BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30600_g1_i1 len=911 path=[889:0-910]

Length=911
                                                                      Score     E

gb|AFR60863.1|  sporamin B                                              186   1e-53   
gb|AFR60859.1|  sporamin B                                              183   9e-53   
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    182   4e-52   Ipomoea batatas [batate]
gb|AFR60865.1|  sporamin B                                              181   5e-52   
gb|ABB90968.1|  sporamin B precursor                                    181   9e-52   Ipomoea batatas [batate]
gb|AFR60862.1|  sporamin B                                              180   1e-51   
gb|AFR60860.1|  sporamin B                                              180   2e-51   
gb|AFR60867.1|  sporamin B                                              167   2e-46   
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     167   2e-46   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                              166   3e-46   
gb|AAA33390.1|  sporamin B                                              166   3e-46   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    166   4e-46   Ipomoea batatas [batate]
gb|AFR60864.1|  sporamin B                                              165   7e-46   
gb|AFR60855.1|  sporamin A                                              153   4e-41   
gb|ABB97547.1|  sporamin A precursor                                    153   5e-41   Ipomoea batatas [batate]
gb|ABG26232.1|  sporamin A                                              152   6e-41   Ipomoea trifida
gb|AAB52547.1|  sporamin precursor                                      151   2e-40   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                              150   3e-40   Ipomoea trifida
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    150   5e-40   Ipomoea batatas [batate]
gb|AAA33391.1|  sporamin A precursor                                    150   5e-40   Ipomoea batatas [batate]
gb|AAL55800.1|AF289060_1  sporamin                                      149   1e-39   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                      149   1e-39   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                    149   1e-39   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                              149   2e-39   Ipomoea trifida
gb|ABG26235.1|  sporamin A                                              148   2e-39   Ipomoea trifida
gb|ABB97549.1|  sporamin A precursor                                    148   3e-39   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                    148   4e-39   Ipomoea batatas [batate]
gb|ABG26224.1|  sporamin A                                              147   5e-39   Ipomoea leucantha
gb|ABG26238.1|  sporamin A                                              147   5e-39   Ipomoea trifida
gb|ABG26222.1|  sporamin A                                              147   7e-39   Ipomoea leucantha
gb|ABG26236.1|  sporamin A                                              147   7e-39   Ipomoea trifida
gb|AFR60856.1|  sporamin A                                              146   2e-38   
gb|AAA86670.1|  preprosporamin                                          146   2e-38   Ipomoea batatas [batate]
gb|ABG26227.1|  sporamin A                                              145   6e-38   Ipomoea leucantha
gb|AAD40288.1|  sporamin A precursor                                    144   7e-38   Ipomoea batatas [batate]
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     144   8e-38   Ipomoea batatas [batate]
gb|ABG26229.1|  sporamin A                                              144   1e-37   Ipomoea trifida
gb|ABB97542.1|  sporamin A precursor                                    143   2e-37   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                143   3e-37   
gb|AAD05567.1|  sporamin A                                              143   3e-37   Ipomoea batatas [batate]
gb|ABB97543.1|  sporamin A precursor                                    141   6e-37   Ipomoea batatas [batate]
gb|AFR60853.1|  truncated sporamin                                      101   1e-22   
gb|AAB52549.1|  sporamin                                              92.8    1e-19   Ipomoea batatas [batate]
gb|AAB52550.1|  sporamin                                              84.7    2e-16   Ipomoea batatas [batate]
ref|XP_008437082.1|  PREDICTED: miraculin                             66.6    9e-10   
ref|XP_010918417.1|  PREDICTED: miraculin-like                        66.2    1e-09   
ref|XP_004137639.1|  PREDICTED: miraculin-like                        64.7    5e-09   
ref|XP_002265965.1|  PREDICTED: miraculin                             63.2    2e-08   Vitis vinifera
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  63.2    2e-08   Synsepalum dulcificum [miracle fruit]
emb|CAN81015.1|  hypothetical protein VITISV_025776                   62.8    2e-08   Vitis vinifera
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              62.8    2e-08   
gb|ABB72793.1|  Kunitz-type protease inhibitor-like protein           62.8    3e-08   Solanum tuberosum [potatoes]
ref|XP_007041757.1|  21 kDa seed protein, putative                    62.8    3e-08   
emb|CAN65022.1|  hypothetical protein VITISV_027379                   62.0    4e-08   Vitis vinifera
gb|ADD51186.1|  tumor-related protein                                 61.2    7e-08   Vitis cinerea var. helleri x Vitis riparia
gb|AIT42186.1|  Kunitz-type inhibitor B                               61.2    8e-08   
sp|Q41484.1|SPI5_SOLTU  RecName: Full=Serine protease inhibitor 5...  61.2    9e-08   Solanum tuberosum [potatoes]
ref|XP_008437071.1|  PREDICTED: miraculin-like                        60.1    2e-07   
ref|XP_010683195.1|  PREDICTED: miraculin-like                        60.1    2e-07   
ref|XP_007036748.1|  21 kDa seed protein, putative                    59.7    3e-07   
emb|CAN75396.1|  hypothetical protein VITISV_028636                   59.3    3e-07   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                             59.3    4e-07   Vitis vinifera
ref|XP_011035401.1|  PREDICTED: miraculin-like                        59.3    4e-07   
emb|CBI35464.3|  unnamed protein product                              59.3    4e-07   
ref|XP_002270111.1|  PREDICTED: miraculin                             58.9    5e-07   Vitis vinifera
emb|CAN63617.1|  hypothetical protein VITISV_041430                   59.3    5e-07   Vitis vinifera
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     58.9    6e-07   Theobroma microcarpum
ref|XP_008778295.1|  PREDICTED: miraculin                             58.2    6e-07   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           58.5    8e-07   
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     58.5    8e-07   Theobroma bicolor
ref|XP_006493433.1|  PREDICTED: miraculin-like                        58.5    9e-07   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           57.8    1e-06   
emb|CAA43267.1|  sporamin                                             58.2    1e-06   Ipomoea batatas [batate]
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  57.4    2e-06   
ref|XP_011072079.1|  PREDICTED: miraculin                             57.0    2e-06   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           57.0    2e-06   
ref|XP_007036746.1|  21 kDa seed protein                              57.4    2e-06   
ref|XP_007036750.1|  21 kDa seed protein                              57.0    2e-06   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        56.6    3e-06   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      56.6    3e-06   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           56.6    3e-06   
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               56.6    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006495061.1|  PREDICTED: miraculin-like                        56.2    4e-06   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        57.8    4e-06   
ref|XP_002305032.2|  trypsin protein inhibitor 3                      56.6    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           56.2    4e-06   
sp|P58514.2|SPI1_SOLTU  RecName: Full=Serine protease inhibitor 1...  56.6    4e-06   Solanum tuberosum [potatoes]
ref|XP_006493430.1|  PREDICTED: miraculin-like                        56.2    5e-06   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           56.6    6e-06   
ref|XP_008238584.1|  PREDICTED: miraculin-like                        55.5    7e-06   
gb|AIT42170.1|  Kunitz-type inhibitor B                               55.5    9e-06   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        55.5    9e-06   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           55.1    1e-05   
ref|NP_001274866.1|  Kunitz-type enzyme inhibitor P4E1 precursor      55.5    1e-05   
dbj|BAA03723.1|  25kD storage protein                                 54.7    2e-05   Colocasia esculenta [cocoyam]
sp|Q41433.1|SPI6_SOLTU  RecName: Full=Probable serine protease in...  54.7    2e-05   Solanum tuberosum [potatoes]
gb|AFK41478.1|  unknown                                               54.7    2e-05   
ref|XP_003534083.1|  PREDICTED: miraculin-like                        54.7    2e-05   
gb|AIT42206.1|  Kunitz-type inhibitor C                               54.7    2e-05   
ref|XP_003620188.1|  Miraculin                                        54.3    2e-05   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           54.3    2e-05   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           53.9    2e-05   
gb|AIT42180.1|  Kunitz-type inhibitor B                               54.3    3e-05   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           53.9    3e-05   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   53.9    3e-05   
ref|XP_008437058.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_004137534.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           53.9    3e-05   
ref|XP_010098224.1|  Alpha-amylase/subtilisin inhibitor               53.5    3e-05   
dbj|BAA04150.1|  proteinase inhibitor                                 53.9    3e-05   Solanum tuberosum [potatoes]
gb|AFC88891.1|  Kunitz-type proteinase inhibitor group A1             53.1    4e-05   
gb|AAL60243.1|AF459078_1  putative Kunitz-type tuber invertase in...  53.5    4e-05   Solanum tuberosum [potatoes]
gb|ACS92512.1|  Kunitz-type protease inhibitor KPI-C7                 53.5    4e-05   Populus trichocarpa x Populus nigra
gb|AAM21642.1|AF495581_1  putative Kunitz-type proteinase inhibitor   53.5    5e-05   Solanum tuberosum [potatoes]
ref|NP_001275427.1|  Kunitz-type protease inhibitor precursor         53.5    5e-05   
gb|AAM10744.1|AF492769_1  putative kunitz-type proteinase inhibit...  53.5    5e-05   Solanum tuberosum [potatoes]
gb|AIT42172.1|  Kunitz-type inhibitor B                               53.5    6e-05   
gb|AIT42188.1|  Kunitz-type inhibitor B                               53.1    6e-05   
sp|P30941.2|SPI7_SOLTU  RecName: Full=Serine protease inhibitor 7...  53.1    6e-05   Solanum tuberosum [potatoes]
ref|XP_004237191.1|  PREDICTED: miraculin-like                        53.1    7e-05   
gb|AAL85648.1|  trypsin inhibitor                                     52.0    7e-05   Theobroma obovatum
gb|AIT42193.1|  Kunitz-type inhibitor B                               52.8    9e-05   
ref|XP_007036743.1|  21 kDa seed protein                              52.8    9e-05   
gb|AIT42190.1|  Kunitz-type inhibitor B                               52.4    1e-04   
gb|AIT42191.1|  Kunitz-type inhibitor B                               52.4    1e-04   
prf||1802409A  albumin                                                52.4    1e-04
ref|XP_010536414.1|  PREDICTED: miraculin-like                        52.4    1e-04   
pdb|4J2K|A  Chain A, Crystal Structure Of A Plant Trypsin Inhibit...  51.6    1e-04   
gb|AAZ94192.1|  Kunitz-type protease inhibitor precursor              52.4    1e-04   Solanum tuberosum [potatoes]
ref|NP_001274943.1|  Kunitz-type protease inhibitor precursor         52.4    1e-04   
gb|AAM21643.1|AF495582_1  putative Kunitz-type proteinase inhibitor   52.4    1e-04   Solanum tuberosum [potatoes]
gb|AAZ94195.1|  Kunitz-type protease inhibitor precursor              52.4    1e-04   Solanum tuberosum [potatoes]
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     52.0    1e-04   Theobroma grandiflorum
gb|AIT42197.1|  Kunitz-type inhibitor B                               52.4    1e-04   
gb|ACS92518.1|  Kunitz-type protease inhibitor KPI-C6.1               52.0    1e-04   Populus trichocarpa x Populus nigra
gb|ACS92499.1|  Kunitz-type protease inhibitor KPI-C6.2               52.0    1e-04   Populus trichocarpa x Populus nigra
gb|ACO39911.1|  kunitz trypsin inhibitor 3                            51.6    1e-04   Populus balsamifera [balsam poplar]
gb|ACO39912.1|  kunitz trypsin inhibitor 3                            51.6    1e-04   Populus balsamifera [balsam poplar]
ref|XP_003532236.1|  PREDICTED: trypsin inhibitor A-like              52.0    1e-04   
gb|AIT42176.1|  Kunitz-type inhibitor B                               52.0    1e-04   
gb|AAM10743.1|AF492359_1  putative kunitz-type proteinase inhibit...  52.0    1e-04   Solanum tuberosum [potatoes]
ref|XP_009777240.1|  PREDICTED: miraculin-like                        52.0    1e-04   
gb|AIT42171.1|  Kunitz-type inhibitor B                               52.0    1e-04   
gb|ACO39957.1|  kunitz trypsin inhibitor 3                            51.2    1e-04   Populus balsamifera [balsam poplar]
ref|XP_003534081.1|  PREDICTED: miraculin-like                        52.0    1e-04   
ref|XP_006387699.1|  hypothetical protein POPTR_0664s00210g           51.6    2e-04   
gb|ACO40004.1|  kunitz trypsin inhibitor 3                            51.2    2e-04   Populus balsamifera [balsam poplar]
emb|CDP16462.1|  unnamed protein product                              52.0    2e-04   
gb|ACO40010.1|  kunitz trypsin inhibitor 3                            51.2    2e-04   Populus balsamifera [balsam poplar]
gb|AFZ77402.1|  Kunitz-type proteinase inhibitor PKI2                 51.6    2e-04   
gb|AIT42187.1|  Kunitz-type inhibitor B                               51.6    2e-04   
gb|AIT42195.1|  Kunitz-type inhibitor B                               52.0    2e-04   
ref|XP_004234331.1|  PREDICTED: miraculin                             51.2    2e-04   
emb|CAA45723.1|  aspartic proteinase inhibitor                        51.6    2e-04   Solanum tuberosum [potatoes]
gb|AAO23566.1|  serine protease inhibitor                             51.6    2e-04   Solanum tuberosum [potatoes]
gb|AAM21645.1|AF495584_1  putative Kunitz-type proteinase inhibitor   51.6    2e-04   Solanum tuberosum [potatoes]
gb|ACO39965.1|  kunitz trypsin inhibitor 3                            50.8    2e-04   Populus balsamifera [balsam poplar]
gb|ACO39935.1|  kunitz trypsin inhibitor 3                            50.8    2e-04   Populus balsamifera [balsam poplar]
emb|CAH59168.1|  kunitz trypsin inhibitor TI3                         51.2    2e-04   Populus tremula [European aspen]
gb|AAL85645.1|  trypsin inhibitor                                     50.4    2e-04   Theobroma grandiflorum
gb|KHM99737.1|  Miraculin                                             51.2    2e-04   
gb|AAL85644.1|  trypsin inhibitor                                     50.1    3e-04   Theobroma subincanum
ref|XP_002888923.1|  trypsin and protease inhibitor family protein    51.2    3e-04   
gb|ACO40038.1|  kunitz trypsin inhibitor 3                            50.4    3e-04   Populus balsamifera [balsam poplar]
gb|AIT42216.1|  Kunitz-type inhibitor D                               50.8    3e-04   
gb|ACO39943.1|  kunitz trypsin inhibitor 3                            50.4    3e-04   Populus balsamifera [balsam poplar]
emb|CDP21779.1|  unnamed protein product                              50.8    3e-04   
ref|NP_001235773.1|  uncharacterized protein LOC100306233 precursor   50.8    3e-04   
gb|AFK49061.1|  unknown                                               50.8    4e-04   
gb|AAL85661.1|  trypsin inhibitor                                     49.7    4e-04   Theobroma bicolor
gb|ACO39920.1|  kunitz trypsin inhibitor 3                            50.1    4e-04   Populus balsamifera [balsam poplar]
gb|ACO39929.1|  kunitz trypsin inhibitor 3                            50.1    4e-04   Populus balsamifera [balsam poplar]
gb|AAU09272.1|  Kunitz-type proteinase inhibitor group B              50.4    4e-04   Solanum tuberosum [potatoes]
gb|AAX47263.1|  Kunitz-type proteinase inhibitor group B1             50.1    4e-04   Solanum palustre
gb|ACO39958.1|  kunitz trypsin inhibitor 3                            50.1    4e-04   Populus balsamifera [balsam poplar]
gb|ACO40066.1|  kunitz trypsin inhibitor 3                            50.1    4e-04   Populus balsamifera [balsam poplar]
emb|CAH59183.1|  kunitz trypsin inhibitor TI3                         50.4    5e-04   Populus tremula [European aspen]
gb|ACO39954.1|  kunitz trypsin inhibitor 3                            49.7    5e-04   Populus balsamifera [balsam poplar]
ref|XP_003532237.1|  PREDICTED: trypsin inhibitor A-like              50.4    5e-04   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        50.4    5e-04   
gb|ACJ86171.1|  unknown                                               50.4    5e-04   Medicago truncatula
gb|ACO39944.1|  kunitz trypsin inhibitor 3                            49.7    5e-04   Populus balsamifera [balsam poplar]
ref|XP_003534100.1|  PREDICTED: miraculin-like                        50.4    5e-04   
gb|ACO39922.1|  kunitz trypsin inhibitor 3                            49.7    5e-04   Populus balsamifera [balsam poplar]
gb|ACO39915.1|  kunitz trypsin inhibitor 3                            49.7    5e-04   Populus balsamifera [balsam poplar]
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   50.1    5e-04   
gb|ACS92496.1|  Kunitz-type protease inhibitor KPI-C2.2               50.1    6e-04   Populus trichocarpa x Populus deltoides
gb|ACO39928.1|  kunitz trypsin inhibitor 3                            49.7    6e-04   Populus balsamifera [balsam poplar]
gb|ACO39910.1|  kunitz trypsin inhibitor 3                            49.7    6e-04   Populus balsamifera [balsam poplar]
ref|XP_011014541.1|  PREDICTED: wound-responsive protein GWIN3-like   50.1    6e-04   
gb|AAM21644.1|AF495583_1  putative Kunitz-type proteinase inhibitor   49.7    6e-04   Solanum tuberosum [potatoes]
gb|AIT42161.1|  Kunitz-type inhibitor A                               50.1    6e-04   
ref|XP_010683193.1|  PREDICTED: miraculin-like                        50.1    6e-04   
ref|XP_006387700.1|  hypothetical protein POPTR_0664s00220g           49.7    7e-04   
emb|CDP19136.1|  unnamed protein product                              50.1    7e-04   
ref|XP_006362681.1|  PREDICTED: serine protease inhibitor 1-like      49.3    7e-04   
ref|XP_011041832.1|  PREDICTED: wound-responsive protein GWIN3-like   49.7    7e-04   
gb|AIT42199.1|  Kunitz-type inhibitor B                               50.1    7e-04   
gb|ACO40041.1|  kunitz trypsin inhibitor 3                            49.3    7e-04   Populus balsamifera [balsam poplar]
ref|NP_001275101.1|  Kunitz-type protease inhibitor precursor         50.1    8e-04   
gb|KHM99741.1|  Miraculin                                             49.7    8e-04   
gb|ACO40021.1|  kunitz trypsin inhibitor 3                            49.3    8e-04   Populus balsamifera [balsam poplar]
gb|ADW95387.1|  Kunitz-type trypsin inhibitor                         49.7    8e-04   
ref|XP_007041756.1|  21 kDa seed protein                              49.7    8e-04   
gb|ACO39924.1|  kunitz trypsin inhibitor 3                            48.9    8e-04   Populus balsamifera [balsam poplar]
gb|ACO39990.1|  kunitz trypsin inhibitor 3                            48.9    9e-04   Populus balsamifera [balsam poplar]
gb|ACO39913.1|  kunitz trypsin inhibitor 3                            48.9    9e-04   Populus balsamifera [balsam poplar]
gb|ACO39979.1|  kunitz trypsin inhibitor 3                            48.9    9e-04   Populus balsamifera [balsam poplar]
prf||1922206A  trypsin inhibitor:ISOTYPE=a                            48.9    9e-04
gb|ACO39926.1|  kunitz trypsin inhibitor 3                            48.9    9e-04   Populus balsamifera [balsam poplar]
gb|ACO40016.1|  kunitz trypsin inhibitor 3                            48.9    0.001   Populus balsamifera [balsam poplar]
gb|ACO40052.1|  kunitz trypsin inhibitor 3                            48.9    0.001   Populus balsamifera [balsam poplar]
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     49.7    0.001   Theobroma cacao [chocolate]
gb|ACO40051.1|  kunitz trypsin inhibitor 3                            48.9    0.001   Populus balsamifera [balsam poplar]



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK LA L F  SLYLLPNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE 
Sbjct  1    MKALA-LFFVLSLYLLPNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGEN  54

Query  691  YYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPS  518
            YYI S     +   G++L  L+S++ +CAS+V+V R  F  GDPI +RP DP + VV+PS
Sbjct  55   YYIVS-AIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITIRPADPESTVVMPS  113

Query  517  KFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYR  341
             F +F FS+ T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+
Sbjct  114  TFQTFRFSIPTNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYK  173

Query  340  IDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            I YC FG  KCF V    D    A R  LS+  F+
Sbjct  174  ISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFV  208



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK LA L F  SLYLLPNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE 
Sbjct  1    MKALA-LFFVLSLYLLPNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGEN  54

Query  691  YYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPS  518
            YYI S     +   G++L  L+S++ +CAS+V+V R  F  GDPI + P DP + VV+PS
Sbjct  55   YYIVS-AIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPS  113

Query  517  KFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYR  341
             F +F F+++T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+
Sbjct  114  TFQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYK  173

Query  340  IDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            I YC FG  KCF V    D    A R  LS+  F+
Sbjct  174  ISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFV  208



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 134/211 (64%), Gaps = 10/211 (5%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK  A L F  SLYLLPNPTHS FNPIRL     TA     S  TPV+D +G+E+RAGE 
Sbjct  1    MKAFA-LFFVLSLYLLPNPTHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGEN  54

Query  691  YYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPS  518
            YY+ S     +   G++L  L+S++ +CAS+V+V R  F  GDPI + P DP A VV+PS
Sbjct  55   YYMVS-AIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPS  113

Query  517  KFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYR  341
             + +F F+++T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+
Sbjct  114  TYQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYK  173

Query  340  IDYCPFGGHKCFYVSLNIDESAGAVRWVLSD  248
            I YC FG  KCF V    D    A R  LS+
Sbjct  174  ISYCQFGTEKCFNVGRYYDPLTRATRLALSN  204



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK  A L F  SLYLLPNPTHS FNPIRL     TA     S  TPV+D +G+E+RAGE 
Sbjct  1    MKAFA-LFFVLSLYLLPNPTHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGEN  54

Query  691  YYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPS  518
            YY+ S     +   G++L  L+S++ +CAS+V+V R  F  GDPI + P DP + VV+PS
Sbjct  55   YYMVS-AIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPS  113

Query  517  KFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYR  341
             + +F F+++T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+
Sbjct  114  TYQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYK  173

Query  340  IDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            I YC FG  KCF V    D    A R  LS+  F+
Sbjct  174  ISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFV  208



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 135/215 (63%), Gaps = 10/215 (5%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK LA L F  SLYLL NP HS FNPIRL     TA     S  TPV+D +G+E+RAGE 
Sbjct  1    MKALA-LFFVLSLYLLANPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGEN  54

Query  691  YYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPS  518
            YYI S     +   G++L  L+S++ +CAS+V+V R  F  GDPI + P DP + VV+PS
Sbjct  55   YYIVS-AIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPS  113

Query  517  KFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYR  341
             F +F F+++T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+
Sbjct  114  TFQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYK  173

Query  340  IDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            I YC FG  KCF V    D    A R  LS+  F+
Sbjct  174  ISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFV  208



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 135/215 (63%), Gaps = 10/215 (5%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK LA L F  SLYLL NP HS FNPIRL     TA     S  TPV+D +G+E+RAGE 
Sbjct  1    MKALA-LFFVLSLYLLANPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGEN  54

Query  691  YYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPS  518
            YYI S     +   G++L  L+S++ +CAS+V+V R  F  GDPI + P DP + VV+PS
Sbjct  55   YYIVS-AIWGAGGGGLRLVRLDSSSNECASDVMVSRSDFDNGDPITITPADPESTVVMPS  113

Query  517  KFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYR  341
             F +F F+++T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+
Sbjct  114  TFQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYK  173

Query  340  IDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            I YC FG  KCF V    D    A R  LS+  F+
Sbjct  174  ISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFV  208



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 137/218 (63%), Gaps = 12/218 (6%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRL-PIRLPTADAAVASDNTPVVDTDGNELRAGE  695
            MK LA L F  SLYLL NP +S FNPIRL P R        AS  TPV+D +G+E+RAGE
Sbjct  1    MKALA-LFFVLSLYLLANPAYSKFNPIRLRPAR------ETASSETPVLDINGDEVRAGE  53

Query  694  TYYITSIETPHSASAGVQLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLP  521
             YYI S     +   G++L  L+S++ +CAS+V+V R  F  GDPI + P DP + VV+P
Sbjct  54   NYYIVS-AIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMP  112

Query  520  SKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTY  344
            S F +F F+++T ++C ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y
Sbjct  113  STFQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAY  172

Query  343  RIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
            +I YC FG  KCF V    D    A R  LS+  F+ V
Sbjct  173  KISYCQFGTEKCFNVGRYYDPLTRATRLALSNTPFVFV  210



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 9/199 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE YYI S     +   G+
Sbjct  16   PNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGENYYIVS-AIWGAGGGGL  69

Query  643  QLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCA  470
            +L  L+S++ +CAS+VVV R  F  GDPI + P DP + VV+PS F +F F+++T ++C 
Sbjct  70   RLVRLDSSSNECASDVVVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV  129

Query  469  SSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVSL  293
            ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+I YC FG  KCF V  
Sbjct  130  NNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGR  189

Query  292  NIDESAGAVRWVLSDNNFL  236
              D    A R  LS+  F+
Sbjct  190  YYDPLTRATRLALSNTPFV  208



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 9/199 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE YYI S     +   G+
Sbjct  16   PNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGENYYIVS-AIWGAGGGGL  69

Query  643  QLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCA  470
            +L  L+S++ +CAS+V+V R  F  GDPI + P DP A VV+PS + +F F+++T ++C 
Sbjct  70   RLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCV  129

Query  469  SSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVSL  293
            ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+I YC FG  KCF V  
Sbjct  130  NNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGR  189

Query  292  NIDESAGAVRWVLSDNNFL  236
              D    A R  LS+  F+
Sbjct  190  YYDPLTRATRLALSNTPFV  208



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 9/199 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE YYI S     +   G+
Sbjct  16   PNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGENYYIVS-AIWGAGGGGL  69

Query  643  QLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCA  470
            +L  L+S++ +CAS+V+V R  F  GDPI + P DP A VV+PS + +F F+++T ++C 
Sbjct  70   RLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCV  129

Query  469  SSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVSL  293
            ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+I YC FG  KCF V  
Sbjct  130  NNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGR  189

Query  292  NIDESAGAVRWVLSDNNFL  236
              D    A R  LS+  F+
Sbjct  190  YYDPLTRATRLALSNTPFV  208



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 9/199 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE YYI S     +   G+
Sbjct  16   PNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGENYYIVS-AIWGAGGGGL  69

Query  643  QLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCA  470
            +L  L+S++ +CAS+V+V R  F  GDPI + P DP + VV+PS F +F F+++T ++C 
Sbjct  70   RLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV  129

Query  469  SSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVSL  293
            ++V WGI++D  S Q+F+ +GEFVSD S QFKI V   + N Y+I YC FG  KCF V  
Sbjct  130  NNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGR  189

Query  292  NIDESAGAVRWVLSDNNFL  236
              D    A R  LS+  F+
Sbjct  190  YYDPLTRATRLALSNTPFV  208



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 133/217 (61%), Gaps = 11/217 (5%)
 Frame = -2

Query  871  MKTLAILLF-AFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGE  695
            MK L + LF A SLYLLPNP HS FNPIRLP          AS  TPV+D +G+E+RAG 
Sbjct  1    MKALTLALFSALSLYLLPNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGG  55

Query  694  TYYITSIETPHSASAGVQLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVL  524
             YY+ S     +   G++LA L+  ++CAS+V+V P     GDPI + P   DP + VV+
Sbjct  56   NYYMVS-AIWGAGGGGLRLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVM  114

Query  523  PSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNT  347
             S + +F F+++T ++C ++V WGIQ D  S Q+FL +GEFVSD S QFKI +   + N+
Sbjct  115  ASTYQTFRFNIATNKLCVNNVNWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNS  174

Query  346  YRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            Y++ YC FG  KC+ V    D      R  LS++ F+
Sbjct  175  YKLTYCQFGSDKCYNVGRFHDHMLRTTRIALSNSPFV  211



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 9/199 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRL     TA     S  TPV+D +G+E+RAGE YYI S     +   G+
Sbjct  16   PNPAHSKFNPIRLRPAHETA-----SSETPVLDINGDEVRAGENYYIVSA-IWGAGGGGL  69

Query  643  QLAWLNSTA-QCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCA  470
            +L  L+S++ +CAS+V+V R  F  GDP  + P DP A VV+PS + +F F+++T ++C 
Sbjct  70   RLVRLDSSSNECASDVIVSRSDFDNGDPTTITPADPEATVVMPSTYQTFRFNIATNKLCV  129

Query  469  SSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDP-NTYRIDYCPFGGHKCFYVSL  293
            ++V WGI++D  S Q+F+ +GEFVSD S QFKI A  D  N Y+I YC FG  KCF V  
Sbjct  130  NNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGR  189

Query  292  NIDESAGAVRWVLSDNNFL  236
              D    A R  LS+  F+
Sbjct  190  YYDPLTRATRLALSNTPFV  208



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (62%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D  +   R  LS++ F+
Sbjct  192  RFHDHMSRTTRLALSNSPFV  211



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 120/200 (60%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S         G 
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEIRAGGNYYMVS-AIWGVGGGGP  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDHMLRTTRLALSNSPFV  211



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 122/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VVL S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LSD+ F+
Sbjct  192  RFHDPMLRTTRLALSDSPFV  211



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 122/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDHMLRTTRLALSNSPFV  211



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 122/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VVL S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 122/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CA++V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDHMLRTTRLALSNSPFV  211



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 122/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPLMRTTRLALSNSPFV  211



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ D  S Q+FL +GEFVSD S QFKI +   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDHMLRTTRIALSNSPFV  211



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VVL S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC  V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 123/200 (62%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          +S  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPSSSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP ++V++ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGI++D  S Q+FL +GEFVSD S QFKI V   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMMRTTRLALSNSPFV  211



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V++ P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP           S  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPPSSQTPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VV+   + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 122/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP           S  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPPSSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P+  DP ++V++ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 120/200 (60%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP H  FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHPRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VVL S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V W IQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWRIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LSD+ F+
Sbjct  192  RFHDPMLRTTRLALSDSPFV  211



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 120/204 (59%), Gaps = 13/204 (6%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFLPVWF  224
               D      R  LS   + P +F
Sbjct  192  RFKDPMLRTTRLALS---YYPFFF  212



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 118/200 (59%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++  ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
              +V WGIQ+D  S Q+FL  GEFVSD S QFKI V   + N Y++ YC FG  KC+   
Sbjct  132  VKNVNWGIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 123/200 (62%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP    T      S+ TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP----TTHEPPPSE-TPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V V P     GDPI + P+  DP ++V++ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDPMLRTTRLALSNSPFV  211



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 116/204 (57%), Gaps = 13/204 (6%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMVS-AILGACGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRP--TDPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+    CAS+V+V P     GD I + P   DP A VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQYD  S Q  L +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFLPVWF  224
               D      R  +S   + P +F
Sbjct  192  RFNDPMLRTTRLAIS---YYPFFF  212



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 115/204 (56%), Gaps = 13/204 (6%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+       +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMV-YAILGACGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRP--TDPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+    CAS+V+V P     GD I + P   DP A VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQYD  S Q  L +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFLPVWF  224
               D      R  LS   + P +F
Sbjct  192  RFKDPMLRTTRLALS---YYPFFF  212



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 119/199 (60%), Gaps = 10/199 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++ 
Sbjct  72   RLAHLDMMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLR  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNF  239
               D      R  LS++ F
Sbjct  192  RFHDPMLRTTRLALSNSPF  210



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 121/200 (61%), Gaps = 10/200 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +L  L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C
Sbjct  72   RLGHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N+Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFL  236
               D      R  LS++ F+
Sbjct  192  RFHDHMLRTTRLALSNSPFV  211



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 114/195 (58%), Gaps = 10/195 (5%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP           S  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLP-----TTHEPPSSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+  ++CAS+V+V P     GDPI + P   DP A VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQYD  S Q  L +GEFVSD S QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLS  251
               D      R  LS
Sbjct  192  RFNDPMLRTTRLALS  206



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 115/204 (56%), Gaps = 13/204 (6%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSGFNPIRLP-----TTHEPASSETPVLDINGDEVRAGGNYYLVS-AILGACGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRP--TDPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L+    CAS+V+V P     GD I + P   DP A VV+ S + +F F+++T ++C
Sbjct  72   RLAHLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVS  296
             ++V WGIQYD  S Q  L +GE VSD + QFKI V   + N Y++ YC FG  KC+ V 
Sbjct  132  VNNVNWGIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  295  LNIDESAGAVRWVLSDNNFLPVWF  224
               D      R  LS   + P +F
Sbjct  192  RFNDPMLRTTRLALS---YYPFFF  212



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 118/196 (60%), Gaps = 10/196 (5%)
 Frame = -2

Query  811  HSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAW  632
            HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G++LA 
Sbjct  2    HSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGLRLAH  55

Query  631  LNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVCASSV  461
            L+  ++CAS+V+V P     GDPI + P   DP + VV+ S + +F F+++T ++C ++V
Sbjct  56   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  115

Query  460  YWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-VAQPDPNTYRIDYCPFGGHKCFYVSLNID  284
             WGIQ+D  S Q+FL +GEFVSD S QFKI +   + N Y++ YC FG  KC+ V    D
Sbjct  116  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  175

Query  283  ESAGAVRWVLSDNNFL  236
                  R  LS++ F+
Sbjct  176  PMLRTTRLALSNSPFV  191



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (63%), Gaps = 9/134 (7%)
 Frame = -2

Query  823  PNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGV  644
            PNP HS FNPIRLP          AS  TPV+D +G+E+RAG  YY+ S     +   G+
Sbjct  18   PNPAHSRFNPIRLPTT-----HEPASSETPVLDINGDEVRAGGNYYMVS-AIWGAGGGGL  71

Query  643  QLAWLNSTAQCASNVVV-PRCFSFGDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVC  473
            +LA L++ ++CAS+V+V P     GDPI + P   DP + VVL S + +F F+++T ++C
Sbjct  72   RLAHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLC  131

Query  472  ASSVYWGIQYDRPS  431
             ++V WGIQ+D  S
Sbjct  132  VNNVNWGIQHDSAS  145



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -2

Query  547  DPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-  371
            DP + VV+ S + +F F+++T ++C ++V WGIQ+D  S Q+FL +GEFVSD S QFKI 
Sbjct  9    DPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIE  68

Query  370  VAQPDPNTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
            +   + N Y++ YC FG  KC+ V    D      R  LS++ F+ V
Sbjct  69   LVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFV  115



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (60%), Gaps = 1/99 (1%)
 Frame = -2

Query  544  PNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-V  368
            P + VV+ S + +F F+++T ++C ++V WGIQYD  S Q  L +GEFVSD S QFKI V
Sbjct  60   PESTVVMASTYQTFRFNIATNKLCVNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEV  119

Query  367  AQPDPNTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLS  251
               + N Y++ YC FG  KC+ V    D      R  LS
Sbjct  120  VDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALS  158



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 101/229 (44%), Gaps = 32/229 (14%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK  A+L F F +                 +R   ADA+  +    V+DTDG +LRAG+ 
Sbjct  1    MKNFALLCFLFIVIASSE------------VRFCRADASPDA----VLDTDGKKLRAGDQ  44

Query  691  YYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--GDPIRVRPTDPNAAVVLPS  518
            YYI S+ + +  S G+ +  +    +C  N ++P  + +  G P    P +P   VV  S
Sbjct  45   YYILSVYSRN--SGGLSIGGIYGYEKCPIN-ILPESYDYLDGLPATFSPVNPKKGVVRVS  101

Query  517  KFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD-----LSGQFKIVAQPD  356
              L+ EF  ST   C  S  W + ++D+  +Q+F+  G    +     +   FK+  +  
Sbjct  102  TDLNIEFEASTR--CGISTVWKVGKFDQYLKQYFVTMGGTKGNPGRETIGNWFKV--EKH  157

Query  355  PNTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNF-LPVWFRKTR  212
               Y+  YCP     C  +  ++       R + + N+   PV F+K R
Sbjct  158  GKNYKFVYCPTVCKYCKVMCKDVGLFYKNGRRIFALNDAPFPVMFKKVR  206



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 83/179 (46%), Gaps = 12/179 (7%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVR  554
            V+DTDGNELR G  YYI    T    + G+ LA  N +      + +    + G P+   
Sbjct  25   VLDTDGNELRRGVEYYIYPGIT--DVAGGLTLASRNHSCPLDVTLAISPT-NNGLPVTFL  81

Query  553  PTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSD-----L  389
            P DP    +  S  L+  FS  T  +C  S  W + +D  +++F++ +G    +     L
Sbjct  82   PADPEEDTINTSTDLNIVFSAFT--ICLQSTAWKLDFDNTTRRFYVTTGGVTGNPGRETL  139

Query  388  SGQFKIVAQPDPNTYRIDYCPFGGHKCFYV--SLNIDESAGAVRWVLSDNNFLPVWFRK  218
               FKI +    + Y + +CP   + C  V  SL +    G +R  +S +  LPV FR+
Sbjct  140  DNWFKIQSASGRSGYNLVFCPSVCNICRPVCGSLGVVREDGRLRLGISSDAPLPVEFRR  198



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 93/198 (47%), Gaps = 20/198 (10%)
 Frame = -2

Query  781  IRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASN  602
            +R   ADA+  +    V+DTDG +LRAG+ YYI S+ + +  S G+ +  +    +C  N
Sbjct  19   VRFCRADASPDA----VLDTDGKKLRAGDQYYILSVYSRN--SGGLSIGGIYGYEKCPIN  72

Query  601  VVVPRCFSF--GDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPS  431
             ++P  + +  G P    P +P   VV  S  L+ +F  +T   C  S  W + ++D   
Sbjct  73   -ILPESYDYLHGLPATFSPINPKKGVVRVSTDLNIQFEANTR--CGISTVWKVGKFDEYL  129

Query  430  QQFFLNSGEFVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESAGAV  266
            +Q+F+  G    +     +   FK+  +     Y++ YCP     C  V  ++       
Sbjct  130  KQYFVTMGGMKGNPGRETIENWFKV--EKYGKNYKLVYCPTVCKYCKVVCKDVGLFYKNG  187

Query  265  RWVLSDNNF-LPVWFRKT  215
            R V++ N+   PV F+K 
Sbjct  188  RRVIALNDAPFPVMFKKV  205



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 94/204 (46%), Gaps = 24/204 (12%)
 Frame = -2

Query  805  AFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLN  626
            AFNP      LP A A  A D  PV+D +G +LR+G  YYI  +        G+ +A + 
Sbjct  17   AFNP------LPGA-AEAAPD--PVLDIEGKQLRSGVDYYILPV--IRGRGGGLTVASVR  65

Query  625  STAQCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI  449
            +   C  +VV  +   S G P+   P +P   V+  S   + +FS +T  +CA S  W +
Sbjct  66   NKT-CPLDVVQDKLEVSHGLPLTFTPVNPKQDVIRVSTDHNIKFSAAT--ICAQSTVWKL  122

Query  448  QYDRPSQQFFLNSGEFVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNID  284
            +YD  + Q F+ +G    +     LS  FKI    D   Y++ +CP   + C  +  ++ 
Sbjct  123  EYDESTGQRFITTGGVEGNPGRGTLSNWFKIEKYGD--DYKLVFCPTVCNFCKVICRDVG  180

Query  283  E--SAGAVRWVLSDNNFLPVWFRK  218
                 G  R  L+ +    V F+K
Sbjct  181  VYIQKGYRRLALTTDAPFRVMFKK  204



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 74/177 (42%), Gaps = 12/177 (7%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGD-PIR  560
            PV+D DG +LR G  YYI  +   H     V     N T  C   VV  R     D P+ 
Sbjct  35   PVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLA  94

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+  FS   P    SS  W + +YD  + Q+F+  G    +   
Sbjct  95   FFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGP  154

Query  391  --LSGQFKIVAQPDPNTYRIDYCPF----GGHKCFYVSLNIDESAGAVRWVLSDNNF  239
              +S  FKI        Y++ +CP        KC  V + ID+  G  R  LSD  F
Sbjct  155  ETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQK-GRRRLALSDKPF  210



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 83/189 (44%), Gaps = 16/189 (8%)
 Frame = -2

Query  760  AAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-  584
             A  S   PV+DT+G +LR+G  YYI  +        G+ LA       C  +VV  +  
Sbjct  22   VAAESSPDPVLDTEGKQLRSGVDYYILPV--IRGRGGGLTLAS-TGNENCPLDVVQEQHE  78

Query  583  FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGE  404
             S G P+   P +P   V+  S   + +FS ST  +C  S  W ++YD  S Q F+ +G 
Sbjct  79   VSNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG  136

Query  403  FVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYV--SLNIDESAGAVRWVLSDN  245
               +     L   FKI    D   Y++ +CP     C  V   + I    G  R  LSD 
Sbjct  137  VEGNPGXETLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDV  194

Query  244  NFLPVWFRK  218
             F  V F+K
Sbjct  195  PF-KVMFKK  202



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 80/183 (44%), Gaps = 15/183 (8%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRV  557
            PV+D  G ELRAG  YYI  +        G+ LA   +     S V        G P+  
Sbjct  32   PVLDISGKELRAGVNYYI--LPVIRGRGGGLSLASTGNNTCPLSVVQEQSELKKGLPLTF  89

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSD-----  392
             P DP   VV  S   + +FS ST  +C  S  W +  D  + ++F+N+G    +     
Sbjct  90   HPVDPKKGVVRLSTDHNIKFSAST--ICVQSTVWRLDNDESTGKYFVNTGGVEGNPGSGS  147

Query  391  LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDN-NFLPVW  227
            +S  FKI A    + Y++ +CP    F    C  V + + +    +   L+D+    P+ 
Sbjct  148  ISNWFKIEAYGSSD-YKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLTLTDDVTPFPIM  206

Query  226  FRK  218
            F+K
Sbjct  207  FKK  209



>gb|ABB72793.1| Kunitz-type protease inhibitor-like protein [Solanum tuberosum]
Length=213

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 86/211 (41%), Gaps = 27/211 (13%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLA  635
            T ++ NPI LP           SD TPV+D  G EL    +Y I SI             
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGK  68

Query  634  WLNSTAQCASNVVVPRCFSF-------GDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTPR  479
              NS A CA+ V     F F       G P+R +  +      +   + L+ +F +ST +
Sbjct  69   SPNSDAPCANGV-----FRFNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVK  123

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCPFGGHKCF  305
            +CAS   W +  YD       L +G  +    S  FKIV       Y + YCPF     F
Sbjct  124  LCASYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPFSSDDQF  182

Query  304  YVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
             + + +    G  R  L  +N L V F++ +
Sbjct  183  CLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  213



>ref|XP_007041757.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOX97588.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 78/187 (42%), Gaps = 12/187 (6%)
 Frame = -2

Query  769  TADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVP  590
            ++ ++   +N PV D +G+E+R G  YY+ S                N T  C  +V   
Sbjct  16   SSKSSATDENVPVYDVNGDEVRPGVQYYVVSAIWGAGGGGLYLGQGRNKT--CPYDVAQE  73

Query  589  RC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFL  416
            R     G P+     D    V+  S  L+ +F    P  C+ S  W +  YD    ++F+
Sbjct  74   RSDLVRGIPVTFSTVDTEGDVIHESTDLNIKFIRPQPTACSPSTVWKVDCYDESGGEWFV  133

Query  415  NSGEFVSD---LSGQFKIVAQPDPNTYRIDYCPFGGHKCF-YVSLNIDESAGA----VRW  260
             +G    D   LS  F+I A P   +Y++  CP     C  Y+   I   +      +R 
Sbjct  134  TTGGLEGDAQALSSLFRITAAPGGISYKLALCPSVCESCTKYLCSEIGRHSSGFDSLIRL  193

Query  259  VLSDNNF  239
            VLSDN +
Sbjct  194  VLSDNGW  200



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 86/188 (46%), Gaps = 16/188 (9%)
 Frame = -2

Query  757  AVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-F  581
            A  S   PV+DT+G +LR+G  YYI  +        G+ LA   + + C  +VV  +   
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTGNES-CPLDVVQEQQEV  79

Query  580  SFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEF  401
            S G P+   P +P   V+  S   + +FS ST  +C  S  W ++YD  S Q+F+ +G  
Sbjct  80   SNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQWFVTTGGV  137

Query  400  VSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYV--SLNIDESAGAVRWVLSDNN  242
              +     L   FKI    D   Y++ +CP     C  V   + I    G  R  LSD  
Sbjct  138  EGNPGRETLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVP  195

Query  241  FLPVWFRK  218
            F  V F+K
Sbjct  196  F-KVMFKK  202



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 100/226 (44%), Gaps = 32/226 (14%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MKT ++L   FSL L           I L ++  +  A  A D  PV+DT+G +LR+G  
Sbjct  1    MKTTSLL---FSLQL-----------IALAVKPFSVAAESAPD--PVLDTEGKKLRSGVD  44

Query  691  YYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSK  515
            YYI  +        G+ LA   +   C  +VV  +   S G P+   P +P   V+  S 
Sbjct  45   YYILPVF--RGRGGGLTLASTGNET-CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVST  101

Query  514  FLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSD-----LSGQFKIVAQPDPN  350
              + +FS ST  +C  S  W ++YD  S Q F+ +G    +     L   FKI    D  
Sbjct  102  DHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYDD--  157

Query  349  TYRIDYCPFGGHKCFYV--SLNIDESAGAVRWVLSDNNFLPVWFRK  218
             Y++ +CP     C  V   + I    G  R  LSD  F  V F+K
Sbjct  158  DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVPF-KVMFKK  202



>gb|AIT42186.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=213

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 86/210 (41%), Gaps = 25/210 (12%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLA  635
            T ++ NPI LP           SD TPV+D  G EL    +Y I SI             
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGK  68

Query  634  WLNSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTPRV  476
              NS A CA+ V      V P     G P+R +  +      +   + L+ +F++ST ++
Sbjct  69   SPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGPHIFEDELLNIQFAISTSKL  124

Query  475  CASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCPFGGHKCFY  302
            C S   W +  YD       L +G  +    S  FKIV       Y + YCPF     F 
Sbjct  125  CVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPFSSDDQFC  183

Query  301  VSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            + + +    G  R  L  +N L V F++ +
Sbjct  184  LKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  213



>sp|Q41484.1|SPI5_SOLTU RecName: Full=Serine protease inhibitor 5; AltName: Full=gCDI-B1; 
Flags: Precursor [Solanum tuberosum]
 dbj|BAA04152.1| proteinase inhibitor [Solanum tuberosum]
 gb|ABB72795.1| Kunitz-type protease inhibitor-like protein [Solanum tuberosum]
 gb|AIT42169.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=213

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 85/211 (40%), Gaps = 27/211 (13%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLA  635
            T ++ NPI LP           SD TPV+D  G EL    +Y I SI             
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGK  68

Query  634  WLNSTAQCASNVVVPRCFSF-------GDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTPR  479
              NS A CA+ V     F F       G P+R +  +      +   + L+ +F +ST +
Sbjct  69   SPNSDAPCANGV-----FRFNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVK  123

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCPFGGHKCF  305
            +C S   W +  YD       L +G  +    S  FKIV       Y + YCPF     F
Sbjct  124  LCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPFSSDDQF  182

Query  304  YVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
             + + +    G  R  L  +N L V F++ +
Sbjct  183  CLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  213



>ref|XP_008437071.1| PREDICTED: miraculin-like [Cucumis melo]
Length=212

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 98/230 (43%), Gaps = 33/230 (14%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK  A+L F F   ++ +            +R   ADA+  +    V+DTDG +LR    
Sbjct  1    MKKFALLSFLFIAIVIASS----------ELRFCRADASPDA----VLDTDGKKLRVSNK  46

Query  691  YYITSIETPHSASAGVQLAWLNSTAQ---CASNVVVPRCF-SFGDPIRVRPTDPNAAVVL  524
            YYI         S G  LA  N   +   C  NVV  R   S GDP    P +P   VV 
Sbjct  47   YYILP---AFEGSGGGGLAIGNIRKEYDRCGINVVQERYEQSDGDPTTFLPINPKKGVVR  103

Query  523  PSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQ-----FKIVAQ  362
             S  L+ EF  +T   C  S  W +  +DR  +Q+F+  G    +   +     FKI   
Sbjct  104  VSTDLNIEFDATTR--CRKSTVWKLGTFDRYLRQYFVTIGGTKGNPGRETTENWFKIEKY  161

Query  361  PDPNTYRIDYCPFGGHKCFYVSLNID--ESAGAVRWVLSDNNFLPVWFRK  218
               N Y++ YCP     C  +  +I   E+ G    VLSD  F PV F+K
Sbjct  162  GKGN-YKLVYCPRVCKYCKVMCKDIGIFENNGIRGLVLSDTPF-PVIFKK  209



>ref|XP_010683195.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=221

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 87/197 (44%), Gaps = 12/197 (6%)
 Frame = -2

Query  793  IRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQ  614
            I L   LPT  A   +D++ V+D DGN +  G  YY+ +  +      G+  A   +  Q
Sbjct  12   ILLIFSLPTNIATKTTDDSLVLDVDGNPIEVGSAYYVRTELSKAGIGGGLVTASKPNHTQ  71

Query  613  CASNVV-VPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDR  437
            C   V  +   F    P+   P+  +   +  S  ++  F+ +T  VC+    W +  D 
Sbjct  72   CPQYVAQLAYGFEGEIPVTFYPSSSSQKFIHISSDINIIFN-TTSNVCSQGA-WQLTPDA  129

Query  436  PSQQFFLNSGEFVSD-----LSGQFKIVAQP-DPNTYRIDYCPFGGHKCFYVSLNIDESA  275
             +   +L++G  + +      +  FKI   P DPN Y+++YCP         S   D   
Sbjct  130  SNGNLYLSTGGVIGNPGSLTTANWFKIAKSPYDPNFYQLEYCP---DTKTVASPTGDIVC  186

Query  274  GAVRWVLSDNNFLPVWF  224
            GA+  + S ++FL +W 
Sbjct  187  GAIDALDSTDDFLLMWL  203



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 78/187 (42%), Gaps = 14/187 (7%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC--FSFGD  569
            N PV+DTDG ELR G  YY+ S                 S  Q   ++VV R     +G 
Sbjct  28   NKPVLDTDGEELRTGVEYYVVSALWAAGGGGLAL---GRSRNQSCPDIVVQRRSELDYGI  84

Query  568  PIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD  392
            P+   P  PN   +  S  L  EF      +C ++  W +  YD+ + ++++ +G    D
Sbjct  85   PVIFSPVKPNDVFIRVSTDLIIEFVPLRDSLCLTTAVWKLDDYDQSTGKWWVIAGRVAGD  144

Query  391  LS-----GQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNID--ESAGAVRWVLSDNNFLP  233
                     FKI  +     Y+  YCP     C  +  +I   E  G +R  LSD  +  
Sbjct  145  AGPHTFPNWFKI-EKNGVFGYKFTYCPSVCDSCTTLCSDIGRYEDNGQIRLGLSDQGWPF  203

Query  232  VWFRKTR  212
            V+ + TR
Sbjct  204  VFTKATR  210



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 70/150 (47%), Gaps = 13/150 (9%)
 Frame = -2

Query  757  AVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-F  581
            A  S   PV+DT+G +LR+G  YYI  +        G+ LA   +   C  +VV  +   
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTGNET-CPLDVVQEQQEV  79

Query  580  SFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEF  401
            S G P+   P +P   V+  S   + +FS ST  +C  S  W ++YD  S Q F+ +G  
Sbjct  80   SNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  400  VSD-----LSGQFKIVAQPDPNTYRIDYCP  326
              +     L   FKI    D   Y++ +CP
Sbjct  138  EGNPGRETLDNWFKIEKYED--DYKLVFCP  165



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 70/150 (47%), Gaps = 13/150 (9%)
 Frame = -2

Query  757  AVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-F  581
            A  S   PV+DT+G +LR+G  YYI  +        G+ LA   +   C  +VV  +   
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTGNET-CPLDVVQEQQEV  79

Query  580  SFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEF  401
            S G P+   P +P   V+  S   + +FS ST  +C  S  W ++YD  S Q F+ +G  
Sbjct  80   SNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  400  VSD-----LSGQFKIVAQPDPNTYRIDYCP  326
              +     L   FKI    D   Y++ +CP
Sbjct  138  EGNPGRETLDNWFKIEKYED--DYKLVFCP  165



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  775  LPTADAAVASD---NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCAS  605
            L +A  ++A D      V+DTDG +LRAG  YYI  +        G+ +A     A C  
Sbjct  16   LASARPSIAGDLDATEAVLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTGDEA-CPL  72

Query  604  NVVV-PRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQ  428
            +VV  P   S G P+   P +P   V+  S  L+ +FS S+  +C  S  W IQ    S+
Sbjct  73   DVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSE  130

Query  427  -QFFLNSGEF-----VSDLSGQFKIVAQPDPNTYRIDYCP  326
             Q+F+ +G       +  ++  FKI    D   Y++ +CP
Sbjct  131  IQWFVTTGGVEGNPGIETITNWFKIEKAGDD--YKLVFCP  168



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 70/150 (47%), Gaps = 13/150 (9%)
 Frame = -2

Query  757  AVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-F  581
            A  S   PV+DT+G +LR+G  YYI  +        G+ LA   +   C  +VV  +   
Sbjct  45   AAESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTGNET-CPLDVVQEQQEV  101

Query  580  SFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEF  401
            S G P+   P +P   V+  S   + +FS ST  +C  S  W ++YD  S Q F+ +G  
Sbjct  102  SNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGGV  159

Query  400  VSD-----LSGQFKIVAQPDPNTYRIDYCP  326
              +     L   FKI    D   Y++ +CP
Sbjct  160  EGNPGRETLDNWFKIEKYED--DYKLVFCP  187



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 82/189 (43%), Gaps = 16/189 (8%)
 Frame = -2

Query  760  AAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-  584
             A  S   PV+DT+G +L +G  YYI  +        G+ LA       C  +VV  +  
Sbjct  22   VAAESSPDPVLDTEGKQLWSGVDYYILPV--IRGRGGGLTLA-STGNENCPLDVVQEQHE  78

Query  583  FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGE  404
             S G P+   P +P   V+  S   + +FS ST  +C  S  W ++YD  S Q F+ +G 
Sbjct  79   VSNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG  136

Query  403  FVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYV--SLNIDESAGAVRWVLSDN  245
               +     L   FKI    D   Y++ +CP     C  V   + I    G  R  LSD 
Sbjct  137  VEGNPGHETLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDV  194

Query  244  NFLPVWFRK  218
             F  V F+K
Sbjct  195  PF-KVMFKK  202



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 12/143 (8%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGDPIR  560
            PV+DT+G +L++   YYI S+        G+ LA       C  +VV  +   S G  + 
Sbjct  30   PVLDTEGKKLQSEVDYYILSV-IRRRGGGGLTLA-STGNKTCPLDVVQEQNEVSNGLTLM  87

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSD----  392
              P +P   V+  S   + EFS +T  +C  S  W ++YD  S Q+F  +G    +    
Sbjct  88   FSPVNPKKGVIRVSTDHNIEFSAAT--ICVQSTVWKLEYDESSGQWFFTTGWVEGNLGRG  145

Query  391  -LSGQFKIVAQPDPNTYRIDYCP  326
             LS QFKI    D N   + +CP
Sbjct  146  TLSNQFKIEKYEDDNN--LVFCP  166



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 18/192 (9%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGD--  569
            N+PV+D DG+ELR G  YY+ S                 +T Q    +VV R     D  
Sbjct  28   NSPVLDIDGDELRTGVQYYVVSALWGAGGGGLAL---GRATGQSCPEIVVQRRSDLDDGT  84

Query  568  PIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNSGEFVSD  392
            P+     D    VV  S  ++ EF     R+C +S  W +  YD  + ++++ +     D
Sbjct  85   PVIFSNADSKDGVVRVSTDINIEFVPIRDRLCTTSTVWKLDNYDNSAGKWWVTTDGVKGD  144

Query  391  -----LSGQFKIVAQPDPNT-YRIDYCPFGGHKCFYVSLNIDESA---GAVRWVLSDNNF  239
                 +S  FKI  +P     Y+  +CP     C  +  +I + +   G +R  LSD+ +
Sbjct  145  PGASTMSSWFKI--EPAGGIGYKFRFCPSVCDSCTKLCSDIGKHSDDDGQIRLALSDSGW  202

Query  238  LPVWFRKTRNCL  203
             P  F+K  N +
Sbjct  203  -PWIFKKASNTI  213



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 15/174 (9%)
 Frame = -2

Query  826  LPNPTHSAFNPIRL--PIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSAS  653
            +PNPT S    I L     L ++   +A+    V+D DGNELR G  YYI    T    +
Sbjct  1    MPNPTTSTMKLILLFSAFFLLSSLTTLAAAEV-VLDRDGNELRRGVEYYIYPGIT--DVA  57

Query  652  AGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVC  473
             G+ LA  N +      + +    S G P+   P DP    +  S  L+  FS  T  +C
Sbjct  58   GGLTLASRNHSCPLDVTLAISPT-SNGLPLTFLPADPEEDTINTSTDLNIVFSAVT--IC  114

Query  472  ASSVYWGIQYDRPSQQFFLNSGEFVSD-----LSGQFKIVAQPDPNTYRIDYCP  326
              S  W + +D  + +F++ +G    +     L+  FKI  + D   Y++ +CP
Sbjct  115  VQSTVWKLDFDDAAGRFYVTTGGVAGNPGRETLANWFKI--ENDRGAYKLVFCP  166



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 81/184 (44%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCLLDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ L +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 83/196 (42%), Gaps = 36/196 (18%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYY-ITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--G  572
            N+PV+DTDG+ELR G  YY ++SI         +  A    T Q    +VV R      G
Sbjct  28   NSPVLDTDGDELRTGVRYYVVSSIWGAGGGGLALGRA----TGQSCPEIVVQRRSDLDNG  83

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNSGEFVS  395
             P+     D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +     
Sbjct  84   TPVIFSNADSKDGVVRLSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTD----  139

Query  394  DLSGQFKIVAQPDPNT--------------YRIDYCPFGGHKCFYVSLNI---DESAGAV  266
                   +  QP PNT              Y+  +CP     C  +  +I    +  G +
Sbjct  140  ------GVRGQPGPNTLTSWFKIERAGVLGYKFRFCPSVCDSCKTLCSDIGRHSDDDGQI  193

Query  265  RWVLSDNNFLPVWFRK  218
            R  LSDN + P  F+K
Sbjct  194  RLALSDNGW-PWMFKK  208



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 81/189 (43%), Gaps = 19/189 (10%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA   +   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRRNNKTCPLDVVQEQHSFKNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPFKVV  202

Query  229  WFRKTRNCL  203
              +K  N L
Sbjct  203  SSKKKLNHL  211



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 81/184 (44%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPVDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGNYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>emb|CAA43267.1| sporamin [Ipomoea batatas]
Length=236

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +2

Query  296  ANVEAFVAAKRTIIDSVSVRVRLG-YNLELAAKVGDKLAGVQEELLGWPVVLDPPIDTTR  472
            AN+ AFV A+ T+ + V V+V +   NLEL A VG KLAG QE L G  VVLD P+    
Sbjct  60   ANIVAFVGAELTVSEFVEVKVGIHQLNLELVAIVGHKLAGFQEILPGRAVVLDSPVHVVH  119

Query  473  ANPGRRNGEFEAQELRRQDDGGVGVSR  553
            A     + E E+   RR D GG  V R
Sbjct  120  AELVGGDVEPESLVRRRHDHGGFRVGR  146



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 20/183 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGDPIR  560
            PV+D  G ELR G  YYI  +        G+ LA       C  +VV  +   S G P+ 
Sbjct  25   PVLDISGEELRTGTDYYILPV--IRGGGGGLTLA-STGNETCPLDVVQEQLEVSNGLPLT  81

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEF-----VS  395
              P +    VV  S  L+ +FS +T  +C  S  W +  D  +Q+  + +G       + 
Sbjct  82   FSPVNITKGVVRVSTDLNIKFSAAT--ICVQSTVWKLDNDEATQKMVVTTGGVEGNPGIE  139

Query  394  DLSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVW  227
             LS  FKI    D   Y++ +CP    F    C  + + ID  AG  R  LSD   L V 
Sbjct  140  TLSNWFKIERYEDD--YKLVFCPGVCDFCRPVCGDLGVFID--AGIRRLALSDVP-LKVM  194

Query  226  FRK  218
            F++
Sbjct  195  FKR  197



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 85/190 (45%), Gaps = 16/190 (8%)
 Frame = -2

Query  760  AAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-  584
            +A A +  PV+DTD N +RAG  YYI  +        G+ LA   +   C  +VV  +  
Sbjct  23   SAAAEEPAPVLDTDRNLVRAGVDYYILPV--IRGRGGGLTLASTGNET-CPLDVVQEQLE  79

Query  583  FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSG  407
               G P+  RP +P   VV  S   + +FS +T  +C  S  W +  YD  + ++F+ +G
Sbjct  80   VRNGLPLTFRPVNPKKGVVRVSTDQNIKFSGAT--ICVQSTVWKLDNYDASTGKYFITTG  137

Query  406  EFVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYV--SLNIDESAGAVRWVLSD  248
                      +S  FKI    D   Y++ +CP   + C  +   + I    G  R  L++
Sbjct  138  GVEGKPGRETISNWFKIETYGD--DYKLVFCPTVCNYCKVICKDVGIFMQDGKRRLALTE  195

Query  247  NNFLPVWFRK  218
            +    V  +K
Sbjct  196  DAPFRVMLKK  205



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 80/184 (43%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA   +   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRGNNKTCPLDVVQEQHSFKNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDIPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 81/191 (42%), Gaps = 14/191 (7%)
 Frame = -2

Query  748  SDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFG  572
            +D +PV+D+DG+ELR G  YY+ S                  T Q    +VV R     G
Sbjct  26   ADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLAL---GRVTGQSCPEIVVQRGSDDDG  82

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVS  395
             P+     D    VV  S  ++ EF     R+C +S  W +  YD  + ++++ +     
Sbjct  83   LPVIFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKG  142

Query  394  D-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESA--GAVRWVLSDNNFL  236
            D     L+  FKI        Y+  +CP     C ++  +       G VR  LS+N + 
Sbjct  143  DPGHNTLTSWFKI-EDAGALGYKFRFCPSVCDSCIHLCNDFGRHGHDGQVRLALSENGW-  200

Query  235  PVWFRKTRNCL  203
            P  F+K RN +
Sbjct  201  PWIFKKARNSI  211



>ref|XP_007036750.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21251.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 81/191 (42%), Gaps = 14/191 (7%)
 Frame = -2

Query  748  SDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFG  572
            +D +PV+D+DG+ELR G  YY+ S                  T Q    +VV R     G
Sbjct  26   ADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLAL---GRVTGQSCPEIVVQRGSDDDG  82

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVS  395
             P+     D    VV  S  ++ EF     R+C +S  W +  YD  + ++++ +     
Sbjct  83   LPVIFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKG  142

Query  394  D-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESA--GAVRWVLSDNNFL  236
            D     L+  FKI        Y+  +CP     C ++  +       G VR  LS+N + 
Sbjct  143  DPGHNTLTSWFKI-ENAGALGYKFRFCPSVCDSCIHLCNDFGRHGHDGQVRLALSENGW-  200

Query  235  PVWFRKTRNCL  203
            P  F+K RN +
Sbjct  201  PWIFKKARNSI  211



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 81/184 (44%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDISGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPVDVVQEQHSFKNGFPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (48%), Gaps = 14/143 (10%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVV-PRCFSFGDPIRV  557
            V+DTDG +LRAG  YYI  +        G+ +A       C  +VV  P   S G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTRDET-CPLDVVQDPLEISKGLPLTF  89

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQ-QFFLNSGEF-----VS  395
             P +P   V+  S  L+ +FS S+  +C  S  W IQ    S+ Q+F+ +G       + 
Sbjct  90   TPVNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  394  DLSGQFKIVAQPDPNTYRIDYCP  326
             ++  FKI    D   Y++ +CP
Sbjct  148  TITNWFKIEKADDD--YKLVFCP  168



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 92/211 (44%), Gaps = 35/211 (17%)
 Frame = -2

Query  853  LLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSI  674
            LLFAFS  L                R   ADAA     +PV+D  GN+L+ G  YYI  +
Sbjct  14   LLFAFSAKL----------------RSVAADAA----PSPVLDITGNKLQTGVDYYI--L  51

Query  673  ETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEF  497
                    G+ LA  ++   C  +VV  +   S G P++  P +    VV  S  L+ +F
Sbjct  52   PVIRGRGGGLTLASTSNKTSCPLDVVQEQNEVSNGLPLKFSPVNVTKGVVRVSTDLNIKF  111

Query  496  SVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQ-----FKIVAQPDPNTYRID  335
            S +T  +C  S  W + ++D  + Q+F+ SG    +   Q     FKI    D   Y++ 
Sbjct  112  SATT--ICVQSTVWKLGKFDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKFGD--DYKLV  167

Query  334  YCPFGGHKCFYV--SLNIDESAGAVRWVLSD  248
            +CP   + C  +   + I    G  R  LSD
Sbjct  168  FCPTVCNFCKVICGDVGIFFQDGKRRLALSD  198



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (48%), Gaps = 14/143 (10%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVV-PRCFSFGDPIRV  557
            V+DTDG +LRAG  YYI  +        G+ +A       C  +VV  P   S G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTRDET-CPLDVVQDPLEISKGLPLTF  89

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQ-QFFLNSGEF-----VS  395
             P +P   V+  S  L+ +FS S+  +C  S  W IQ    S+ Q+F+ +G       + 
Sbjct  90   TPVNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  394  DLSGQFKIVAQPDPNTYRIDYCP  326
             ++  FKI    D   Y++ +CP
Sbjct  148  TITNWFKIEKAGDD--YKLVFCP  168



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 76/174 (44%), Gaps = 19/174 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSD  248
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSD  196



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 95/218 (44%), Gaps = 20/218 (9%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PVVD  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVVDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ +CP    F    C  V + I+   G  R  LSD   L V
Sbjct  147  RTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVP-LKV  201

Query  229  WFRKTRNCLDFTL*TGV*GQKFSFSVLGVGSWKLIMLN  116
             F+K R      +   + G+    ++   G+ K ++L+
Sbjct  202  VFKKLRVGSKHYILAAICGRGGGLTLGSRGNNKTVLLH  239



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (48%), Gaps = 14/143 (10%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVV-PRCFSFGDPIRV  557
            V+DTDG +LRAG  YYI  +        G+ +A       C  +VV  P   S G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTRDET-CPLDVVQDPLEISKGLPLTF  89

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQ-QFFLNSGEF-----VS  395
             P +P   V+  S  L+ +FS S+  +C  S  W IQ    S+ Q+F+ +G       + 
Sbjct  90   TPVNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  394  DLSGQFKIVAQPDPNTYRIDYCP  326
             ++  FKI    D   Y++ +CP
Sbjct  148  TITNWFKIEKAGDD--YKLVFCP  168



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 81/184 (44%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPVDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  ++ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAAIGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>sp|P58514.2|SPI1_SOLTU RecName: Full=Serine protease inhibitor 1; AltName: Full=PSPI-21; 
AltName: Full=PSPI-21-6.3; Contains: RecName: Full=Serine 
protease inhibitor 1 chain A; Contains: RecName: Full=Serine 
protease inhibitor 1 chain B; Flags: Precursor [Solanum 
tuberosum]
 gb|AAM21646.1|AF495585_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
 gb|AIT42178.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 99/236 (42%), Gaps = 41/236 (17%)
 Frame = -2

Query  850  LFAFSLYLLP----NPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYI  683
            LF   L L+P    + T ++ NPI LP           SD TPV+D  G EL +  +Y I
Sbjct  4    LFLVCLCLVPIVVFSSTFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI  52

Query  682  TSIETPHSASAG-VQLAWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAV  530
              I T   A  G V L    NS A CA+ V      V P     G P+R +  +      
Sbjct  53   --ISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGQG  106

Query  529  VLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPD  356
            +  ++ L+ +F++ST ++C S   W +  YD       L +G  +    S  FKIV    
Sbjct  107  IFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQ  166

Query  355  PNTYRIDY--------CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
               Y + Y        CPF     F + + +    G  R  L  +N L + F++ +
Sbjct  167  LG-YNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDISFKQVQ  221



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 81/184 (44%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDISGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPVDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWVVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 80/184 (43%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LR G  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  74   PVLDIAGKQLRTGSKYYILPVT--KGRGGGLTLAGRSNNKTCPLDVVQEQHSFKNGLPVT  131

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ L +G    +   
Sbjct  132  FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGP  189

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  +
Sbjct  190  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KI  244

Query  229  WFRK  218
             F+K
Sbjct  245  VFKK  248



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 85/182 (47%), Gaps = 17/182 (9%)
 Frame = -2

Query  760  AAVASDN--TPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR  587
             +VA+D   +PV+D  GN+L+ G  YYI  +        G+ LA  ++   C  +VV  +
Sbjct  23   GSVAADAAPSPVLDITGNKLQTGVNYYI--LPVIRGRGGGLTLASTSNKTSCPLDVVQEQ  80

Query  586  C-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLN  413
               S G  ++  P +    VVL S  L+ +FS +T  +C  S  W + ++D  + Q+F+ 
Sbjct  81   NEVSNGLSLKFSPVNVTKGVVLVSTDLNIKFSATT--ICVQSTVWKLGKFDEQTGQWFVT  138

Query  412  SGEFVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDE--SAGAVRWVL  254
            SG    +      S  FKI    D   Y++ +CP   + C  +  ++      G  R  L
Sbjct  139  SGGVEGNPGRQTTSNWFKIEKFGDD--YKLVFCPTVCNFCKVICRDVGIFFQDGKRRLAL  196

Query  253  SD  248
            SD
Sbjct  197  SD  198



>gb|AIT42170.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 90/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y+I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYHI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQCIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + Q     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVQSSQFGYNLLYCPVTSTMSC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 76/174 (44%), Gaps = 19/174 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDTAFGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSD  248
              +   FKI  +     Y++ +CP    F    C  V + I+   G  R  LSD
Sbjct  147  RTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRLALSD  196



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 74/153 (48%), Gaps = 15/153 (10%)
 Frame = -2

Query  757  AVASDN--TPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC  584
            +VA+D   +PV+D  G +LR G  YYI  +        G+ LA  ++T  C  +VV  + 
Sbjct  20   SVAADAAPSPVLDITGKKLRTGTDYYILPV--IRGRGGGLTLASTSNTTSCPLDVVQEQH  77

Query  583  -FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNS  410
              S G P+   P +P   VV  S   + +FS +T  +C  S  W + ++D  + Q+F+ S
Sbjct  78   EVSNGLPLTFSPVNPKKGVVRVSTDHNIKFSAAT--ICVQSTMWKLDKFDEQTGQWFVTS  135

Query  409  GEFVSD-----LSGQFKIVAQPDPNTYRIDYCP  326
            G    +      S  FKI  +     Y++ +CP
Sbjct  136  GGVEGNPGRQTTSNWFKI--EKYDEDYKLVFCP  166



>ref|NP_001274866.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 gb|AAL99260.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 dbj|BAC23032.1| cathepsin D inhibitor [Solanum tuberosum]
 gb|AIT42154.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 84/205 (41%), Gaps = 28/205 (14%)
 Frame = -2

Query  784  PIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQLAWL-NSTAQC  611
            PI LPT         TPV+DT+GNEL    +Y I  I T   A  G V L    NS A C
Sbjct  27   PIDLPTDTTPC----TPVLDTNGNELNPNSSYRI--ISTFWGALGGDVYLGKSPNSDAPC  80

Query  610  ASNV------VVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI  449
               V      V PR    G P+R  P   + A +   + L+ +F++ TP++C S   W +
Sbjct  81   PDGVFRYNSDVGPR----GTPVRFIPL--SGANICEDQLLNIQFNIPTPKLCVSYTIWKV  134

Query  448  -QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDYCPFGGHKC-------FYVSL  293
               +   +   L +G  +      +  + +     Y + YCP     C       F   +
Sbjct  135  GNLNALLRTMLLETGGTIGQADSSYFKIVKSSKIGYNLLYCPLTPIICPLCPDDLFCAKV  194

Query  292  NIDESAGAVRWVLSDNNFLPVWFRK  218
             +    G  R  L + N L V F++
Sbjct  195  GVVIQNGKRRLALVNENPLDVLFQE  219



>dbj|BAA03723.1| 25kD storage protein [Colocasia esculenta]
Length=209

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 68/151 (45%), Gaps = 11/151 (7%)
 Frame = -2

Query  769  TADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVP  590
            TA AAVAS+  PV+D DGNELR G  YY  S+ +P+S   G+ LA + S A C  NV   
Sbjct  14   TARAAVASN--PVLDVDGNELRRGNRYYAISLRSPNS---GLTLA-VRSNAPCPLNVDQA  67

Query  589  RCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNS  410
                +G P+   P + +   V     L   F    P  C  S  W +  +         S
Sbjct  68   PSKDYGRPLAFFPENVDDDTVQEGSTLYIMF--PEPSECRESTVWTLGRETDVVTTGGTS  125

Query  409  GEFVSDLSGQFKIVAQPDPNT---YRIDYCP  326
               +   + +F I    D ++   Y+I+ CP
Sbjct  126  SSAIGPRNSRFTIRRTGDASSKGEYQIEVCP  156



>sp|Q41433.1|SPI6_SOLTU RecName: Full=Probable serine protease inhibitor 6; AltName: 
Full=AM66; Flags: Precursor [Solanum tuberosum]
 gb|AAC49602.1| Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=221

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 90/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y+I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYHI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + Q     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVQSSQFGYNLLYCPVTSTMSC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|AFK41478.1| unknown [Medicago truncatula]
Length=213

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 21/178 (12%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIET-------PHSASAGVQLAWLNSTAQCASNVVVPRCFSF  575
            VVDT+G ++RAG  YYI  + T       P    +G  L   +    C  NVVV   F  
Sbjct  30   VVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGFVLIARSPNETCPLNVVVVEGFR-  88

Query  574  GDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFV  398
            G  +   P +P   V+  S  L+ + S++T   C  S  W +  +D  + Q+F+ +G  +
Sbjct  89   GQGVTFTPVNPKKGVIRVSTDLNIKTSLNTS--CEESTIWTLDDFDSSTGQWFVTTGGVL  146

Query  397  SD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNID---ESAGAVRWVLSD  248
             +     +   FKI    D   Y+  +CP   + C  +  N+    +S G  R  L+D
Sbjct  147  GNPGKDTVDNWFKIEKYED--DYKFVFCPTVCNFCKVMCRNVGIFRDSNGNQRVALTD  202



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 85/191 (45%), Gaps = 26/191 (14%)
 Frame = -2

Query  748  SDNTP--VVDTDGNELRAGETYYI------TSIETPHSASAGVQLAWLNSTAQCASN-VV  596
            +D +P  VVDT G +LRAG +YYI      T          G  L+  +    C  + VV
Sbjct  23   ADASPEQVVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLASIGESCPLDVVV  82

Query  595  VPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFF  419
            VPR  S G P++  P DP   VV  S  L+  FS         S  W +  +D    ++F
Sbjct  83   VPR--SHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDHFDVSKGKWF  140

Query  418  LNSGEFVSDLSGQ-----FKIVAQPDPNTYRIDYCP------FGGHKCFYVSLNIDESAG  272
            +++G  + + S +     FKI  +     Y+I YCP         H C  + + +DE+ G
Sbjct  141  VSTGGSMGNPSWETIRNWFKI--EKCDGAYKIVYCPSVFPSSSSKHMCKDIGVFVDEN-G  197

Query  271  AVRWVLSDNNF  239
              R  LS+  F
Sbjct  198  FRRLALSNVPF  208



>gb|AIT42206.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 97/228 (43%), Gaps = 32/228 (14%)
 Frame = -2

Query  865  TLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYY  686
            TL+++ FA S         S+ NPI LP      D  V  +   V D DGN LR GE Y 
Sbjct  13   TLSLVAFAQSF--------SSENPIVLPTTCHDDDNLVLPE---VYDQDGNPLRIGERYI  61

Query  685  ITSIETPHSASAGVQLAWLNSTAQCASNVV----VPRCFSFGDPIR-VRPTDPN-AAVVL  524
            I   + P      V L  + +  QC + V+    +P+    G P+  VR ++ +   VV 
Sbjct  62   I---KNPLLGGGAVYLDNIGN-LQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYRDVVR  117

Query  523  PSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-----VAQP  359
                +  +F V T R+C     W + +++      + +G  V + +  FKI     V + 
Sbjct  118  VMTGVYIKFFVKTSRLCVDETVWKVNHEQ-----LVVTGGNVGNENDIFKIKKTDLVVRG  172

Query  358  DPNTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKT  215
              N Y++ +CP    +C  +  N       +  V  D +F+P  F K 
Sbjct  173  MKNVYKLLHCP-SHLQCKNIGSNFKNGYPRLVTVHDDKDFIPFVFIKV  219



>ref|XP_003620188.1| Miraculin [Medicago truncatula]
 gb|AES76406.1| Lipid transfer protein [Medicago truncatula]
Length=213

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 21/178 (12%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIET-------PHSASAGVQLAWLNSTAQCASNVVVPRCFSF  575
            VVDT+G ++RAG  YYI  + T       P    +G  L   +    C  NVVV   F  
Sbjct  30   VVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGFVLIARSPNETCPLNVVVVEGFR-  88

Query  574  GDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFV  398
            G  +   P +P   V+  S  L+ + S++T   C  S  W +  +D  + Q+F+ +G  +
Sbjct  89   GQGVTFTPVNPKKGVIRVSTDLNIKTSLNTS--CEESTIWTLDDFDSSTGQWFVTTGGVL  146

Query  397  SD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNID---ESAGAVRWVLSD  248
             +     +   FKI    D   Y+  +CP   + C  +  N+    +S G  R  L+D
Sbjct  147  GNPGKDTVDNWFKIEKYED--DYKFVFCPTVCNFCKVMCRNVGIFRDSNGNQRVALTD  202



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 79/184 (43%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA   +   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRGNNKTCPLDVVQEQHSFKNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  ++ +   +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDINIKLDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ YCP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDIPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 82/185 (44%), Gaps = 22/185 (12%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  ++ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP-----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLP  233
              +   FKI  +     Y++ +CP     F G  C  V + I+   G  R  LSD  F  
Sbjct  147  RTMRNWFKI--EKFYGDYKLVFCPSVCNIFRGL-CRDVGIFIN--GGVRRLALSDVPF-K  200

Query  232  VWFRK  218
            V F+K
Sbjct  201  VVFKK  205



>gb|AIT42180.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 92/220 (42%), Gaps = 37/220 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +FS+ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFSISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            CPF     F + + +    G  R  L  +N L + F++ +
Sbjct  182  CPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDISFKQVQ  221



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 80/184 (43%), Gaps = 20/184 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +     G P+ 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVT--KGQGGGLTLAGRSNNKTCPLDVVQEQHSLRNGFPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S  L+ +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
              +   FKI  +     Y++ +CP    F    C  V + I+   G  R  LSD  F  V
Sbjct  147  RTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRLALSDVPF-KV  201

Query  229  WFRK  218
             F+K
Sbjct  202  VFKK  205



>ref|NP_001241106.1| uncharacterized protein LOC100790688 precursor [Glycine max]
 gb|ACU23857.1| unknown [Glycine max]
 gb|KHM99731.1| Miraculin [Glycine soja]
Length=209

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 80/178 (45%), Gaps = 25/178 (14%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYI------TSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFG  572
            VVDT G +LR G  YYI      T I T    + G+ LA +     C  +VVV   +  G
Sbjct  31   VVDTLGKKLRVGTNYYIVPSLPYTKIRT----TRGLGLASVGK-PYCPLDVVVVNGY-HG  84

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVS  395
             P+   P +P   V+  S  L+ +FS  T      S  W +  +D   +Q+F+ +G  V 
Sbjct  85   LPVTFSPVNPKKGVIRVSTDLNIKFSARTSCPRQYSTVWKLDDFDFSKRQWFVTTGGVVG  144

Query  394  DLSGQ-----FKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSD  248
            + S +     FKI  +     Y++ YCP       H C  V L +DE  G  R  L+D
Sbjct  145  NPSLETIHNWFKI--EKYDGAYKLVYCPSVVKCPKHLCKNVGLFVDEK-GNKRLALTD  199



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 86/198 (43%), Gaps = 23/198 (12%)
 Frame = -2

Query  781  IRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASN  602
            +R  TADA+  +    V+D DG +LRAG  YYI     P     G  L   N  ++    
Sbjct  20   LRFSTADASPEA----VLDIDGKKLRAGVNYYI----LPVFRGRGGGLTLGNLQSEICPV  71

Query  601  VVVPRCFSF--GDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPS  431
             VV   F    G P    P +P   VV  S  L+ +F  ST  +C +S  W + ++D  +
Sbjct  72   NVVQEQFELMNGFPTTFHPVNPKKGVVRVSTDLNVQFDAST--ICVTSTVWKLDKFDEST  129

Query  430  QQFFLNSGE-----FVSDLSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDE--SAG  272
             Q+F+  G       V  +   FKI  +     Y++ +CP   + C  +  +I      G
Sbjct  130  GQWFVTIGGSRGNPGVETVDNWFKI--EKHGKDYKLVFCPTVCNFCKVMCRDIGIFFKNG  187

Query  271  AVRWVLSDNNFLPVWFRK  218
                 LSD  F PV F+K
Sbjct  188  KRALALSDTPF-PVMFKK  204



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 97/228 (43%), Gaps = 33/228 (14%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK   IL +   L++L   T          IR  TADA+  +    V+D DG +LRAG  
Sbjct  1    MKNFGILFYF--LFILLASTQL--------IRFSTADASPEA----VLDIDGKKLRAGVN  46

Query  691  YYITSIETPHSASAGVQLAWLN-STAQCASNVVVPRCFSF-GDPIRVRPTDPNAAVVLPS  518
            YYI     P     G  L   N  + +C  NVV  +     G P    P +P   VV  S
Sbjct  47   YYI----LPVFRGRGGGLTLGNLQSEKCPLNVVQEQLEVMNGFPTTFHPVNPKKGVVRVS  102

Query  517  KFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGE-----FVSDLSGQFKIVAQPD  356
              L+ +F  ST  +C +S  W + ++D  + Q+ +  G       V  +   FKI  +  
Sbjct  103  TDLNVQFEAST--ICVTSTVWKLDKFDESTGQWLVTIGGSRGNPGVETVDNWFKI--EKH  158

Query  355  PNTYRIDYCPFGGHKCFYVSLNIDE--SAGAVRWVLSDNNFLPVWFRK  218
               Y++ +CP   + C  +  +I      G     LSD  F PV F+K
Sbjct  159  GKDYKLVFCPTVCNFCKVMCRDIGIFFKNGERALALSDTPF-PVMFKK  205



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 75/174 (43%), Gaps = 19/174 (11%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PV+D  G +LRAG  YYI  +        G+ LA  ++   C  +VV  +  F  G P+ 
Sbjct  31   PVLDVAGKKLRAGSKYYILPVT--KGQGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P +P   VV  S   + +F  +T   CA S  W +  +D    Q+ + +G    +   
Sbjct  89   FSPVNPKKGVVRESTDFNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGP  146

Query  391  --LSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSD  248
              +   FKI  +     Y++ +CP    F    C  V + I+   G  R  LSD
Sbjct  147  RTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRLALSD  196



>ref|XP_010098224.1| Alpha-amylase/subtilisin inhibitor [Morus notabilis]
 gb|EXB74709.1| Alpha-amylase/subtilisin inhibitor [Morus notabilis]
Length=207

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 63/148 (43%), Gaps = 10/148 (7%)
 Frame = -2

Query  763  DAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC  584
            +AA A  N+PV+DT GN L+ G  YYI     P    AG     ++    C   V     
Sbjct  21   NAATAQSNSPVLDTSGNPLQRGVEYYI----KPAITEAGGPFTLVSRNDPCPLYVGQRNV  76

Query  583  FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRP-SQQFFLNSG  407
               G P+   P +    VV   K     FS +T  +C  S  W +    P + +  + +G
Sbjct  77   SVDGIPVTFAPYEKREKVVRERKNFKVTFSAAT--ICVQSTAWKVGETEPVTGRRLIAAG  134

Query  406  EFVSDLSGQFKIVAQPD-PNTYRIDYCP  326
            E    L+  F I  + D P+ Y I +CP
Sbjct  135  E--GGLANYFYIKKEQDCPSCYSIQWCP  160



>dbj|BAA04150.1| proteinase inhibitor [Solanum tuberosum]
Length=221

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 93/222 (42%), Gaps = 41/222 (18%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQ----------PDPNTYRI  338
            ++C S   W +  YD       L +G  +    S  FKIV            P  +T R 
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMR-  181

Query  337  DYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
              CPF     F + + +    G  R  L  +N L V F++ +
Sbjct  182  --CPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|AFC88891.1| Kunitz-type proteinase inhibitor group A1, partial [Solanum tuberosum]
Length=191

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 81/194 (42%), Gaps = 24/194 (12%)
 Frame = -2

Query  751  ASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQLAWL-NSTAQCASNV------V  596
            A+  TPV+DT+GNEL    +Y I  I T   A  G V L    NS A C   V      V
Sbjct  5    ATPCTPVLDTNGNELNPNSSYRI--ISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDV  62

Query  595  VPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFF  419
             PR    G P+R  P   + A +   + L+ +F++ TP++C S   W +   +   +   
Sbjct  63   GPR----GTPVRFIPL--SGANICEDQLLNIQFNIPTPKLCVSYTIWKVGNLNALLRTML  116

Query  418  LNSGEFVSDLSGQFKIVAQPDPNTYRIDYCPFGGHKC-------FYVSLNIDESAGAVRW  260
            L +G  +      +  + +     Y + YCP     C       F   + +    G  R 
Sbjct  117  LETGGTIGQADSSYFKIVKSSKIGYNLLYCPLTPIICPLCPDDLFCAKVGVVIQNGKRRL  176

Query  259  VLSDNNFLPVWFRK  218
             L + N L V F++
Sbjct  177  ALVNENPLDVLFQE  190



>gb|AAL60243.1|AF459078_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
 gb|AIT42201.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 97/227 (43%), Gaps = 32/227 (14%)
 Frame = -2

Query  865  TLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYY  686
            TL+++ FA S         S+ NPI LP      D  V  +   V D DGN LR GE Y 
Sbjct  13   TLSLVAFARSF--------SSENPIVLPTTCHDDDNLVLPE---VYDQDGNPLRIGERYI  61

Query  685  ITSIETPHSASAGVQLAWLNSTAQCASNVV----VPRCFSFGDPIR-VRPTDPN-AAVVL  524
            I   + P      V L  + +  QC + V+    +P+    G P+  VR ++ +   VV 
Sbjct  62   I---KNPLLGGGAVYLDNIGN-LQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYGDVVR  117

Query  523  PSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKI-----VAQP  359
                +  +F V T ++C     W + +++      + +G  V + +  FKI     V + 
Sbjct  118  VMTGVYIKFFVKTSKLCVDETVWKVNHEQ-----LVVTGGNVGNENDIFKIKKTDLVIRG  172

Query  358  DPNTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
              N Y++ +CP    +C  +  N       +  V  D +F+P  F K
Sbjct  173  MKNVYKLLHCP-SHLQCKNIGSNFKNGYPRLVTVHDDKDFIPFVFIK  218



>gb|ACS92512.1| Kunitz-type protease inhibitor KPI-C7 [Populus trichocarpa x 
Populus nigra]
Length=202

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  GNE+R
Sbjct  3    ITNFLVLSFLLFAFTATSVFPRAVHAE----------------------AVIDVFGNEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVMFSPAVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIV-AQPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKCEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|AAM21642.1|AF495581_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=229

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 87/212 (41%), Gaps = 37/212 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSHLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
            CPF     F   + +    G  RW+LS    L
Sbjct  182  CPFSSDDQFCSKVGVVHQNGKRRWLLSRTILL  213



>ref|NP_001275427.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94199.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94200.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94201.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AIT42177.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 92/220 (42%), Gaps = 37/220 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDITGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            CPF     F + + +    G  R  L  +N L V F++ +
Sbjct  182  CPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|AAM10744.1|AF492769_1 putative kunitz-type proteinase inhibitor S1C1 [Solanum tuberosum]
Length=221

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 92/222 (41%), Gaps = 41/222 (18%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQ----------PDPNTYRI  338
            ++C S   W +  YD       L +G  +    S  FKIV            P  NT   
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTNTMS-  181

Query  337  DYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
              CPF     F + + +    G  R  L  +N L V F++ +
Sbjct  182  --CPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|AIT42172.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=245

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 92/219 (42%), Gaps = 37/219 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKT  215
            CPF     F + + +    G  R  L  +N L + F+++
Sbjct  182  CPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDISFKQS  220



>gb|AIT42188.1| Kunitz-type inhibitor B, partial [Solanum tuberosum]
Length=224

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 90/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  23   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  69

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  70   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  125

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + +     Y + Y        C
Sbjct  126  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSC  185

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  186  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  224



>sp|P30941.2|SPI7_SOLTU RecName: Full=Serine protease inhibitor 7; AltName: Full=PIGEN1; 
Short=PIG; AltName: Full=STPIA; AltName: Full=STPIB; AltName: 
Full=pF4; AltName: Full=pKEN14-28; AltName: Allergen=Sola 
t 4; Flags: Precursor [Solanum tuberosum]
 dbj|BAA04149.1| proteinase inhibitor [Solanum tuberosum]
 gb|AIT42198.1| Kunitz-type inhibitor B [Solanum tuberosum]
 gb|AIT42200.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 90/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + +     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>ref|XP_004237191.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=221

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 81/185 (44%), Gaps = 12/185 (6%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCF--SFGDPIR  560
            V+D  G+EL+ G  Y I  I    S+S GV +  L +  +     V+ +    S G P R
Sbjct  39   VLDIGGHELQIGLKYTILPINQNGSSSGGVGVLALEAKNRPCPFYVIQKNIESSNGLPTR  98

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYW--GIQYDRPSQQFFLNSGEF----V  398
              P D N  V+  S  L+  F  ST  +C  S  W  G   +R  +++ ++ G      +
Sbjct  99   FIPIDNNQQVINLSTDLNIVFVAST--ICVQSTAWKVGGADERTGRRYVMSGGTIGRPGI  156

Query  397  SDLSGQFKIVAQPDPNTYRIDYCP-FGGHKCFYVSLNIDE-SAGAVRWVLSDNNFLPVWF  224
              +S  FKI    +  +Y+I +CP      C  V  N+   +    +W+   +  L V F
Sbjct  157  ETISNWFKIERYGNNESYKIVFCPRVCSSNCKIVCGNVGVFNENGKKWLGLIDEPLVVRF  216

Query  223  RKTRN  209
            +K  N
Sbjct  217  KKVLN  221



>gb|AAL85648.1| trypsin inhibitor [Theobroma obovatum]
 gb|AAL85649.1| trypsin inhibitor [Theobroma obovatum]
Length=154

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 12/157 (8%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--GDPIR  560
            V+DTDG+ELR G  YY+ S+                +T Q    +VV R      G P+ 
Sbjct  1    VLDTDGDELRTGVQYYVVSVIWGAGGGGLAL---GRATDQKCPEIVVQRRSDLDNGTPVI  57

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
                D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +G    +   
Sbjct  58   FSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKGEPGP  117

Query  391  --LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI  287
              LS  FKI  +   N Y+  +CP     C  +  +I
Sbjct  118  NTLSNWFKI-EEAGGNVYKFRFCPSVCDSCATLCSDI  153



>gb|AIT42193.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 91/220 (41%), Gaps = 37/220 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +   + L+ +FS+ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFEIELLNIQFSISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            CPF     F + + +    G +R  L   + L + F++ +
Sbjct  182  CPFSSDDQFCLKVGVVHQNGKIRLALVKEHPLDISFQQVQ  221



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (41%), Gaps = 33/188 (18%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--GD  569
            N+PV+DTDG+EL+ G  YY+ S  +              +T Q    +VV R      G 
Sbjct  28   NSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGR---ATGQSCPEIVVQRRSDLDNGT  84

Query  568  PIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNSGEFVSD  392
            P+     D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +      
Sbjct  85   PVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTD-----  139

Query  391  LSGQFKIVAQPDPNT--------------YRIDYCPFGGHKCFYVSLNI---DESAGAVR  263
                  +  +P PNT              Y+  +CP     C  +  +I    +  G +R
Sbjct  140  -----GVKGEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIR  194

Query  262  WVLSDNNF  239
              LSDN +
Sbjct  195  LALSDNEW  202



>gb|AIT42190.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y+I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYHI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + Q     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVQSSQFGYNLLYCPVTSTMSC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G     L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKKSLALVKDNPLDVSFKQVQ  221



>gb|AIT42191.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 92/220 (42%), Gaps = 37/220 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P++ +  +      +  ++ L+ +FS+ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVKFICSSSHFGQGIFENELLNIQFSISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            CPF     F + + +    G  R  L  +N L + F++ +
Sbjct  182  CPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDISFKQVQ  221



>prf||1802409A albumin
Length=221

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (41%), Gaps = 33/188 (18%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--GD  569
            N+PV+DTDG+EL+ G  YY+ S  +              +T Q    +VV R      G 
Sbjct  28   NSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGR---ATGQSCPEIVVQRRSDLDNGT  84

Query  568  PIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNSGEFVSD  392
            P+     D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +      
Sbjct  85   PVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTD-----  139

Query  391  LSGQFKIVAQPDPNT--------------YRIDYCPFGGHKCFYVSLNI---DESAGAVR  263
                  +  +P PNT              Y+  +CP     C  +  +I    +  G +R
Sbjct  140  -----GVKGEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIR  194

Query  262  WVLSDNNF  239
              LSDN +
Sbjct  195  LALSDNEW  202



>ref|XP_010536414.1| PREDICTED: miraculin-like [Tarenaya hassleriana]
Length=212

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 84/189 (44%), Gaps = 18/189 (10%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGDP  566
             T V D DG+ LR G  YY+  +   H    G+ LA   S   C  ++V        G P
Sbjct  23   GTAVRDVDGDLLRPGVGYYVLPVLRGHGG--GLTLAGRGSEL-CPLDIVQENSEVDDGIP  79

Query  565  IRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFV---  398
            ++          V  S+ L+ +  V+   +C  S YW I ++D+  +Q+F+ +G  +   
Sbjct  80   VKFSGWTSRVGFVPESEDLNIKTDVAAT-ICIQSTYWWIDEFDKQRKQWFVTTGNALRRS  138

Query  397  --SDLSGQFKIVAQPDPNTYRIDYCP----FGGHKCFYVSLNIDESAGAVRWVLSDNNFL  236
                L   FKIV     N Y+  +CP    F    C  V + +DE+ G  R  LSD  F+
Sbjct  139  GKESLRSFFKIVKS--RNDYKFVFCPRDCEFCRPICGDVGIFVDEN-GIRRLALSDQPFV  195

Query  235  PVWFRKTRN  209
             ++ + T+ 
Sbjct  196  VMFKKATKE  204



>pdb|4J2K|A Chain A, Crystal Structure Of A Plant Trypsin Inhibitor Ecti
 pdb|4J2K|B Chain B, Crystal Structure Of A Plant Trypsin Inhibitor Ecti
 pdb|4J2Y|A Chain A, Crystal Structure Of A Plant Trypsin Inhibitor Ecti 
In Complex With Bovine Trypsin.
Length=176

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 82/181 (45%), Gaps = 21/181 (12%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVR  554
            ++D+DG+ LR G TYYI  +        G++LA       C  NVV  R     +  R R
Sbjct  3    LLDSDGDILRNGGTYYI--LPALRGKGGGLELAKTGDET-CPLNVVQARS----ETKRGR  55

Query  553  P----TDPNAAVVLPSKFLSFEFSVSTPRVCA---SSVYWGIQYDRPSQQFFLNSGEFVS  395
            P    T P  A++ P+ +L+ EF       C    S + W ++ +  SQ+  +   E   
Sbjct  56   PAIIWTPPRIAILTPAFYLNIEFQTRDLPACLEEYSRLPWKVEGE--SQEVKIAPKEEEQ  113

Query  394  DLSGQFKIVAQPDPNTYRIDYCPFGGHK--CFYVSLNIDESAGAVRWVLSDNNFLPVWFR  221
             L G FKI  +P  + Y++ YC        C  + ++ID+    +  V+ D + L V F 
Sbjct  114  HLFGSFKI--KPYRDDYKLVYCEGNSDDDSCKDLGISIDDENNRL-LVVKDGDPLAVRFV  170

Query  220  K  218
            K
Sbjct  171  K  171



>gb|AAZ94192.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
Length=220

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 88/217 (41%), Gaps = 36/217 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP   P           PV+DT+G EL    +Y I  I T   A  G V L
Sbjct  21   TFTSQNPINLPSESPLPK--------PVLDTNGKELNPNLSYRI--ISTYWGALGGDVYL  70

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPR  479
                NS A C   V      V P     G P+R  P   N   +   + L+ +F++ TP+
Sbjct  71   GKSPNSDAPCPDGVFRYNSDVGPS----GTPVRFIPLSTN---IFEDQLLNIQFNIPTPK  123

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCPFGGH---  314
            +C S   W +   + P +   L +G  +    S  FKIV   +   Y + YCP   H   
Sbjct  124  LCVSYTIWKVGNINAPLRTMLLETGGTIGQADSSYFKIVKSSN-FGYNLLYCPITRHFLC  182

Query  313  -----KCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
                   F   + +    G  R  L + N L V F++
Sbjct  183  PFCRDDYFCAKVGVVIQNGKRRLALVNENPLDVLFQE  219



>ref|NP_001274943.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94179.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94186.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
Length=220

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 88/217 (41%), Gaps = 36/217 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP   P           PV+DT+G EL    +Y I  I T   A  G V L
Sbjct  21   TFTSQNPINLPSESPLPK--------PVLDTNGKELNPNLSYRI--ISTYWGALGGDVYL  70

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPR  479
                NS A C   V      V P     G P+R  P   N   +   + L+ +F++ TP+
Sbjct  71   GKSPNSDAPCPDGVFRYNSDVGPS----GTPVRFIPLSTN---IFEDQLLNIQFNIPTPK  123

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCPFGGH---  314
            +C S   W +   + P +   L +G  +    S  FKIV   +   Y + YCP   H   
Sbjct  124  LCVSYTIWKVGNINAPLRTMLLETGGTIGQADSSYFKIVKSSN-FGYNLLYCPITRHFLC  182

Query  313  -----KCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
                   F   + +    G  R  L + N L V F++
Sbjct  183  PFCRDDNFCAKVGVVIQNGKRRLALVNENPLDVLFQE  219



>gb|AAM21643.1|AF495582_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=213

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 83/190 (44%), Gaps = 33/190 (17%)
 Frame = -2

Query  850  LFAFSLYLLP----NPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYI  683
            LF   L L+P    + T ++ NPI LP           SD TPV+D  G EL +  +Y I
Sbjct  4    LFLVCLCLVPIVVFSSTFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI  52

Query  682  TSIETPHSASAG-VQLAWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAV  530
              I T   A  G V L    NS A CA+ V      V P     G P+R +  +      
Sbjct  53   --ISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGQG  106

Query  529  VLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPD  356
            +  ++ L+ +F++ST ++C S   W +  YD       L +G  +    S  FKIV    
Sbjct  107  IFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQ  166

Query  355  PNTYRIDYCP  326
               Y + YCP
Sbjct  167  LG-YNLLYCP  175



>gb|AAZ94195.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
Length=220

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 88/217 (41%), Gaps = 36/217 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP   P           PV+DT+G EL    +Y I  I T   A  G V L
Sbjct  21   TFTSQNPINLPSESPLPK--------PVLDTNGKELNPNLSYRI--ISTYWGALGGDVYL  70

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPR  479
                NS A C   V      V P     G P+R  P   N   +   + L+ +F++ TP+
Sbjct  71   GKSPNSDAPCPDGVFRYNSDVGPS----GTPVRFIPLSTN---IFEDQLLNIQFNIPTPK  123

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCPFGGH---  314
            +C S   W +   + P +   L +G  +    S  FKIV   +   Y + YCP   H   
Sbjct  124  LCVSYTIWKVGNINAPLRTMLLETGGTIGQADSSYFKIVKSSN-FGYNLLYCPITRHFLC  182

Query  313  -----KCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
                   F   + +    G  R  L + N L V F++
Sbjct  183  PFCRDDNFCAKVGVVIQNGKRRLALVNENPLDVLFQE  219



>gb|AAV41232.1| putative 21 kDa trypsin inhibitor [Theobroma grandiflorum]
Length=206

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 14/165 (8%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYY-ITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC--FSFG  572
            N+PV+DTDG++L+ G  YY ++SI         +  A      Q    +VV R      G
Sbjct  28   NSPVLDTDGDDLQVGVQYYVVSSIWGAGGGGLDLGRA----IGQSCPEIVVQRQSDLVLG  83

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNS-----  410
             P+     D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +     
Sbjct  84   TPVIFSNADSKDGVVRVSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTDGGEG  143

Query  409  GEFVSDLSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESA  275
            G   S L+ +FKI  +     Y++  CP     C  +S +I +S 
Sbjct  144  GCGRSRLTSRFKI-EKVGRIGYKLRLCPSVCESCITLSSDIGKSG  187



>gb|AIT42197.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 91/220 (41%), Gaps = 37/220 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSHLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            CPF     F   + +    G  R  L  +N L + F++ +
Sbjct  182  CPFSSDDQFCSKVGVVHQNGKRRLALVKDNPLDISFKQVQ  221



>gb|ACS92518.1| Kunitz-type protease inhibitor KPI-C6.1 [Populus trichocarpa 
x Populus nigra]
Length=202

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRLICNSDVVFSP-MSDGLPVMFSPAVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIV-AQPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKCEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACS92499.1| Kunitz-type protease inhibitor KPI-C6.2 [Populus trichocarpa 
x Populus nigra]
 gb|AEK26935.1| Kunitz-type trypsin inhibitor A6 [Populus nigra]
Length=202

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRLICNSDVVFSP-MSDGLPVMFSPAVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39911.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 85/194 (44%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P+  H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPHAVHAE----------------------AVIDAFGHEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39912.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39921.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39933.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39934.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39951.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40002.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40020.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40022.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40037.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40039.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 85/194 (44%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P+  H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPHAVHAE----------------------AVIDAFGHEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>ref|XP_003532236.1| PREDICTED: trypsin inhibitor A-like [Glycine max]
 gb|KHN01862.1| Trypsin inhibitor A [Glycine soja]
Length=213

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 81/177 (46%), Gaps = 11/177 (6%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPI  563
             T VVDT+G+ L+   TY+I S+  P     GV+ A   +  +     VV   F  G P+
Sbjct  23   TTAVVDTNGDILQNPGTYFILSVFRP---GGGVEFAATGN--ETCPLTVVQTLFGRGFPV  77

Query  562  RVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSG  383
             +  +     ++   +  S  F +  P    +   W I    P       +G + + + G
Sbjct  78   -ILSSQLRIPIIGEGQLFSILFRI-VPWCATTPSKWTIVEGLPESPAVKLTG-YDNTVPG  134

Query  382  QFKI-VAQPDPNTYRIDYCPFGGH-KCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
            +FKI  A P  N Y + +CP G   KC ++ ++ D+  G  R V+S+ N L V F+K
Sbjct  135  EFKIEKANPFHNDYTLLFCPAGEESKCGHIGIHFDDD-GNRRLVVSEENILRVQFQK  190



>gb|AIT42176.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 88/219 (40%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ V      V P     G P+R +  +      +   + L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGQGIFEDELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDYC--------  329
            ++C S   W +  YD       L +G  +      +  + +     Y + YC        
Sbjct  123  KMCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTTTMTL  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|AAM10743.1|AF492359_1 putative kunitz-type proteinase inhibitor precursor P1H5 [Solanum 
tuberosum]
 gb|AIT42174.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 88/219 (40%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ V      V P     G P+R +  +      +   + L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGQGIFEDELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDYC--------  329
            ++C S   W +  YD       L +G  +      +  + +     Y + YC        
Sbjct  123  KMCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTTTMTL  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/195 (25%), Positives = 83/195 (43%), Gaps = 16/195 (8%)
 Frame = -2

Query  772  PTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVV  593
            P+   +     +PV+DT+G+++RAG  Y++  +        G+  + +     C  +++ 
Sbjct  21   PSELVSAGPSPSPVLDTNGDKIRAGSNYFVLPVI--RGRGGGLLPSNVKQNNSCPRDIIQ  78

Query  592  -PRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFF  419
                   G P+   P DP   V+  S  L+  F   TP +CA    W +  YD   +Q+F
Sbjct  79   NSNEVQEGLPVVFTPVDPKKGVIRLSTDLNVRF--FTPTICARETIWKLGTYDEKLKQYF  136

Query  418  LNSGEFVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYV--SLNIDESAGAVRW  260
            + +G    +     +S  FKI  +     Y+  +CP     C  +   + I    G    
Sbjct  137  IVTGGVEGNPGPLTVSNWFKI--EKLGTDYKFVFCPSVCTFCKVICKDVGIYNKDGVRFL  194

Query  259  VLSDNNFLPVWFRKT  215
             LSD  F  V F++T
Sbjct  195  ALSDTPFR-VMFKRT  208



>gb|AIT42171.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 96/238 (40%), Gaps = 35/238 (15%)
 Frame = -2

Query  871  MKTLAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGET  692
            MK L ++       ++ + T ++ NPI LP           SD TPV+D  G EL +  +
Sbjct  1    MKCLFLVCLCLVPIVVFSSTFTSQNPINLP-----------SDATPVLDVTGKELDSRLS  49

Query  691  YYITSIETPHSASAG-VQLAWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPN  539
            Y I  I T   A  G V L    NS A CA+ V      V P     G P+R +  +   
Sbjct  50   YRI--ISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHF  103

Query  538  AAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQ  362
               +  ++ L+ +F++ST ++C S   W +  YD       L +G  +      +    +
Sbjct  104  GQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKNVK  163

Query  361  PDPNTYRIDY--------CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
                 Y + Y        CPF     F + + +    G  R  L  +N L + F + +
Sbjct  164  SSQLGYHLLYCPVTNTMSCPFSSDDQFCLKVGVVHPNGKRRLALVQDNPLDISFHQAQ  221



>gb|ACO39957.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>ref|XP_003534081.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 79/180 (44%), Gaps = 22/180 (12%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYIT-------SIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF  575
            VVDT GN LR G  YYI        SI + +  + G+ LA + +      +V+V      
Sbjct  30   VVDTSGNILRVGANYYIIPNPTTKCSIFSKYKGNNGLVLAKVAANKTFPLDVLVVEGQQL  89

Query  574  GDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGE  404
            G P+   P       A V  S  L+ EFS+ T   C+ S  W I  +DR ++++F+ +G 
Sbjct  90   GQPLTFTPIHDQKKGAPVRVSTDLNIEFSMQTS--CSQSNVWKIDHFDRATRKWFVTTGG  147

Query  403  FVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI---DESAGAVRWVLSD  248
             V       +S  FKI  +     Y++  CP     C     +I   ++  G  R  L+D
Sbjct  148  VVGHPSWRTISNWFKI--EKYDGDYKLVSCPTFCAYCKVQCRDIGVYEDQNGNKRLALTD  205



>ref|XP_006387699.1| hypothetical protein POPTR_0664s00210g [Populus trichocarpa]
 gb|ERP46613.1| hypothetical protein POPTR_0664s00210g [Populus trichocarpa]
Length=204

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 29/189 (15%)
 Frame = -2

Query  862  LAILLFAFS-LYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYY  686
            L+ LLFAF+   + P+  H                   A D   V+D +GNE+ A   Y+
Sbjct  9    LSFLLFAFTATSIFPHAVH-------------------AEDPEAVIDVNGNEVTADARYF  49

Query  685  ITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP--TDPNAAVVLPSKF  512
            I +    ++ +  V      S   C S+V++    S G P+       + N  V+    +
Sbjct  50   IGAASDDNTTTLAVSAT---SQIICNSDVILSS-MSNGLPVTFSSPVGESNDGVIREDSY  105

Query  511  LSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPNTYRID  335
            L+  F  +T R+   S  W ++  RP+ + F+ +   V  L+ +FKI   +   N+Y++ 
Sbjct  106  LNVNFDAATCRMAGVSTMWKMEL-RPTMRGFVVTTGGVDGLN-RFKITKYEGGNNSYQLS  163

Query  334  YCPFGGHKC  308
            YCP     C
Sbjct  164  YCPISDPMC  172



>gb|ACO40004.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 78/187 (42%), Gaps = 10/187 (5%)
 Frame = -2

Query  751  ASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSF  575
            A    PV+D DG+E+RAG  YYI S     +   GV          C   VV  +     
Sbjct  21   AEKPNPVLDHDGDEIRAGVEYYIVS-SIRGAGGGGVTYGRSIGNESCPLPVVQEKLDLLR  79

Query  574  GDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRP-SQQFFLNSGEFV  398
            G P+   P +    VV  S  L+ +FS + P VC  S  W + +D    Q F L +G   
Sbjct  80   GHPVTFTPVNSKEGVVRVSTDLNIKFSKAAP-VCNESNVWKLDFDEELGQHFILTNGVEG  138

Query  397  SDLSGQ----FKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPV  230
            +   G     FKI   P   +YR+ +CP   + C  +  ++   +   R  L       V
Sbjct  139  NPGCGTIHNWFKIEG-PYHKSYRLVFCPTVCNICNVICKDVGVFSDR-RLALGGTRSFTV  196

Query  229  WFRKTRN  209
            + +K R+
Sbjct  197  FIQKARS  203



>gb|ACO40010.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 84/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|AFZ77402.1| Kunitz-type proteinase inhibitor PKI2 [Solanum tuberosum]
Length=221

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 90/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I S  T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRIVS--TFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + +     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMIC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRSALVKDNPLDVSFKQVQ  221



>gb|AIT42187.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 90/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +   +     +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSFNHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + +     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFQQVQ  221



>gb|AIT42195.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=229

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 93/225 (41%), Gaps = 39/225 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDITGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGNYDASLGTMLLETGGTIGQANSSWFKIVKSSQLG-YNLLYCPVTNTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKT--RNCL  203
            CPF     F + + +    G     L  +N L V F++   + CL
Sbjct  182  CPFSSDDQFCLKVGVVHQNGKKHLALVKDNPLDVSFQQVQYKKCL  226



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 77/185 (42%), Gaps = 24/185 (13%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSA-----SAGVQLAWLNSTAQCASNVVVPRCFSFGD  569
            VVD DG  LR G  YYI  +           S G ++  L++  Q  + +        G 
Sbjct  31   VVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKMCPLDAVVQEHNEI------DQGL  84

Query  568  PIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGE----  404
            P+   P DP   V+  S  L+  FS ++  +C  +  W +  +D  + Q+F+  G     
Sbjct  85   PLTFTPVDPKKGVIRESTDLNIIFSANS--ICVQTTQWKLDDFDETTGQYFITLGGDQGN  142

Query  403  -FVSDLSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNID--ESAGAVRWVLSDNNFLP  233
              V  +S  FKI  +     Y++ YCP     C  +  +I      G  R  LSD  F  
Sbjct  143  PGVETISNWFKI--EKYDRDYKLLYCPTVCDFCKVICRDIGIFIQDGVRRLALSDVPF-K  199

Query  232  VWFRK  218
            V F+K
Sbjct  200  VMFKK  204



>emb|CAA45723.1| aspartic proteinase inhibitor [Solanum tuberosum]
Length=217

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 88/218 (40%), Gaps = 37/218 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPR  479
                NS A CA+ +      V P     G P+R          +  ++ L+ +F++ST +
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFSHFGQG---IFENELLNIQFAISTSK  119

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------CP  326
            +C S   W +  YD       L +G  +      +  + +     Y + Y        CP
Sbjct  120  LCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSCP  179

Query  325  FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            F     F + + +    G  R  L  +N L V F++ +
Sbjct  180  FSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ  217



>gb|AAO23566.1| serine protease inhibitor [Solanum tuberosum]
Length=221

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 87/219 (40%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ V      V P     G P+R +  +      +   + L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGQGIFEDELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDYC--------  329
            ++C S   W +  YD       L +G  +      +  + +     Y + YC        
Sbjct  123  KMCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWLKIVKSSQFGYNLLYCPVTTTMTL  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F +   +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLKAGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|AAM21645.1|AF495584_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
 gb|AIT42181.1| Kunitz-type inhibitor B [Solanum tuberosum]
 gb|AIT42192.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 90/220 (41%), Gaps = 37/220 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------  332
            ++C S   W +  YD       L +G  +    S  FKIV       Y + Y        
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMI  181

Query  331  CPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            CPF     F   + +    G  R  L  +N L V F + +
Sbjct  182  CPFSSEDQFCSKVGVVHQNGKRRLALVKDNPLDVSFMQVQ  221



>gb|ACO39965.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40014.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 84/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGHEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39935.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40011.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40013.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 84/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGHEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>emb|CAH59168.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 84/192 (44%), Gaps = 35/192 (18%)
 Frame = -2

Query  874  NMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAG  698
            N   L+ LLFAF+   + P   H+A                       V+DT G+E+RAG
Sbjct  5    NFLVLSFLLFAFTATSIFPRAVHAA----------------------AVIDTFGDEVRAG  42

Query  697  ETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDP-IRVRPTDPNAAVVLP  521
            + Y I +     + +A        S   C S+VV     S G P I  +  + N +V+  
Sbjct  43   DRYIIGAASNDFAITA-------TSPIICNSDVVFSP-MSNGLPVIFSKVVESNDSVINE  94

Query  520  SKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVAQPD-PNTY  344
              +L+ +F  S+ R+   S  W I+  RP+ + F+ +   V+ L+ +F I    D  N Y
Sbjct  95   DSYLNVDFDASSCRMAGVSTMWKIE-SRPTARGFVVTTGGVAGLN-RFTITKYGDGTNLY  152

Query  343  RIDYCPFGGHKC  308
            ++ YCP     C
Sbjct  153  QLSYCPISEPIC  164



>gb|AAL85645.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85646.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85647.1| trypsin inhibitor [Theobroma grandiflorum]
Length=154

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 67/157 (43%), Gaps = 12/157 (8%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--GDPIR  560
            V+DTDG+ELR G  YY+ S                 +T Q    +V+ R      G P+ 
Sbjct  1    VLDTDGDELRTGVQYYVLSALWGAGGGGLDLGR---ATDQKCPEIVIQRRSDLDNGTPVI  57

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
                D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +G    +   
Sbjct  58   FSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKGEPGP  117

Query  391  --LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI  287
              LS  FKI  +   N Y+  +CP     C  +  +I
Sbjct  118  NTLSNWFKI-EEAGGNVYKFRFCPSVCDSCATLCSDI  153



>gb|KHM99737.1| Miraculin [Glycine soja]
Length=215

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 79/180 (44%), Gaps = 22/180 (12%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYIT-------SIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF  575
            VVDT GN LR G  YYI        SI + +  + G+ LA + +      +V+V      
Sbjct  30   VVDTSGNILRVGANYYIIPNPTTKCSIFSNYKGNNGLVLAKVAANKTFPLDVLVVEGQQL  89

Query  574  GDPIRVRPT--DPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGE  404
            G P+   P       A V  S  L+ EFS+ T   C+ S  W I  +DR ++++F+ +G 
Sbjct  90   GQPLTFTPIHDQKKGAPVRVSTDLNIEFSMQTS--CSQSNVWKIDHFDRATRKWFVTTGG  147

Query  403  FVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI---DESAGAVRWVLSD  248
             V       +S  FKI  +     Y++  CP     C     +I   ++  G  R  L+D
Sbjct  148  VVGHPSWRTISNWFKI--EKYDGDYKLVSCPTFCAYCKVQCRDIGVYEDQNGNKRLALTD  205



>gb|AAL85644.1| trypsin inhibitor [Theobroma subincanum]
Length=154

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 67/157 (43%), Gaps = 12/157 (8%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSF--GDPIR  560
            V+DTDG+ELR G  YY+ S                 +T Q    +VV R      G P+ 
Sbjct  1    VLDTDGDELRTGVQYYVMSAIWGAGGGGLAL---GRATDQKCPEIVVQRRSDLDNGTPVI  57

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
                D    VV  S  ++ EF     R+C++S  W +  YD  + ++++ +G    +   
Sbjct  58   FSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKGEPGP  117

Query  391  --LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI  287
              LS  FKI  +   N Y+  +CP     C  +  +I
Sbjct  118  NTLSNWFKI-EEAGGNVYKFRFCPSVCDSCATLCSDI  153



>ref|XP_002888923.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65182.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=222

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 76/175 (43%), Gaps = 7/175 (4%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRC--FSFGDPIR  560
            V+DT G+ +++   YYI   +             LN+   C +  +V     F  G P+ 
Sbjct  32   VLDTAGHPVQSNVQYYIIPAKIGTGGGLIPSNRNLNTQDLCLNLDIVQSSSPFVSGLPVT  91

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQ  380
              P +     V  S  L+ EF  ST  +C  S  W I +    ++ F+++G      +  
Sbjct  92   FSPLNTKTKHVQLSTSLNLEFD-STVWLCPESKVWRIDHSLQLRKSFVSTGGEKGKGNSW  150

Query  379  FKIVAQPDPNTYRIDYCPFGGH-KCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
            F+I  Q D + Y++ YCP      C  VSL  D + G  R VLS +    V F+K
Sbjct  151  FQI--QEDGDAYKLMYCPISSAIACINVSLETD-NLGVRRLVLSTDQSFAVKFQK  202



>gb|ACO40038.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S+ W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSIMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|AIT42216.1| Kunitz-type inhibitor D, partial [Solanum tuberosum]
Length=203

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 92/185 (50%), Gaps = 18/185 (10%)
 Frame = -2

Query  757  AVASDNTP------VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQ--CASN  602
            A +++N P      + D +GN L     Y+I S     +   GV+LA L +  Q  C ++
Sbjct  6    ASSTNNIPNQAFRTIRDIEGNPLNKNSRYFIVS-AIWGAGGGGVRLANLGNQGQNDCPTS  64

Query  601  VVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQ  428
            VV  R     G  + + P DP   ++     ++ +F + +P  C+  + W +  + +P  
Sbjct  65   VVQSRNDLDNGIAVYITPHDPKYDIISEMSTVNIKFYLDSP-TCSHFIMWMVDDFPKPVD  123

Query  427  QFF-LNSGEFV---SDLSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESAGAVRW  260
            Q + +++GE +    +L+ +F+I +    +TY++ +CP+ G K    ++ I +  G  R 
Sbjct  124  QLYTISTGEQLINSVNLNNRFQIKSLGG-STYKLVFCPY-GEKFTCQNVGIADENGYNRL  181

Query  259  VLSDN  245
            VL++N
Sbjct  182  VLTEN  186



>gb|ACO39943.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39961.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+V+     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVMFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 66/151 (44%), Gaps = 17/151 (11%)
 Frame = -2

Query  751  ASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFG  572
            A +  PV+DT+G E+R G  YY+ +I  P     GV          C    VV      G
Sbjct  21   AEEPNPVLDTNGEEIRPGVEYYMGTIFRP---GGGVTYGKGPGNEICPL-AVVQAWLQRG  76

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRV--CASSVYWGIQYDRPSQQFFL------  416
            DP+   P +P   VV  S  L+ +F+   P +  C  S  W + ++   +Q F+      
Sbjct  77   DPVTFTPVNPEEGVVRVSTDLNIKFA-EPPIINFCRGSNVWKVHFNEALKQHFVLTDGVE  135

Query  415  -NSGEFVSDLSGQFKIVAQPDPNTYRIDYCP  326
             NSG      +  FKI A  D + Y+  +CP
Sbjct  136  GNSG--CETTANWFKIEAVSDRD-YKFVFCP  163



>ref|NP_001235773.1| uncharacterized protein LOC100306233 precursor [Glycine max]
 gb|ACU14325.1| unknown [Glycine max]
Length=208

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 82/177 (46%), Gaps = 13/177 (7%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVP-RCFSFGDPIRV  557
            V+DTDG+ +    TYY+   ++  S   G+++A     + CA  VV      S G P+++
Sbjct  29   VLDTDGHAVENHGTYYLLPAKS-GSGGGGIEVAATGKES-CALTVVQSLNEDSMGLPLKL  86

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQF  377
                   +       LS EF+ S P  C+S+  W +    P  +  +   ++ + + G F
Sbjct  87   SSPSITTSHFTEYTSLSIEFT-SAPAPCSSASEWTVVKGLPEGRA-VKLNDYGNTVEGDF  144

Query  376  KIVAQPDP-----NTYRIDYCPFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFR  221
              V           +Y++ +CP+G  +C  V ++ID+  G  R V+SD N  P  F+
Sbjct  145  AFVCAKREFYRCNKSYQLIFCPYGLMRCEDVGISIDDD-GNRRLVISDGN--PFLFK  198



>gb|AFK49061.1| unknown [Medicago truncatula]
Length=217

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 77/177 (44%), Gaps = 11/177 (6%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRV  557
            PV D  GN L  G  YYI    + + +S G+ L  +  +  C   V+     + G P++ 
Sbjct  28   PVFDKHGNPLTPGNQYYILP-ASDNPSSGGLTLDKVGDSV-CPLTVLQNNAVT-GLPVKF  84

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGE-----FVSD  392
               + + + ++    L  EF ++ P  CA S  W +  D  +Q  F+  G       V  
Sbjct  85   TILENSTSNIVTGTDLEIEF-INKPD-CAESSKWLMVVDHVTQLSFVGIGGPANYPGVEL  142

Query  391  LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLN-IDESAGAVRWVLSDNNFLPVWF  224
            +SG+F I+     N YR+ +C      C Y+ L+  +   G  R +L+  N   V F
Sbjct  143  ISGKFLILKHGSGNAYRVGFCLDTTGDCAYLGLHEFNSGEGGSRLILTAINAYSVVF  199



>gb|AAL85661.1| trypsin inhibitor [Theobroma bicolor]
Length=154

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 66/157 (42%), Gaps = 12/157 (8%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR--CFSFGDPIR  560
            V+DTDG ELR G  YY+ S                 S  Q   ++VV R     +G P+ 
Sbjct  1    VLDTDGEELRTGVEYYVVSALWGAGGGGLAP---GRSRNQSCPDIVVQRRSDLDYGIPVI  57

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD---  392
              P  PN   +  S  L+ EF+     +C ++  W +  YD+ + ++++ +G    D   
Sbjct  58   FSPVKPNDIFIRVSTDLNIEFTPLRDSLCLTTAVWKLDDYDQSTGKWWVIAGGVAGDAGP  117

Query  391  --LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI  287
              L   FKI  +     Y+  YCP     C  +  +I
Sbjct  118  HTLPNWFKI-EKNGVLGYKFIYCPSVCDSCTTLCSDI  153



>gb|ACO39920.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39925.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39936.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39939.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39962.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39982.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39985.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40005.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40046.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40047.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40069.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40072.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+V+     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVMFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39929.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P+  H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPHAVHAE----------------------AVIDAFGHEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|AAU09272.1| Kunitz-type proteinase inhibitor group B [Solanum tuberosum]
Length=194

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 84/198 (42%), Gaps = 26/198 (13%)
 Frame = -2

Query  748  SDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQLAWL-NSTAQCASNV------VV  593
            SD TPV+D  G EL +  +Y I  I T   A  G V L    NS A CA+ V      V 
Sbjct  4    SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVG  61

Query  592  PRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFF  419
            P     G P+R +  +      +  ++ L+ +F++ST ++C S   W +  YD       
Sbjct  62   PS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTML  117

Query  418  LNSGEFVSDL-SGQFKIVAQPDPNTYRIDY--------CPFGGHKCFYVSLNIDESAGAV  266
            L +G  +    S  FKIV       Y + Y        CPF     F + + +    G  
Sbjct  118  LETGGTIGQADSSWFKIVKSSQLG-YNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKR  176

Query  265  RWVLSDNNFLPVWFRKTR  212
            R  L  +N L + F++ +
Sbjct  177  RLALVKDNPLDISFKQVQ  194



>gb|AAX47263.1| Kunitz-type proteinase inhibitor group B1 [Solanum palustre]
Length=194

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 85/198 (43%), Gaps = 26/198 (13%)
 Frame = -2

Query  748  SDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQLAWL-NSTAQCASNV------VV  593
            SD TPV+D  G EL +  +Y I  I T   A  G V L    NS A CA+ V      V 
Sbjct  4    SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVG  61

Query  592  PRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QYDRPSQQFF  419
            P     G P+R +  +      +  ++ L+ +F++ST ++C S   W +  YD       
Sbjct  62   PS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTML  117

Query  418  LNSGEFVSDL-SGQFKIVAQPD--------PNTYRIDYCPFGGHKCFYVSLNIDESAGAV  266
            L +G  +    S  FKIV            P T  ++ CPF     F + + +    G  
Sbjct  118  LETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMN-CPFSSDDQFCLKVGVVHQNGKR  176

Query  265  RWVLSDNNFLPVWFRKTR  212
            R  L  +N L V F++ +
Sbjct  177  RLALVKDNPLDVSFKQVQ  194



>gb|ACO39958.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 82/192 (43%), Gaps = 36/192 (19%)
 Frame = -2

Query  874  NMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAG  698
            N   L+ LLFAF+   + P   H+                        V+D  G+E+R G
Sbjct  5    NFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVRTG  42

Query  697  ETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVVLP  521
            + Y I         +A    A  +S   C S+V+     S G P+   P  + N +V+  
Sbjct  43   DRYII--------GAASNDFAVTSSRIICNSDVMFSP-MSDGLPVIFSPVVESNDSVIHE  93

Query  520  SKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPNTY  344
              +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N Y
Sbjct  94   DSYLNVDFDAATCRMAGVSTMWKIEM-RPTARGFVVTTGGVAGLN-RFKITKYEGGNNLY  151

Query  343  RIDYCPFGGHKC  308
            ++ YCP     C
Sbjct  152  QLSYCPISEPIC  163



>gb|ACO40066.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 84/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V++    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVMLSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>emb|CAH59183.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 35/192 (18%)
 Frame = -2

Query  874  NMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAG  698
            N   L+ LLFAF+   + P   H+A                       V+DT G+E+RAG
Sbjct  5    NFLVLSFLLFAFTATSIFPRAVHAA----------------------AVIDTFGDEVRAG  42

Query  697  ETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDP-IRVRPTDPNAAVVLP  521
              Y I +     + +A        S   C S+VV     S G P I  +  + N +V+  
Sbjct  43   YRYIIGAASNDFAITA-------TSPIICNSDVVFSP-MSTGLPVIFSKVVESNDSVINE  94

Query  520  SKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPNTY  344
              +L+ +F  S+ R+   S  W I+    ++ F +N+G  V+ L+ +F I   +   N Y
Sbjct  95   DSYLNVDFDASSCRMAGVSTMWKIELRLTARGFVVNTGG-VAGLN-RFTITKYEGGNNLY  152

Query  343  RIDYCPFGGHKC  308
            ++ YCP     C
Sbjct  153  QLSYCPISEPIC  164



>gb|ACO39954.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40035.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 82/192 (43%), Gaps = 36/192 (19%)
 Frame = -2

Query  874  NMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAG  698
            N   L+ LLFAF+   + P   H+                        V+D  G+E+R G
Sbjct  5    NFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVRTG  42

Query  697  ETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVVLP  521
            + Y I         +A    A  +S   C S+V+     S G P+   P  + N +V+  
Sbjct  43   DRYII--------GAASNDFAVTSSRIICNSDVMFSP-MSDGLPVIFSPVVESNDSVIHE  93

Query  520  SKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPNTY  344
              +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N Y
Sbjct  94   DSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNNLY  151

Query  343  RIDYCPFGGHKC  308
            ++ YCP     C
Sbjct  152  QLSYCPISEPIC  163



>ref|XP_003532237.1| PREDICTED: trypsin inhibitor A-like [Glycine max]
Length=213

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 79/177 (45%), Gaps = 11/177 (6%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPI  563
             T VVDTDG+ L+   TY+I S+  P     GV+ A   +  +     VV   F  G P 
Sbjct  23   TTAVVDTDGDILQNPGTYFILSVFRP---GGGVEFAATGN--ETCPLTVVQTLFGRGFP-  76

Query  562  RVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSG  383
             +  +      +   +  S  F +  P    +   W I    P       +G + + + G
Sbjct  77   AILSSRLRIPFIGEGQLFSILFRI-VPWCATTPSKWTIVEGLPESPAVKLTG-YDNTVPG  134

Query  382  QFKI-VAQPDPNTYRIDYCPFGGH-KCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
            +FKI  A P  N Y + +CP G   KC ++ ++ D+  G  R V+S+ N L V F+K
Sbjct  135  EFKIEKANPFHNDYTLLFCPAGEESKCGHIGIHFDDD-GNRRLVVSEENILRVQFQK  190



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 97/225 (43%), Gaps = 26/225 (12%)
 Frame = -2

Query  862  LAILLFAFSLYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYI  683
            + ILL +F   LL +   S  NP  L         +     +PV+DT+G+++R G  Y++
Sbjct  1    MNILLLSF--ILLQSFAFSLANPSEL--------LSAGPSPSPVLDTNGDKIRTGSNYFV  50

Query  682  TSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGDPIRVRPTDPNAAVVLPSKFLS  506
              +        G+  + +     C  +++        G P+   P DP   V+  S  L+
Sbjct  51   LPVI--RGRGGGLFPSNVKQNNTCPRDIIQESLDVQQGLPVVFTPVDPKKGVIRLSSDLN  108

Query  505  FEFSVSTPRVCASSVYWGI-QYDRPSQQFFLNSGEFVSD-----LSGQFKIVAQPDPNTY  344
              F   TP +CA    W +  +D   +Q+F+ +G    +     +S  FKI  +     Y
Sbjct  109  VRF--FTPTICARETIWKVGDFDEKLKQYFVVTGGVEGNPGPQTVSNWFKI--EKLGTDY  164

Query  343  RIDYCPFGGHKCFYVSLNIDE-SAGAVRWV-LSDNNFLPVWFRKT  215
            +  +CP     C  +  ++   +   VR++ LSD  F  V F+KT
Sbjct  165  KFVFCPSVCSFCKVICKDVGIFTKNGVRFLALSDTPFR-VMFKKT  208



>gb|ACJ86171.1| unknown [Medicago truncatula]
 gb|AFK46102.1| unknown [Medicago truncatula]
 gb|KEH26655.1| Kunitz type trypsin inhibitor / Alpha-fucosidase [Medicago truncatula]
Length=217

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 76/177 (43%), Gaps = 11/177 (6%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRV  557
            PV D  GN L  G  YYI    + + +S G+ L  +  +  C   V+     + G P++ 
Sbjct  28   PVFDKHGNPLTPGNQYYILP-ASDNPSSGGLTLDKVGDSV-CPLTVLQNNAVT-GLPVKF  84

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGE-----FVSD  392
               + + + ++    L  EF ++ P  CA S  W +  D  +Q  F+  G       V  
Sbjct  85   TILENSTSNIVTGTDLEIEF-INKPD-CAESSKWLMVVDHVTQLSFVGIGGPANYPGVEL  142

Query  391  LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSL-NIDESAGAVRWVLSDNNFLPVWF  224
            +SG+F I+     N YR+ +C      C Y+ L   +   G  R +L+  N   V F
Sbjct  143  ISGKFLILKHGSGNAYRVGFCLDTTGDCAYLGLQEFNSGEGGSRLILTAINAYSVVF  199



>gb|ACO39944.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39994.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40028.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFS-LYLLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSP-MSHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEM-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 85/185 (46%), Gaps = 26/185 (14%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSA--------SAGVQLAWLNSTAQCASNVVVPRCFS  578
            V+DT G EL+ G +YY+       +         + G+ LA +  +  C  +VVV +  S
Sbjct  30   VIDTSGTELQPGLSYYVVPAMRSFTRCGKFECLNAEGLSLASIGES--CPLDVVVEQ-RS  86

Query  577  FGDPIRVRPTDPNAAVVLPSKFLSFEFSVS-TPRVCAS-SVYWGI-QYDRPSQQFFLNSG  407
            FG P+   P D N +VV  S  L+  F    T   CA  S  W +  +D    ++F+ +G
Sbjct  87   FGLPLSFSPLDTNESVVRVSTDLNIMFCTDRTSYSCAEYSPVWKLDHFDVSKGKWFVTTG  146

Query  406  EFVSDLSGQ-----FKIVAQPDPNTYRIDY----CPFGGHKCFYVSLNIDESAGAVRWVL  254
              + + S +     FKI  +   + YRI Y    CP   H C  V + +DE+ G  R  L
Sbjct  147  GSMGNPSWETIRNWFKI--EKCDSAYRIVYCPSVCPSSKHMCKDVGVFVDEN-GYRRLAL  203

Query  253  SDNNF  239
            SD  F
Sbjct  204  SDVPF  208



>gb|ACO39922.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSP-MSHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEM-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39915.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39932.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39960.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39968.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40024.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40040.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 82/192 (43%), Gaps = 36/192 (19%)
 Frame = -2

Query  874  NMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAG  698
            N   L+ LLFAF+   + P   H+                        V+D  G+E+R G
Sbjct  5    NFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVRTG  42

Query  697  ETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVVLP  521
            + Y I         +A    A  +S   C S+V+     S G P+   P  + N +V+  
Sbjct  43   DRYII--------GAASNDFAVTSSRIICNSDVMFSP-MSDGLPVIFSPVVESNDSVIHE  93

Query  520  SKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPNTY  344
              +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N Y
Sbjct  94   DSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNNLY  151

Query  343  RIDYCPFGGHKC  308
            ++ YCP     C
Sbjct  152  QLSYCPISEPIC  163



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 86/196 (44%), Gaps = 21/196 (11%)
 Frame = -2

Query  784  PIRLPTADAAVASDNTPVVDTDGNELRAGETYYIT-----SIETPHSASAGVQLAWLNST  620
            P+ L  A AA      PV+DT G +LRA   Y+I      +I    S   G  L+  +  
Sbjct  18   PLLLGAAGAA----PEPVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSID  73

Query  619  AQCASNVVVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGI-QY  443
              C  +V++ +  + G P+R  P +    V+  S  L+  FS S  R    S  W + Q+
Sbjct  74   ESCPLDVIIEKA-NEGLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQF  132

Query  442  DRPSQQFFLNSGEFVSD-----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDES  278
            D    Q ++ +G  V +     +   FKI  Q   + Y++ YCP     C ++  +I   
Sbjct  133  DASIGQTYVTTGGVVGNPGEHTILNWFKI--QKYEDAYKLVYCPRVCPSCHHLCKDIGMF  190

Query  277  AGAVRWV---LSDNNF  239
              A R +   LSD+ F
Sbjct  191  VDANRRMHLALSDDPF  206



>gb|ACS92496.1| Kunitz-type protease inhibitor KPI-C2.2 [Populus trichocarpa 
x Populus deltoides]
Length=207

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 70/151 (46%), Gaps = 9/151 (6%)
 Frame = -2

Query  751  ASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFG  572
            A D   V+D +GNE+ A   Y+I +    ++ +  V      S   C S+V++    S G
Sbjct  28   AEDPEAVIDVNGNEVTADARYFIGAASDDNTTTLAVSAT---SRIICNSDVILSS-MSNG  83

Query  571  DPIRVRP--TDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFV  398
             P+       + N  V+    +L+  F  +T R+   S  W ++  RP+ + F+ +   V
Sbjct  84   LPVTFSSPVGESNDGVIREDSYLNVNFDAATCRMAGVSTMWKMEL-RPTMRGFVVTTGGV  142

Query  397  SDLSGQFKIVA-QPDPNTYRIDYCPFGGHKC  308
            + L+ +FKI   +   N Y++ YCP     C
Sbjct  143  NGLN-RFKITKYEGGNNLYQLSYCPISDPMC  172



>gb|ACO39928.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSP-MSHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39910.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39947.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39952.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39953.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39970.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39981.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39987.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40009.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40019.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40026.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40029.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDAFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSP-MSHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEM-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>ref|XP_011014541.1| PREDICTED: wound-responsive protein GWIN3-like [Populus euphratica]
Length=203

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (43%), Gaps = 35/194 (18%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        VVD  G+E+R
Sbjct  3    INNFIVLSFLLFAFTATSIFPRAVHA----------------------EAVVDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G  Y+I +     + SA        S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGGRYFIAAASNDFAVSA-------TSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  92

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  ++ R+   S  W I++ RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  93   NEDSHLTVDFFAASCRMAGVSTMWKIEF-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  150

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  151  LYQLSYCPISEPIC  164



>gb|AAM21644.1|AF495583_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=186

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 76/174 (44%), Gaps = 29/174 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSHLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCP  326
            ++C S   W +  YD       L +G  +    S  FKIV       Y + YCP
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCP  175



>gb|AIT42161.1| Kunitz-type inhibitor A, partial [Solanum tuberosum]
Length=210

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 87/216 (40%), Gaps = 33/216 (15%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T S+ NPI LP           +  TPV DT+GNEL    +Y I  I T   A  G V L
Sbjct  10   TFSSQNPIDLPTD--------TTPCTPVHDTNGNELNPNSSYRI--ISTFWGALGGDVYL  59

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPR  479
                NS A C   V      V P     G P+R  P     A +   + L+ +F++ T +
Sbjct  60   GKSPNSDAPCPDGVFRYNSDVGPS----GTPVRFIPK--YGANICEDQLLNIQFNIPTVK  113

Query  478  VCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------CP  326
            +C S   W +   +   +   L +G  +      +  +A+     Y + Y        CP
Sbjct  114  LCVSYTIWKVGNLNAHPRTMLLETGGTIGQADSSYFKIAKSSKFGYNLLYCPITRPIICP  173

Query  325  FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRK  218
            F   + F   + +    G  R  L + N L V+F++
Sbjct  174  FCHDENFCAKMGVVIQNGKKRLALVNENPLDVYFQE  209



>ref|XP_010683193.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (44%), Gaps = 11/148 (7%)
 Frame = -2

Query  748  SDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVP-RCFSFG  572
            +DNT V+D +G  L+AG  YYI  +        G+ +A  N+T  C   V       S G
Sbjct  24   ADNTAVLDINGRPLQAGYNYYILPV--IRGRGGGLTMASKNATELCPLYVAQEDHEVSNG  81

Query  571  DPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSD  392
             P++  P +P    +  S  L+F F  +T   C  S  W +  +  + + ++ +G  + +
Sbjct  82   LPLKFYPVNPKDKRISLSSDLNFVFDAAT--TCVQSTGWSLTIEMETGRRYVGTGGEIGN  139

Query  391  -----LSGQFKIVAQPDPN-TYRIDYCP  326
                 +   FKI         Y+I YCP
Sbjct  140  PGVETVDNWFKIEKDGSGKYDYKIVYCP  167



>ref|XP_006387700.1| hypothetical protein POPTR_0664s00220g [Populus trichocarpa]
 gb|ERP46614.1| hypothetical protein POPTR_0664s00220g [Populus trichocarpa]
Length=202

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+V+     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVMFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 80/191 (42%), Gaps = 27/191 (14%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPR-CFSFGDPIR  560
            PVVD +G E+R G  YY+ S+  P    +GV          C   VV  R  F+ G P+ 
Sbjct  26   PVVDFNGEEIRPGVDYYVVSV-FPGGRGSGVTYGKGPGNEICPLAVVQARPDFNRGHPVT  84

Query  559  VRPTDPNAAVVLPSKFLSFEFSVSTPRV--CASSVYWGIQYDRP-SQQFFLNSGEFVSDL  389
              P +P  +VV  S  L+ +FS   P +  C  S  W + ++    Q F L  G  V   
Sbjct  85   FTPVNPEESVVRVSTDLNIKFS-EPPFINFCRGSNVWKVHFNEALKQHFVLTDG--VEGN  141

Query  388  SGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNIDESAGAV--------------RWVLS  251
            SG      + + N ++I+     G+K  +     D S+ A+              R  LS
Sbjct  142  SG-----CETEANWFKIELTGNVGYKFVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALS  196

Query  250  DNNFLPVWFRK  218
            D  F+  + +K
Sbjct  197  DQPFVVFFIKK  207



>ref|XP_006362681.1| PREDICTED: serine protease inhibitor 1-like [Solanum tuberosum]
Length=186

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 76/174 (44%), Gaps = 29/174 (17%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P+R +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVRFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDL-SGQFKIVAQPDPNTYRIDYCP  326
            ++C S   W +  YD       L +G  +    S  FKIV       Y + YCP
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLG-YNLLYCP  175



>ref|XP_011041832.1| PREDICTED: wound-responsive protein GWIN3-like [Populus euphratica]
Length=207

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (41%), Gaps = 27/188 (14%)
 Frame = -2

Query  862  LAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYY  686
            L+ LLFAF+   + P+  H                   A D   V+D  GNE+ A  +Y+
Sbjct  9    LSFLLFAFTATSIFPHAVH-------------------AGDPAAVIDVYGNEVTADASYF  49

Query  685  ITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP--TDPNAAVVLPSKF  512
            I +    ++ +  V      S   C S+VV+    S G P+       + N  V+    +
Sbjct  50   IGAASDDNTTTLAVS---ATSRIICNSDVVLSS-MSNGLPVTFSSPVGESNDGVIREDSY  105

Query  511  LSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY  332
            L+  F  +T RV   S  W ++  RP+ + F+ +   V  L+       +   N Y++ Y
Sbjct  106  LNVNFDAATCRVAGVSTMWKMEL-RPTMRGFVVTTGGVDGLNRVKSTKYEGGTNLYQLSY  164

Query  331  CPFGGHKC  308
            CP     C
Sbjct  165  CPISDPMC  172



>gb|AIT42199.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (41%), Gaps = 35/219 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL +  +Y I  I T   A  G V L
Sbjct  20   TFTSKNPINLP-----------SDATPVLDVAGKELDSRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDP-IRVRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ +      V P     G P I +  +      +  ++ L+ +F++ST 
Sbjct  67   GKSPNSDAPCANGIFRYNSDVGPS----GTPVIFIGSSSHFGQGIFENELLNIQFAISTS  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVSDLSGQFKIVAQPDPNTYRIDY--------C  329
            ++C S   W +  YD       L +G  +      +  + +     Y + Y        C
Sbjct  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSC  182

Query  328  PFGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            PF     F + + +    G  R  L  +N L V F++ +
Sbjct  183  PFSSDDQFCLXVGVVHQNGKRRLALVKDNPLDVSFKQVQ  221



>gb|ACO40041.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHTE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>ref|NP_001275101.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94187.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94197.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94198.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AIT42173.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=219

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 89/218 (41%), Gaps = 35/218 (16%)
 Frame = -2

Query  814  THSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAG-VQL  638
            T ++ NPI LP           SD TPV+D  G EL    +Y I  I T   A  G V L
Sbjct  20   TFTSQNPINLP-----------SDATPVLDVTGKELDPRLSYRI--ISTFWGALGGDVYL  66

Query  637  AWL-NSTAQCASNV------VVPRCFSFGDPIR-VRPTDPNAAVVLPSKFLSFEFSVSTP  482
                NS A CA+ V      V P     G P+R +  +      +   + L+ +F +ST 
Sbjct  67   GKSPNSDAPCANGVFRYNSDVGPS----GTPVRFIGSSSHFGPHIFEGELLNIQFDISTV  122

Query  481  RVCASSVYWGI-QYDRPSQQFFLNSGEFVS-DLSGQFKIVAQPDPNTYRIDY------CP  326
            + C S   W +  YD       L +G  +  + S  FKIV       Y + Y      CP
Sbjct  123  KSCVSYTIWKVGDYDASLGTMLLETGGTIGQEDSSWFKIVKSSQLG-YNLLYCPATMICP  181

Query  325  FGGHKCFYVSLNIDESAGAVRWVLSDNNFLPVWFRKTR  212
            F     F + + +    G  R  L  +N L V F++ +
Sbjct  182  FCSDDEFCLKVGVIHQNGKRRLALVKDNPLDVSFKQVQ  219



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 69/150 (46%), Gaps = 16/150 (11%)
 Frame = -2

Query  733  VVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVR  554
            V+DT G  +RA  +YYI     P S   G  L   ++ A C  +VVV   +  G P+   
Sbjct  30   VLDTSGKIVRARSSYYI----VPASPDLG-GLDMASTGADCPLDVVVVDGYQ-GQPLIFT  83

Query  553  PTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNSGEFVSDLSGQ-  380
            P + N  V+  S  L+  F V+T   C  +  W ++ YD  + Q+F+ +G    +   Q 
Sbjct  84   PVNFNKGVIRVSTDLNIYFPVATS--CPQTTVWKLKDYDYSTSQWFVTTGGDFGNPGSQT  141

Query  379  ----FKIVAQPDPNTYRIDYCPFGGHKCFY  302
                FKI    D   Y++ YCP   + C Y
Sbjct  142  VANWFKIEKYED--AYKLVYCPSVCNDCSY  169



>gb|ACO40021.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 84/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P+  H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPHAVHAE----------------------AVIDAFGHEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ADW95387.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|AEK26934.1| Kunitz-type trypsin inhibitor A7 [Populus nigra]
Length=207

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/189 (25%), Positives = 82/189 (43%), Gaps = 29/189 (15%)
 Frame = -2

Query  862  LAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELRAGETYY  686
            L+ LLFAF+   + P+  H                   A D   V+D +GNE+     Y+
Sbjct  9    LSFLLFAFTATSIFPHAVH-------------------AEDPEAVIDVNGNEVTPDARYF  49

Query  685  ITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP--TDPNAAVVLPSKF  512
            I +    ++ +  V      S   C S+V++    S G P+       + N  V+    +
Sbjct  50   IGAASDDNTTTLAVSAT---SQIICNSDVILSS-MSNGLPVTFSSPVGESNDGVIREDSY  105

Query  511  LSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPNTYRID  335
            L+  F  +T R+   S  W ++  RP+ + F+ +   V+ L+ +FKI   +   N+Y++ 
Sbjct  106  LNVNFDAATCRMAGVSTMWKMEL-RPTMRGFVVTTGGVNGLN-RFKITKYEGGNNSYQLS  163

Query  334  YCPFGGHKC  308
            YCP     C
Sbjct  164  YCPISDPMC  172



>ref|XP_007041756.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOX97587.1| 21 kDa seed protein [Theobroma cacao]
Length=214

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 77/196 (39%), Gaps = 16/196 (8%)
 Frame = -2

Query  769  TADAAVASDNTPVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVP  590
            ++ ++   +N  V   +G+ELR G  YY+ S                N T  C  +VV  
Sbjct  17   SSKSSATDENGSVYHLNGDELRPGVEYYVVSAIWGAGGGGLYLGKGRNQT--CPYDVVQE  74

Query  589  RCFSFGDPIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLN  413
            +      P+   P D    V+     L+  F    P  C+ S  W +  YD   +++F+ 
Sbjct  75   KP---ALPVTFSPVDTKGGVIHEPTDLNISFIPPGPTACSQSTVWKVDSYDESRREWFVA  131

Query  412  SGEFVSD---LSGQFKIVAQPDPNTYRIDYCPFGGHKCF-YVSLNIDESAGA----VRWV  257
            +G    D   LS  FKI        Y + +CP     C  Y+   I   +      +R V
Sbjct  132  TGGVEGDPQALSSLFKIKGA-GGLLYELAFCPSVCESCRKYLCSEIGRYSSGFDPLIRLV  190

Query  256  LSDNNFLPVWFRKTRN  209
            LSDN  LP  F K  N
Sbjct  191  LSDNE-LPFVFIKAGN  205



>gb|ACO39924.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39942.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39948.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39955.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39969.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39999.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40001.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40003.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40058.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40062.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40071.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39990.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39991.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39913.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39919.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39923.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39930.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39931.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39949.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39964.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39971.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39977.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39978.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39984.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39992.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39993.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39997.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40033.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40042.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40045.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40049.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40056.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40057.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40059.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40060.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40061.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40065.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40067.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40068.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO39979.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>prf||1922206A trypsin inhibitor:ISOTYPE=a
Length=184

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 59/140 (42%), Gaps = 9/140 (6%)
 Frame = -2

Query  736  PVVDTDGNELRAGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRV  557
            PV+D DGNELR G  YY  S+  P+S   G+ LA   S A C  NV       +G P+  
Sbjct  3    PVLDVDGNELRRGNRYYAISLRRPNS---GLTLA-ARSNAPCPLNVAQAAPRDYGRPLAF  58

Query  556  RPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQF  377
             P + +   V     L+  F    P  C  S  W +  +         S   +   + +F
Sbjct  59   FPENADDDTVQEGSTLNIMF--PEPTECRESTVWTLDRETGVVTTGGTSSSEIGPHNERF  116

Query  376  KIVAQPDPNT---YRIDYCP  326
             I    D ++   Y+I+ CP
Sbjct  117  AIRRAGDASSKREYQIEVCP  136



>gb|ACO39926.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39946.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39967.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39976.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39989.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39996.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40050.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO40016.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S+  C S+V +    S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSSIICNSDVFLSPT-SHGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|ACO40052.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40054.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A  +S   C S+VV     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTSSRIICNSDVVFSP-MSDGLPVIFSPAVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                 L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSDLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



>gb|AAV41231.1| putative 21 kDa trypsin inhibitor [Theobroma cacao]
Length=221

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 78/179 (44%), Gaps = 15/179 (8%)
 Frame = -2

Query  742  NTPVVDTDGNELRAGETYYI-TSIETPHSASAGVQLAWLNSTAQCASNVVVPRC-FSFGD  569
            N+P++DTDG+EL+ G  YY+ +SI         ++   + S   C   VV  R     G 
Sbjct  28   NSPLLDTDGDELQTGVQYYVLSSISGAGGGGLALEGVQVQS---CPEIVVQRRSELDNGT  84

Query  568  PIRVRPTDPNAAVVLPSKFLSFEFSVSTPRVCASSVYWGIQ-YDRPSQQFFLNSGEFVSD  392
            P+     D    VV  S  ++ EF     R+C++S  W +  YD  + +++L +     +
Sbjct  85   PVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWLATDGVKGE  144

Query  391  -----LSGQFKIVAQPDPNTYRIDYCPFGGHKCFYVSLNI---DESAGAVRWVLSDNNF  239
                 L   FKI  +     Y+  +CP     C  +  +I    +  G +R   SDN +
Sbjct  145  TGPNTLCSWFKI-EKSGVLGYKFRFCPSACDSCTTLCSDIGRHSDDDGQIRLAFSDNGW  202



>gb|ACO40051.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 83/194 (43%), Gaps = 36/194 (19%)
 Frame = -2

Query  880  VGNMKTLAILLFAFSLY-LLPNPTHSAFNPIRLPIRLPTADAAVASDNTPVVDTDGNELR  704
            + N   L+ LLFAF+   + P   H+                        V+D  G+E+R
Sbjct  3    ITNFLVLSFLLFAFTATSIFPRAVHAE----------------------AVIDVFGDEVR  40

Query  703  AGETYYITSIETPHSASAGVQLAWLNSTAQCASNVVVPRCFSFGDPIRVRP-TDPNAAVV  527
             G+ Y I         +A    A   ++  C S+V+     S G P+   P  + N +V+
Sbjct  41   TGDRYII--------GAASNDFAVTATSPICNSDVMFSP-MSDGLPVIFSPVVESNDSVI  91

Query  526  LPSKFLSFEFSVSTPRVCASSVYWGIQYDRPSQQFFLNSGEFVSDLSGQFKIVA-QPDPN  350
                +L+ +F  +T R+   S  W I+  RP+ + F+ +   V+ L+ +FKI   +   N
Sbjct  92   HEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFKITKYEGGNN  149

Query  349  TYRIDYCPFGGHKC  308
             Y++ YCP     C
Sbjct  150  LYQLSYCPISEPIC  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1932141131370