  QEKQKLHLTATIQLLKKASRPSERLVSHENCTFKKPMQHNCVHLHEITEAEGTEEVEADA  173

Query  493  eydnALREAIKGVQDAVTVINEHLEEV  413
            EYDNAL EAI+GVQDAVT INEHLEEV
Sbjct  174  EYDNALNEAIRGVQDAVTTINEHLEEV  200



>ref|XP_008231903.1| PREDICTED: uncharacterized protein LOC103331067 [Prunus mume]
Length=213

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 4/159 (3%)
 Frame = -3

Query  853  KRGFEDYMV-SGV--ESAYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALLR  686
            KRGF +YMV SG   E AYQ++CSE+T+EFN+CSK VL +ES FL+ PD  R DLA LLR
Sbjct  53   KRGFGEYMVCSGAHGELAYQQVCSEVTLEFNECSKHVLRIESLFLNDPDYGRVDLAHLLR  112

Query  685  SVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeea  506
            +VQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRF KPM HECVH+ +ITEA+GTEEA
Sbjct  113  AVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFKKPMEHECVHLHEITEAAGTEEA  172

Query  505  eadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EADA+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173  EADAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  211



>ref|XP_006829871.1| hypothetical protein AMTR_s00119p00136700 [Amborella trichopoda]
 gb|ERM97287.1| hypothetical protein AMTR_s00119p00136700 [Amborella trichopoda]
Length=150

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  832  MVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQEKQKLN  653
            MV+G ++ YQ+LCSEITVEFNDCSKQV+E+ESQF +P   R DLA++L++VQ QEKQKL+
Sbjct  1    MVNGSDATYQQLCSEITVEFNDCSKQVVELESQFSNPYFCRGDLASILKAVQAQEKQKLH  60

Query  652  LTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaeydnALR  473
            +TA IQVLKKAGRPSERLVSHE CRF +P  H CVH+ +ITEASGTE+AE DA YD AL+
Sbjct  61   MTAKIQVLKKAGRPSERLVSHERCRFDRPAEHRCVHLHEITEASGTEDAEVDAAYDEALK  120

Query  472  EAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EAI+GVQDAVT+IN+HLEEV+YEI ALE
Sbjct  121  EAIRGVQDAVTIINDHLEEVQYEIEALE  148



>ref|XP_007218386.1| hypothetical protein PRUPE_ppa011354mg [Prunus persica]
 gb|EMJ19585.1| hypothetical protein PRUPE_ppa011354mg [Prunus persica]
Length=214

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 5/160 (3%)
 Frame = -3

Query  853  KRGFEDYMVS--GV--ESAYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALL  689
            KRGF +YMVS  G   E AYQ++CSE+T+EFN+CSK VL +ES FL+ PD  R DLA LL
Sbjct  53   KRGFGEYMVSCSGAHGELAYQQVCSEVTLEFNECSKHVLRIESLFLNDPDYGRVDLAHLL  112

Query  688  RSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTee  509
            R+VQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRF KPM HECVH+ +ITEA+GTEE
Sbjct  113  RAVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFKKPMEHECVHLHEITEAAGTEE  172

Query  508  aeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            AEADA+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173  AEADAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  212



>ref|XP_008346101.1| PREDICTED: uncharacterized protein LOC103409057 [Malus domestica]
 ref|XP_008346108.1| PREDICTED: uncharacterized protein LOC103409057 [Malus domestica]
Length=211

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 175/217 (81%), Gaps = 18/217 (8%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             EF+KKV+I D ME+          E+ +  +K   LLR FL +QQRRA+AYA+LKRGF +
Sbjct  3     EFDKKVSITDPMEQ----------ESVASKTKTVGLLREFLGIQQRRAEAYAKLKRGFGE  52

Query  835   YM-----VSGVES--AYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALLRSV  680
             YM      SGV++  AYQ++CSE+T+EFN+CSKQVL +ES FL+ PD  R DLA LLR+V
Sbjct  53    YMESSPPSSGVDAELAYQQVCSEVTLEFNECSKQVLRIESLFLNDPDFSRIDLAHLLRAV  112

Query  679   QTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaea  500
             QT EKQKLNLT TIQVLK+AGRPSERLVSHENCRF++PM HECVH+ +ITEA+GTEEAEA
Sbjct  113   QTHEKQKLNLTVTIQVLKRAGRPSERLVSHENCRFNRPMEHECVHLHEITEAAGTEEAEA  172

Query  499   daeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
             +A+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173   NAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  209



>emb|CDX70185.1| BnaA10g25340D [Brassica napus]
Length=216

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +Y+ +  E+ YQKLCSEIT EFN+CSKQV EME+ FL+PD  R DLA LL  +QT
Sbjct  60   KRGFSEYVETSGEALYQKLCSEITAEFNECSKQVREMETLFLNPDVGRSDLAQLLSDIQT  119

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA GTEEAEADA
Sbjct  120  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAEGTEEAEADA  179

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE+VRYEIAALE
Sbjct  180  EFDNALKEAIRGVQDAVTCINEYLEDVRYEIAALE  214



>ref|XP_006398947.1| hypothetical protein EUTSA_v10014633mg [Eutrema salsugineum]
 gb|ESQ40400.1| hypothetical protein EUTSA_v10014633mg [Eutrema salsugineum]
Length=218

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +Y+ S  E+ YQKLCSEIT EFN+CSKQV EMES FL+P+  R DLA LL  +QT
Sbjct  62   KRGFSEYVESSAEAIYQKLCSEITAEFNECSKQVREMESLFLNPELGRADLAQLLGDIQT  121

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  122  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  181

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAVT INE+LE++RYEIAALE
Sbjct  182  EYDNALKEAIRGVQDAVTCINEYLEDIRYEIAALE  216



>ref|XP_009122552.1| PREDICTED: uncharacterized protein LOC103847244 [Brassica rapa]
Length=216

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +Y+ +  E+ YQKLCSEIT EFN+CSKQV EME+ FL+PD  R DLA LL  +QT
Sbjct  60   KRGFSEYVETSGEALYQKLCSEITAEFNECSKQVREMETLFLNPDVGRSDLAQLLSDIQT  119

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA GTEEAEADA
Sbjct  120  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAEGTEEAEADA  179

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE+VRYEIAALE
Sbjct  180  EFDNALKEAIRGVQDAVTCINEYLEDVRYEIAALE  214



>gb|ABV89667.1| hypothetical protein at5g04910 [Brassica rapa]
Length=196

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +Y+ +  E+ YQKLCSEIT EFN+CSKQV EME+ FL+PD  R DLA LL  +QT
Sbjct  40   KRGFSEYVETSGEALYQKLCSEITAEFNECSKQVREMETLFLNPDVGRSDLAQLLSDIQT  99

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA GTEEAEADA
Sbjct  100  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAEGTEEAEADA  159

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+E I+GVQDAVT INE+LE+VRYEIAALE
Sbjct  160  EFDNALKEVIRGVQDAVTCINEYLEDVRYEIAALE  194



>ref|XP_009355057.1| PREDICTED: uncharacterized protein LOC103946147 [Pyrus x bretschneideri]
Length=211

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 171/217 (79%), Gaps = 18/217 (8%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             EF+KKV+I D MEE          E+ +  +K   LLR FL +QQRRA+AYA+LKRGF +
Sbjct  3     EFDKKVSITDPMEE----------ESVASKTKTVALLREFLGIQQRRAEAYAKLKRGFGE  52

Query  835   YMVSG-------VESAYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALLRSV  680
              M S         E AYQ++CSE+T+EFN+CSKQVL +ES FL+ PD  R DLA LLR+V
Sbjct  53    DMESSPPSSAVDAELAYQQVCSEVTLEFNECSKQVLRIESLFLNDPDFSRIDLAHLLRAV  112

Query  679   QTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaea  500
             QT EKQKLNLT TIQVLK+AGRPSERLVSHENCRF++PM HECVH+ +ITEA+GTEEAEA
Sbjct  113   QTHEKQKLNLTVTIQVLKRAGRPSERLVSHENCRFNRPMEHECVHLHEITEAAGTEEAEA  172

Query  499   daeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
             +A+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173   NAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  209



>ref|XP_009350994.1| PREDICTED: uncharacterized protein LOC103942535 [Pyrus x bretschneideri]
 ref|XP_009350995.1| PREDICTED: uncharacterized protein LOC103942535 [Pyrus x bretschneideri]
 ref|XP_009350997.1| PREDICTED: uncharacterized protein LOC103942535 [Pyrus x bretschneideri]
 ref|XP_009350998.1| PREDICTED: uncharacterized protein LOC103942535 [Pyrus x bretschneideri]
 ref|XP_009350999.1| PREDICTED: uncharacterized protein LOC103942535 [Pyrus x bretschneideri]
 ref|XP_009351000.1| PREDICTED: uncharacterized protein LOC103942535 [Pyrus x bretschneideri]
Length=211

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 174/217 (80%), Gaps = 18/217 (8%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             EF+KKV+I D MEE          E+ +  +K   LLR FL +QQRRA+AYA+LKRGF +
Sbjct  3     EFDKKVSITDPMEE----------ESVASKTKTVALLREFLGIQQRRAEAYAKLKRGFGE  52

Query  835   YM-----VSGVES--AYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALLRSV  680
             YM      SGV++  A Q++CSE+T+EFN+CSKQVL +ES FL+ PD  R DLA LLR+V
Sbjct  53    YMESSPPSSGVDAELACQQVCSEVTLEFNECSKQVLRIESLFLNDPDFSRIDLAHLLRAV  112

Query  679   QTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaea  500
             QT EKQKLNLT TIQVLK+AGRPSERLVSHENCRF++PM HECVH+ +ITEA+GTEEAEA
Sbjct  113   QTHEKQKLNLTVTIQVLKRAGRPSERLVSHENCRFNRPMEHECVHLHEITEAAGTEEAEA  172

Query  499   daeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
             +A+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173   NAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  209



>ref|XP_002871123.1| hypothetical protein ARALYDRAFT_487277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47382.1| hypothetical protein ARALYDRAFT_487277 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQ LCSEIT EF++CSKQV EMESQFL+P+  R DLA LL  +QT
Sbjct  66   KSGFSEYVESGAEALYQTLCSEITTEFSECSKQVREMESQFLNPEVGRADLAQLLSDIQT  125

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  126  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  185

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  186  EFDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  220



>ref|XP_006578408.1| PREDICTED: uncharacterized protein LOC100818042 [Glycine max]
Length=222

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQE  668
            GF DYM SG E AY++LCSEIT+EFNDCSK+VLEMES F SPD  R DLA LLR++Q QE
Sbjct  51   GFSDYMASGGELAYKQLCSEITIEFNDCSKKVLEMESLFTSPDYCRVDLAQLLRAIQDQE  110

Query  667  KQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaey  488
            K KL LTATIQVLKKAGRPSERLVSHENC+F+KP  HECVH+Q+ITEASGTEEAEADAEY
Sbjct  111  KLKLQLTATIQVLKKAGRPSERLVSHENCKFTKPAEHECVHVQEITEASGTEEAEADAEY  170

Query  487  dnALREAIKGVQDAVTVINE  428
            DNAL+EAI+GVQDAV  INE
Sbjct  171  DNALKEAIRGVQDAVMAINE  190



>ref|NP_196111.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE66130.1| hypothetical protein At5g04910 [Arabidopsis thaliana]
 gb|AED90803.1| uncharacterized protein AT5G04910 [Arabidopsis thaliana]
Length=222

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQKLCSEIT EF++CSKQV EMES FL+P+  R DLA LL  +QT
Sbjct  66   KSGFSEYVESGAEALYQKLCSEITTEFSECSKQVREMESLFLNPEVGRADLAKLLSDIQT  125

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  126  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  185

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  186  EFDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  220



>gb|ABK28681.1| unknown [Arabidopsis thaliana]
Length=223

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQKLCSEIT EF++CSKQV EMES FL+P+  R DLA LL  +QT
Sbjct  66   KSGFSEYVESGAEAFYQKLCSEITTEFSECSKQVREMESLFLNPEVGRADLAKLLSDIQT  125

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  126  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  185

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  186  EFDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  220



>gb|KFK24931.1| hypothetical protein AALP_AA8G043600 [Arabis alpina]
Length=225

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF +Y+ S  E+ YQKLCSE+T EFN+CSKQV EMES FL+P+  R DLA LL  +QT
Sbjct  68   KRGFSEYVESSAEAIYQKLCSEVTAEFNECSKQVREMESMFLNPEIGRADLAQLLGDIQT  127

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER++SHENC+F KPM HECVH+ +ITEA GTEEAEADA
Sbjct  128  QEKQKLHLTVTIQVLKKAGRPSERMLSHENCKFKKPMQHECVHLHEITEAEGTEEAEADA  187

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE LE++RYEI ALE
Sbjct  188  EFDNALKEAIQGVQDAVTCINECLEDIRYEIDALE  222



>ref|XP_010423517.1| PREDICTED: uncharacterized protein LOC104708622 [Camelina sativa]
Length=221

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQKLCSEIT EF++CSKQV EMES FL P+  R DLA LL  +Q+
Sbjct  65   KSGFSEYVESGAEALYQKLCSEITAEFSECSKQVREMESLFLKPEFGRADLAQLLLDIQS  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  125  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  185  EFDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  219



>ref|XP_010452393.1| PREDICTED: uncharacterized protein LOC104734498 [Camelina sativa]
Length=221

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQKLCSEIT EF++CSKQV EMES FL P+  R DLA LL  +Q+
Sbjct  65   KSGFSEYVESGAEALYQKLCSEITAEFSECSKQVREMESLFLKPEFGRADLAQLLLDIQS  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  125  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  185  EFDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  219



>ref|XP_006288639.1| hypothetical protein CARUB_v10001943mg [Capsella rubella]
 gb|EOA21537.1| hypothetical protein CARUB_v10001943mg [Capsella rubella]
Length=215

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E  YQKLCSEIT EF++CSKQV EMES FL+P+  R DLA LL  +QT
Sbjct  59   KSGFSEYVESGAEPLYQKLCSEITAEFSECSKQVREMESLFLNPEVGRADLAQLLSDIQT  118

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT T QVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  119  QEKQKLHLTVTKQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  178

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYDNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  179  EYDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  213



>ref|XP_010491020.1| PREDICTED: uncharacterized protein LOC104768688 [Camelina sativa]
Length=221

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQKLCSEIT EF++CSKQV EMES FL P+  R DLA LL  +Q+
Sbjct  65   KSGFSEYVESGAEALYQKLCSEITAEFSECSKQVREMESLFLKPEFGRADLAQLLLDIQS  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+LT TIQVLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA GTEEAEADA
Sbjct  125  QEKQKLHLTVTIQVLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAEGTEEAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDA+T INE+LE +RYEI ALE
Sbjct  185  EFDNALKEAIRGVQDALTSINEYLENIRYEIEALE  219



>ref|XP_002526323.1| hypothetical protein RCOM_0720210 [Ricinus communis]
 gb|EEF36059.1| hypothetical protein RCOM_0720210 [Ricinus communis]
Length=221

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 138/179 (77%), Gaps = 27/179 (15%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGF++YMVSG E AYQ+LCSEIT+EF+DCSKQVLEME  F +   +R DLA LLR+VQT
Sbjct  44   KRGFDEYMVSGGELAYQQLCSEITLEFSDCSKQVLEMEGLFQN---YRLDLAQLLRAVQT  100

Query  673  QEKQKLNL------------------------TATIQVLKKAGRPSERLVSHENCRFSKP  566
            QEK KL+L                        TATIQVLKKAG PSERLVSHENCRF+ P
Sbjct  101  QEKHKLHLFLASMFFFSSDKYNYIYPAPSVQKTATIQVLKKAGHPSERLVSHENCRFTMP  160

Query  565  MGHECVHIQKITEASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            M HECVH+ +ITEA+GTEEAEADAEYD AL+EAI+GVQDAVT IN+H+EEV+YEIAALE
Sbjct  161  MEHECVHVSEITEAAGTEEAEADAEYDAALKEAIRGVQDAVTAINDHIEEVKYEIAALE  219



>ref|XP_007218385.1| hypothetical protein PRUPE_ppa011354mg [Prunus persica]
 gb|EMJ19584.1| hypothetical protein PRUPE_ppa011354mg [Prunus persica]
Length=209

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 10/160 (6%)
 Frame = -3

Query  853  KRGFEDYMVS--GV--ESAYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALL  689
            KRGF +YMVS  G   E AYQ++CSE+T+EFN+CSK VL +ES FL+ PD  R DLA LL
Sbjct  53   KRGFGEYMVSCSGAHGELAYQQVCSEVTLEFNECSKHVLRIESLFLNDPDYGRVDLAHLL  112

Query  688  RSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTee  509
            R+VQTQEKQKLNL     VLKKAGRPSERLVSHENCRF KPM HECVH+ +ITEA+GTEE
Sbjct  113  RAVQTQEKQKLNL-----VLKKAGRPSERLVSHENCRFKKPMEHECVHLHEITEAAGTEE  167

Query  508  aeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            AEADA+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  168  AEADAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  207



>ref|XP_004306436.1| PREDICTED: uncharacterized protein LOC101315374 [Fragaria vesca 
subsp. vesca]
Length=207

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -3

Query  847  GFEDYMVSGVESA---YQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQ  677
            GF  YM S   SA   YQKLC ++T EF+DCS+QVL +ES FL P   R DLA LLR+VQ
Sbjct  50   GFARYMESSSSSAESAYQKLCGDVTQEFSDCSRQVLHLESLFLGPHYDRLDLAHLLRAVQ  109

Query  676  TQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaead  497
            T EKQKLNLTAT+Q+LKKAGRPSERLVSHENCRF KPM H+CVH+ +ITEA+GTEEAEA+
Sbjct  110  THEKQKLNLTATLQLLKKAGRPSERLVSHENCRFEKPMEHQCVHLHEITEAAGTEEAEAN  169

Query  496  aeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            A+YD  L+EAI+GVQD+VT INEHLEEVRYEIAA E
Sbjct  170  AQYDIDLKEAIRGVQDSVTAINEHLEEVRYEIAAHE  205



>gb|AGT16097.1| hypothetical protein SHCRBa_261_O20_R_210 [Saccharum hybrid cultivar 
R570]
Length=241

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQKLC  IT EFNDCSKQV+E+ S    P+  R DLA LL+ VQ 
Sbjct  65   RRGFSEYMANGGELAYQKLCGSITAEFNDCSKQVIEIISLLSMPEFSRSDLADLLKGVQA  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEK+KL+LTA IQVLKKAGRPSERLV+HE+CR      H CVH+++ITEA+GTE+AEADA
Sbjct  125  QEKEKLHLTAKIQVLKKAGRPSERLVNHEDCRSRSMAQHVCVHVKEITEAAGTEDAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+GVQ+AVT INEH+EEVRYEI  LE
Sbjct  185  EYDAALKEAIQGVQEAVTSINEHMEEVRYEIDGLE  219



>dbj|BAB11513.1| unnamed protein product [Arabidopsis thaliana]
Length=217

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 5/155 (3%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +Y+ SG E+ YQKLCSEIT EF++CSKQV EMES FL+P+  R DLA LL  +QT
Sbjct  66   KSGFSEYVESGAEALYQKLCSEITTEFSECSKQVREMESLFLNPEVGRADLAKLLSDIQT  125

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
            QEKQKL+L     VLKKAGRPSER+++HENC+F KPM HECVH+ +ITEA+GTEEAEADA
Sbjct  126  QEKQKLHL-----VLKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTEEAEADA  180

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            E+DNAL+EAI+GVQDAVT INE+LE++RYEI ALE
Sbjct  181  EFDNALKEAIRGVQDAVTSINEYLEDIRYEIEALE  215



>ref|XP_004248520.1| PREDICTED: uncharacterized protein LOC101254136 isoform X2 [Solanum 
lycopersicum]
Length=171

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 114/156 (73%), Gaps = 35/156 (22%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFEDYM SGVES YQ+LCSEIT EFNDCSKQ                           
Sbjct  51   KRGFEDYMASGVESTYQQLCSEITDEFNDCSKQ---------------------------  83

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
                    TATIQVLK+AGRPSER VSHENCRFSKP GHECVHIQKITEASGTEEAEADA
Sbjct  84   --------TATIQVLKRAGRPSERPVSHENCRFSKPTGHECVHIQKITEASGTEEAEADA  135

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALED  386
            E+DNAL+EAI GVQDAVT IN+HLEEVRYEIAALED
Sbjct  136  EFDNALKEAINGVQDAVTAINDHLEEVRYEIAALED  171



>gb|EAZ11347.1| hypothetical protein OsJ_01214 [Oryza sativa Japonica Group]
Length=211

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E A+Q+LC+ +T EFNDCSKQVLEM +   +P+  R DLA LL+ VQ 
Sbjct  35   RRGFSEYMANGGELAFQQLCASVTAEFNDCSKQVLEMVALLSTPEICRGDLANLLKDVQA  94

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EK+KL+LTA IQVLKKAGRPSERLV+H +CR S    H CVH+++ITEA+GTE+AEADA
Sbjct  95   HEKEKLHLTARIQVLKKAGRPSERLVNHADCRSSNMAQHVCVHVKEITEAAGTEDAEADA  154

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAAL  392
            EYD AL+EAI+GVQ+AVT INEH+EEVRYEI AL
Sbjct  155  EYDGALKEAIQGVQEAVTSINEHMEEVRYEIDAL  188



>ref|XP_002457615.1| hypothetical protein SORBIDRAFT_03g010370 [Sorghum bicolor]
 gb|EES02735.1| hypothetical protein SORBIDRAFT_03g010370 [Sorghum bicolor]
Length=230

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQKLC  IT EFNDCSKQV+E+ S    P+  R DLA LL+ VQ 
Sbjct  54   RRGFSEYMANGGELAYQKLCGSITAEFNDCSKQVIEIISLLSMPEFSRSDLADLLKGVQA  113

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EK+KL+LTA IQVLKKAGRPSERLV+HE+CR      H CVH+++ITEA+GTE+AEADA
Sbjct  114  HEKEKLHLTAKIQVLKKAGRPSERLVNHEDCRSRSMAQHVCVHVKEITEAAGTEDAEADA  173

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALEDCS*GT  371
            EYD AL+EAI+GVQ+AVT INEH+EEVRYEI  LE  + G+
Sbjct  174  EYDAALKEAIQGVQEAVTSINEHMEEVRYEIDGLEADTIGS  214



>ref|NP_001042671.1| Os01g0265700 [Oryza sativa Japonica Group]
 dbj|BAD81185.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04585.1| Os01g0265700 [Oryza sativa Japonica Group]
 gb|EAY73416.1| hypothetical protein OsI_01298 [Oryza sativa Indica Group]
 dbj|BAG99188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=241

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E A+Q+LC+ +T EFNDCSKQVLEM +   +P+  R DLA LL+ VQ 
Sbjct  65   RRGFSEYMANGGELAFQQLCASVTAEFNDCSKQVLEMVALLSTPEICRGDLANLLKDVQA  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EK+KL+LTA IQVLKKAGRPSERLV+H +CR S    H CVH+++ITEA+GTE+AEADA
Sbjct  125  HEKEKLHLTARIQVLKKAGRPSERLVNHADCRSSNMAQHVCVHVKEITEAAGTEDAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAAL  392
            EYD AL+EAI+GVQ+AVT INEH+EEVRYEI AL
Sbjct  185  EYDGALKEAIQGVQEAVTSINEHMEEVRYEIDAL  218



>ref|XP_004967763.1| PREDICTED: uncharacterized protein LOC101773260 [Setaria italica]
Length=242

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQ+LC  IT EFNDCSKQVLE+ S    PD  R DLA LL+ VQ 
Sbjct  66   RRGFSEYMANGGELAYQQLCGNITAEFNDCSKQVLEVISLLSMPDFCRSDLADLLKGVQA  125

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EK+KL+LTA IQVLKKAGRPSERLV+H +CR      H CVH+++ITEA+GTE+AEADA
Sbjct  126  HEKEKLHLTAKIQVLKKAGRPSERLVNHADCRSRSVTQHVCVHVKEITEAAGTEDAEADA  185

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+GVQ+AVT INEH+EEVRYEI ALE
Sbjct  186  EYDAALKEAIQGVQEAVTSINEHMEEVRYEIDALE  220



>ref|XP_009355155.1| PREDICTED: uncharacterized protein LOC103946223 [Pyrus x bretschneideri]
Length=211

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 165/217 (76%), Gaps = 18/217 (8%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             EF+KKV+I D M+ +            +  +K   LLR FL +QQRRA+    LKRGF +
Sbjct  3     EFDKKVSITDPMDPM----------DVASKTKTVALLREFLGIQQRRAERAEELKRGFGE  52

Query  835   YM-----VSGVES--AYQKLCSEITVEFNDCSKQVLEMESQFLS-PDCFREDLAALLRSV  680
             YM      SGV++  A Q++CSE+T+EFN+CS+  + +ES FL+ PD  R DLA LLR++
Sbjct  53    YMESSPPSSGVDAELACQQVCSEVTLEFNECSECSIRIESLFLNDPDFSRIDLAHLLRAL  112

Query  679   QTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaea  500
             +  EKQKLNLT TIQVLK+AGRPSERLVSHENCRF++PM HECVH+ +ITEA+GTEEAEA
Sbjct  113   RAHEKQKLNLTVTIQVLKRAGRPSERLVSHENCRFNRPMEHECVHLHEITEAAGTEEAEA  172

Query  499   daeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
             +A+YDN L+EAI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  173   NAQYDNDLKEAIRGVQDAVTAINEHLEEVRYEIAALE  209



>ref|XP_006645743.1| PREDICTED: uncharacterized protein LOC102722266 [Oryza brachyantha]
Length=235

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF  YM +G E A+Q+LC  +T EFNDCSKQV+EM +   +P+  R D+A LL+ VQ 
Sbjct  59   RRGFSAYMANGSELAFQQLCGSVTAEFNDCSKQVIEMVALLSTPEICRSDVANLLKDVQA  118

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             E++KL+LTA IQVLKKAGRPSERLV+H +CR S    H CVH+++ITEA+GTE+AEADA
Sbjct  119  HEREKLHLTARIQVLKKAGRPSERLVNHADCRSSNMAQHVCVHVKEITEAAGTEDAEADA  178

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+GVQ AVT INEH+EEVRYEI ALE
Sbjct  179  EYDGALKEAIQGVQAAVTSINEHMEEVRYEIDALE  213



>ref|XP_006279453.1| hypothetical protein CARUB_v10007893mg, partial [Capsella rubella]
 gb|EOA12351.1| hypothetical protein CARUB_v10007893mg, partial [Capsella rubella]
Length=165

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 126/163 (77%), Gaps = 10/163 (6%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQV--------LEMESQFLSPDCFREDLAAL  692
            GF +Y+ SG E  YQKLC EIT EF++CSKQ+         EMES FL+P+  R DLA L
Sbjct  1    GFSEYVESGAEPLYQKLCREITAEFSECSKQIEPFDDILYTEMESLFLNPEVGRADLAQL  60

Query  691  LRSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKIT--EASG  518
            L  +Q+QEKQKL+LT T+Q+LKKAGRPSER+++HENC+F KPM HECVH+ +IT    + 
Sbjct  61   LSDIQSQEKQKLHLTVTMQILKKAGRPSERMLTHENCKFKKPMQHECVHLHEITEAAGTE  120

Query  517  TeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
              EAEADAEYDNAL+EAI+GVQDAVT INE+LE++RYEI  LE
Sbjct  121  EAEAEADAEYDNALKEAIRGVQDAVTSINEYLEDIRYEIETLE  163



>gb|ACG48423.1| hypothetical protein [Zea mays]
 tpg|DAA54072.1| TPA: hypothetical protein ZEAMMB73_165181 [Zea mays]
Length=241

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM  G E AYQ+LC  IT EFNDCSKQVLE+ S    P+  R DLA LL+ VQ 
Sbjct  65   RRGFSEYMAYGGELAYQQLCGNITAEFNDCSKQVLEIISLLSMPEFSRSDLADLLKGVQA  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EK+KL+LTA IQVLKKAGRPSERLV+H +CR      H CVH+++ITEA+GTE+AEADA
Sbjct  125  HEKEKLHLTAKIQVLKKAGRPSERLVNHADCRSRSMAQHVCVHVKEITEAAGTEDAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+GVQ AV+ INEH+EEVRYEI  LE
Sbjct  185  EYDAALKEAIQGVQVAVSSINEHMEEVRYEIDGLE  219



>ref|NP_001145494.1| uncharacterized protein LOC100278893 [Zea mays]
 gb|ACG48008.1| hypothetical protein [Zea mays]
Length=241

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM  G E AYQ+LC  IT EFNDCSKQVLE+ S    P+  R DLA LL+ VQ 
Sbjct  65   RRGFSEYMAYGGELAYQQLCGNITAEFNDCSKQVLEIISLLSMPEFSRSDLADLLKGVQA  124

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             EK+KL+LTA IQVLKKAGRPSERLV+H +CR      H CVH+++ITEA+GTE+AEADA
Sbjct  125  HEKEKLHLTAKIQVLKKAGRPSERLVNHADCRSRSMAQHVCVHVKEITEAAGTEDAEADA  184

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI GVQ AV+ INEH+EEVRYEI  LE
Sbjct  185  EYDAALKEAIHGVQVAVSSINEHMEEVRYEIDGLE  219



>dbj|BAK07146.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQ+LC  +T EFNDCS Q+LEM S F  P+  R DLA LL+ VQ 
Sbjct  64   RRGFSEYMANGGECAYQQLCGNVTAEFNDCSTQILEMVSLFSKPNFCRGDLANLLKDVQA  123

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             E+ KL LTA IQVLKKAGRPSERLV+HE+CR S    H C ++++ITEASGTE+AEADA
Sbjct  124  CERDKLELTARIQVLKKAGRPSERLVNHEHCRSSSTSQHVCANLKEITEASGTEDAEADA  183

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+ +Q+AVT INEH+EEVRYEI ALE
Sbjct  184  EYDAALKEAIQSIQEAVTRINEHMEEVRYEIDALE  218



>emb|CDM80735.1| unnamed protein product [Triticum aestivum]
Length=224

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            + GF +Y+ +G E AYQ+LC  +T EFNDCS Q+LEM S    P+  R DLA LL+ VQ 
Sbjct  48   RSGFSEYIANGGECAYQQLCGNVTAEFNDCSTQILEMVSLLSKPNFCRGDLANLLKDVQA  107

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeada  494
             E+ KL LTA IQVLKKAGRPSERLV+HE+CR S    H C ++++ITEASGTE+AEADA
Sbjct  108  CERDKLQLTARIQVLKKAGRPSERLVNHEHCRSSSTSQHVCANLKEITEASGTEDAEADA  167

Query  493  eydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            EYD AL+EAI+G+Q+AVT INEH+EEVRYEI ALE
Sbjct  168  EYDAALKEAIQGIQEAVTSINEHMEEVRYEIDALE  202



>ref|XP_003565625.1| PREDICTED: uncharacterized protein LOC100822108 [Brachypodium 
distachyon]
Length=301

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -3

Query  850  RGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQ  671
            RGF +YM +G E AYQ+LC  +T EFNDCSKQ+LEM +    P     DLA +L+ VQ  
Sbjct  127  RGFSEYMTNGGECAYQQLCGNVTGEFNDCSKQILEMVALLSEPKFCHGDLANILKDVQAH  186

Query  670  EKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadae  491
            E+ KL LTA IQVLKKAGRPSERLV+HE+CR S  M H C ++++ITEA+GTE+AEADAE
Sbjct  187  ERDKLQLTAQIQVLKKAGRPSERLVNHEHCR-SSGMAHVCANVKEITEAAGTEDAEADAE  245

Query  490  ydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            YD AL+EAI+G+Q AVT INEH+EEVRYEI ALE
Sbjct  246  YDAALKEAIQGIQKAVTSINEHMEEVRYEIDALE  279



>ref|XP_010103997.1| hypothetical protein L484_020251 [Morus notabilis]
 gb|EXB97700.1| hypothetical protein L484_020251 [Morus notabilis]
Length=271

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 137/218 (63%), Gaps = 63/218 (29%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GFE+Y+ SG E AYQ+LCSEIT+EF+DCSKQVLE+ES FL+PD  R DLA LLR+VQT
Sbjct  52   KWGFEEYVASGGELAYQQLCSEITLEFSDCSKQVLEIESLFLNPDYCRGDLAQLLRAVQT  111

Query  673  QEKQKL----------------------------NLTATIQVLK----------------  626
            QEKQKL                            N  ATI++++                
Sbjct  112  QEKQKLHLFSLAGLISVKAVWNVINAPCFEGRQPNFPATIKLVRRRIQKFHSAFTRRQDG  171

Query  625  -------------------KAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeae  503
                               KAGRPSERLVSH NC+F KP  HECVH+ +ITEA+GTEEAE
Sbjct  172  AVVSIDASVAQTATIQVLKKAGRPSERLVSHTNCKFEKPTEHECVHVHEITEAAGTEEAE  231

Query  502  adaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            ADAEYDNAL+EAI+GVQD+VT I EH+EEVRYEIAALE
Sbjct  232  ADAEYDNALKEAIRGVQDSVTAIIEHMEEVRYEIAALE  269



>gb|EMT04033.1| hypothetical protein F775_28484 [Aegilops tauschii]
Length=253

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 119/175 (68%), Gaps = 20/175 (11%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            + GF +YM +G E AYQ+LC  +T EFNDCS Q+LEM S    P   R DLA LL+ VQ 
Sbjct  57   RSGFSEYMANGGECAYQQLCGNVTAEFNDCSTQILEMVSLLSKPSFCRGDLANLLKDVQA  116

Query  673  QEKQKLNL--------------------TATIQVLKKAGRPSERLVSHENCRFSKPMGHE  554
             E+ KL L                    TA IQVLKKAG PSERLV+HE+CR S    H 
Sbjct  117  CERDKLQLSKFPPVTCQLVHYISGWLDQTARIQVLKKAGHPSERLVNHEHCRSSSTSQHV  176

Query  553  CVHIQKITEASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAALE  389
            C ++++ITEASGTE+AEADAEYD AL+EAI+G+Q+AVT INEH+EEVRYEI ALE
Sbjct  177  CANLKEITEASGTEDAEADAEYDAALKEAIQGIQEAVTSINEHMEEVRYEIDALE  231



>gb|EMS57326.1| hypothetical protein TRIUR3_22005 [Triticum urartu]
Length=244

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 119/174 (68%), Gaps = 20/174 (11%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            + GF +YM +G E AYQ+LC  +T EFNDCS Q+LEM S    P   R DLA LL+ VQ 
Sbjct  48   RSGFSEYMANGGECAYQQLCGNVTAEFNDCSTQILEMVSLLSKPIFCRGDLANLLKDVQA  107

Query  673  QEKQKLNL--------------------TATIQVLKKAGRPSERLVSHENCRFSKPMGHE  554
             E+ KL L                    TA IQVLKKAGRPSERLV+HE+CR S    H 
Sbjct  108  CERDKLQLSNIPPVICQLVHYVSGWLDQTARIQVLKKAGRPSERLVNHEHCRSSSTSQHV  167

Query  553  CVHIQKITEASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYEIAAL  392
            C ++++ITEASGTE+AEADAEYD AL+EAI+G+Q+AVT INEH+EEVRYEI AL
Sbjct  168  CANLKEITEASGTEDAEADAEYDAALKEAIQGIQEAVTSINEHMEEVRYEIDAL  221



>ref|XP_001762946.1| predicted protein [Physcomitrella patens]
 gb|EDQ72151.1| predicted protein [Physcomitrella patens]
Length=191

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQE  668
            GF DY+ SG E ++Q+LC  IT +FNDCS+QV+++++    P+  R+DLA +L+ VQ QE
Sbjct  42   GFADYLKSGSELSFQQLCGRITTDFNDCSRQVIDIQAALRGPEIARQDLADILQDVQAQE  101

Query  667  KQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaey  488
            KQ L +TAT+Q+L+KAGRPS+R  +H      K   H C H  +   A   E AE+DAEY
Sbjct  102  KQNLKMTATLQLLRKAGRPSDRAQAHAG---KKVQHHLCSHGHEEESA--LELAESDAEY  156

Query  487  dnALREAIKGVQDAVTVINEHLEEVRYEIAA  395
            D A +EA + +Q+A T I+E++EEVRYE+A+
Sbjct  157  DAAYKEATQALQEARTTIHEYMEEVRYELAS  187



>gb|KDO42411.1| hypothetical protein CISIN_1g0386972mg, partial [Citrus sinensis]
Length=89

 Score =   121 bits (303),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -3

Query  649  TATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITEASGTeeaeadaeydnALRE  470
            TATIQ+LKKAGRPSERLVSHENC+F +P  HECVH+Q+ITEA+GTEEAEADAEYDNAL+E
Sbjct  1    TATIQLLKKAGRPSERLVSHENCKFREPKKHECVHVQEITEAAGTEEAEADAEYDNALKE  60

Query  469  AIKGVQDAVTVINEHLEEVRYEIAALE  389
            AI+GVQDAVT INEHLEEVRYEIAALE
Sbjct  61   AIRGVQDAVTAINEHLEEVRYEIAALE  87



>ref|XP_010327276.1| PREDICTED: uncharacterized protein LOC101254136 isoform X3 [Solanum 
lycopersicum]
Length=148

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            KRGFEDYM SGVES YQ+LCSEIT EFNDCSKQVLEMESQFL+  CFREDL+ LLRSVQ 
Sbjct  51   KRGFEDYMASGVESTYQQLCSEITDEFNDCSKQVLEMESQFLTAHCFREDLSLLLRSVQN  110

Query  673  QEKQKLNLTATI  638
            QEK KL L   I
Sbjct  111  QEKMKLQLVFMI  122



>ref|XP_002962136.1| hypothetical protein SELMODRAFT_403688 [Selaginella moellendorffii]
 gb|EFJ37396.1| hypothetical protein SELMODRAFT_403688 [Selaginella moellendorffii]
Length=187

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 103/161 (64%), Gaps = 11/161 (7%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQ--------VLEMESQFLSPDCFREDLA  698
            +RGF DY+ S  E AY++LC  +TVEFN+CS+Q        VLE+E+    P C REDLA
Sbjct  25   QRGFADYLRSNAELAYKELCGRVTVEFNECSRQAINPSIHKVLEIEAALRDPACSREDLA  84

Query  697  ALLRSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHE--CVHIQKITEA  524
             LL++VQ+ EK+KL +TAT+Q+LK+AG PSER  + +  R + P      C   +     
Sbjct  85   VLLQAVQSHEKKKLQMTATLQILKRAGHPSERQATDQR-RVAPPEACNLCCTPAELDGAI  143

Query  523  SGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYEI  401
            SG EE +A+AEY  A +EA+  +Q+AV  INE +E VR E+
Sbjct  144  SGLEECQAEAEYLAAHKEAVTSLQEAVLAINELVETVRSEM  184



>ref|XP_010907490.1| PREDICTED: uncharacterized protein C19orf60 homolog isoform X2 
[Elaeis guineensis]
Length=132

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM +G E AYQ LC EIT EFNDCSKQVLEMES  L PD +R+DLA LLR+VQ 
Sbjct  48   QRGFSEYMTNGGELAYQNLCGEITAEFNDCSKQVLEMESLLLMPDLYRDDLAGLLRAVQE  107

Query  673  QEKQKLNLTATI  638
            QEKQKL+L   +
Sbjct  108  QEKQKLHLGQNL  119



>gb|KCW50601.1| hypothetical protein EUGRSUZ_J00312 [Eucalyptus grandis]
Length=142

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            K GF +YMVSG E AYQ+LC EIT EFNDCSKQV+EMES F++PD  R DLA +LR+VQ 
Sbjct  54   KSGFAEYMVSGGEVAYQQLCGEITAEFNDCSKQVIEMESLFMAPDYGRVDLAQMLRAVQV  113

Query  673  QEKQKLNLT  647
            QEKQKL+L 
Sbjct  114  QEKQKLHLV  122



>gb|AFB34090.1| hypothetical protein CL2438Contig1_03, partial [Pinus mugo]
 gb|AFB34091.1| hypothetical protein CL2438Contig1_03, partial [Pinus mugo]
 gb|AFB34092.1| hypothetical protein CL2438Contig1_03, partial [Pinus mugo]
 gb|AFB34093.1| hypothetical protein CL2438Contig1_03, partial [Pinus mugo]
 gb|AFB34094.1| hypothetical protein CL2438Contig1_03, partial [Pinus mugo]
Length=97

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = -3

Query  706  DLAALLRSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITE  527
            DL  LL++VQ  EKQKL++ ATIQVLKKAGRPSER V  +N    +P+ H CVH+ +ITE
Sbjct  1    DLVHLLKTVQAHEKQKLHMVATIQVLKKAGRPSERHVQLKN----RPVEHRCVHVTEITE  56

Query  526  ASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYE  404
             +G E+AEADAEYD AL EAI+ +Q+ VT IN+ +EEVRYE
Sbjct  57   VTGLEDAEADAEYDAALNEAIRVIQEVVTYINDQMEEVRYE  97



>gb|AFG60421.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60422.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60427.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60430.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60435.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60436.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60437.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
Length=97

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = -3

Query  706  DLAALLRSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITE  527
            DL  LL++VQ  EKQKL++ ATIQVLKKAGRPSER V  +N    +P+ H CVH+ +ITE
Sbjct  1    DLVHLLKTVQAHEKQKLHMVATIQVLKKAGRPSERHVQLKN----RPVEHRCVHVTEITE  56

Query  526  ASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYE  404
             +G E+AEADAEYD AL EAI+ VQ+ VT IN+ +EEVRYE
Sbjct  57   VTGLEDAEADAEYDAALNEAIRVVQEVVTHINDQMEEVRYE  97



>gb|AEW08954.1| hypothetical protein CL2438Contig1_03, partial [Pinus radiata]
 gb|AFG60424.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60426.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60429.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60431.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60432.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60434.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
Length=97

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = -3

Query  706  DLAALLRSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITE  527
            DL  LL++VQ  EKQKL++ ATIQVLKKAGRPSER V  +N    +P+ H CVH+ +ITE
Sbjct  1    DLVHLLKTVQAHEKQKLHMVATIQVLKKAGRPSERHVQLKN----RPVEHRCVHVTEITE  56

Query  526  ASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYE  404
             +G E+AEADAEYD AL EAI+ +Q+ VT IN+ +EEVRYE
Sbjct  57   VTGLEDAEADAEYDAALNEAIRVIQEVVTHINDQMEEVRYE  97



>gb|AFG60423.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60425.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60428.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
 gb|AFG60433.1| hypothetical protein CL2438Contig1_03, partial [Pinus taeda]
Length=97

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = -3

Query  706  DLAALLRSVQTQEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHECVHIQKITE  527
            DL  LL++VQ  EKQKL++ ATIQVLKKAGRPSER V  +N    +P+ H CVH+ +I E
Sbjct  1    DLVHLLKTVQAHEKQKLHMVATIQVLKKAGRPSERHVQLKN----RPVEHRCVHVTEIAE  56

Query  526  ASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVRYE  404
             +G E+AEADAEYD AL EAI+ +Q+ VT IN+ +EEVRYE
Sbjct  57   VTGLEDAEADAEYDAALNEAIRVIQEVVTHINDQMEEVRYE  97



>ref|XP_002965038.1| hypothetical protein SELMODRAFT_406136 [Selaginella moellendorffii]
 gb|EFJ33876.1| hypothetical protein SELMODRAFT_406136 [Selaginella moellendorffii]
Length=168

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 92/152 (61%), Gaps = 14/152 (9%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF DY+ S  E AY++LC            +VLE+E+    P C REDLA LL++VQ+
Sbjct  25   QRGFADYLRSNAELAYKELCG-----------RVLEIEAALRDPACSREDLAVLLQAVQS  73

Query  673  QEKQKLNLTATIQVLKKAGRPSERLVSHENCRFSKPMGHE--CVHIQKITEASGTeeaea  500
             EK+KL +TAT+Q+LK+AG PSER  + +  R + P      C   +     SG EE +A
Sbjct  74   HEKKKLQMTATLQILKRAGHPSERQATDQR-RVAPPEACNLCCTPAELDGAISGLEECQA  132

Query  499  daeydnALREAIKGVQDAVTVINEHLEEVRYE  404
            +AEY  A +EA+  +Q+AV  INE +E VR E
Sbjct  133  EAEYLAAHKEAVTSLQEAVLAINELVETVRSE  164



>tpg|DAA54073.1| TPA: hypothetical protein ZEAMMB73_165181 [Zea mays]
Length=137

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQT  674
            +RGF +YM  G E AYQ+LC  IT EFNDCSKQVLE+ S    P+  R DLA LL+ VQ 
Sbjct  65   RRGFSEYMAYGGELAYQQLCGNITAEFNDCSKQVLEIISLLSMPEFSRSDLADLLKGVQA  124

Query  673  QEKQKLNL  650
             EK+KL+L
Sbjct  125  HEKEKLHL  132



>ref|XP_007148750.1| hypothetical protein PHAVU_005G010900g [Phaseolus vulgaris]
 gb|ESW20744.1| hypothetical protein PHAVU_005G010900g [Phaseolus vulgaris]
Length=113

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRS-VQTQ  671
            GF    ++G E AY++LCSE+T+EF DC K+VLEME+ F S D  R DLA LLR+ VQ Q
Sbjct  42   GFLTTWLNGGELAYKQLCSEMTIEFIDCLKKVLEMEALFRSCDYCRIDLAQLLRTAVQDQ  101

Query  670  EKQKLNL  650
            EKQ L L
Sbjct  102  EKQNLFL  108



>ref|XP_002952830.1| hypothetical protein VOLCADRAFT_62922 [Volvox carteri f. nagariensis]
 gb|EFJ46080.1| hypothetical protein VOLCADRAFT_62922 [Volvox carteri f. nagariensis]
Length=289

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQE  668
            GF+ ++ +  E  Y+ L SE+T+ FNDCSK+V+ +ES     +  R DLAA LR+VQ  E
Sbjct  31   GFKTFIRTRHEGPYKALLSELTLAFNDCSKKVIGLESAL--QEMGRADLAATLRTVQESE  88

Query  667  KQKLNLTATIQVLKKA  620
            + KL LT T+Q LK+A
Sbjct  89   RDKLRLTLTLQALKQA  104



>gb|KDO42412.1| hypothetical protein CISIN_1g0386971mg, partial [Citrus sinensis]
Length=85

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 61/87 (70%), Gaps = 4/87 (5%)
 Frame = -3

Query  1015  EFEKKVAICDKMEEVVeanggseaeteseTSKIavllrrflalqqrraqayarLKRGFED  836
             +FEKKV I D ME           +  + +SK   LLR FL +QQRRAQAYA+LKRGF +
Sbjct  3     DFEKKVTITDAME----MEEMDIEQANNNSSKTLQLLRTFLDIQQRRAQAYAKLKRGFSE  58

Query  835   YMVSGVESAYQKLCSEITVEFNDCSKQ  755
             YM+SG E AYQ+LCSEIT EFNDCSKQ
Sbjct  59    YMISGGELAYQQLCSEITSEFNDCSKQ  85



>ref|XP_005849152.1| hypothetical protein CHLNCDRAFT_143776 [Chlorella variabilis]
 gb|EFN57050.1| hypothetical protein CHLNCDRAFT_143776 [Chlorella variabilis]
Length=215

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 81/169 (48%), Gaps = 42/169 (25%)
 Frame = -3

Query  844  FEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQEK  665
            F  Y+ +G E  Y+ +  ++T +F DCS++VL +E+   S    +++ AALLR+VQ  E+
Sbjct  56   FRAYLQNGAEGPYRHVMGQLTAQFQDCSRRVLSVEAALQS--TGQDEAAALLRAVQENER  113

Query  664  QKLNLTATIQVLKKAGRPSERLVSHENCRFS--------------KP------MGH----  557
            +KL LT  +Q LK A         H   RFS               P       GH    
Sbjct  114  EKLRLTLALQALKAA---------HAQQRFSWQHEEAAVAAAASLAPGVADLLQGHLCRV  164

Query  556  ECVHIQKITEASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEEVR  410
             CVH     E +        AEY  A+RE+ + +Q  +T I+E LEEV+
Sbjct  165  GCVHEAPTDEPT-------QAEYAGAVRESYQLLQGTITAISEALEEVQ  206



>tpg|DAA54074.1| TPA: hypothetical protein ZEAMMB73_165181 [Zea mays]
Length=113

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  853  KRGFEDYMVSGVESAYQKLCSEITVEFNDCSKQV  752
            +RGF +YM  G E AYQ+LC  IT EFNDCSKQV
Sbjct  65   RRGFSEYMAYGGELAYQQLCGNITAEFNDCSKQV  98



>ref|XP_001698871.1| hypothetical protein CHLREDRAFT_195671 [Chlamydomonas reinhardtii]
 gb|AAP12521.1| REX1-B [Chlamydomonas reinhardtii]
 gb|EDO99153.1| predicted protein [Chlamydomonas reinhardtii]
Length=305

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -3

Query  847  GFEDYMVSGVESAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQTQE  668
            G + +M +  ES ++ L S++T  F+DCS+QV+ +E+     D  R DLAA+LRSVQ  E
Sbjct  35   GHKAFMRNKAESTFRCLMSDLTAAFSDCSRQVIALEAALK--DMGRPDLAAILRSVQECE  92

Query  667  KQKLNLT  647
            + KL LT
Sbjct  93   RDKLRLT  99



>ref|XP_006485569.1| PREDICTED: uncharacterized protein LOC102609786 [Citrus sinensis]
Length=155

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  565  MGHECVHIQKITEASGTeeaeadaeydnALREAIKGVQDAVTVINEHLEE  416
            M HECV I +I E +G EEA+ADAEYDNAL+EAI+GVQDA+T INEHLEE
Sbjct  1    MKHECVRILEIREVAGIEEADADAEYDNALKEAIRGVQDAMTAINEHLEE  50



>ref|XP_008405327.1| PREDICTED: uncharacterized protein C19orf60 homolog [Poecilia 
reticulata]
Length=150

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -3

Query  847  GFEDYMVSGVE---SAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQ  677
            G E Y+ +G       Y++L +EIT  F+  SK+VLE++++ L  D  R DL+  +  +Q
Sbjct  30   GHEAYLRTGPHYDFEHYKQLVNEITQAFSGISKEVLEIKAK-LHRDFDRADLSEHIEKLQ  88

Query  676  TQEKQKLNLTATIQVLKKAGR  614
            ++EKQKL LTA +Q+ K+  +
Sbjct  89   SKEKQKLELTAKLQLAKQQAQ  109



>ref|XP_007577286.1| PREDICTED: uncharacterized protein C19orf60 homolog [Poecilia 
formosa]
Length=150

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -3

Query  847  GFEDYMVSGVE---SAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQ  677
            G E Y+ +G       Y++L +EIT  F+  SK+VLE++++ L  D  R DL+  +  +Q
Sbjct  30   GHEAYLRTGPHYDFEHYKQLVNEITQAFSGISKEVLEIKAK-LHRDFDRADLSEHIEKLQ  88

Query  676  TQEKQKLNLTATIQVLKKAGR  614
            ++EKQKL LTA +Q+ K+  +
Sbjct  89   SKEKQKLELTAKLQLAKQQAQ  109



>ref|XP_005795673.1| PREDICTED: uncharacterized protein C19orf60 homolog [Xiphophorus 
maculatus]
Length=150

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -3

Query  847  GFEDYMVSGVE---SAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQ  677
            G E Y+ +G       Y++L +EIT  F+  SK+VLE++++ L  D  R DL+  +  +Q
Sbjct  30   GHEAYLRTGPHYDFEHYKQLVNEITQAFSGISKEVLEIKAR-LHRDFDRADLSEHIEKLQ  88

Query  676  TQEKQKLNLTATIQVLKKAGR  614
            ++EKQKL LTA +Q+ K+  +
Sbjct  89   SKEKQKLELTAKLQLAKQQAQ  109



>ref|XP_007233329.1| PREDICTED: uncharacterized protein C19orf60 homolog [Astyanax 
mexicanus]
Length=150

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = -3

Query  847  GFEDYMVSGVE---SAYQKLCSEITVEFNDCSKQVLEMESQFLSPDCFREDLAALLRSVQ  677
            G E Y+ +G       Y++L  EIT  F   SK+VLE+  Q L  D  R DL+  +  +Q
Sbjct  30   GHEAYLRTGPHYDFDHYRQLVHEITKAFCGISKEVLEI-KQRLHQDFDRPDLSEHIEKLQ  88

Query  676  TQEKQKLNLTATIQVLKKAGR  614
             +EKQKL LTA +Q+ K++ +
Sbjct  89   IKEKQKLELTAKLQLAKQSAQ  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3073151727104