BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30585_g1_i1 len=1093 path=[1071:0-1092]

Length=1093
                                                                      Score     E

ref|XP_009778201.1|  PREDICTED: transmembrane ascorbate ferriredu...    374   7e-126   
ref|XP_009590952.1|  PREDICTED: transmembrane ascorbate ferriredu...    372   2e-125   
dbj|BAE46406.1|  cytochrome b561                                        339   2e-112   Citrullus lanatus [wild melon]
ref|XP_011076172.1|  PREDICTED: transmembrane ascorbate ferriredu...    337   9e-112   
ref|XP_008465873.1|  PREDICTED: transmembrane ascorbate ferriredu...    336   3e-111   
ref|XP_009371327.1|  PREDICTED: transmembrane ascorbate ferriredu...    336   3e-111   
ref|XP_002318222.2|  hypothetical protein POPTR_0012s13210g             337   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_004148357.1|  PREDICTED: transmembrane ascorbate ferriredu...    335   9e-111   
ref|XP_004234390.1|  PREDICTED: transmembrane ascorbate ferriredu...    335   1e-110   
ref|XP_009349345.1|  PREDICTED: transmembrane ascorbate ferriredu...    334   1e-110   
ref|XP_006353305.1|  PREDICTED: transmembrane ascorbate ferriredu...    333   3e-110   
gb|EYU25091.1|  hypothetical protein MIMGU_mgv1a013071mg                332   9e-110   
ref|XP_004308091.1|  PREDICTED: transmembrane ascorbate ferriredu...    332   9e-110   
ref|XP_010107440.1|  Transmembrane ascorbate ferrireductase 1           331   2e-109   
ref|XP_008376574.1|  PREDICTED: transmembrane ascorbate ferriredu...    331   4e-109   
gb|ABK93740.1|  unknown                                                 330   6e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011048710.1|  PREDICTED: transmembrane ascorbate ferriredu...    329   1e-108   
ref|XP_010667562.1|  PREDICTED: transmembrane ascorbate ferriredu...    328   7e-108   
ref|XP_011030106.1|  PREDICTED: transmembrane ascorbate ferriredu...    327   9e-108   
ref|XP_004496575.1|  PREDICTED: transmembrane ascorbate ferriredu...    327   1e-107   
ref|XP_010537185.1|  PREDICTED: transmembrane ascorbate ferriredu...    326   3e-107   
ref|XP_010061065.1|  PREDICTED: transmembrane ascorbate ferriredu...    326   4e-107   
ref|XP_003638360.1|  Cytochrome b reductase                             325   8e-107   
gb|AFK34168.1|  unknown                                                 323   3e-106   
gb|KDP22285.1|  hypothetical protein JCGZ_26116                         323   5e-106   
ref|XP_010255441.1|  PREDICTED: probable ascorbate-specific trans...    320   6e-105   
ref|XP_006421910.1|  hypothetical protein CICLE_v10005795mg             313   2e-102   
ref|XP_002267852.1|  PREDICTED: transmembrane ascorbate ferriredu...    313   4e-102   Vitis vinifera
emb|CAA18169.1|  putative protein                                       312   3e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05207.1|  unnamed protein product                                310   5e-101   
ref|XP_009137537.1|  PREDICTED: transmembrane ascorbate ferriredu...    310   8e-101   
gb|AAM62824.1|  cytochrome b561                                         310   8e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038676.1|  Cytochrome b561/ferric reductase transmembra...    308   2e-100   
emb|CAB81367.1|  putative protein                                       310   2e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KHN26657.1|  Transmembrane ascorbate ferrireductase 1                307   7e-100   
ref|XP_006284451.1|  hypothetical protein CARUB_v10005631mg             307   1e-99    
ref|XP_010448412.1|  PREDICTED: transmembrane ascorbate ferriredu...    306   1e-99    
ref|XP_007038677.1|  Cytochrome b561/ferric reductase transmembra...    306   2e-99    
ref|XP_010433616.1|  PREDICTED: transmembrane ascorbate ferriredu...    306   2e-99    
ref|XP_010438862.1|  PREDICTED: transmembrane ascorbate ferriredu...    305   4e-99    
ref|NP_001234998.1|  uncharacterized protein LOC100306179               305   5e-99    
gb|KFK29056.1|  hypothetical protein AALP_AA7G083000                    305   6e-99    
ref|XP_010667557.1|  PREDICTED: transmembrane ascorbate ferriredu...    303   2e-98    
ref|XP_008794543.1|  PREDICTED: probable ascorbate-specific trans...    304   3e-98    
ref|NP_567723.1|  transmembrane ascorbate ferrireductase 1              303   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413294.1|  hypothetical protein EUTSA_v10026122mg             303   3e-98    
dbj|BAB21522.1|  cytochrome b561                                        302   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908428.1|  PREDICTED: ascorbate-specific transmembrane ...    301   1e-97    
gb|EPS69896.1|  hypothetical protein M569_04865                         297   3e-96    
ref|XP_010905108.1|  PREDICTED: probable ascorbate-specific trans...    298   3e-96    
ref|XP_008794188.1|  PREDICTED: ascorbate-specific transmembrane ...    296   1e-95    
ref|XP_002510795.1|  cytochrome B561, putative                          295   3e-95    Ricinus communis
ref|NP_001237148.1|  uncharacterized protein LOC100527259               294   8e-95    
ref|XP_007143403.1|  hypothetical protein PHAVU_007G069600g             293   2e-94    
ref|XP_002322468.2|  hypothetical protein POPTR_0015s13160g             291   4e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010442754.1|  PREDICTED: transmembrane ascorbate ferriredu...    291   8e-94    
ref|XP_008778726.1|  PREDICTED: probable ascorbate-specific trans...    291   1e-93    
ref|XP_007218307.1|  hypothetical protein PRUPE_ppa010860mg             290   3e-93    
gb|AFN53683.1|  hypothetical protein                                    296   5e-93    
ref|XP_006647595.1|  PREDICTED: probable ascorbate-specific trans...    288   3e-92    
ref|XP_009397940.1|  PREDICTED: probable ascorbate-specific trans...    287   4e-92    
ref|XP_006279689.1|  hypothetical protein CARUB_v10027027mg             287   4e-92    
ref|XP_010444670.1|  PREDICTED: transmembrane ascorbate ferriredu...    287   6e-92    
ref|XP_008234253.1|  PREDICTED: transmembrane ascorbate ferriredu...    286   9e-92    
ref|XP_004953261.1|  PREDICTED: ascorbate-specific transmembrane ...    285   3e-91    
sp|A3A9H6.1|ACET1_ORYSJ  RecName: Full=Probable ascorbate-specifi...    284   9e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940462.1|  PREDICTED: probable ascorbate-specific trans...    283   2e-90    
gb|EAY86856.1|  hypothetical protein OsI_08240                          282   3e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001140931.1|  ascorbate-specific transmembrane electron tr...    282   7e-90    Zea mays [maize]
ref|XP_007038680.1|  Cytochrome b561/ferric reductase transmembra...    281   8e-90    
ref|XP_009340012.1|  PREDICTED: transmembrane ascorbate ferriredu...    281   1e-89    
ref|XP_009410543.1|  PREDICTED: probable ascorbate-specific trans...    278   2e-88    
gb|KCW90707.1|  hypothetical protein EUGRSUZ_A02792                     275   5e-88    
gb|KEH43715.1|  transmembrane ascorbate ferrireductase                  274   7e-88    
ref|NP_001170569.1|  ascorbate-specific transmembrane electron tr...    276   9e-88    Zea mays [maize]
emb|CDX91626.1|  BnaC02g15340D                                          276   2e-87    
ref|XP_003569967.1|  PREDICTED: probable ascorbate-specific trans...    275   3e-87    
ref|XP_002452857.1|  hypothetical protein SORBIDRAFT_04g033650          275   4e-87    Sorghum bicolor [broomcorn]
ref|XP_009127253.1|  PREDICTED: transmembrane ascorbate ferriredu...    274   6e-87    
gb|ACG34049.1|  cytochrome b561                                         274   7e-87    Zea mays [maize]
dbj|BAD25232.1|  putative cytochrome                                    274   9e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007038678.1|  Cytochrome b561/ferric reductase transmembra...    272   9e-87    
emb|CDY27081.1|  BnaA02g11010D                                          272   3e-86    
ref|XP_009340016.1|  PREDICTED: transmembrane ascorbate ferriredu...    272   3e-86    
dbj|BAJ98832.1|  predicted protein                                      272   1e-85    
gb|EMT23263.1|  Cytochrome b561                                         270   2e-85    
gb|KDO60010.1|  hypothetical protein CISIN_1g0269791mg                  266   9e-85    
ref|NP_001132893.1|  uncharacterized protein LOC100194390               268   9e-85    Zea mays [maize]
gb|EMS55631.1|  Cytochrome b561                                         268   1e-84    
ref|XP_006374625.1|  hypothetical protein POPTR_0015s13160g             264   7e-84    
ref|XP_002867604.1|  hypothetical protein ARALYDRAFT_329112             266   1e-83    
ref|XP_006827691.1|  hypothetical protein AMTR_s00009p00257510          265   2e-83    
ref|XP_004976346.1|  PREDICTED: probable ascorbate-specific trans...    264   7e-83    
ref|XP_006401843.1|  hypothetical protein EUTSA_v10014551mg             263   2e-82    
ref|XP_008667311.1|  PREDICTED: uncharacterized protein LOC100194...    262   3e-82    
ref|XP_003580220.2|  PREDICTED: probable ascorbate-specific trans...    262   7e-82    
dbj|BAJ87208.1|  predicted protein                                      261   1e-81    
dbj|BAK01821.1|  predicted protein                                      261   1e-81    
ref|XP_009411317.1|  PREDICTED: probable ascorbate-specific trans...    258   5e-81    
gb|KDO60011.1|  hypothetical protein CISIN_1g0269791mg                  257   6e-81    
ref|NP_001053410.1|  Os04g0533500                                       258   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009394549.1|  PREDICTED: probable ascorbate-specific trans...    256   7e-80    
dbj|BAK01196.1|  predicted protein                                      250   1e-77    
gb|EMT24483.1|  Cytochrome b reductase 1                                248   6e-77    
ref|XP_004982675.1|  PREDICTED: probable ascorbate-specific trans...    248   6e-77    
ref|XP_007038679.1|  Cytochrome b561/ferric reductase transmembra...    246   8e-77    
gb|EEC77699.1|  hypothetical protein OsI_16769                          245   2e-75    Oryza sativa Indica Group [Indian rice]
tpg|DAA36686.1|  TPA: hypothetical protein ZEAMMB73_743413              245   4e-75    
gb|ACN40160.1|  unknown                                                 242   9e-75    Picea sitchensis
ref|NP_001136673.1|  uncharacterized protein LOC100216802               242   2e-74    Zea mays [maize]
gb|ABK26244.1|  unknown                                                 242   2e-74    Picea sitchensis
gb|ACG44499.1|  cytochrome b561                                         241   2e-74    Zea mays [maize]
gb|ABK25854.1|  unknown                                                 241   3e-74    Picea sitchensis
ref|XP_010235771.1|  PREDICTED: probable ascorbate-specific trans...    236   6e-73    
gb|AFW72528.1|  hypothetical protein ZEAMMB73_083654                    234   3e-72    
emb|CAB64376.2|  putative cytochrome B 561                              234   7e-72    Craterostigma plantagineum
ref|XP_002464409.1|  hypothetical protein SORBIDRAFT_01g017730          234   2e-71    Sorghum bicolor [broomcorn]
gb|EAY79128.1|  hypothetical protein OsI_34235                          233   5e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001065002.1|  Os10g0504200                                       232   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652569.1|  PREDICTED: probable ascorbate-specific trans...    231   4e-70    
ref|XP_002967611.1|  hypothetical protein SELMODRAFT_88335              229   2e-69    
ref|XP_003574161.1|  PREDICTED: probable ascorbate-specific trans...    228   4e-69    
ref|XP_007152286.1|  hypothetical protein PHAVU_004G116800g             226   2e-68    
ref|XP_002981734.1|  hypothetical protein SELMODRAFT_233794             226   4e-68    
gb|ACG35739.1|  cytochrome b561                                         223   1e-67    Zea mays [maize]
dbj|BAD26572.1|  cytochrome b561                                        221   2e-67    Citrullus lanatus [wild melon]
ref|XP_008378265.1|  PREDICTED: transmembrane ascorbate ferriredu...    225   2e-67    
gb|EEE61401.1|  hypothetical protein OsJ_15584                          225   1e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002488860.1|  hypothetical protein SORBIDRAFT_3247s002010        219   1e-65    Sorghum bicolor [broomcorn]
dbj|BAK07054.1|  predicted protein                                      212   1e-62    
ref|XP_010032611.1|  PREDICTED: probable transmembrane ascorbate ...    208   2e-61    
ref|XP_008679491.1|  PREDICTED: probable ascorbate-specific trans...    207   5e-61    
ref|XP_007033344.1|  Cytochrome B561-1 isoform 1                        206   1e-60    
gb|ABK22502.1|  unknown                                                 205   4e-60    Picea sitchensis
ref|XP_010924199.1|  PREDICTED: probable transmembrane ascorbate ...    204   5e-60    
gb|KHG00377.1|  putative transmembrane ascorbate ferrireductase 2...    205   6e-60    
ref|XP_010924200.1|  PREDICTED: probable transmembrane ascorbate ...    204   6e-60    
emb|CDP02400.1|  unnamed protein product                                203   1e-59    
gb|EMS57351.1|  Cytochrome b reductase 1                                202   3e-59    
ref|XP_008775288.1|  PREDICTED: probable transmembrane ascorbate ...    202   5e-59    
ref|XP_011012662.1|  PREDICTED: probable transmembrane ascorbate ...    202   5e-59    
ref|XP_008775287.1|  PREDICTED: probable transmembrane ascorbate ...    202   6e-59    
ref|XP_004233407.1|  PREDICTED: probable transmembrane ascorbate ...    201   1e-58    
ref|XP_002305954.2|  hypothetical protein POPTR_0004s10360g             200   3e-58    Populus trichocarpa [western balsam poplar]
emb|CAN62730.1|  hypothetical protein VITISV_001339                     200   3e-58    Vitis vinifera
gb|KDP32926.1|  hypothetical protein JCGZ_12957                         200   3e-58    
ref|XP_010924962.1|  PREDICTED: probable transmembrane ascorbate ...    200   3e-58    
ref|XP_010924953.1|  PREDICTED: probable transmembrane ascorbate ...    200   3e-58    
ref|XP_009416757.1|  PREDICTED: probable transmembrane ascorbate ...    200   4e-58    
ref|XP_002283161.1|  PREDICTED: probable transmembrane ascorbate ...    201   4e-58    Vitis vinifera
ref|XP_009395542.1|  PREDICTED: probable transmembrane ascorbate ...    201   4e-58    
ref|XP_006373463.1|  hypothetical protein POPTR_0017s14010g             199   7e-58    
gb|AFK36991.1|  unknown                                                 196   9e-58    
ref|XP_010262598.1|  PREDICTED: probable transmembrane ascorbate ...    198   1e-57    
gb|KDP29352.1|  hypothetical protein JCGZ_18273                         199   1e-57    
ref|XP_010097840.1|  putative transmembrane ascorbate ferrireduct...    199   2e-57    
ref|XP_010029474.1|  PREDICTED: probable transmembrane ascorbate ...    198   2e-57    
ref|XP_006482300.1|  PREDICTED: probable transmembrane ascorbate ...    197   4e-57    
ref|XP_006430824.1|  hypothetical protein CICLE_v10012646mg             197   6e-57    
gb|KCW56404.1|  hypothetical protein EUGRSUZ_I02130                     199   7e-57    
ref|XP_002525965.1|  cytochrome B561, putative                          196   8e-57    Ricinus communis
ref|XP_006344832.1|  PREDICTED: probable transmembrane ascorbate ...    196   1e-56    
gb|KCW56403.1|  hypothetical protein EUGRSUZ_I02130                     199   1e-56    
ref|XP_011021197.1|  PREDICTED: probable transmembrane ascorbate ...    196   1e-56    
gb|ADE77752.1|  unknown                                                 196   2e-56    
gb|KCW56402.1|  hypothetical protein EUGRSUZ_I02130                     199   2e-56    
ref|XP_010271183.1|  PREDICTED: probable transmembrane ascorbate ...    194   3e-56    
ref|XP_010692471.1|  PREDICTED: probable transmembrane ascorbate ...    195   3e-56    
ref|XP_004306029.1|  PREDICTED: probable transmembrane ascorbate ...    196   3e-56    
gb|EPS73361.1|  hypothetical protein M569_01396                         195   3e-56    
ref|XP_009357027.1|  PREDICTED: probable transmembrane ascorbate ...    194   5e-56    
ref|XP_006828023.1|  hypothetical protein AMTR_s00008p00250900          194   5e-56    
ref|XP_008230380.1|  PREDICTED: probable transmembrane ascorbate ...    194   8e-56    
gb|EYU44300.1|  hypothetical protein MIMGU_mgv1a013024mg                194   8e-56    
ref|XP_008341861.1|  PREDICTED: probable transmembrane ascorbate ...    194   9e-56    
ref|XP_008379502.1|  PREDICTED: probable transmembrane ascorbate ...    194   1e-55    
ref|XP_009371014.1|  PREDICTED: probable transmembrane ascorbate ...    193   1e-55    
ref|XP_007215912.1|  hypothetical protein PRUPE_ppa010828mg             192   2e-55    
dbj|BAE46407.1|  cytochrome b561                                        192   2e-55    Citrullus lanatus [wild melon]
ref|XP_007151758.1|  hypothetical protein PHAVU_004G072300g             192   3e-55    
ref|XP_004141495.1|  PREDICTED: probable transmembrane ascorbate ...    192   4e-55    
ref|XP_008459454.1|  PREDICTED: probable transmembrane ascorbate ...    191   8e-55    
ref|NP_001060763.1|  Os08g0101700                                       191   1e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003638361.1|  Cytochrome b reductase                             187   2e-54    
ref|XP_003555094.1|  PREDICTED: probable transmembrane ascorbate ...    190   3e-54    
ref|XP_009623679.1|  PREDICTED: probable transmembrane ascorbate ...    190   3e-54    
ref|XP_004513358.1|  PREDICTED: probable transmembrane ascorbate ...    189   5e-54    
ref|XP_010435775.1|  PREDICTED: probable transmembrane ascorbate ...    187   2e-53    
ref|XP_009774999.1|  PREDICTED: probable transmembrane ascorbate ...    187   4e-53    
ref|XP_006405734.1|  hypothetical protein EUTSA_v10027908mg             186   5e-53    
emb|CDX74514.1|  BnaA04g08750D                                          186   7e-53    
ref|XP_009139798.1|  PREDICTED: probable transmembrane ascorbate ...    186   7e-53    
ref|XP_011030107.1|  PREDICTED: transmembrane ascorbate ferriredu...    185   7e-53    
dbj|BAK02812.1|  predicted protein                                      186   8e-53    
ref|XP_011030105.1|  PREDICTED: uncharacterized protein LOC105129...    187   8e-53    
emb|CDY01648.1|  BnaC04g31040D                                          186   9e-53    
ref|XP_003574424.1|  PREDICTED: probable transmembrane ascorbate ...    184   3e-52    
gb|KFK33241.1|  hypothetical protein AALP_AA6G348500                    184   3e-52    
ref|NP_198679.1|  probable transmembrane ascorbate ferrireductase 2     184   3e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870832.1|  hypothetical protein ARALYDRAFT_916464             184   5e-52    
ref|XP_006284470.1|  hypothetical protein CARUB_v10005654mg             184   6e-52    
ref|XP_010105549.1|  putative transmembrane ascorbate ferrireduct...    182   1e-51    
ref|XP_008343726.1|  PREDICTED: transmembrane ascorbate ferriredu...    180   1e-51    
ref|XP_002978638.1|  hypothetical protein SELMODRAFT_109639             183   2e-51    
ref|XP_009395543.1|  PREDICTED: probable transmembrane ascorbate ...    181   4e-51    
ref|XP_004514369.1|  PREDICTED: probable transmembrane ascorbate ...    181   5e-51    
gb|KCW52026.1|  hypothetical protein EUGRSUZ_J01463                     180   5e-51    
ref|XP_004973300.1|  PREDICTED: probable transmembrane ascorbate ...    181   6e-51    
ref|XP_006659365.1|  PREDICTED: probable transmembrane ascorbate ...    181   7e-51    
ref|XP_010066551.1|  PREDICTED: probable ascorbate-specific trans...    180   9e-51    
ref|XP_003637054.1|  Cytochrome b561                                    179   2e-50    
gb|EAZ06841.1|  hypothetical protein OsI_29077                          179   3e-50    Oryza sativa Indica Group [Indian rice]
dbj|BAD05824.1|  putative cytochrome b-561                              179   3e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364056.1|  PREDICTED: probable ascorbate-specific trans...    179   3e-50    
ref|XP_003555842.1|  PREDICTED: probable ascorbate-specific trans...    178   6e-50    
gb|EYU45963.1|  hypothetical protein MIMGU_mgv1a013302mg                178   7e-50    
ref|XP_011099288.1|  PREDICTED: probable transmembrane ascorbate ...    178   7e-50    
ref|XP_002444276.1|  hypothetical protein SORBIDRAFT_07g019370          177   2e-49    Sorghum bicolor [broomcorn]
ref|XP_004228748.1|  PREDICTED: probable ascorbate-specific trans...    177   2e-49    
ref|XP_004142327.1|  PREDICTED: transmembrane ascorbate ferriredu...    176   5e-49    
ref|XP_006659727.1|  PREDICTED: ascorbate-specific transmembrane ...    176   7e-49    
ref|XP_004169141.1|  PREDICTED: probable transmembrane ascorbate ...    175   8e-49    
ref|XP_004142817.1|  PREDICTED: probable transmembrane ascorbate ...    175   8e-49    
gb|KEH40688.1|  eukaryotic cytochrome b561 protein                      174   2e-48    
ref|XP_009351583.1|  PREDICTED: probable transmembrane ascorbate ...    174   3e-48    
gb|KEH40690.1|  transmembrane ascorbate ferrireductase                  172   7e-48    
ref|XP_009802978.1|  PREDICTED: probable ascorbate-specific trans...    172   7e-48    
ref|XP_009611647.1|  PREDICTED: probable ascorbate-specific trans...    172   9e-48    
ref|NP_001141146.1|  uncharacterized protein LOC100273232               172   1e-47    Zea mays [maize]
ref|XP_006469332.1|  PREDICTED: probable ascorbate-specific trans...    172   1e-47    
gb|EYU30174.1|  hypothetical protein MIMGU_mgv1a013281mg                171   2e-47    
emb|CDP05494.1|  unnamed protein product                                171   2e-47    
ref|XP_010528463.1|  PREDICTED: probable transmembrane ascorbate ...    171   3e-47    
gb|ABK25459.1|  unknown                                                 169   3e-47    Picea sitchensis
ref|XP_011021733.1|  PREDICTED: probable transmembrane ascorbate ...    171   4e-47    
ref|XP_008365813.1|  PREDICTED: probable transmembrane ascorbate ...    171   4e-47    
ref|XP_008466953.1|  PREDICTED: probable transmembrane ascorbate ...    171   4e-47    
ref|XP_002281627.1|  PREDICTED: probable ascorbate-specific trans...    170   5e-47    Vitis vinifera
ref|XP_002281620.1|  PREDICTED: probable ascorbate-specific trans...    171   6e-47    Vitis vinifera
gb|ACG32872.1|  cytochrome b561                                         171   7e-47    Zea mays [maize]
ref|XP_004298488.1|  PREDICTED: probable transmembrane ascorbate ...    170   8e-47    
ref|XP_006448096.1|  hypothetical protein CICLE_v10016590mg             170   9e-47    
ref|XP_002311430.2|  hypothetical protein POPTR_0008s11430g             170   1e-46    Populus trichocarpa [western balsam poplar]
ref|XP_010692475.1|  PREDICTED: probable transmembrane ascorbate ...    169   2e-46    
ref|XP_002984576.1|  hypothetical protein SELMODRAFT_17233              167   2e-46    
ref|XP_002312480.1|  cytochrome B561 family protein                     169   2e-46    Populus trichocarpa [western balsam poplar]
ref|XP_011070533.1|  PREDICTED: probable transmembrane ascorbate ...    169   2e-46    
ref|XP_003529234.1|  PREDICTED: probable transmembrane ascorbate ...    168   3e-46    
ref|XP_011028017.1|  PREDICTED: uncharacterized protein LOC105128167    176   4e-46    
ref|XP_002314762.1|  hypothetical protein POPTR_0010s11290g             168   5e-46    Populus trichocarpa [western balsam poplar]
emb|CDP05495.1|  unnamed protein product                                166   3e-45    
ref|XP_003638756.1|  Cytochrome b reductase                             165   4e-45    
ref|XP_004504584.1|  PREDICTED: probable transmembrane ascorbate ...    165   4e-45    
ref|XP_006828025.1|  hypothetical protein AMTR_s00008p00251350          165   4e-45    
ref|XP_006828024.1|  hypothetical protein AMTR_s00008p00251170          165   5e-45    
ref|XP_010043930.1|  PREDICTED: probable transmembrane ascorbate ...    165   7e-45    
ref|XP_011085553.1|  PREDICTED: probable transmembrane ascorbate ...    165   8e-45    
gb|AFK35228.1|  unknown                                                 164   1e-44    
ref|XP_007153191.1|  hypothetical protein PHAVU_003G014500g             164   1e-44    
ref|XP_002312479.1|  hypothetical protein POPTR_0008s13760g             163   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_006364079.1|  PREDICTED: probable transmembrane ascorbate ...    163   3e-44    
ref|XP_007045474.1|  Cytochrome b561/ferric reductase transmembra...    163   3e-44    
ref|XP_004228747.1|  PREDICTED: probable transmembrane ascorbate ...    163   4e-44    
ref|XP_007227148.1|  hypothetical protein PRUPE_ppa026406mg             162   6e-44    
ref|XP_011024563.1|  PREDICTED: probable transmembrane ascorbate ...    162   7e-44    
ref|XP_008220939.1|  PREDICTED: probable transmembrane ascorbate ...    162   1e-43    
gb|ACN28843.1|  unknown                                                 159   1e-43    Zea mays [maize]
emb|CBI26788.3|  unnamed protein product                                160   2e-43    
ref|XP_002285137.1|  PREDICTED: probable transmembrane ascorbate ...    160   3e-43    Vitis vinifera
ref|XP_001775585.1|  predicted protein                                  160   4e-43    
ref|XP_004983432.1|  PREDICTED: probable ascorbate-specific trans...    160   5e-43    
gb|KCW52027.1|  hypothetical protein EUGRSUZ_J01463                     159   8e-43    
ref|XP_011028106.1|  PREDICTED: probable ascorbate-specific trans...    159   9e-43    
gb|KDP38167.1|  hypothetical protein JCGZ_04810                         159   1e-42    
gb|EMS60988.1|  Cytochrome b561                                         158   1e-42    
ref|XP_009589416.1|  PREDICTED: probable ascorbate-specific trans...    159   2e-42    
ref|XP_010939997.1|  PREDICTED: probable ascorbate-specific trans...    158   2e-42    
gb|EYU39371.1|  hypothetical protein MIMGU_mgv1a013194mg                158   2e-42    
ref|XP_002527546.1|  cytochrome B561, putative                          158   3e-42    Ricinus communis
gb|KHF98707.1|  putative transmembrane ascorbate ferrireductase 3...    157   4e-42    
ref|XP_007215911.1|  hypothetical protein PRUPE_ppa010828mg             155   6e-42    
ref|XP_007033346.1|  Cytochrome B561-1 isoform 3                        154   1e-41    
ref|XP_007033345.1|  Cytochrome B561-1 isoform 2                        154   2e-41    
ref|XP_007158789.1|  hypothetical protein PHAVU_002G182100g             154   7e-41    
ref|XP_002524392.1|  cytochrome B561, putative                          158   2e-40    
ref|XP_010435776.1|  PREDICTED: probable transmembrane ascorbate ...    152   2e-40    
ref|XP_009380071.1|  PREDICTED: probable ascorbate-specific trans...    153   2e-40    
ref|XP_008389144.1|  PREDICTED: probable transmembrane ascorbate ...    153   2e-40    
gb|KDP38166.1|  hypothetical protein JCGZ_04809                         153   2e-40    
ref|XP_004513927.1|  PREDICTED: probable ascorbate-specific trans...    152   3e-40    
ref|XP_010553517.1|  PREDICTED: probable transmembrane ascorbate ...    152   3e-40    
ref|XP_009619946.1|  PREDICTED: probable transmembrane ascorbate ...    152   5e-40    
dbj|BAJ99969.1|  predicted protein                                      152   7e-40    
ref|XP_010234230.1|  PREDICTED: probable ascorbate-specific trans...    151   1e-39    
ref|NP_001235966.1|  uncharacterized protein LOC100305990               150   2e-39    
ref|XP_006416978.1|  hypothetical protein EUTSA_v10008705mg             150   2e-39    
ref|XP_002527545.1|  cytochrome B561, putative                          150   2e-39    
gb|KFK43719.1|  hypothetical protein AALP_AA1G164000                    150   3e-39    
ref|XP_006849752.1|  hypothetical protein AMTR_s00024p00250430          148   4e-39    
ref|XP_007223498.1|  hypothetical protein PRUPE_ppa011790mg             148   5e-39    
emb|CDY41099.1|  BnaC05g10900D                                          149   8e-39    
ref|XP_008365817.1|  PREDICTED: probable ascorbate-specific trans...    148   1e-38    
ref|XP_009778204.1|  PREDICTED: transmembrane ascorbate ferriredu...    146   1e-38    
gb|KDO58932.1|  hypothetical protein CISIN_1g0268681mg                  146   1e-38    
ref|XP_002890073.1|  hypothetical protein ARALYDRAFT_471660             148   2e-38    
ref|XP_006430823.1|  hypothetical protein CICLE_v10012646mg             146   2e-38    
ref|XP_002464798.1|  hypothetical protein SORBIDRAFT_01g026870          147   2e-38    
ref|XP_010683561.1|  PREDICTED: probable transmembrane ascorbate ...    147   3e-38    
ref|NP_172926.2|  probable transmembrane ascorbate ferrireductase 3     147   3e-38    
ref|XP_008799074.1|  PREDICTED: probable ascorbate-specific trans...    147   4e-38    
ref|XP_008643983.1|  PREDICTED: uncharacterized protein LOC100382...    148   6e-38    
emb|CDY45283.1|  BnaA06g09530D                                          146   6e-38    
ref|XP_004298489.1|  PREDICTED: probable ascorbate-specific trans...    146   7e-38    
ref|XP_002595114.1|  hypothetical protein BRAFLDRAFT_90224              147   1e-37    
ref|XP_009761784.1|  PREDICTED: probable transmembrane ascorbate ...    146   1e-37    
ref|XP_009117878.1|  PREDICTED: probable transmembrane ascorbate ...    145   1e-37    
gb|KGN49679.1|  hypothetical protein Csa_5G059150                       144   1e-37    
emb|CDX81667.1|  BnaC08g39340D                                          145   1e-37    
ref|XP_006305605.1|  hypothetical protein CARUB_v10010271mg             144   3e-37    
ref|XP_008844828.1|  PREDICTED: cytochrome b561                         145   3e-37    
ref|NP_001100526.1|  cytochrome b-561                                   145   4e-37    
gb|EYU40852.1|  hypothetical protein MIMGU_mgv1a013028mg                144   4e-37    
gb|AAD11424.1|  cytochrome                                              143   5e-37    
ref|XP_010635812.1|  PREDICTED: cytochrome b561 isoform X1              145   5e-37    
ref|XP_010635817.1|  PREDICTED: cytochrome b561 isoform X3              145   6e-37    
ref|XP_010635816.1|  PREDICTED: cytochrome b561 isoform X2              145   6e-37    
ref|XP_004981976.1|  PREDICTED: probable transmembrane ascorbate ...    144   7e-37    
dbj|BAC26117.1|  unnamed protein product                                144   8e-37    
ref|XP_010066756.1|  PREDICTED: probable transmembrane ascorbate ...    144   1e-36    
ref|NP_031831.2|  cytochrome b561                                       144   1e-36    
ref|XP_003466022.2|  PREDICTED: cytochrome b561-like isoform X1         144   1e-36    
ref|XP_006661611.1|  PREDICTED: probable ascorbate-specific trans...    143   1e-36    
ref|XP_006532192.1|  PREDICTED: cytochrome b561 isoform X1              144   1e-36    
ref|XP_006970581.1|  PREDICTED: cytochrome b561-like                    144   1e-36    
ref|NP_001064060.1|  Os10g0118800                                       142   2e-36    
ref|XP_002466565.1|  hypothetical protein SORBIDRAFT_01g010100          142   2e-36    
ref|XP_009148856.1|  PREDICTED: probable transmembrane ascorbate ...    142   3e-36    
ref|XP_005328241.1|  PREDICTED: cytochrome b561-like                    142   3e-36    
ref|XP_007527715.1|  PREDICTED: cytochrome b561                         142   3e-36    
gb|EDL34247.1|  cytochrome b-561, isoform CRA_a                         143   4e-36    
gb|KCW64462.1|  hypothetical protein EUGRSUZ_G02076                     139   4e-36    
ref|XP_003503018.1|  PREDICTED: cytochrome b561                         142   4e-36    
ref|XP_004374295.1|  PREDICTED: cytochrome b561-like                    142   5e-36    
ref|XP_005369474.1|  PREDICTED: cytochrome b561-like isoform X1         142   5e-36    
ref|XP_009781198.1|  PREDICTED: probable transmembrane ascorbate ...    141   5e-36    
ref|XP_007957939.1|  PREDICTED: cytochrome b561                         142   6e-36    
ref|XP_853258.1|  PREDICTED: cytochrome b561 isoform X2                 142   6e-36    
ref|XP_010458985.1|  PREDICTED: probable transmembrane ascorbate ...    141   6e-36    
gb|AAA65643.1|  cytochrome B561                                         142   6e-36    
gb|KHN05848.1|  Putative transmembrane ascorbate ferrireductase 4       141   6e-36    
ref|XP_010476542.1|  PREDICTED: probable transmembrane ascorbate ...    141   6e-36    
ref|XP_010320786.1|  PREDICTED: probable transmembrane ascorbate ...    141   7e-36    
ref|XP_007061948.1|  PREDICTED: cytochrome b561-like                    142   7e-36    
gb|EDL34248.1|  cytochrome b-561, isoform CRA_b                         143   7e-36    
ref|XP_003614405.1|  Cytochrome b reductase                             141   8e-36    
ref|XP_006362522.1|  PREDICTED: probable transmembrane ascorbate ...    141   8e-36    
ref|XP_010681404.1|  PREDICTED: probable transmembrane ascorbate ...    141   9e-36    
ref|XP_003559495.1|  PREDICTED: probable transmembrane ascorbate ...    140   1e-35    
ref|NP_001237101.1|  uncharacterized protein LOC100527512               141   1e-35    
ref|XP_009597394.1|  PREDICTED: probable transmembrane ascorbate ...    141   1e-35    
ref|XP_005309685.1|  PREDICTED: cytochrome b561                         141   1e-35    
ref|XP_005668733.1|  PREDICTED: cytochrome b561 isoform X1              140   2e-35    
ref|NP_001090991.1|  cytochrome b561                                    140   3e-35    
ref|XP_004891581.1|  PREDICTED: cytochrome b561-like isoform X1         140   3e-35    
ref|XP_004432685.1|  PREDICTED: cytochrome b561-like                    140   3e-35    
ref|XP_001776753.1|  predicted protein                                  139   4e-35    
ref|XP_005070090.1|  PREDICTED: cytochrome b561-like                    140   4e-35    
gb|EMT20988.1|  Cytochrome b reductase 1                                138   4e-35    
ref|XP_004868648.1|  PREDICTED: cytochrome b561-like isoform X1         140   5e-35    
gb|EMT16658.1|  Cytochrome b561                                         138   6e-35    
ref|XP_004516789.1|  PREDICTED: probable transmembrane ascorbate ...    138   9e-35    
gb|AFK40290.1|  unknown                                                 138   9e-35    
ref|XP_006813966.1|  PREDICTED: cytochrome b561-like                    138   1e-34    
ref|XP_006833622.1|  PREDICTED: cytochrome b561-like                    139   1e-34    
ref|XP_004297148.1|  PREDICTED: probable transmembrane ascorbate ...    138   1e-34    
ref|NP_001125175.1|  cytochrome b561                                    138   1e-34    
ref|XP_004749271.1|  PREDICTED: cytochrome b561-like isoform X5         139   1e-34    
ref|XP_008454856.1|  PREDICTED: transmembrane ascorbate ferriredu...    135   1e-34    
ref|XP_004749272.1|  PREDICTED: cytochrome b561-like isoform X6         138   1e-34    
ref|XP_004749270.1|  PREDICTED: cytochrome b561-like isoform X4         139   1e-34    
ref|XP_007456814.1|  PREDICTED: cytochrome b561-like                    138   1e-34    
ref|XP_008530918.1|  PREDICTED: cytochrome b561 isoform X1              139   1e-34    
ref|XP_008530919.1|  PREDICTED: cytochrome b561 isoform X2              138   1e-34    
gb|KFM56650.1|  Cytochrome b561                                         139   1e-34    
ref|XP_010954302.1|  PREDICTED: cytochrome b561                         138   2e-34    
ref|XP_004749267.1|  PREDICTED: cytochrome b561-like isoform X1         139   2e-34    
ref|XP_004749269.1|  PREDICTED: cytochrome b561-like isoform X3         139   2e-34    
ref|XP_006044195.1|  PREDICTED: cytochrome b561-like isoform X2         138   2e-34    
ref|XP_003315719.1|  PREDICTED: cytochrome b561 isoform X2              138   2e-34    
ref|XP_005220876.1|  PREDICTED: cytochrome b561 isoform X1              138   2e-34    
ref|XP_003414367.1|  PREDICTED: cytochrome b561                         138   2e-34    
ref|XP_003913308.1|  PREDICTED: cytochrome b561                         137   2e-34    
gb|EHH25095.1|  hypothetical protein EGK_08857                          137   2e-34    
ref|XP_005597348.1|  PREDICTED: cytochrome b561-like isoform X2         138   2e-34    
ref|XP_001495680.3|  PREDICTED: cytochrome b561-like isoform X1         137   2e-34    
ref|XP_009368766.1|  PREDICTED: probable ascorbate-specific trans...    136   3e-34    
ref|XP_006044194.1|  PREDICTED: cytochrome b561-like isoform X1         138   3e-34    
ref|NP_001087259.1|  cytochrome b561                                    137   3e-34    
ref|XP_011077352.1|  PREDICTED: probable transmembrane ascorbate ...    137   3e-34    
ref|XP_004326650.1|  PREDICTED: cytochrome b561-like                    137   4e-34    
ref|XP_005257149.1|  PREDICTED: cytochrome b561 isoform X3              136   4e-34    
dbj|BAH13913.1|  unnamed protein product                                136   4e-34    
ref|NP_777262.1|  cytochrome b561                                       137   4e-34    
ref|XP_009336637.1|  PREDICTED: probable transmembrane ascorbate ...    137   4e-34    
gb|AFK43807.1|  unknown                                                 137   4e-34    
ref|XP_003997090.1|  PREDICTED: cytochrome b561-like                    137   5e-34    
ref|XP_007153192.1|  hypothetical protein PHAVU_003G014600g             136   5e-34    
ref|XP_010093380.1|  putative transmembrane ascorbate ferrireduct...    136   5e-34    
ref|XP_010378372.1|  PREDICTED: cytochrome b561                         136   6e-34    
ref|XP_004041193.1|  PREDICTED: cytochrome b561-like                    137   6e-34    
ref|XP_004275708.1|  PREDICTED: cytochrome b561-like                    136   6e-34    
ref|XP_004041190.1|  PREDICTED: cytochrome b561-like                    136   6e-34    
ref|NP_001906.3|  cytochrome b561                                       136   6e-34    
gb|AAH02976.1|  Cytochrome b-561                                        136   7e-34    
gb|AAP36815.1|  Homo sapiens cytochrome b-561                           136   8e-34    
ref|XP_003419541.1|  PREDICTED: cytochrome b ascorbate-dependent ...    136   8e-34    
ref|XP_003339345.1|  PREDICTED: cytochrome b561 isoform X1              137   8e-34    
ref|XP_004630213.1|  PREDICTED: cytochrome b561-like                    139   1e-33    
gb|AAA50952.1|  HCYTO B561                                              135   1e-33    
gb|AAC50212.1|  cytochrome b561                                         136   1e-33    
ref|XP_006304925.1|  hypothetical protein CARUB_v10012001mg             135   1e-33    
ref|XP_006638194.1|  PREDICTED: cytochrome b561-like                    136   1e-33    
ref|XP_006017890.1|  PREDICTED: cytochrome b561-like                    136   1e-33    
ref|NP_001272215.1|  uncharacterized protein LOC102126833               135   1e-33    
ref|XP_006721790.1|  PREDICTED: cytochrome b561 isoform X4              135   1e-33    
ref|XP_008787976.1|  PREDICTED: probable ascorbate-specific trans...    135   1e-33    
ref|XP_008389322.1|  PREDICTED: probable transmembrane ascorbate ...    135   1e-33    
ref|XP_004041196.1|  PREDICTED: cytochrome b561-like                    136   1e-33    
ref|XP_002315965.2|  cytochrome B561 family protein                     135   1e-33    
ref|XP_003516860.1|  PREDICTED: probable transmembrane ascorbate ...    135   1e-33    
ref|XP_008243157.1|  PREDICTED: probable transmembrane ascorbate ...    135   1e-33    
ref|XP_006146876.1|  PREDICTED: cytochrome b561-like isoform X1         135   2e-33    
ref|XP_006912390.1|  PREDICTED: cytochrome b561-like                    135   2e-33    
gb|AFK37090.1|  unknown                                                 133   2e-33    
ref|XP_003786260.1|  PREDICTED: cytochrome b561-like                    135   2e-33    
gb|EHH58239.1|  hypothetical protein EGM_08042                          135   2e-33    
ref|XP_011008725.1|  PREDICTED: probable transmembrane ascorbate ...    135   2e-33    
ref|XP_007905533.1|  PREDICTED: cytochrome b561                         135   2e-33    
emb|CDP00561.1|  unnamed protein product                                135   2e-33    
ref|XP_008293597.1|  PREDICTED: cytochrome b561                         135   2e-33    
gb|AAI62523.1|  Similar to cytochrome b561                              135   2e-33    
ref|XP_004041191.1|  PREDICTED: cytochrome b561-like                    136   3e-33    
ref|XP_008569357.1|  PREDICTED: cytochrome b561                         135   3e-33    
ref|NP_001177665.1|  cytochrome b561                                    134   3e-33    
ref|XP_004456863.1|  PREDICTED: cytochrome b561-like isoform 1          135   3e-33    
ref|NP_001122216.2|  cytochrome b561                                    135   3e-33    
ref|XP_007153326.1|  hypothetical protein PHAVU_003G025900g             134   3e-33    
ref|NP_001047555.1|  Os02g0642300                                       130   3e-33    
ref|XP_002426701.1|  Cytochrome b561, putative                          134   4e-33    
ref|XP_010477915.1|  PREDICTED: probable transmembrane ascorbate ...    134   4e-33    
ref|XP_010460366.1|  PREDICTED: probable transmembrane ascorbate ...    134   4e-33    
ref|XP_004707322.1|  PREDICTED: cytochrome b561-like                    134   4e-33    
ref|XP_004041192.1|  PREDICTED: cytochrome b561-like                    136   4e-33    
ref|XP_010265300.1|  PREDICTED: probable transmembrane ascorbate ...    134   4e-33    
ref|XP_008147670.1|  PREDICTED: cytochrome b561 isoform X3              134   4e-33    
dbj|BAH11829.1|  unnamed protein product                                136   4e-33    
ref|XP_005257147.1|  PREDICTED: cytochrome b561 isoform X1              136   4e-33    
ref|XP_008010371.1|  PREDICTED: cytochrome b561 isoform X3              134   5e-33    
ref|XP_006897858.1|  PREDICTED: cytochrome b561-like                    134   5e-33    
ref|XP_006776792.1|  PREDICTED: cytochrome b561-like                    134   5e-33    
gb|KHG22144.1|  putative transmembrane ascorbate ferrireductase 4...    134   5e-33    
ref|XP_008147668.1|  PREDICTED: cytochrome b561 isoform X2              134   5e-33    
ref|XP_002719514.1|  PREDICTED: cytochrome b561                         134   5e-33    
ref|XP_008147667.1|  PREDICTED: cytochrome b561 isoform X1              134   6e-33    
ref|NP_001173617.1|  Os03g0717200                                       133   7e-33    
ref|XP_007223757.1|  hypothetical protein PRUPE_ppa010555mg             133   7e-33    
ref|XP_010499084.1|  PREDICTED: probable transmembrane ascorbate ...    133   8e-33    
ref|XP_010936901.1|  PREDICTED: probable ascorbate-specific trans...    132   9e-33    
ref|XP_004071917.1|  PREDICTED: cytochrome b561-like                    133   9e-33    
ref|XP_797543.1|  PREDICTED: cytochrome b561-like                       133   1e-32    
ref|XP_007433211.1|  PREDICTED: cytochrome b561-like isoform X1         133   1e-32    
gb|KDP29351.1|  hypothetical protein JCGZ_18272                         133   1e-32    
ref|XP_004072829.1|  PREDICTED: cytochrome b ascorbate-dependent ...    134   1e-32    
ref|XP_006092234.1|  PREDICTED: cytochrome b561-like isoform X3         133   1e-32    
ref|XP_008413213.1|  PREDICTED: cytochrome b561                         132   2e-32    
ref|XP_006000378.1|  PREDICTED: cytochrome b561-like isoform X1         132   2e-32    
ref|XP_009527107.1|  hypothetical protein PHYSODRAFT_261288             133   2e-32    
ref|XP_004405946.1|  PREDICTED: cytochrome b561-like                    132   2e-32    
ref|XP_007565526.1|  PREDICTED: cytochrome b561                         132   2e-32    
ref|XP_005858684.1|  PREDICTED: cytochrome b561-like isoform X4         133   2e-32    
gb|EPQ02956.1|  Cytochrome b561                                         133   2e-32    
ref|XP_006271634.1|  PREDICTED: cytochrome b561-like                    132   2e-32    
ref|XP_008995117.1|  PREDICTED: cytochrome b561 isoform X2              132   2e-32    
ref|NP_958739.1|  cytochrome b ascorbate-dependent protein 3 isof...    132   3e-32    
ref|XP_003614406.1|  Cytochrome b reductase                             130   3e-32    
ref|XP_008498665.1|  PREDICTED: cytochrome b ascorbate-dependent ...    132   3e-32    
ref|XP_002890679.1|  cytochrome B561 family protein                     131   3e-32    
ref|XP_003768533.1|  PREDICTED: cytochrome b561-like                    132   3e-32    
ref|XP_003747797.1|  PREDICTED: cytochrome b561-like                    132   3e-32    
ref|NP_001268994.1|  cytochrome b ascorbate-dependent protein 3 i...    132   4e-32    
gb|KFP05966.1|  Cytochrome b ascorbate-dependent protein 3              131   4e-32    
ref|XP_006484396.1|  PREDICTED: probable transmembrane ascorbate ...    131   4e-32    
ref|XP_005369698.1|  PREDICTED: cytochrome b ascorbate-dependent ...    131   4e-32    
ref|XP_004896130.1|  PREDICTED: cytochrome b reductase 1-like           132   5e-32    
gb|EDL41367.1|  cytochrome b, ascorbate dependent 3, isoform CRA_a      132   5e-32    
ref|XP_002281093.1|  PREDICTED: probable transmembrane ascorbate ...    131   5e-32    
dbj|BAE20585.1|  unnamed protein product                                131   5e-32    
ref|NP_173935.1|  probable transmembrane ascorbate ferric reducta...    130   5e-32    
ref|XP_008010367.1|  PREDICTED: cytochrome b561 isoform X1              132   5e-32    
ref|XP_006437753.1|  hypothetical protein CICLE_v10032628mg             130   6e-32    



>ref|XP_009778201.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Nicotiana 
sylvestris]
Length=231

 Score =   374 bits (959),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 211/230 (92%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA   KALPFS  AH +A+V A++VLVW+IHFRGGLAWE  NKNLIFN+HPVLMLIGF+I
Sbjct  1    MATGLKALPFSFGAHFLAVVAAIMVLVWSIHFRGGLAWEADNKNLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAIMSYKS PLKK+VKKVIHL+LHAIALVLGIVGICAAFKNHNES I NLYSLHSW+
Sbjct  61   LGGEAIMSYKSFPLKKQVKKVIHLILHAIALVLGIVGICAAFKNHNESNIPNLYSLHSWV  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFVVFFYPGG+A++RR+SLPWHVLFG FVY++AV NA LG LEKLT
Sbjct  121  GIGVIVLYGIQWIYGFVVFFYPGGSAEVRRDSLPWHVLFGMFVYVMAVGNACLGLLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE +GL KYGSEAFLVNFTAI+TV+YGVFVFLTILSQAPTEDD+SYSAI
Sbjct  181  FLEVNGLAKYGSEAFLVNFTAIATVLYGVFVFLTILSQAPTEDDYSYSAI  230



>ref|XP_009590952.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Nicotiana 
tomentosiformis]
Length=231

 Score =   372 bits (956),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 211/230 (92%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA   KALPFS  AH +ALV A++VLVW+IHFRGGLAWE  NKNLIFN+HPVLMLIGF+I
Sbjct  1    MATGLKALPFSFGAHFLALVAAIMVLVWSIHFRGGLAWEADNKNLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAIMSYKS PLKK+VKKVIHL+LHAIALVLGIVGICAAFKNHNES I N+YSLHSW+
Sbjct  61   LGGEAIMSYKSFPLKKQVKKVIHLILHAIALVLGIVGICAAFKNHNESNIPNMYSLHSWV  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV +LYGIQW+YGFVVFFYPGG+A++RR+SLPWHVLFG FVY++AV NA LG LEKLT
Sbjct  121  GIGVIILYGIQWIYGFVVFFYPGGSAEVRRDSLPWHVLFGMFVYVMAVGNACLGLLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE +GL KYGSEAFLVNFTAI+TV+YGVFVFLTILSQAPTEDD+SYSAI
Sbjct  181  FLEVNGLAKYGSEAFLVNFTAIATVLYGVFVFLTILSQAPTEDDYSYSAI  230



>dbj|BAE46406.1| cytochrome b561 [Citrullus lanatus]
Length=232

 Score =   339 bits (870),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 202/232 (87%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+A KA PF+ V+H +A+V  +LVLVW IHFRGGLAWE  NKNLIFN+HPVLML+G +I
Sbjct  1    MALAVKAFPFTVVSHVLAIVALILVLVWTIHFRGGLAWEAVNKNLIFNIHPVLMLLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPL+KEVKKVIHLVLH +AL LGIVGI AAFKNHNESGIANLYSLHSWI
Sbjct  61   IGGEAIISYKSLPLRKEVKKVIHLVLHGVALALGIVGIIAAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG+QWVYGFV FFYPGG+AD+RR SLPWHVLFG  +YILAV N+ LGFLEKLT
Sbjct  121  GIGVISLYGLQWVYGFVTFFYPGGSADLRRASLPWHVLFGITIYILAVGNSALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDH--SYSAI  220
            FLESSGL KYG+EAFLVNFTAI+TV++ +FV L+++SQ   ++D+   YSAI
Sbjct  181  FLESSGLAKYGTEAFLVNFTAITTVVFALFVILSVISQPCVQEDNHGDYSAI  232



>ref|XP_011076172.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Sesamum 
indicum]
Length=230

 Score =   337 bits (865),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  KALP S VAH + +V A+LVL+W I FRGGLAWE TNKNLIFNLHPVLMLIG +I
Sbjct  1    MAIGVKALPISFVAHFLGVVGAILVLIWCISFRGGLAWEATNKNLIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYK LPLKK  KK+IHLVLHA AL+LGI+GI  AFK HNES IANLYSLHSW+
Sbjct  61   IGGEAIMSYKCLPLKKPEKKLIHLVLHATALILGIIGIYMAFKFHNESNIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGF+VFF+PGGT  IR ESLPWHVLFG FVY+LAV  A LG+LEKLT
Sbjct  121  GIGVIVLYGIQWIYGFLVFFFPGGTTAIRSESLPWHVLFGIFVYVLAVGTATLGYLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE+SGL KYGSEAFLVNFTAI T+++G FV LTILSQAP ED++SYSAI
Sbjct  181  FLENSGLAKYGSEAFLVNFTAIITILFGTFVILTILSQAPPEDEYSYSAI  230



>ref|XP_008465873.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Cucumis 
melo]
Length=233

 Score =   336 bits (862),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 201/233 (86%), Gaps = 3/233 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+A KA P + V+H + +V  +LVLVW IHFRGGLAWE  NKNLIFN+HP LML+G ++
Sbjct  1    MALAVKAFPLTVVSHVVGIVAVILVLVWTIHFRGGLAWEAVNKNLIFNIHPFLMLLGLIV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPL+KEVKKVIHLVLH +ALVLGIVGI AAFKNHNESGIANLYSLHSWI
Sbjct  61   IGGEAIISYKSLPLRKEVKKVIHLVLHGVALVLGIVGIIAAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LY +QWVYGFV FFYPGG+AD+RR SLPWHV+FG  VYILAV N+ LGFLEKLT
Sbjct  121  GIGVISLYALQWVYGFVTFFYPGGSADLRRVSLPWHVVFGLTVYILAVGNSALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ--APTEDDH-SYSAI  220
            FLESSG+ KYG+EAFLVNFTAI+T+I+GVFV  +++SQ  A  EDDH +YSAI
Sbjct  181  FLESSGIPKYGTEAFLVNFTAITTIIFGVFVIFSVISQPCAQPEDDHGAYSAI  233



>ref|XP_009371327.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Pyrus 
x bretschneideri]
Length=232

 Score =   336 bits (862),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 200/232 (86%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALPF+ V H + +V  VLVLVWNIHFRGGLAWE TNKNLIFNLHPVLML+G + 
Sbjct  1    MALKVPALPFTFVVHTLGIVALVLVLVWNIHFRGGLAWESTNKNLIFNLHPVLMLLGLIF  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LP +KEVKKVIHLVLHA+AL LGI+GI  AFKNHNESGIANLYSLHSWI
Sbjct  61   LGGEAIVSYKALPFRKEVKKVIHLVLHALALGLGIIGIYLAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW+YGFV FFYPGG+  +R ES+PWHV FG  VY+LAV NA LGFLEKLT
Sbjct  121  GIGVICLYGIQWIYGFVTFFYPGGSPALRSESIPWHVAFGITVYLLAVGNASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAP--TEDDHSYSAI  220
            FLE+SG+DK+G+EAFLVNFTAI TV++GVFV L++LS+AP   EDD+SYSAI
Sbjct  181  FLENSGIDKFGTEAFLVNFTAIITVLFGVFVILSVLSEAPPSVEDDNSYSAI  232



>ref|XP_002318222.2| hypothetical protein POPTR_0012s13210g [Populus trichocarpa]
 gb|EEE96442.2| hypothetical protein POPTR_0012s13210g [Populus trichocarpa]
Length=273

 Score =   337 bits (865),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  915  RDMAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGF  736
              M I  +ALP + VAHA+A+  AV VLVWN+++RGGLAWE TNK+LIFNLHPVLMLIG 
Sbjct  46   SSMTIGVEALPLTFVAHALAVAGAVTVLVWNLYYRGGLAWEATNKSLIFNLHPVLMLIGL  105

Query  735  VILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHS  556
            +I+GGEAIMSYKSLPLKKEVKKVIHLVLHAIA++LG VGI AAFKNHNES IANLYSLHS
Sbjct  106  IIIGGEAIMSYKSLPLKKEVKKVIHLVLHAIAMILGSVGIAAAFKNHNESNIANLYSLHS  165

Query  555  WIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEK  376
            W+GI +  LYGIQW+YGF+VFFYPGG+A IR ESLPWHVLFG FVYILAV NA LG LEK
Sbjct  166  WLGISIISLYGIQWIYGFIVFFYPGGSAIIRSESLPWHVLFGIFVYILAVGNAALGCLEK  225

Query  375  LTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            LTFLESSG+DKYG EA LVNFTA+ T++YG FV L++L QAP EDD
Sbjct  226  LTFLESSGIDKYGPEALLVNFTAVITILYGAFVILSVLGQAPVEDD  271



>ref|XP_004148357.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Cucumis 
sativus]
 ref|XP_004162410.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Cucumis 
sativus]
 gb|KGN60469.1| hypothetical protein Csa_3G914000 [Cucumis sativus]
Length=233

 Score =   335 bits (859),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 199/233 (85%), Gaps = 3/233 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+A KA P + V+H + +V  ++VLVW IHFRGGLAWE  NKNLIFN+HPVLML+G +I
Sbjct  1    MALAVKAFPLTVVSHVVGIVAMIMVLVWTIHFRGGLAWEAVNKNLIFNIHPVLMLLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYKSLPL+KEVKKVIHLVLH +AL LGIVGI AAFKNHNESGIANLYSLHSWI
Sbjct  61   IGGEAIMSYKSLPLRKEVKKVIHLVLHGVALGLGIVGIIAAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG+QWVYGF  FFYPGG+ D+RR SLPWHV+FG  VY+LAV N+ LGFLEKLT
Sbjct  121  GIGVISLYGLQWVYGFATFFYPGGSGDLRRVSLPWHVVFGLAVYVLAVGNSALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ--APTEDDH-SYSAI  220
            FLES G+ KYG+EAFLVNFTAI+T+I+ VFV L+++SQ  A  EDDH +YSAI
Sbjct  181  FLESGGIPKYGTEAFLVNFTAITTIIFAVFVILSVISQPCAQQEDDHGAYSAI  233



>ref|XP_004234390.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Solanum 
lycopersicum]
Length=231

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 205/230 (89%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA   KALPFS  AH IAL+ A++VLVW+IHFRGGLAWE  NKNLIFN+HPVLMLIGF+I
Sbjct  1    MATGLKALPFSFGAHFIALIAAIMVLVWSIHFRGGLAWEAENKNLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKS PL+K+VKK IHLVLHAIAL+LGI+GI  AFKNHNES I N+YSLHSWI
Sbjct  61   LGGEAIISYKSFPLEKQVKKKIHLVLHAIALILGIIGIYTAFKNHNESNIPNMYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW+YGFVVFFYPGG+++IRR+SLPWHVL G F+Y++AV NA LGFLEKLT
Sbjct  121  GIGVITLYGIQWIYGFVVFFYPGGSSEIRRDSLPWHVLLGMFIYVVAVGNACLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE +GL KYGSEAFLVNFTAI+TV+YGVFVFLTILSQ PT DDHSYSAI
Sbjct  181  FLEVNGLAKYGSEAFLVNFTAIATVLYGVFVFLTILSQGPTADDHSYSAI  230



>ref|XP_009349345.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Pyrus 
x bretschneideri]
Length=232

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 199/232 (86%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALP + V H + +V  VLVLVWNIHFRGGLAWE TNKNLIFNLHPVLML+G + 
Sbjct  1    MALKVPALPLTFVVHTLGIVALVLVLVWNIHFRGGLAWESTNKNLIFNLHPVLMLLGLIF  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LP +KEVKKVIHLVLHA+AL LGI+GI  AFKNHNESGIANLYSLHSWI
Sbjct  61   LGGEAIVSYKALPFRKEVKKVIHLVLHALALGLGIIGIYLAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW+YGFV FFYPGG+  +R ES+PWHV FG  VY+LAV NA LGFLEKLT
Sbjct  121  GIGVICLYGIQWIYGFVTFFYPGGSPALRSESIPWHVAFGITVYLLAVGNASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAP--TEDDHSYSAI  220
            FLE+SG+DK+G+EAFLVNFTAI TV++GVFV L++LS+AP   EDD+SYSAI
Sbjct  181  FLENSGIDKFGTEAFLVNFTAIITVLFGVFVILSVLSEAPPSVEDDNSYSAI  232



>ref|XP_006353305.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Solanum 
tuberosum]
Length=231

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 205/230 (89%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA   KALPFS  AH +AL+ A++VLVW+IHFRGGLAWE  NKNLIFN+HPVLMLIGF+I
Sbjct  1    MATGLKALPFSFGAHFLALIAAIMVLVWSIHFRGGLAWEAENKNLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKS PL+K+VKK IHLVLHAIAL+LGI+GI  AFKNHNE+ I N+YSLHSWI
Sbjct  61   LGGEAIISYKSFPLEKQVKKKIHLVLHAIALILGIIGIYTAFKNHNETNIPNMYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW+YGFVVFFYPGG+++IRR+SLPWHVL G F+Y++AV NA LGFLEKLT
Sbjct  121  GIGVITLYGIQWIYGFVVFFYPGGSSEIRRDSLPWHVLLGMFIYVVAVGNACLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE +GL KYGSEAFLVNFTAI+TV+YGVFVFLTILSQ PT DDHSYSAI
Sbjct  181  FLEVNGLAKYGSEAFLVNFTAIATVLYGVFVFLTILSQGPTADDHSYSAI  230



>gb|EYU25091.1| hypothetical protein MIMGU_mgv1a013071mg [Erythranthe guttata]
Length=231

 Score =   332 bits (852),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 200/231 (87%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  KALP S VAH +A+V  +LVL+W I+FRGGLAWE TNKNLIFNLHPVLMLIG +I
Sbjct  1    MAIGVKALPISFVAHFLAIVGVILVLIWTINFRGGLAWESTNKNLIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPLKK  KK+IHL+LHAIALVLGI+GI  AFK HNES IANLYSLHSW+
Sbjct  61   IGGEAIISYKSLPLKKPQKKLIHLILHAIALVLGIIGIYTAFKFHNESNIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFVVFFYPGG+  IR ES+PWHVLFG FVY+LAV  A  G+LEKLT
Sbjct  121  GIGVIVLYGIQWLYGFVVFFYPGGSPAIRSESVPWHVLFGIFVYVLAVGTAATGYLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA-PTEDDHSYSAI  220
            FLE++G+ KYG+EAFLVNFTA+ T++YG FV LTILSQ+ P ED++SYSAI
Sbjct  181  FLETNGVAKYGTEAFLVNFTALVTILYGTFVILTILSQSPPPEDEYSYSAI  231



>ref|XP_004308091.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   332 bits (852),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   + P + VAH + + + VLVLVW+I+FRGG AWE TNKNLIFNLHP LM++G +I
Sbjct  1    MALGVPSTPLTFVAHGLGVAVLVLVLVWSIYFRGGFAWEATNKNLIFNLHPFLMVLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPL+K+VKK++HLVLHAIALVLGIVGICAAFKNHNESG+ANLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLRKDVKKIVHLVLHAIALVLGIVGICAAFKNHNESGVANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW+YGF+VFFYP G+  +R ES+PWHV+ G  VY+LAV NA LG+LEKLT
Sbjct  121  GIGVICLYGIQWIYGFLVFFYPKGSPGLRSESVPWHVILGLLVYVLAVGNATLGYLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLESSGL+KYGSEAFLVNFTA+ T+++GVFV  +++SQAP +DD+SYS I
Sbjct  181  FLESSGLEKYGSEAFLVNFTALVTILFGVFVIFSVISQAPVDDDNSYSEI  230



>ref|XP_010107440.1| Transmembrane ascorbate ferrireductase 1 [Morus notabilis]
 gb|EXC15978.1| Transmembrane ascorbate ferrireductase 1 [Morus notabilis]
Length=231

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 199/231 (86%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A PF+ V HA+ LV  +LVLVW IHFRGG AWED+NKNLIFNLHP+LMLIGF++
Sbjct  1    MALKVPAAPFTFVVHALGLVGLILVLVWTIHFRGGFAWEDSNKNLIFNLHPLLMLIGFIV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPL K+VKK+IHLVLHAIALVLGIVGI  AFK HNESGIANLYSLHSW+
Sbjct  61   LGGEAIISYKSLPLSKDVKKLIHLVLHAIALVLGIVGIYTAFKYHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLY IQW+YGF+ FF+PGG+A +R ESLPWHV+FG F+Y+LAV  A LGFLEKLT
Sbjct  121  GIGVIVLYAIQWLYGFLTFFFPGGSAYLRSESLPWHVVFGIFIYVLAVTTATLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTE-DDHSYSAI  220
            FL++SGL KYGSEAFLVNFTAI TV++G FV L++ SQ P+  DD+SYSAI
Sbjct  181  FLQNSGLAKYGSEAFLVNFTAILTVLFGTFVLLSVASQGPSSADDYSYSAI  231



>ref|XP_008376574.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Malus domestica]
Length=231

 Score =   331 bits (848),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALP + V H + +V  VLVLVWNIHFRGGLAWE  NKNLIFNLHPVLM +G + 
Sbjct  1    MALKVPALPLTFVVHTLGIVGLVLVLVWNIHFRGGLAWEAANKNLIFNLHPVLMFLGLIF  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LP +KEVKKVIHLVLHA+AL LGI+GI  AFKNHNESGIANLYSLHSWI
Sbjct  61   LGGEAIVSYKALPFRKEVKKVIHLVLHALALGLGIIGIYLAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW+YGFV FFYPGG+  +R ES+PWHV+FG  VY+LAV NA LGFLEK+T
Sbjct  121  GIGVICLYGIQWIYGFVTFFYPGGSPALRSESIPWHVVFGITVYLLAVGNASLGFLEKVT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPT-EDDHSYSAI  220
            FLE+SGLDK+G+EAFLVNFTAI TV++GVFV  ++LS+APT EDD+SYSAI
Sbjct  181  FLENSGLDKFGTEAFLVNFTAIITVLFGVFVIFSVLSEAPTVEDDNSYSAI  231



>gb|ABK93740.1| unknown [Populus trichocarpa]
Length=230

 Score =   330 bits (846),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+  +ALP + +AHA+A+  AV+VLVW +++RGG+AWE  NKNLIFNLHP LML G +I
Sbjct  1    MALEFRALPLTFLAHALAIAGAVMVLVWVLYYRGGMAWEAANKNLIFNLHPFLMLFGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYKSLPLKKEVKK+IHLVLHAIA++LG VGI AAFKNHNES IANLYSLHSW+
Sbjct  61   IGGEAIMSYKSLPLKKEVKKLIHLVLHAIAIILGCVGIAAAFKNHNESNIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI +  LYGIQW+YGF+VFFYP G+  +R E LPWHVLFG FVYILAV NA LGFLEKLT
Sbjct  121  GITIISLYGIQWIYGFLVFFYPKGSPTLRSECLPWHVLFGIFVYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLESSG+ KYGSEA LVNFTA+ TV+YG FV L++L QAP EDD SYSAI
Sbjct  181  FLESSGIAKYGSEALLVNFTAVVTVLYGAFVILSVLGQAPVEDDDSYSAI  230



>ref|XP_011048710.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Populus 
euphratica]
Length=228

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 196/228 (86%), Gaps = 0/228 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +A +ALP + +AHA+A+  AV+VLVW +++RGG+AWE +NKNLIFNLHP LML+G +I+G
Sbjct  1    MAFRALPLTFLAHALAIAGAVMVLVWVLYYRGGMAWEASNKNLIFNLHPFLMLVGLIIIG  60

Query  723  GEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGI  544
            GEAIMSYKSLPLKKEVKKVIHLVLHAIA++LG VGI AAFKNH ES IANLYSLHSW+GI
Sbjct  61   GEAIMSYKSLPLKKEVKKVIHLVLHAIAIILGCVGIAAAFKNHKESNIANLYSLHSWLGI  120

Query  543  GVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFL  364
             +  LYGIQW+YGF+VFFYP G+  +R ESLPWHVLFG FVYILAV NA LGFLEKLTFL
Sbjct  121  TIISLYGIQWIYGFLVFFYPKGSPTLRSESLPWHVLFGIFVYILAVGNAALGFLEKLTFL  180

Query  363  ESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            ESSG+ KYG EA LVNFTA+ TV+YG FV L++L QAP EDD SYSAI
Sbjct  181  ESSGIAKYGPEALLVNFTAVVTVLYGAFVILSVLGQAPVEDDDSYSAI  228



>ref|XP_010667562.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Beta 
vulgaris subsp. vulgaris]
Length=233

 Score =   328 bits (840),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 200/233 (86%), Gaps = 3/233 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA   KA P + V HA+A+  AV+VLVW IHFRGGLAWE TNK LIFN+HPVLMLIGF+I
Sbjct  1    MAGEIKATPLTFVVHALAVACAVMVLVWCIHFRGGLAWEATNKGLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPLKK+VKKVIHLVLHAIAL+LGIVGI AAFK HNES I NLYSLHSW+
Sbjct  61   LGGEAIVSYKSLPLKKDVKKVIHLVLHAIALILGIVGIWAAFKFHNESAILNLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG+ VLYGIQW+YGFV+FFYPGG + +R ESLPWHVLFG FVY LAVANA +GFLEKLT
Sbjct  121  GIGIIVLYGIQWIYGFVIFFYPGGNSSLRSESLPWHVLFGIFVYGLAVANAAIGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA---PTEDDHSYSAI  220
            FL+S+GLDK+G+EA+LVNFTAI+TV+YG FV LT+ +Q     TED  +YSAI
Sbjct  181  FLQSAGLDKFGAEAYLVNFTAIATVLYGAFVLLTVRAQKDQESTEDYGTYSAI  233



>ref|XP_011030106.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like isoform 
X2 [Populus euphratica]
Length=226

 Score =   327 bits (838),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  +ALP + VAHA+A   AV+VLVWN+++RGGLAWE TNK+LIFNLHPVLMLIG +I
Sbjct  1    MAIGVEALPLTFVAHALAAAAAVMVLVWNLYYRGGLAWEATNKSLIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYKSLPLKKEVKKVIHLVLHAIA++LG VGI AAFKNHNES IANLYSLHSW+
Sbjct  61   IGGEAIMSYKSLPLKKEVKKVIHLVLHAIAIILGSVGIAAAFKNHNESNIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI +  LYG QW+YGF+VFFYPGG+  IR ESLPWHVLFG FVYILAV NA LG LEKLT
Sbjct  121  GISIISLYGFQWIYGFIVFFYPGGSTIIRSESLPWHVLFGIFVYILAVGNAALGCLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            FLE SG+DKYG EA LVNFTA+ TV+YG FV L++L QAP E+D
Sbjct  181  FLEISGIDKYGPEALLVNFTAVVTVLYGAFVILSVLGQAPVEND  224



>ref|XP_004496575.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496576.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like isoform 
X2 [Cicer arietinum]
Length=229

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 192/224 (86%), Gaps = 0/224 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+A  A+PF+   H + LV  VLVL+WN+HFRGGLAW  +NK LIFNLHPVLMLIG +I
Sbjct  1    MALAVPAVPFTYGVHLLGLVAIVLVLLWNLHFRGGLAWNSSNKALIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
             GGEAI+SYKSLPLKKEVKK+IHL+LHAIAL+LGIVGI AAFKNHNESGIANLYSLHSW+
Sbjct  61   FGGEAIISYKSLPLKKEVKKLIHLILHAIALILGIVGISAAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG+QW++GFVVFFYPGGT+ IRRESLPWHVL G FVYILA+  A LGFLEKLT
Sbjct  121  GIGVISLYGVQWIFGFVVFFYPGGTSSIRRESLPWHVLIGLFVYILAIGTASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            FLE+SGL KYGSEA LVNFTA+ T+++G FV L+ +S+AP   +
Sbjct  181  FLENSGLAKYGSEALLVNFTALITILFGTFVVLSAISEAPAAAE  224



>ref|XP_010537185.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Tarenaya 
hassleriana]
Length=232

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 200/232 (86%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A P + VAHA+A+  A++VLVWNI +RGGLAWE TNKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVELNARPLTFVAHALAIAGAIMVLVWNISYRGGLAWEATNKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYK+LPLKK VKK+IHL+LHAIAL+LG  GI AAFKNHNE+GIANLYSLHSWI
Sbjct  61   MGGEAIISYKALPLKKPVKKLIHLILHAIALILGSWGISAAFKNHNEAGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYG+QW+YGFVVFFYPGG++ +R +SLP H L G FVYILAV NA LGFLEKLT
Sbjct  121  GIGVIVLYGLQWLYGFVVFFYPGGSSTLRSDSLPLHALVGLFVYILAVGNATLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD--HSYSAI  220
            FLESSGLDKYGSEAFLVNFTAI TV++G FV LT +++  + DD  +SYSAI
Sbjct  181  FLESSGLDKYGSEAFLVNFTAIITVLFGAFVVLTAIAKPASSDDDNYSYSAI  232



>ref|XP_010061065.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Eucalyptus 
grandis]
 gb|KCW90706.1| hypothetical protein EUGRSUZ_A02792 [Eucalyptus grandis]
Length=231

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 194/228 (85%), Gaps = 0/228 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            I  KA PF+ VA  +A+   VLVLVW I F GGLAWE TNK+LIFNLHPVLMLIG +I+G
Sbjct  4    IGLKATPFAAVAQLLAVTGVVLVLVWCISFMGGLAWEATNKSLIFNLHPVLMLIGLIIIG  63

Query  723  GEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGI  544
            GEAI++YK+LPL KE KKVIH+VLHAIAL+LGI+G+ AAFK HNES IANLYSLHSW+GI
Sbjct  64   GEAIITYKTLPLNKETKKVIHMVLHAIALILGIIGVYAAFKYHNESSIANLYSLHSWLGI  123

Query  543  GVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFL  364
             + VLYGIQW+YGFV+FFYPGG + +R +SLPWHVLFG FVYILAVANA LGFLEKLTFL
Sbjct  124  CIIVLYGIQWIYGFVIFFYPGGPSTLRSDSLPWHVLFGLFVYILAVANAALGFLEKLTFL  183

Query  363  ESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            E+SGL K+GSEA LVNFTA+ TV++G FV +T+LSQ   EDD+SYSAI
Sbjct  184  ENSGLAKFGSEAILVNFTAVVTVLFGTFVIVTVLSQPVIEDDYSYSAI  231



>ref|XP_003638360.1| Cytochrome b reductase [Medicago truncatula]
 gb|ACJ84548.1| unknown [Medicago truncatula]
 gb|KEH43716.1| transmembrane ascorbate ferrireductase [Medicago truncatula]
Length=229

 Score =   325 bits (832),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+PF+ VAH + +V  VLVL WN+HFRGGLAW   NK  IFNLHPVLMLIG +I
Sbjct  1    MALGVPAVPFTYVAHLLGIVAIVLVLFWNLHFRGGLAWNSDNKAQIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPLKKEVKK+IHLVLHA ALVLGI+GICAAFKNHNESGIANLYSLHSW+
Sbjct  61   IGGEAIISYKSLPLKKEVKKLIHLVLHAHALVLGIIGICAAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW++GFVVFFYPGG++++RRES+PWHVLFG FVYILA+A + LGFLEKLT
Sbjct  121  GIGVISLYGIQWIFGFVVFFYPGGSSELRRESVPWHVLFGLFVYILALATSSLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            FLESSG+ KYG+EA LVNF AI T+++G FV L+ +SQAP   D
Sbjct  181  FLESSGVAKYGAEALLVNFNAIITILFGTFVVLSAISQAPPAAD  224



>gb|AFK34168.1| unknown [Medicago truncatula]
Length=229

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 192/224 (86%), Gaps = 0/224 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+PF+ VAH + +V  VLVL WN+HFRGGLAW   NK  IFNLHPVLMLIG +I
Sbjct  1    MALGVPAVPFTYVAHLLGIVAIVLVLFWNLHFRGGLAWNSDNKAQIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPLKKEVKK+IHLVLHA ALVLGI+GICAAFKNHNESGIANLYSLHSW+
Sbjct  61   IGGEAIISYKSLPLKKEVKKLIHLVLHAHALVLGIIGICAAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYGIQW++GFVVFFYPGG++++RRES+PWHVLFG FVYILA+A + LGFLEKLT
Sbjct  121  GIGVISLYGIQWIFGFVVFFYPGGSSELRRESVPWHVLFGLFVYILALATSSLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            FLESSG+ KYG+EA LVNF AI T+++G FV L+ +SQ P   D
Sbjct  181  FLESSGVAKYGAEALLVNFNAIITILFGTFVVLSAISQTPPAAD  224



>gb|KDP22285.1| hypothetical protein JCGZ_26116 [Jatropha curcas]
Length=231

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+  KALPF+ V HA+A+  A+LVLVW I+FRGGLAWE +NK+LIFN+HPVLMLIG +I
Sbjct  1    MALEVKALPFTFVTHALAVAGAILVLVWCIYFRGGLAWEASNKSLIFNIHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLP KK+ KK+IHLVLHA+AL+LGI+GI  AFK HNES IANLYSLHSW+
Sbjct  61   IGGEAIISYKSLPFKKQEKKLIHLVLHAVALILGIIGIYTAFKFHNESSIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI +  LYGIQW+YGF++FFYPGG+  +R ESLPWHV+FG  VYILAVANA +GFLEKLT
Sbjct  121  GITIISLYGIQWIYGFIIFFYPGGSTGLRSESLPWHVVFGVLVYILAVANAAIGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA-PTEDDHSYSAI  220
            FLESSGL KYGSEA LVNFTA+ T+ YG FV  T+L Q  P E+DHSY+AI
Sbjct  181  FLESSGLAKYGSEALLVNFTAVLTIFYGAFVIFTVLGQGPPAEEDHSYTAI  231



>ref|XP_010255441.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Nelumbo nucifera]
Length=230

 Score =   320 bits (820),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A PF+ V+H +A+  A++VLVW IHFRGGLA+E TNK+LIFN+HPVLMLIGF+I
Sbjct  1    MALRVSAQPFTLVSHVLAIAAAIMVLVWCIHFRGGLAFEATNKSLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LP +KEVKK+IHL+LH  AL+LGIVGI AAFK HNES IANLYSLHSWI
Sbjct  61   LGGEAIISYKALPWRKEVKKLIHLILHLFALILGIVGIYAAFKYHNESNIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG   LYGIQW+YGF+VFFYPGG+A +R ESLPWHV+FG FVY+LA+  A+LGFLEKLT
Sbjct  121  GIGTICLYGIQWIYGFLVFFYPGGSAAVRGESLPWHVVFGLFVYVLALGTAMLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLESSGL KYG EA+LVNFT+I TV++G FV L++LS +  EDD +YS+I
Sbjct  181  FLESSGLAKYGPEAYLVNFTSIVTVLFGAFVVLSVLSPSHVEDDFTYSSI  230



>ref|XP_006421910.1| hypothetical protein CICLE_v10005795mg [Citrus clementina]
 ref|XP_006490379.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Citrus 
sinensis]
 gb|ESR35150.1| hypothetical protein CICLE_v10005795mg [Citrus clementina]
Length=230

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  KALP + VAHA+A+V A++VLVW + FRGGLAWEDTNKNLIFNLHPVLMLIG +I
Sbjct  1    MAIGVKALPITFVAHAVAIVAAIMVLVWCLGFRGGLAWEDTNKNLIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYK L L+KEVKKVIHLVLHAIAL+LGI+GI AAFK HNES I NLYSLHSW+
Sbjct  61   IGGEAIMSYKGLNLRKEVKKVIHLVLHAIALILGIIGIYAAFKYHNESAIVNLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI V  LYGIQW+YGFV+FFYPGG+  +R ESLPWHVLFG FVYILAVANA +GFLEKLT
Sbjct  121  GIAVISLYGIQWLYGFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE+SGL KYGSEA LVNFTA+ T++YG FV  ++ SQ P EDD+SYSAI
Sbjct  181  FLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVASQGPAEDDYSYSAI  230



>ref|XP_002267852.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Vitis vinifera]
 emb|CAN73186.1| hypothetical protein VITISV_041528 [Vitis vinifera]
 emb|CBI22752.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   313 bits (801),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  KA+P S VAHA+A+  AV+VLVW I+F GGLAWE TNK LIFNLHPVLMLIG VI
Sbjct  1    MAIGGKAVPLSFVAHALAVAGAVMVLVWCIYFLGGLAWEATNKALIFNLHPVLMLIGLVI  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GG+AIMSYKSLPL+KEVKKVIHLVLHAIAL+LGI+GI AAFKNHNESGIANLYSLHSW+
Sbjct  61   IGGQAIMSYKSLPLRKEVKKVIHLVLHAIALILGIIGIYAAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI +  LYGIQW+YGF+VFFYPGGT  +R  SLPWHVLFG  VY+L V NA LGFLEKLT
Sbjct  121  GIVLISLYGIQWIYGFLVFFYPGGTLGLRSASLPWHVLFGLLVYVLVVGNAELGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLESSGL KYG+EA LVNFTAI T++YGVFV +T LSQ P E+D+ YSAI
Sbjct  181  FLESSGLAKYGAEALLVNFTAIVTILYGVFVVMTALSQPPPEEDYGYSAI  230



>emb|CAA18169.1| putative protein [Arabidopsis thaliana]
Length=280

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 197/243 (81%), Gaps = 9/243 (4%)
 Frame = -2

Query  921  KERDMAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLI  742
            +ERDMA+   A+  + VAHA+A++ A++VLVW+I +RGGLAWE TNKNLIFNLHPVLMLI
Sbjct  38   RERDMAVRINAMAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLI  97

Query  741  GFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSL  562
            GF+ILGGEAI+SYKSLPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNES I NLYSL
Sbjct  98   GFIILGGEAIISYKSLPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESHIPNLYSL  157

Query  561  HSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFL  382
            HSWIGIGV  LYG QWVY F+VFF+PGG+ +++   LPWH + G FVYILAV NA LGFL
Sbjct  158  HSWIGIGVISLYGFQWVYSFIVFFFPGGSTNLKSGLLPWHAMLGLFVYILAVGNAALGFL  217

Query  381  EKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ-------APTED--DHSY  229
            EKLTFLE+ GLDKYGSEAFL+NFTAI T+++G FV LT  ++          +D  D SY
Sbjct  218  EKLTFLENGGLDKYGSEAFLINFTAIITILFGAFVVLTASAESPSPSPSVSNDDSVDFSY  277

Query  228  SAI  220
            SAI
Sbjct  278  SAI  280



>emb|CDP05207.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  KA+PF+ VA  + +   ++VL+WNI FRGGLAWE  NK+LIFN+HPVLML+G ++
Sbjct  1    MAIGIKAVPFAVVAQVLGVAGIIMVLIWNISFRGGLAWESANKSLIFNIHPVLMLLGLIV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI++YK+LPL+KE+KK+IHLVLHAIAL+LGI+GI  AFK HNES I NLYSLHSW+
Sbjct  61   IGGEAIITYKTLPLRKELKKLIHLVLHAIALILGIIGIYTAFKFHNESNIVNLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG+ VLYGIQW+YGF+VFFYPGG+++IR+ESLPWHV+FG FVYILAV NA LG+LEKLT
Sbjct  121  GIGIIVLYGIQWIYGFLVFFYPGGSSEIRQESLPWHVVFGLFVYILAVGNASLGYLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLE+SGL+KYG+EAFLVNFTA+ T+++G FV LT+ S+   ED++SYSAI
Sbjct  181  FLENSGLEKYGAEAFLVNFTALVTILFGTFVVLTVFSKPVAEDEYSYSAI  230



>ref|XP_009137537.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Brassica 
rapa]
 emb|CDY57373.1| BnaCnng31860D [Brassica napus]
 emb|CDY50196.1| BnaA03g47520D [Brassica napus]
 emb|CDX92719.1| BnaC07g39770D [Brassica napus]
Length=235

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 193/235 (82%), Gaps = 5/235 (2%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+P +  AHA+A++ A++VLVWNI +RGGLAWE  NKNLIFNLHPVLMLIGFVI
Sbjct  1    MAVGINAMPVTFAAHALAVIAAIMVLVWNISYRGGLAWEAENKNLIFNLHPVLMLIGFVI  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNESGI NLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLEKPVKKLIHLILHAIALALGIWGICAAFKNHNESGIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG QWVY F+VFF+PGG+ ++R   LPWH + G FVYILAV NA LGFLEKLT
Sbjct  121  GIGVISLYGFQWVYSFIVFFFPGGSPNLRSGLLPWHAILGLFVYILAVGNAALGFLEKLT  180

Query  369  FLESSG-LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTE----DDHSYSAI  220
            FLES   LDKYG EAFLVNFTAI T+++G  V LT  +++P+     D++SYSAI
Sbjct  181  FLESGAKLDKYGPEAFLVNFTAIVTILFGALVVLTASAKSPSSIDDADNYSYSAI  235



>gb|AAM62824.1| cytochrome b561 [Arabidopsis thaliana]
Length=237

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 194/237 (82%), Gaps = 7/237 (3%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+  + VAHA+A++ A++VLVW+I +RGGLAWE TNKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVRINAMAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNES I NLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESHIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG QWVY F+VFF+PGG+ +++   LPWH + G FVYILAV NA LGFLEKLT
Sbjct  121  GIGVISLYGFQWVYSFIVFFFPGGSTNLKSGLLPWHAMLGLFVYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTED-------DHSYSAI  220
            FLE+ GLDKYGSEAFL+NFTAI T+++G FV LT  +++P+         D SYSAI
Sbjct  181  FLENGGLDKYGSEAFLINFTAIITILFGAFVVLTASAESPSPSVSNDDSVDFSYSAI  237



>ref|XP_007038676.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 1 [Theobroma cacao]
 gb|EOY23177.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 1 [Theobroma cacao]
Length=228

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLAW  +NKNLIFNLHPVLMLIGF+ILGGEAIMSYKSLPL K+VKK+IHLVLH
Sbjct  26   WCIHFRGGLAWASSNKNLIFNLHPVLMLIGFIILGGEAIMSYKSLPLSKDVKKLIHLVLH  85

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL+LGI+GI  AFK HNES I NLYSLHSW+G+G+ VLYGIQW+YGF+VFFYPGG+A 
Sbjct  86   GIALILGIIGIYTAFKYHNESSIVNLYSLHSWLGMGIIVLYGIQWIYGFLVFFYPGGSAG  145

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R ESLPWHVL G FVYILA+ NA +GFLEKLTFLE+SGL KYG+EA+LVNFTA+ T++Y
Sbjct  146  LRSESLPWHVLLGLFVYILAIGNASIGFLEKLTFLENSGLAKYGAEAYLVNFTAVVTILY  205

Query  288  GVFVFLTILSQAPTEDDHSYSAI  220
            G FV  T+ ++AP+EDD+SYSAI
Sbjct  206  GAFVIFTVFAKAPSEDDNSYSAI  228



>emb|CAB81367.1| putative protein [Arabidopsis thaliana]
Length=280

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 196/243 (81%), Gaps = 9/243 (4%)
 Frame = -2

Query  921  KERDMAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLI  742
            +ERDMA+   A+  + VAHA+A++ A++VLVW+I +RGGLAWE TNKNLIF LHPVLMLI
Sbjct  38   RERDMAVRINAMAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFKLHPVLMLI  97

Query  741  GFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSL  562
            GF+ILGGEAI+SYKSLPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNES I NLYSL
Sbjct  98   GFIILGGEAIISYKSLPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESHIPNLYSL  157

Query  561  HSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFL  382
            HSWIGIGV  LYG QWVY F+VFF+PGG+ +++   LPWH + G FVYILAV NA LGFL
Sbjct  158  HSWIGIGVISLYGFQWVYSFIVFFFPGGSTNLKSGLLPWHAMLGLFVYILAVGNAALGFL  217

Query  381  EKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ-------APTED--DHSY  229
            EKLTFLE+ GLDKYGSEAFL+NFTAI T+++G FV LT  ++          +D  D SY
Sbjct  218  EKLTFLENGGLDKYGSEAFLINFTAIITILFGAFVVLTASAESPSPSPSVSNDDSVDFSY  277

Query  228  SAI  220
            SAI
Sbjct  278  SAI  280



>gb|KHN26657.1| Transmembrane ascorbate ferrireductase 1 [Glycine soja]
Length=231

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALP + VAH +ALV ++LV++W ++FRGGLAW+  NK LIFNLHPVL++IG ++
Sbjct  1    MALGVPALPLTYVAHVLALVASILVVLWVLNFRGGLAWDSDNKALIFNLHPVLIVIGLLV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LPLKKEVKK+IHLV HAIAL+LGIVGI  AFK HNESGIANLYSLHSW+
Sbjct  61   LGGEAIISYKALPLKKEVKKLIHLVFHAIALILGIVGIYTAFKYHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFV+FF+PGGT DIRR SLPWH LFG FV++LAV  A LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFVIFFFPGGTPDIRRASLPWHALFGLFVFVLAVGTAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTIL  262
            FLE+SGLDKYGSEA LVNFTAI TV++G FV L+ L
Sbjct  181  FLENSGLDKYGSEALLVNFTAIITVLFGAFVVLSAL  216



>ref|XP_006284451.1| hypothetical protein CARUB_v10005631mg [Capsella rubella]
 gb|EOA17349.1| hypothetical protein CARUB_v10005631mg [Capsella rubella]
Length=237

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 176/210 (84%), Gaps = 7/210 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGGLAWE TNKNLIFNLHPVLMLIGF+ILGGEAI+SYK+LPL+K VKK+IHL+LH
Sbjct  28   WSISYRGGLAWEATNKNLIFNLHPVLMLIGFIILGGEAIISYKALPLEKPVKKLIHLILH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL LGI GICAAFKNHNESGI NLYSLHSWIGIGV  LYG QWVY F+VFF+PGG+A+
Sbjct  88   AIALALGIFGICAAFKNHNESGIPNLYSLHSWIGIGVISLYGFQWVYSFIVFFFPGGSAN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R   LPWH + G F YILAV NA LGFLEKLTFLE+ GLDKYGSEAFL+NFTAI T+++
Sbjct  148  LRSGLLPWHAMLGLFAYILAVGNAALGFLEKLTFLENGGLDKYGSEAFLINFTAIVTILF  207

Query  288  GVFVFLT-----ILSQAPTED--DHSYSAI  220
            G FV LT       S +P +D  D+SYSAI
Sbjct  208  GAFVVLTASAKSPSSSSPNDDTVDYSYSAI  237



>ref|XP_010448412.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Camelina 
sativa]
Length=234

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 174/211 (82%), Gaps = 8/211 (4%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGGLAWE TNKNLIFNLHPVLMLIGF+ILGGEAI+SYKSLPL+K VKK+IHL+LH
Sbjct  24   WSISYRGGLAWEATNKNLIFNLHPVLMLIGFIILGGEAIISYKSLPLEKPVKKLIHLILH  83

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL LGI GICAAFKNHNES I NLYSLHSWIGIGV  LYG QWVY F+VFF+PGG+A+
Sbjct  84   AIALALGIFGICAAFKNHNESNIPNLYSLHSWIGIGVISLYGFQWVYSFIVFFFPGGSAN  143

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R   LPWH + G FVYILAV NA LGFLEKLTFLE+ GLDKYGSEAFL+NFTAI T+++
Sbjct  144  LRSGLLPWHAMLGLFVYILAVGNAALGFLEKLTFLENGGLDKYGSEAFLINFTAIVTILF  203

Query  288  GVFVFLT-----ILSQAPTED---DHSYSAI  220
            G FV LT         +  +D   D+SYSAI
Sbjct  204  GAFVVLTASAKSPSPSSSNDDDTVDYSYSAI  234



>ref|XP_007038677.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 2 [Theobroma cacao]
 gb|EOY23178.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 2 [Theobroma cacao]
Length=228

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W I+FRGGLAW  +NKNLIFNLHPVLMLIGF+ILGGEAIMSYKSLPL K+VKK+IHLVLH
Sbjct  26   WCIYFRGGLAWASSNKNLIFNLHPVLMLIGFIILGGEAIMSYKSLPLSKDVKKLIHLVLH  85

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL+LGI+GI  AFK HNES I NLYSLHSW+G+G+ VLYGIQW+YGF+VFFYPGG+A 
Sbjct  86   GIALILGIIGIYTAFKYHNESSIVNLYSLHSWLGMGIIVLYGIQWIYGFLVFFYPGGSAG  145

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R ESLPWHVL G FVYILA+ NA +GFLEKLTFLE+SGL KYG+EA+LVNFTA+ T++Y
Sbjct  146  LRSESLPWHVLLGLFVYILAIGNASIGFLEKLTFLENSGLAKYGAEAYLVNFTAVVTILY  205

Query  288  GVFVFLTILSQAPTEDDHSYSAI  220
            G FV  T+ ++AP+EDD+SYSAI
Sbjct  206  GAFVIFTVFAKAPSEDDNSYSAI  228



>ref|XP_010433616.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Camelina 
sativa]
Length=238

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 194/238 (82%), Gaps = 8/238 (3%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+  + VAHA+A++ AV+VLVW+I +RGGLAWE TNKNLIFNLHPV+MLIGF+I
Sbjct  1    MAVGINAMAVTFVAHALAVIAAVMVLVWSISYRGGLAWEATNKNLIFNLHPVMMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNES I NLYSLHSWI
Sbjct  61   LGGEAIISYKALPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESNIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG QWVY F+VFF+PGG+A++R   LPWH + G FVYILAV NA LGFLEKLT
Sbjct  121  GIGVISLYGFQWVYSFIVFFFPGGSANLRSGLLPWHAMLGLFVYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLT-----ILSQAPTED---DHSYSAI  220
            FLE+ GLDKYGSEAFL+NFTAI T+++G FV LT         +  +D   D+SYSAI
Sbjct  181  FLENGGLDKYGSEAFLINFTAIVTILFGAFVVLTASAKSPSPSSSNDDDTVDYSYSAI  238



>ref|XP_010438862.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Camelina 
sativa]
Length=238

 Score =   305 bits (782),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 193/238 (81%), Gaps = 8/238 (3%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+  + VAHA+A++ AV+VLVW+I +RGGLAWE TNKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVGINAMAVTFVAHALAVIAAVMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNES I NLYSLHSWI
Sbjct  61   LGGEAIISYKALPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESKIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG   LYG QWVY FVVFF+PGG+A++R   LPWH + G FVYILAV NA LGFLEKLT
Sbjct  121  GIGAISLYGFQWVYSFVVFFFPGGSANLRSGLLPWHAMLGLFVYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLT-----ILSQAPTED---DHSYSAI  220
            FLE+ GLDKYGSEAFL+NFTAI T+++G FV LT         +  +D   D+SYSAI
Sbjct  181  FLENGGLDKYGSEAFLINFTAIVTILFGAFVVLTASAKSPSPSSSNDDDTVDYSYSAI  238



>ref|NP_001234998.1| uncharacterized protein LOC100306179 [Glycine max]
 gb|ACU14239.1| unknown [Glycine max]
Length=231

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALP + VAH +ALV ++LV++W ++FRGGLAW+  NK LIFNLHPVL++IG ++
Sbjct  1    MALGVPALPLTYVAHVLALVASILVVLWVLNFRGGLAWDSDNKALIFNLHPVLIVIGLLV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LPLKKEVKK+IHLV HAIAL+LGIVGI  AFK +NESGIANLYSLHSW+
Sbjct  61   LGGEAIISYKALPLKKEVKKLIHLVFHAIALILGIVGIYTAFKYYNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFV+FF+PGGT DIRR SLPWH LFG FV++LAV  A LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFVIFFFPGGTPDIRRASLPWHALFGLFVFVLAVGTAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTIL  262
            FLE+SGLDKYGSEA LVNFTAI TV++G FV L+ L
Sbjct  181  FLENSGLDKYGSEALLVNFTAIITVLFGAFVVLSAL  216



>gb|KFK29056.1| hypothetical protein AALP_AA7G083000 [Arabis alpina]
Length=237

 Score =   305 bits (781),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 189/237 (80%), Gaps = 7/237 (3%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+P + VAHA+A++ A++VLVW I FRGGLAWE TNKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVGINAMPVTFVAHALAIIAAIMVLVWTISFRGGLAWEATNKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPL+K VKKVIHLVLHAIAL LGI GICAAFKNHNESGIANLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLEKPVKKVIHLVLHAIALALGIWGICAAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG QW+Y F +FFYPGG+A++R    PWH + G FVYILAV NA LGFLEKLT
Sbjct  121  GIGVISLYGFQWLYSFGLFFYPGGSANLRSSVFPWHAILGLFVYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFL-------TILSQAPTEDDHSYSAI  220
            FLES  LDKYG+EAFLVNF AI T+++G  V L       +       E ++SYSAI
Sbjct  181  FLESGKLDKYGTEAFLVNFMAIVTILFGALVVLTASAKSTSSSPPVDDESNYSYSAI  237



>ref|XP_010667557.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Beta 
vulgaris subsp. vulgaris]
Length=229

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 191/229 (83%), Gaps = 0/229 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +  +A P + VAHA+A+V AV+VLVW   FRGGLAWE  NK+LIFN+HPVLMLIGF+I
Sbjct  1    MMLVLRATPLTYVAHALAVVCAVMVLVWCSSFRGGLAWESPNKSLIFNIHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
             GGEAI+SYKSLPL+K+VKKVIHLVLHAIAL+LGIVGI A FK H ES I NLYSLHSW+
Sbjct  61   FGGEAIISYKSLPLRKDVKKVIHLVLHAIALILGIVGIWAGFKFHYESSIPNLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            G+GV VLYG+QW+YG  VFFYPGG+  +RR  LPWHVL G FVY+LAVANA +GFLEKLT
Sbjct  121  GMGVIVLYGLQWIYGLGVFFYPGGSPPMRRALLPWHVLIGMFVYVLAVANAAIGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSA  223
            FLE++GL+KYGSEA+LVNFTAI+T++YG FVFLT+ ++   E D   S+
Sbjct  181  FLEAAGLEKYGSEAYLVNFTAIATILYGTFVFLTVYAKKDQECDDGLSS  229



>ref|XP_008794543.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Phoenix dactylifera]
Length=257

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 190/239 (79%), Gaps = 2/239 (1%)
 Frame = -2

Query  930  EELKERDMA--IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHP  757
            E+ +  +M      +ALPF+  +H +A   A +VLVWNIHFRGGLA+E TNKNLIFN+HP
Sbjct  16   EQRRGEEMGGLPGVRALPFTFASHVLAAAAAAMVLVWNIHFRGGLAFESTNKNLIFNVHP  75

Query  756  VLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIA  577
            VLM IGF+I+G EAIMSYK+ P   EV+KV+HLVLHAIALVLG VGI  AFK HNESGIA
Sbjct  76   VLMTIGFIIMGSEAIMSYKAFPWSHEVRKVVHLVLHAIALVLGAVGIYCAFKFHNESGIA  135

Query  576  NLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANA  397
            NLYSLHSW+G+G   LYGIQW++GFV FF+PG    +RR++LPWHV FG FVYILA+A+A
Sbjct  136  NLYSLHSWVGLGTICLYGIQWIFGFVTFFFPGAAPTLRRDALPWHVFFGLFVYILALASA  195

Query  396  LLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
             LGFLEKLTFL+S+GL KYGSEAFLVNFTA+  ++ GV V ++ ++ A  ED HSY+AI
Sbjct  196  ELGFLEKLTFLQSTGLAKYGSEAFLVNFTALVVILLGVSVVISAIAPAHIEDPHSYTAI  254



>ref|NP_567723.1| transmembrane ascorbate ferrireductase 1 [Arabidopsis thaliana]
 sp|Q8L856.1|ACFR1_ARATH RecName: Full=Transmembrane ascorbate ferrireductase 1; AltName: 
Full=Cytochrome b561; Short=Artb561-1; Short=AtCytb561; 
AltName: Full=Protein b561A.tha5; AltName: Full=Tonoplast Cyt-b561; 
Short=TCytb [Arabidopsis thaliana]
 gb|AAM53288.1| putative protein [Arabidopsis thaliana]
 gb|AAN72187.1| putative protein [Arabidopsis thaliana]
 gb|AEE85078.1| transmembrane ascorbate ferrireductase 1 [Arabidopsis thaliana]
Length=239

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 193/239 (81%), Gaps = 9/239 (4%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+  + VAHA+A++ A++VLVW+I +RGGLAWE TNKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVRINAMAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPL+K VKK+IHL+LHAIAL LGI GICAAFKNHNES I NLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESHIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG QWVY F+VFF+PGG+ +++   LPWH + G FVYILAV NA LGFLEKLT
Sbjct  121  GIGVISLYGFQWVYSFIVFFFPGGSTNLKSGLLPWHAMLGLFVYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ-------APTED--DHSYSAI  220
            FLE+ GLDKYGSEAFL+NFTAI T+++G FV LT  ++          +D  D SYSAI
Sbjct  181  FLENGGLDKYGSEAFLINFTAIITILFGAFVVLTASAESPSPSPSVSNDDSVDFSYSAI  239



>ref|XP_006413294.1| hypothetical protein EUTSA_v10026122mg [Eutrema salsugineum]
 gb|ESQ54747.1| hypothetical protein EUTSA_v10026122mg [Eutrema salsugineum]
Length=237

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 192/237 (81%), Gaps = 7/237 (3%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+  + VAHA+A++ A++VL W+I +RGGLAWE  NKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVGINAMAVTFVAHALAVIAAIMVLFWSISYRGGLAWEAENKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYK+LPL+K VKK+IHLVLHAIAL LGI GICAAFKNHNESGI NLYSLHSWI
Sbjct  61   LGGEAIISYKALPLEKPVKKLIHLVLHAIALALGIWGICAAFKNHNESGIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LY  QWVY F+VFF+PGG+ ++R   LPWH + G F YILAV NA LGFLEKLT
Sbjct  121  GIGVISLYAFQWVYSFIVFFFPGGSPNLRSGLLPWHAMLGLFAYILAVGNAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA-------PTEDDHSYSAI  220
            FLE+ GLDKYGSEAFLVNF+AI T+++G FV LT+ +++         E ++SYSAI
Sbjct  181  FLENGGLDKYGSEAFLVNFSAIVTILFGAFVVLTVSAKSPSSSPPIDDEPNYSYSAI  237



>dbj|BAB21522.1| cytochrome b561 [Arabidopsis thaliana]
Length=237

 Score =   302 bits (773),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 173/212 (82%), Gaps = 9/212 (4%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGGLAWE TNKNLIFNLHPVLMLIGF+ILGGEAI+SYKSLPL+K VKK+IHL+LH
Sbjct  26   WSISYRGGLAWEATNKNLIFNLHPVLMLIGFIILGGEAIISYKSLPLEKPVKKLIHLILH  85

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL LGI GICAAFKNHNES I NLYSLHSWIGIGV  LYG QWVY F+VFF+PGG+ +
Sbjct  86   AIALALGIFGICAAFKNHNESHIPNLYSLHSWIGIGVISLYGFQWVYSFIVFFFPGGSTN  145

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            ++   LPWH + G FVYILAV NA LGFLEKLTFLE+ GLDKYGSEAFL+NFTAI T+++
Sbjct  146  LKSGLLPWHAMLGLFVYILAVGNAALGFLEKLTFLENGGLDKYGSEAFLINFTAIITILF  205

Query  288  GVFVFLTILSQ-------APTED--DHSYSAI  220
            G FV LT  ++          +D  D SYSAI
Sbjct  206  GAFVVLTASAESPSPSPSVSNDDSVDFSYSAI  237



>ref|XP_010908428.1| PREDICTED: ascorbate-specific transmembrane electron transporter 
2-like [Elaeis guineensis]
Length=232

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  +A PF+ V+H +A+  AV+VLVWNIHFRGGLA+E TNKNLIFN+HPVLM IGF+I+G
Sbjct  5    VGVRARPFTYVSHVLAVAAAVMVLVWNIHFRGGLAFESTNKNLIFNVHPVLMTIGFIIMG  64

Query  723  GEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGI  544
             EAIMSY++ P  +EV K++HL LHA+ALVLG +GI  AFKNHNESGIANLYSLHSW+G+
Sbjct  65   SEAIMSYRAFPGSREVNKIVHLTLHAVALVLGALGIYFAFKNHNESGIANLYSLHSWVGL  124

Query  543  GVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFL  364
            G   LYGIQWV+GFV+FF+PG   +++R +LPWHV FG FVYILA+ANA LGFLEK+TFL
Sbjct  125  GTICLYGIQWVFGFVIFFFPGAAPNLKRGALPWHVFFGLFVYILALANAELGFLEKITFL  184

Query  363  ESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            +S+GL KYG E+FLVNFTA+  ++ GVFV ++ ++ A  ED HSYSAI
Sbjct  185  QSTGLPKYGPESFLVNFTALVVILLGVFVLISAIAPAHIEDPHSYSAI  232



>gb|EPS69896.1| hypothetical protein M569_04865, partial [Genlisea aurea]
Length=218

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  KA+P + VAH +A+V A+LVLVWNI FRGG AWE   K LIFNLHPVLMLIGF+I
Sbjct  1    MAIGLKAVPVAYVAHFLAIVAAILVLVWNISFRGGFAWETETKALIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI++YKSLPLKK  KK+IHL+LH  AL LGI+GI AAFK HNES IANLYS HSW+
Sbjct  61   LGGEAIIAYKSLPLKKPQKKLIHLLLHFTALALGILGIYAAFKYHNESNIANLYSFHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LY IQWVYGF+VFFYPGG A IR  SLPWHVL G FVY+LA+A A LGFLEKLT
Sbjct  121  GIGVITLYAIQWVYGFLVFFYPGGPAAIRSVSLPWHVLVGVFVYVLALAAASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ  256
            FLES GL KYG+EAFLVNFTA+ T+++G FV LT LSQ
Sbjct  181  FLESGGLPKYGAEAFLVNFTAVVTILFGTFVILTTLSQ  218



>ref|XP_010905108.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Elaeis guineensis]
Length=235

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 185/228 (81%), Gaps = 0/228 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  +ALPF+  +H +A   AV+VLVWNIHFRGGLA+E TNKNLIFN+HPVLM IGF+I+G
Sbjct  5    VGVRALPFTYASHVLAAAAAVMVLVWNIHFRGGLAFESTNKNLIFNVHPVLMTIGFIIMG  64

Query  723  GEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGI  544
             EAIMSYK+ P   EV KV+HLVLHAIALVLG VGI  AFK HNESGI NLYSLHSW+G+
Sbjct  65   SEAIMSYKAFPGSHEVHKVVHLVLHAIALVLGAVGIYFAFKFHNESGIDNLYSLHSWVGL  124

Query  543  GVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFL  364
            G   LYGIQW++GFV FF+PG   ++RR++LPWHV FG FVYILA+A+A LGFLEKLTFL
Sbjct  125  GTICLYGIQWIFGFVTFFFPGAAPNLRRDALPWHVFFGLFVYILALASAQLGFLEKLTFL  184

Query  363  ESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            +S+GL KYGSEAFLVNFTA+  ++ GV V ++ ++ A  E+ HSYS I
Sbjct  185  QSTGLAKYGSEAFLVNFTALVVILLGVSVVISAMAPAHVEEPHSYSPI  232



>ref|XP_008794188.1| PREDICTED: ascorbate-specific transmembrane electron transporter 
2-like [Phoenix dactylifera]
Length=232

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 183/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  906  AIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVIL  727
            ++  + LPF+  AH +A   AV+VLVWNIHFRGGLA+E +NKNLIFN+HPVLM+IGF+I+
Sbjct  4    SVGVRPLPFTFAAHVLAAAAAVMVLVWNIHFRGGLAFESSNKNLIFNVHPVLMIIGFIIM  63

Query  726  GGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIG  547
            G EAIMSYKS P  +EV K++HL+LHAIALVLG  GI  AFKNHNESGIANLYSLHSW+G
Sbjct  64   GSEAIMSYKSFPWSREVNKMVHLILHAIALVLGAFGIYFAFKNHNESGIANLYSLHSWVG  123

Query  546  IGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTF  367
            +G   LYGIQW++GFV +F+PG    +RR  LP HV FG FVYILA+ANA LGFLEKLTF
Sbjct  124  LGTICLYGIQWIFGFVTYFFPGAQPSVRRNVLPLHVFFGLFVYILAIANAELGFLEKLTF  183

Query  366  LESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            LES+GL KYG EAFLVNFTA+  ++ GV V ++  + A TED  SYSAI
Sbjct  184  LESTGLPKYGPEAFLVNFTALVVILLGVTVVISAATPAHTEDSLSYSAI  232



>ref|XP_002510795.1| cytochrome B561, putative [Ricinus communis]
 gb|EEF51397.1| cytochrome B561, putative [Ricinus communis]
Length=231

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 195/231 (84%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+  KALPF+ VAHA+ ++ A++VLVW I FRGGLAWE  NKNLIFN+HPVLMLIG VI
Sbjct  1    MALEVKALPFTFVAHALGIIGAIMVLVWCIDFRGGLAWEAVNKNLIFNIHPVLMLIGLVI  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GG+AIMSYKSLPLKKE KK++HLVLHAIAL+LG +GI  AFKNHNESGIANLYSLHSW+
Sbjct  61   IGGQAIMSYKSLPLKKEKKKLVHLVLHAIALILGCIGIYTAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI +  LYGIQW+YGF+VFF+PG  A +R  SLPWHV+FG  VYILAVANA LGFLEKLT
Sbjct  121  GITIISLYGIQWIYGFIVFFFPGAPAAVRSASLPWHVIFGVLVYILAVANAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA-PTEDDHSYSAI  220
            FLES GL KYGSEA LVNFTAI  ++YG+FV L+  SQ  P EDD+SYSAI
Sbjct  181  FLESGGLAKYGSEALLVNFTAIVAILYGIFVILSTFSQGPPVEDDYSYSAI  231



>ref|NP_001237148.1| uncharacterized protein LOC100527259 [Glycine max]
 gb|ACU16317.1| unknown [Glycine max]
 gb|KHN21738.1| Transmembrane ascorbate ferrireductase 1 [Glycine soja]
Length=231

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALP + VAH +A+V +VLV+VW ++FRGGLAW+  NK+LIFN+HPVL++IG ++
Sbjct  1    MALGVPALPLTYVAHVLAVVASVLVVVWVVNFRGGLAWDSDNKSLIFNIHPVLIVIGLLV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
             GGEAI+SYK+ PLKKEVKK+IHLV HAIAL+LGIVGI  AFK HNESGIANLYSLHSW+
Sbjct  61   HGGEAIISYKAFPLKKEVKKLIHLVFHAIALILGIVGIYTAFKFHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFV+FF+PGGT DIRR SLPWH LFG FV++LAV  A LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFVIFFFPGGTPDIRRASLPWHALFGLFVFVLAVGTAALGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTIL  262
            FLE+SGLDKYGSEA LVNFTAI T+++G FV L+ L
Sbjct  181  FLENSGLDKYGSEALLVNFTAIITILFGAFVVLSAL  216



>ref|XP_007143403.1| hypothetical protein PHAVU_007G069600g [Phaseolus vulgaris]
 gb|ESW15397.1| hypothetical protein PHAVU_007G069600g [Phaseolus vulgaris]
Length=231

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +   A P + V+H + +V  +LVLVW ++FRGGLAW+  NK LIFN+HP L++ G ++
Sbjct  1    MGLGVPAFPLTIVSHVLGVVATILVLVWVVNFRGGLAWDADNKQLIFNIHPFLIVFGLIV  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
             GGEAI+SYKSLPLKKEVKK++HL LH  ALVLGI+GI  AFK HNESGIANLYSLHSW+
Sbjct  61   HGGEAIISYKSLPLKKEVKKLVHLGLHGAALVLGIIGIYTAFKYHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFV+FFYPGGT D+RR SLPWH LFG FV++LAV  A LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFVIFFYPGGTPDVRRFSLPWHALFGLFVFVLAVGTATLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLT  268
            FLESSGLDKYG+EA LVNFTAI T+++GVF+ L+
Sbjct  181  FLESSGLDKYGTEALLVNFTAIVTILFGVFIVLS  214



>ref|XP_002322468.2| hypothetical protein POPTR_0015s13160g [Populus trichocarpa]
 gb|EEF06595.2| hypothetical protein POPTR_0015s13160g [Populus trichocarpa]
Length=210

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 4/195 (2%)
 Frame = -2

Query  792  DTNKNLIF----NLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGI  625
             +N NL+      LHP LML G +I+GGEAIMSYKSLPLKKEVKK+IHLVLHAIA++LG 
Sbjct  16   SSNVNLVSVFLQQLHPFLMLFGLIIIGGEAIMSYKSLPLKKEVKKLIHLVLHAIAIILGC  75

Query  624  VGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPW  445
            VGI AAFKNHNES IANLYSLHSW+GI +  LYGIQW+YGF+VFFYP G+  +R E LPW
Sbjct  76   VGIAAAFKNHNESNIANLYSLHSWLGITIISLYGIQWIYGFLVFFYPKGSPTLRSECLPW  135

Query  444  HVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTI  265
            HVLFG FVYILAV NA LGFLEKLTFLESSG+ KYGSEA LVNFTA+ TV+YG FV L++
Sbjct  136  HVLFGIFVYILAVGNAALGFLEKLTFLESSGIAKYGSEALLVNFTAVVTVLYGAFVILSV  195

Query  264  LSQAPTEDDHSYSAI  220
            L QAP EDD SYSAI
Sbjct  196  LGQAPVEDDDSYSAI  210



>ref|XP_010442754.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Camelina 
sativa]
Length=233

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 167/202 (83%), Gaps = 1/202 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE TNKNLIFNLHPVLMLIG +ILGGEAI+SYK L ++K+ KK IHLVLH
Sbjct  28   WSISYRGGFAWESTNKNLIFNLHPVLMLIGLIILGGEAIISYKWLRIEKQKKKKIHLVLH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL+LGI GICAAFKNHNES I NLYSLHSWIGIGV V Y  QW Y F++FF+P G++ 
Sbjct  88   AIALILGICGICAAFKNHNESHIPNLYSLHSWIGIGVIVFYAFQWHYSFIIFFFPRGSST  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R   LPWH   G FVYILAV N+ LGFLEKLTF+E+SGLDKYGSEAFLVNF AI T+++
Sbjct  148  LRSNLLPWHAFLGLFVYILAVGNSALGFLEKLTFMENSGLDKYGSEAFLVNFMAIVTILF  207

Query  288  GVFVFLTILSQ-APTEDDHSYS  226
            G FV LT+ ++ AP+ ++++YS
Sbjct  208  GTFVILTVSAKPAPSSNEYNYS  229



>ref|XP_008778726.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Phoenix dactylifera]
Length=242

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLA+E TNK+LIFN+HPVLMLIGF+I+G EAIMSY++LP  KEVKK+IHL+LH
Sbjct  37   WCIHFRGGLAFESTNKSLIFNVHPVLMLIGFIIIGSEAIMSYRALPFSKEVKKLIHLILH  96

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIALVLG VGI AAFK HNESGIANLYSLHSWIG+G   LYGIQW++GFV FFYPG +  
Sbjct  97   AIALVLGAVGIYAAFKYHNESGIANLYSLHSWIGLGTICLYGIQWIFGFVTFFYPGASLA  156

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             +R +LPWHVLFG FVYILAV  A LGFLEKLTFLE+SGL KY SEAFLVNFTA+  +  
Sbjct  157  FKRVALPWHVLFGLFVYILAVGAAELGFLEKLTFLENSGLAKYSSEAFLVNFTALVVIFL  216

Query  288  GVFVFLTILSQAPTEDDHSYSAI  220
            G  V ++ ++    ED H Y+A+
Sbjct  217  GACVVISTIAPYHVEDPHDYTAV  239



>ref|XP_007218307.1| hypothetical protein PRUPE_ppa010860mg [Prunus persica]
 gb|EMJ19506.1| hypothetical protein PRUPE_ppa010860mg [Prunus persica]
Length=232

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 207/232 (89%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+PF+ VAH +A+   VLVLVWNIHFRGG AWE TNKNLIFNLHP+LML+G +I
Sbjct  1    MALRVPAIPFTFVAHTLAIAALVLVLVWNIHFRGGFAWEATNKNLIFNLHPLLMLLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPLKK+VKK+IHLVLHA+AL LGI+GI AAFKNHNESGIANLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLKKQVKKLIHLVLHALALALGIIGIYAAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGF++FFYPGG++ +R E +PWHV+FG  VY+LAVANA LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFLIFFYPGGSSTLRSECMPWHVVFGLLVYVLAVANASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPT--EDDHSYSAI  220
            FLESSG+ K+GSEAFLVNFTA++T+++GVFV +++LS+AP   EDD+SYS+I
Sbjct  181  FLESSGVAKFGSEAFLVNFTALTTILFGVFVVISVLSEAPAPIEDDNSYSSI  232



>gb|AFN53683.1| hypothetical protein [Linum usitatissimum]
Length=422

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 185/224 (83%), Gaps = 1/224 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   ALPF+ VAH I +  AV+VLVW I+FRGGLAWEDTNKNLIFN+HPVLMLIG +I
Sbjct  1    MALTVNALPFTFVAHLIGIAAAVMVLVWCIYFRGGLAWEDTNKNLIFNIHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPLKKE KK+ HL+LH +AL+LGI+GI AAFK HNESGI NLYSLHSW+
Sbjct  61   IGGEAIISYKSLPLKKEAKKLTHLILHGVALILGIIGIYAAFKFHNESGIDNLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GI V  LYGIQW+YG ++FFYPGG++ +R+ S+PWHVL G F+++LA+  A +G LEKLT
Sbjct  121  GILVISLYGIQWIYGLIIFFYPGGSSTLRKTSIPWHVLLGLFIFVLAIGTAAIGLLEKLT  180

Query  369  FLESS-GLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTED  241
            FLE+   L KYGSEA LVNFTA+ T++YG FV L++L ++  E+
Sbjct  181  FLENGIKLPKYGSEALLVNFTAVVTILYGAFVILSVLGRSQEEE  224



>ref|XP_006647595.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1-like [Oryza brachyantha]
Length=234

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 188/231 (81%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M + A+A PF+ VAHA+A+  A +VLVW IHFRGGLA+E TNKNLIFN+HPVLMLIG++I
Sbjct  1    MGLGARAAPFTYVAHALAVAAAAMVLVWCIHFRGGLAFEATNKNLIFNVHPVLMLIGYLI  60

Query  729  LGGEAIMSYKSLPL-KKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK LP  K +  K+IHL+LHAIALVLG++GI  AFK HNESGIANLYSLHSW
Sbjct  61   LGSEAIMVYKVLPTWKHDSTKLIHLILHAIALVLGVIGIYCAFKFHNESGIANLYSLHSW  120

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GFV FF+P  + ++R+ +LPWH+LFG FVYILA+A A LGFLEKL
Sbjct  121  LGIGTICLYGIQWIFGFVTFFFPRASPNVRKGALPWHILFGLFVYILALATAQLGFLEKL  180

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFL+SSGLDKYG+EAFLVNFTA++ V++G  V +  +S A  E+ H Y+ I
Sbjct  181  TFLQSSGLDKYGAEAFLVNFTALAVVLFGASVVVAAVSPARFEEPHDYAPI  231



>ref|XP_009397940.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Musa acuminata subsp. malaccensis]
Length=235

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = -2

Query  894  KALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEA  715
            K  PF+ V+H +A+  A +VLVW IHFRGGLA+E TNK+LIFN+HPVLMLIGF+I+G EA
Sbjct  8    KVAPFTYVSHVLAVASAAMVLVWCIHFRGGLAFESTNKSLIFNIHPVLMLIGFIIVGSEA  67

Query  714  IMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVA  535
            IMSYK+LPL  EV KVIHL LHAIALVLG VGI AAFK HNESGI NLYSLHSW+G+G  
Sbjct  68   IMSYKTLPLSHEVNKVIHLTLHAIALVLGAVGIYAAFKFHNESGIDNLYSLHSWVGLGTI  127

Query  534  VLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESS  355
             LYGIQW++GFV FF+PG +  +R +SLPWHVLFG FVYILA+A A LGFLEKLTFLESS
Sbjct  128  CLYGIQWIFGFVTFFFPGASPTLRGKSLPWHVLFGLFVYILAIATAELGFLEKLTFLESS  187

Query  354  GLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            GL KY SE+FLVNFTA+  +  G  V ++ ++ A  +    YS+I
Sbjct  188  GLYKYSSESFLVNFTALVVIFLGASVVISAIAPAHVDAPQGYSSI  232



>ref|XP_006279689.1| hypothetical protein CARUB_v10027027mg [Capsella rubella]
 gb|EOA12587.1| hypothetical protein CARUB_v10027027mg [Capsella rubella]
Length=240

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 168/208 (81%), Gaps = 5/208 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE TNK LIFNLHP LMLIG VILGGEAI+S+K L L+K VKK IHLVLH
Sbjct  28   WSISYRGGFAWESTNKRLIFNLHPPLMLIGLVILGGEAIISHKWLQLEKPVKKKIHLVLH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL+LGI GICAAFKNHNES I NLYSLHSWIGIGV V+Y +QW+Y F+VFFYP G+  
Sbjct  88   AIALILGIWGICAAFKNHNESNIPNLYSLHSWIGIGVIVIYVLQWLYSFIVFFYPRGSTP  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R   LPWHV  G FVY+LAV N  LGFLEKLTF+E+SGLDK+GSEAFL+NF AI T+++
Sbjct  148  LRSNLLPWHVFLGLFVYVLAVGNTALGFLEKLTFMETSGLDKFGSEAFLINFMAIITILF  207

Query  288  GVFVFLTI-LSQAPT----EDDHSYSAI  220
            G FV L +  + AP+    ED++SYSA+
Sbjct  208  GTFVILIVSATPAPSSDDVEDNYSYSAL  235



>ref|XP_010444670.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Camelina 
sativa]
Length=234

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE TNKNLIFNLHPVLMLIG +ILGGEAI+SYK L  +K+ KK IHLVLH
Sbjct  28   WSISYRGGFAWESTNKNLIFNLHPVLMLIGLIILGGEAIISYKWLRNEKQKKKKIHLVLH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL+LGI GICAAFKNHNES I NLYSLHSWIGIGV VLY  QW Y F+VFF+P G++ 
Sbjct  88   AIALILGIWGICAAFKNHNESHIPNLYSLHSWIGIGVIVLYAFQWHYSFIVFFFPRGSST  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R   LPWH   G FVY+LAV N+ LGFLEKLTF+E+SGLDK+GSEAFLVNF AI T+++
Sbjct  148  LRSNLLPWHAFLGLFVYVLAVGNSALGFLEKLTFMENSGLDKFGSEAFLVNFMAIVTILF  207

Query  288  GVFVFLTILSQA--PTEDDHSYS  226
            G FV LT+ ++   P+ D+++Y+
Sbjct  208  GTFVILTVSAKPADPSSDEYNYT  230



>ref|XP_008234253.1| PREDICTED: transmembrane ascorbate ferrireductase 1 [Prunus mume]
Length=232

 Score =   286 bits (733),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 203/232 (88%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+PF+ VAH + +   VLVLVWNIHFRGG AWE  NKNLIFNLHP+LML+G +I
Sbjct  1    MALRVPAIPFTFVAHTLGIAALVLVLVWNIHFRGGFAWEAANKNLIFNLHPLLMLLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+SYKSLPLKK+VKK+IHLVLHA+AL LGI+GI AAFKNHNESGIANLYSLHSWI
Sbjct  61   LGGEAIISYKSLPLKKQVKKLIHLVLHALALALGIIGIYAAFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGF++FFYPGG+  +R E +PWHV+FG  VY+LAVANA LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFLIFFYPGGSPILRSECMPWHVVFGLLVYVLAVANASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPT--EDDHSYSAI  220
            FLESSG+ K+GSEAFLVNFTA+ T+++GVFV +++LS+AP   EDDHSYS+I
Sbjct  181  FLESSGVAKFGSEAFLVNFTALITILFGVFVVISVLSEAPAPIEDDHSYSSI  232



>ref|XP_004953261.1| PREDICTED: ascorbate-specific transmembrane electron transporter 
2-like [Setaria italica]
Length=234

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+  +A PF+ VAH +A+  A +VLVW IHFRGGLA E TNKNLIFN+HPVLMLIG++I
Sbjct  1    MALGVRAAPFTYVAHVLAVAAAAMVLVWAIHFRGGLAIEATNKNLIFNVHPVLMLIGYII  60

Query  729  LGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            +G EAIM YK+ P L  +  K+IHL+LH IALVLG VGI  AFKNHNESGIANLYSLHSW
Sbjct  61   IGSEAIMVYKAFPTLNHDTAKLIHLILHGIALVLGAVGIYFAFKNHNESGIANLYSLHSW  120

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            IGIG  +LYGIQW++GFV FF+PG   ++R+  LPWH+LFG FVYILA+ANA LGFLEKL
Sbjct  121  IGIGTIILYGIQWIFGFVTFFFPGAAPNLRKSVLPWHILFGLFVYILALANASLGFLEKL  180

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFLES GLDKYG+EAFLVNFTA+  V++G  V +  ++ A  E+   Y+ I
Sbjct  181  TFLESGGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPARLEEPQGYAPI  231



>sp|A3A9H6.1|ACET1_ORYSJ RecName: Full=Probable ascorbate-specific transmembrane electron 
transporter 1; AltName: Full=Cytochrome b561-1 [Oryza sativa 
Japonica Group]
 gb|EAZ23965.1| hypothetical protein OsJ_07691 [Oryza sativa Japonica Group]
Length=234

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +  +A PF+ VAHA+A+  A +VLVW IHFRGGLA+E TNKNLIFN+HPVLMLIG++I
Sbjct  1    MGLGVRAAPFTYVAHALAVAAATMVLVWCIHFRGGLAFEATNKNLIFNVHPVLMLIGYII  60

Query  729  LGGEAIMSYKSLPL-KKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK LP  K +  K+IHL+LHAIALV G VGI  AFK HNESGIANLYSLHSW
Sbjct  61   LGSEAIMVYKVLPTWKHDTTKLIHLILHAIALVFGAVGIYCAFKFHNESGIANLYSLHSW  120

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GFV FF+P  +  +R+  LPWH+LFG FVYILA+A A LGFLEKL
Sbjct  121  LGIGTICLYGIQWIFGFVAFFFPRASPSVRKGVLPWHILFGLFVYILALATAELGFLEKL  180

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFL+SSGLDKYG+EAFLVNFTA+  V++G  V +  +S A  E+ H Y+ I
Sbjct  181  TFLQSSGLDKYGAEAFLVNFTALIVVLFGASVVVAAVSPARVEEPHEYAPI  231



>ref|XP_010940462.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Elaeis guineensis]
Length=232

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLA+E TNK+LIFN+HPVLMLIGF+I+G EAIMSY++LPL KEVKK IHL+L 
Sbjct  27   WCIHFRGGLAFESTNKSLIFNVHPVLMLIGFIIIGSEAIMSYRALPLSKEVKKRIHLILQ  86

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIA+VLG VGI AAFK HNESGIANLYSLHSWIG+G   LYGIQW+ GF+ FFYPG   D
Sbjct  87   AIAIVLGAVGIYAAFKYHNESGIANLYSLHSWIGLGTICLYGIQWILGFITFFYPGAALD  146

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             ++ +LPWH LFG FVY LAV  A LGFLEKLTFLE S + K+GSEAFLVNFTA+  +  
Sbjct  147  FKQVALPWHALFGLFVYALAVGAAELGFLEKLTFLEESDVAKFGSEAFLVNFTALVVIFL  206

Query  288  GVFVFLTILSQAPTEDDHSYSAI  220
            G FV ++ +S    ED H Y+ +
Sbjct  207  GAFVVISTVSPNHEEDPHDYTTV  229



>gb|EAY86856.1| hypothetical protein OsI_08240 [Oryza sativa Indica Group]
Length=234

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +  +A PF+ VAHA+A+  A +VLVW IHFRGGLA+E TNKNLIFN+HPVLMLIG++I
Sbjct  1    MGLGVRAAPFTYVAHALAVAAATMVLVWCIHFRGGLAFEATNKNLIFNVHPVLMLIGYII  60

Query  729  LGGEAIMSYKSLPL-KKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK LP  K +  K+IHL+LHAIALV G VGI  AFK HNESGIANLYSLHSW
Sbjct  61   LGSEAIMVYKVLPTWKHDTTKLIHLILHAIALVFGAVGIYCAFKFHNESGIANLYSLHSW  120

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GFV FF+P  +  +R+  LPWH+LFG FVYILA+A   LGFLEKL
Sbjct  121  LGIGTICLYGIQWIFGFVAFFFPRASPSVRKGVLPWHILFGLFVYILALATVELGFLEKL  180

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFL+SSGLDKYG+EAFLVNFTA+  V++G  V +  +S A  E+ H Y+ I
Sbjct  181  TFLQSSGLDKYGAEAFLVNFTALIVVLFGASVVVAAVSPARVEEPHEYAPI  231



>ref|NP_001140931.1| ascorbate-specific transmembrane electron transporter 1 [Zea 
mays]
 sp|Q6I681.1|ACET1_MAIZE RecName: Full=Ascorbate-specific transmembrane electron transporter 
1; AltName: Full=Cytochrome b561-1; Short=Zmb561 [Zea 
mays]
 dbj|BAD24966.1| cytochrome b561 [Zea mays]
 gb|ACF84988.1| unknown [Zea mays]
 gb|ACG34825.1| cytochrome b561 [Zea mays]
 gb|AFW63184.1| cytochrome b561 [Zea mays]
Length=236

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            + +  +A PF+  AHA+A+  A +VLVW+I FRGGLA E TNKNLIFN+HPVLMLIG+VI
Sbjct  3    LGLGVRAAPFTYAAHALAVAAAAMVLVWSIQFRGGLAIESTNKNLIFNVHPVLMLIGYVI  62

Query  729  LGGEAIMSYKSLPLKK-EVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            +GGEAIM Y+ LP    +  K+IHL+LH IALVLG VGI  AFKNHNESGIANLYSLHSW
Sbjct  63   IGGEAIMVYRVLPTSNHDTTKLIHLILHGIALVLGAVGIYFAFKNHNESGIANLYSLHSW  122

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            IGIG   LYGIQW+ GFV FF+PG   ++++  LPWHVLFG FVYILA+ANA LGFLEKL
Sbjct  123  IGIGTITLYGIQWIIGFVTFFFPGAAPNVKKGVLPWHVLFGLFVYILALANAELGFLEKL  182

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFLESSGLDKYG+EAFLVNFTA+  V++G  V +  ++    E+   Y  I
Sbjct  183  TFLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYDPI  233



>ref|XP_007038680.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 2 [Theobroma cacao]
 gb|EOY23181.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 2 [Theobroma cacao]
Length=225

 Score =   281 bits (719),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLAW+ +NKN IFNLHPVLMLIGF+ILGGEAIMSYKSLPL K+VKK++HLVLH
Sbjct  26   WCIHFRGGLAWDSSNKNHIFNLHPVLMLIGFIILGGEAIMSYKSLPLSKDVKKLMHLVLH  85

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIAL+LGI+GI  AFK HNES I NLYSLHSW+G+G+ VLYGIQW+YGF+VFFYP G+A 
Sbjct  86   AIALILGIIGIYTAFKYHNESSIVNLYSLHSWLGMGIIVLYGIQWIYGFLVFFYPEGSAG  145

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R ESLPWHVL G FVYILAV NA LGFLEKLTFLE+SGL ++G+EA+LVNFTA+ T++Y
Sbjct  146  LRSESLPWHVLLGLFVYILAVGNASLGFLEKLTFLENSGLARHGAEAYLVNFTAVVTILY  205

Query  288  GVFVFLTILSQ  256
            G FV  T+L+Q
Sbjct  206  GAFVIFTVLNQ  216



>ref|XP_009340012.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Pyrus 
x bretschneideri]
Length=233

 Score =   281 bits (719),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 196/232 (84%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+ F+ V H + +   VLVLVW IHFRGGLAWE TNKNLIFNLHPVLML+G +I
Sbjct  1    MALKVPAVAFTSVVHTLGIAALVLVLVWTIHFRGGLAWEATNKNLIFNLHPVLMLLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEA++SYKSLP  K++KKVIHLVLHA+AL LGI+GI  AFKNHNESGIAN+YS H+WI
Sbjct  61   LGGEALVSYKSLPFNKKMKKVIHLVLHALALALGIIGIYLAFKNHNESGIANMYSSHAWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VLYGIQW+YGFV FF+PGG+  +RRES+PWHV+FG  VY+LAV +A LGFLEKLT
Sbjct  121  GIGVIVLYGIQWIYGFVTFFFPGGSPTLRRESIPWHVVFGIIVYVLAVGDASLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA--PTEDDHSYSAI  220
            FLE SGLDK+G+EAFLVNFT I TV++GVFV L+++S+A  P ED +SYS+I
Sbjct  181  FLERSGLDKFGTEAFLVNFTTIITVLFGVFVILSVISEAPPPVEDYYSYSSI  232



>ref|XP_009410543.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=235

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 177/227 (78%), Gaps = 0/227 (0%)
 Frame = -2

Query  900  AAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGG  721
            + KA PF+  +HA+AL  A +VLVW +HFRGGLA+E +NK+LIFN+HPVLMLIGF+I+G 
Sbjct  6    SVKAAPFTYASHALALASAAMVLVWCVHFRGGLAFESSNKSLIFNIHPVLMLIGFIIIGS  65

Query  720  EAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIG  541
            EAIMSYK+LP   E+ K++H  LHAIALVLG VGI AAFK HNESGI NLYSLHSW+G+G
Sbjct  66   EAIMSYKTLPWNHEMNKIVHFTLHAIALVLGAVGIYAAFKFHNESGIDNLYSLHSWVGLG  125

Query  540  VAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE  361
               LYGIQW+ GFV FF+PG    +R +SLPWHVLFG FVYILAVA A LGFLEKLTFLE
Sbjct  126  TISLYGIQWILGFVTFFFPGAPPALRGKSLPWHVLFGLFVYILAVATAELGFLEKLTFLE  185

Query  360  SSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            SSGL KY SEAFLVNFTA+  +  G  V +++++ A  +    YS I
Sbjct  186  SSGLYKYSSEAFLVNFTALILIFLGASVVISVIAPARADAPRGYSEI  232



>gb|KCW90707.1| hypothetical protein EUGRSUZ_A02792 [Eucalyptus grandis]
Length=177

 Score =   275 bits (702),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  750  MLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANL  571
            MLIG +I+GGEAI++YK+LPL KE KKVIH+VLHAIAL+LGI+G+ AAFK HNES IANL
Sbjct  1    MLIGLIIIGGEAIITYKTLPLNKETKKVIHMVLHAIALILGIIGVYAAFKYHNESSIANL  60

Query  570  YSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALL  391
            YSLHSW+GI + VLYGIQW+YGFV+FFYPGG + +R +SLPWHVLFG FVYILAVANA L
Sbjct  61   YSLHSWLGICIIVLYGIQWIYGFVIFFYPGGPSTLRSDSLPWHVLFGLFVYILAVANAAL  120

Query  390  GFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            GFLEKLTFLE+SGL K+GSEA LVNFTA+ TV++G FV +T+LSQ   EDD+SYSAI
Sbjct  121  GFLEKLTFLENSGLAKFGSEAILVNFTAVVTVLFGTFVIVTVLSQPVIEDDYSYSAI  177



>gb|KEH43715.1| transmembrane ascorbate ferrireductase [Medicago truncatula]
Length=176

 Score =   274 bits (701),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  750  MLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANL  571
            MLIG +I+GGEAI+SYKSLPLKKEVKK+IHLVLHA ALVLGI+GICAAFKNHNESGIANL
Sbjct  1    MLIGLIIIGGEAIISYKSLPLKKEVKKLIHLVLHAHALVLGIIGICAAFKNHNESGIANL  60

Query  570  YSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALL  391
            YSLHSW+GIGV  LYGIQW++GFVVFFYPGG++++RRES+PWHVLFG FVYILA+A + L
Sbjct  61   YSLHSWLGIGVISLYGIQWIFGFVVFFYPGGSSELRRESVPWHVLFGLFVYILALATSSL  120

Query  390  GFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            GFLEKLTFLESSG+ KYG+EA LVNF AI T+++G FV L+ +SQAP   D
Sbjct  121  GFLEKLTFLESSGVAKYGAEALLVNFNAIITILFGTFVVLSAISQAPPAAD  171



>ref|NP_001170569.1| ascorbate-specific transmembrane electron transporter 2 [Zea 
mays]
 sp|C4IYS8.1|ACFR2_MAIZE RecName: Full=Ascorbate-specific transmembrane electron transporter 
2; AltName: Full=Cytochrome b561-2 [Zea mays]
 gb|ACR34078.1| unknown [Zea mays]
 gb|AFW72529.1| cytochrome b561 isoform 1 [Zea mays]
 gb|AFW72530.1| cytochrome b561 isoform 2 [Zea mays]
Length=236

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            + +  +A PF+  AHA+A+  A +VLVW I+FRGGLA E TNKNLIFN+HPVLMLIG++I
Sbjct  3    LGLGVRAAPFTYAAHALAVAAAAMVLVWAIYFRGGLAIEATNKNLIFNVHPVLMLIGYII  62

Query  729  LGGEAIMSYKSLPLKK-EVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            +GGEAIM Y+ LP    E  K+IHLVLH IALVLG VGI  AFKNHNESGIANLYSLHSW
Sbjct  63   IGGEAIMVYRVLPTSNHETNKLIHLVLHGIALVLGAVGIYFAFKNHNESGIANLYSLHSW  122

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            IGIG   LYGIQW+ GFV FF+PG   ++++  LPWH+LFG FVYILA+ANA LGFLEKL
Sbjct  123  IGIGTITLYGIQWIVGFVTFFFPGAAPNVKKGVLPWHILFGLFVYILALANAELGFLEKL  182

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFLESSGLDKYG+EAFLVNFTA+  V++G  V +  ++    E+   Y  I
Sbjct  183  TFLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYVPI  233



>emb|CDX91626.1| BnaC02g15340D [Brassica napus]
Length=233

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE TNK LIFNLHPVL L G VILGGEAI+SYKSLP +K V K+IHLV H
Sbjct  28   WSICYRGGFAWESTNKTLIFNLHPVLTLTGLVILGGEAIISYKSLPFEKRVNKLIHLVFH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIA++LGI+GI AAFK+HNE  I NLY++HSW+GIGV VLY +QW+Y F+++F+PGG++ 
Sbjct  88   AIAIILGILGIYAAFKHHNEKHIPNLYTIHSWVGIGVIVLYALQWLYSFIIYFFPGGSST  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +RR+ LPWH+ FG FVY+LAV N++LGFLEKLTFLE SGLDK+GSEAFLVNF AI T+++
Sbjct  148  LRRDLLPWHIFFGVFVYVLAVGNSVLGFLEKLTFLEKSGLDKFGSEAFLVNFMAIITILF  207

Query  288  GVFVFLTILSQAPT---EDDHSYSAI  220
            G FV L + S++P    ED++SYSAI
Sbjct  208  GTFVLLIVYSKSPPSVEEDNYSYSAI  233



>ref|XP_003569967.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 isoform X2 [Brachypodium distachyon]
Length=234

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 183/231 (79%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +  +A PF+ VAHA+A+  A +V+VW +HFRGGLA+E +NKNLIFN+HPVLMLIG++I
Sbjct  1    MGLGVRAAPFTYVAHALAVAAAAMVVVWCVHFRGGLAFEASNKNLIFNVHPVLMLIGYII  60

Query  729  LGGEAIMSYKSLPL-KKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK LP    +  K+IHL+LH IALVLG+VGI  AFK HNESGIANLYSLHSW
Sbjct  61   LGSEAIMVYKVLPTWNHDTTKLIHLILHGIALVLGVVGIYCAFKFHNESGIANLYSLHSW  120

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQWV+GF+ FF+PG   ++RR +LPWH+LFG FVYILA+A A LGFLEKL
Sbjct  121  LGIGTICLYGIQWVFGFLAFFFPGAAPNVRRGALPWHILFGMFVYILALATAELGFLEKL  180

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFL+SSGLDKYG+EAFLVNFTA+  V++G  V +  ++ A  E+   Y+ I
Sbjct  181  TFLQSSGLDKYGAEAFLVNFTALVVVLFGASVVVAAVAPARLEEPQGYAPI  231



>ref|XP_002452857.1| hypothetical protein SORBIDRAFT_04g033650 [Sorghum bicolor]
 gb|EES05833.1| hypothetical protein SORBIDRAFT_04g033650 [Sorghum bicolor]
Length=237

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 178/230 (77%), Gaps = 1/230 (0%)
 Frame = -2

Query  906  AIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVIL  727
             +  +A PF+  AHA+A+  A +VLVW I FRGGLA E TNKNLIFN+HPVLMLIG++I+
Sbjct  5    GLGVRAAPFTYAAHALAVAAAAMVLVWAIQFRGGLAIEATNKNLIFNVHPVLMLIGYIII  64

Query  726  GGEAIMSYKSLPLKK-EVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            GGEAIM Y+ LP    +  K+IHL+LH IALVLG VGI  AFKNHNESGIANLYSLHSWI
Sbjct  65   GGEAIMVYRVLPTTNHDTTKLIHLILHGIALVLGAVGIYFAFKNHNESGIANLYSLHSWI  124

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG   LYGIQW+ GFV FF+PG   ++++  LPWH+LFG FVYILA+ANA LGFLEKLT
Sbjct  125  GIGTITLYGIQWIIGFVTFFFPGAAPNVKKGVLPWHILFGLFVYILALANAELGFLEKLT  184

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLESSGLDKYG+EAFLVNFTA+  V++G  V +  ++    E+   Y+ I
Sbjct  185  FLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYAPI  234



>ref|XP_009127253.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Brassica 
rapa]
Length=233

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 171/206 (83%), Gaps = 3/206 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE TNK LIFNLHPVL L G VILGGEA +SYKSLP +K V K+IHLVLH
Sbjct  28   WSICYRGGFAWESTNKTLIFNLHPVLTLTGLVILGGEATISYKSLPFEKRVNKLIHLVLH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIA++LGI+GI AAFK+HNE  I NLY++HSW+GIGV VLY +QW+Y F+V+F+PGG++ 
Sbjct  88   AIAIILGILGIYAAFKHHNEKHIPNLYTIHSWVGIGVIVLYALQWLYSFIVYFFPGGSSA  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +RR+ LPWHV  G FVY+LAV N++LGFLEKLTFLE SGLDK+GSEAFLVNF AI T+++
Sbjct  148  LRRDLLPWHVFLGVFVYVLAVGNSVLGFLEKLTFLEKSGLDKFGSEAFLVNFMAIITILF  207

Query  288  GVFVFLTILSQAPT---EDDHSYSAI  220
            G FV L + S++P    ED++SYSAI
Sbjct  208  GTFVLLIVYSKSPPSVEEDNYSYSAI  233



>gb|ACG34049.1| cytochrome b561 [Zea mays]
Length=236

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 178/231 (77%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            + +  +A PF+  AHA+A+  A +VLVW I+FRGGLA E TNKNLIFN+HPVLMLIG++I
Sbjct  3    LGLGVRAAPFTYAAHALAVAAAAMVLVWAIYFRGGLAIEATNKNLIFNVHPVLMLIGYII  62

Query  729  LGGEAIMSYKSLPLKKE-VKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            +GGEAIM Y+ LP       K+IHLVLH IALVLG VGI  AFKNHNESGIANLYSLHSW
Sbjct  63   IGGEAIMVYRVLPTSNHGTNKLIHLVLHGIALVLGAVGIYFAFKNHNESGIANLYSLHSW  122

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            IGIG   LYGIQW+ GFV FF+PG   ++++  LPWH+LFG FVYILA+ANA LGFLEKL
Sbjct  123  IGIGTITLYGIQWIVGFVTFFFPGAAPNVKKGVLPWHILFGLFVYILALANAELGFLEKL  182

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFLESSGLDKYG+EAFLVNFTA+  V++G  V +  ++    E+   Y  I
Sbjct  183  TFLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYVPI  233



>dbj|BAD25232.1| putative cytochrome [Oryza sativa Japonica Group]
Length=249

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 182/246 (74%), Gaps = 16/246 (7%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFN------------  766
            M +  +A PF+ VAHA+A+  A +VLVW IHFRGGLA+E TNKNLIFN            
Sbjct  1    MGLGVRAAPFTYVAHALAVAAATMVLVWCIHFRGGLAFEATNKNLIFNRFKSVAHISNVE  60

Query  765  ---LHPVLMLIGFVILGGEAIMSYKSLPL-KKEVKKVIHLVLHAIALVLGIVGICAAFKN  598
               +HPVLMLIG++ILG EAIM YK LP  K +  K+IHL+LHAIALV G VGI  AFK 
Sbjct  61   TLQVHPVLMLIGYIILGSEAIMVYKVLPTWKHDTTKLIHLILHAIALVFGAVGIYCAFKF  120

Query  597  HNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVY  418
            HNESGIANLYSLHSW+GIG   LYGIQW++GFV FF+P  +  +R+  LPWH+LFG FVY
Sbjct  121  HNESGIANLYSLHSWLGIGTICLYGIQWIFGFVAFFFPRASPSVRKGVLPWHILFGLFVY  180

Query  417  ILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            ILA+A A LGFLEKLTFL+SSGLDKYG+EAFLVNFTA+  V++G  V +  +S A  E+ 
Sbjct  181  ILALATAELGFLEKLTFLQSSGLDKYGAEAFLVNFTALIVVLFGASVVVAAVSPARVEEP  240

Query  237  HSYSAI  220
            H Y+ I
Sbjct  241  HEYAPI  246



>ref|XP_007038678.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 3 [Theobroma cacao]
 gb|EOY23179.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 3 [Theobroma cacao]
Length=192

 Score =   272 bits (695),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  777  LIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKN  598
            L   LHPVLMLIGF+ILGGEAIMSYKSLPL K+VKK+IHLVLH IAL+LGI+GI  AFK 
Sbjct  7    LFLQLHPVLMLIGFIILGGEAIMSYKSLPLSKDVKKLIHLVLHGIALILGIIGIYTAFKY  66

Query  597  HNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVY  418
            HNES I NLYSLHSW+G+G+ VLYGIQW+YGF+VFFYPGG+A +R ESLPWHVL G FVY
Sbjct  67   HNESSIVNLYSLHSWLGMGIIVLYGIQWIYGFLVFFYPGGSAGLRSESLPWHVLLGLFVY  126

Query  417  ILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            ILA+ NA +GFLEKLTFLE+SGL KYG+EA+LVNFTA+ T++YG FV  T+ ++AP+EDD
Sbjct  127  ILAIGNASIGFLEKLTFLENSGLAKYGAEAYLVNFTAVVTILYGAFVIFTVFAKAPSEDD  186

Query  237  HSYSAI  220
            +SYSAI
Sbjct  187  NSYSAI  192



>emb|CDY27081.1| BnaA02g11010D [Brassica napus]
Length=233

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 3/206 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE T+K LIFNLHPVL L G VILGGEA +SYKSLP +K V K+IHLVLH
Sbjct  28   WSICYRGGFAWESTSKTLIFNLHPVLTLTGLVILGGEATISYKSLPFEKRVNKLIHLVLH  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIA++LGI+GI AAFK+HNE  I NLY++HSW+GIGV VLY +QW+Y F+V+F+PGG++ 
Sbjct  88   AIAIILGILGIYAAFKHHNEKHIPNLYTIHSWVGIGVIVLYALQWLYSFIVYFFPGGSSA  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +RR+ LPWHV  G FVY+LAV N++LGFLEKLTFLE SGLDK+GSEAFLVNF AI T+++
Sbjct  148  LRRDLLPWHVFLGVFVYVLAVGNSVLGFLEKLTFLEKSGLDKFGSEAFLVNFMAIITILF  207

Query  288  GVFVFLTILSQAPT---EDDHSYSAI  220
            G FV L + S++P    ED++SYSAI
Sbjct  208  GTFVLLIVYSKSPPSVEEDNYSYSAI  233



>ref|XP_009340016.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Pyrus 
x bretschneideri]
Length=235

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 191/232 (82%), Gaps = 2/232 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+ F+ V H + +    L+LVW IHFRGG AWE TNKNLIFNLHP LML+G +I
Sbjct  1    MALKVPAVAFTFVVHTLGVAALALMLVWTIHFRGGFAWEATNKNLIFNLHPFLMLLGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            LGGEAI+S+KSLP  KE KKVIHLVLHA+AL LGI+GI   FKNHNESGI NLYSLHSWI
Sbjct  61   LGGEAIVSHKSLPFNKETKKVIHLVLHALALALGIIGIYLVFKNHNESGIPNLYSLHSWI  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV VL GIQW+ GF+ FFYPGG+  +R ES+PWHV+FG  VY+LAV N+ LGFLEKLT
Sbjct  121  GIGVIVLCGIQWICGFLTFFYPGGSPTLRSESIPWHVVFGIIVYLLAVGNSSLGFLEKLT  180

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPT--EDDHSYSAI  220
            FLE+SGLDK+G+EAFLVNFTAI TV++GVFV L+++S+AP   EDD+S+S+I
Sbjct  181  FLENSGLDKFGTEAFLVNFTAIITVLFGVFVILSVISEAPAPVEDDNSFSSI  232



>dbj|BAJ98832.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=264

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +  +A PF+ VAHA+A+  A +VL W IHFRGGLA+E  NKNLIFN+HPVLMLIGF+I
Sbjct  31   MGLGVRAAPFTYVAHALAVAAAAMVLYWCIHFRGGLAFEADNKNLIFNVHPVLMLIGFII  90

Query  729  LGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK LP +  +  K+IHLVLHAIALVLG VGI  AFKNHNE+GIANLYSLHSW
Sbjct  91   LGSEAIMVYKVLPTVNHDTTKLIHLVLHAIALVLGAVGIYCAFKNHNETGIANLYSLHSW  150

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GF+ FF+P    ++R+ +LPWHVL G FVYILA+A A LGFLEKL
Sbjct  151  LGIGTISLYGIQWIFGFLTFFFPKAAPNVRKGALPWHVLLGIFVYILALATAELGFLEKL  210

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFL+SSG+DKYG E+FLVNFTA+  V+ G  V +  ++ A  E+   Y+ I
Sbjct  211  TFLQSSGIDKYGPESFLVNFTALVVVLLGASVVVAAVAPARLEEPQGYAPI  261



>gb|EMT23263.1| Cytochrome b561 [Aegilops tauschii]
Length=234

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            M +  +A PF+ VAHA+A+V A +VL W IHFRGGLA+E  NKNLIFN+HPVLMLIGF+I
Sbjct  1    MGLGVRAAPFTYVAHALAVVAAAMVLYWCIHFRGGLAFEAANKNLIFNVHPVLMLIGFII  60

Query  729  LGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK LP +  +  K+IHL+LHAIALVLG VGI  AFKNHNE+GIANLYSLHSW
Sbjct  61   LGSEAIMVYKVLPTVNHDTTKLIHLILHAIALVLGAVGIYCAFKNHNETGIANLYSLHSW  120

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GF+ FF+P    ++R+ +LPWH L G FVYILA+A A LGFLEKL
Sbjct  121  LGIGTISLYGIQWIFGFLAFFFPKAAPNVRKSALPWHALLGIFVYILALATAELGFLEKL  180

Query  372  TFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            TFL+SSG+DKYG E+FLVNFTA+  V++G  V + +++ A  E+   Y+ I
Sbjct  181  TFLQSSGIDKYGPESFLVNFTALVVVLFGASVVVAVVAPARLEEPQGYAPI  231



>gb|KDO60010.1| hypothetical protein CISIN_1g0269791mg, partial [Citrus sinensis]
Length=182

 Score =   266 bits (681),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  765  LHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNES  586
            LHPVLMLIG +I+GGEAIMSYK L L+KEVKKVIHLVLHAIAL+LGI+GI AAFK HNES
Sbjct  1    LHPVLMLIGLIIIGGEAIMSYKGLNLRKEVKKVIHLVLHAIALILGIIGIYAAFKYHNES  60

Query  585  GIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAV  406
             I NLYSLHSW+GI V  LYGIQW+YGFV+FFYPGG+  +R ESLPWHVLFG FVYILAV
Sbjct  61   AIVNLYSLHSWLGIAVISLYGIQWLYGFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAV  120

Query  405  ANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYS  226
            ANA +GFLEKLTFLE+SGL KYGSEA LVNFTA+ T++YG FV  ++ SQ P EDD+SYS
Sbjct  121  ANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVASQGPAEDDYSYS  180

Query  225  AI  220
            AI
Sbjct  181  AI  182



>ref|NP_001132893.1| uncharacterized protein LOC100194390 [Zea mays]
 gb|ACF81927.1| unknown [Zea mays]
 gb|ACG34405.1| cytochrome b561 [Zea mays]
 tpg|DAA36687.1| TPA: cytochrome b561 [Zea mays]
Length=237

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  KA PF+  AHA+A V A LVLVW +HFRGGLA E  NKNLIFN+HPVLMLIG++ILG
Sbjct  6    LGVKATPFTYAAHALAAVAAALVLVWCVHFRGGLALEAQNKNLIFNVHPVLMLIGYIILG  65

Query  723  GEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIG  547
             EAIM YK  P L  +  K+ HL+LHA+A VLG  GI  AFK HN+SGIANLYSLHSW+G
Sbjct  66   SEAIMIYKVFPNLNHDTAKLTHLILHAVATVLGAFGIYCAFKYHNDSGIANLYSLHSWLG  125

Query  546  IGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTF  367
            IG   LY IQWV+GFV FF PG    +RR +LPWH LFG FVY+LA+A A LGFLEKLTF
Sbjct  126  IGTIALYAIQWVFGFVTFFLPGAAPGVRRGALPWHALFGLFVYVLALATAELGFLEKLTF  185

Query  366  LESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            LES GLDKYG+EAFLVNFTA+  V+ G FV +  ++ A  E+   Y+ I
Sbjct  186  LESGGLDKYGAEAFLVNFTALVVVLLGAFVVVAAVTPAHAEEPRGYAPI  234



>gb|EMS55631.1| Cytochrome b561 [Triticum urartu]
Length=211

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLP-LKKEVKKVIHLVL  652
            W IHFRGGLA+E  NKNLIFN+HPVLMLIGF+ILG EAIM YK LP +  +  K+IHLVL
Sbjct  5    WCIHFRGGLAFEADNKNLIFNVHPVLMLIGFIILGSEAIMIYKVLPTVNHDTTKLIHLVL  64

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HAIALVLG VGI  AFKNHNE+GIANLYSLHSW+GIG   LYGIQW++GF+ FF+P    
Sbjct  65   HAIALVLGAVGIYCAFKNHNETGIANLYSLHSWLGIGTISLYGIQWIFGFLAFFFPKAAP  124

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
            ++R+ +LPWHVL G FVYILA+A A LGFLEKLTFL+SSG+DKYG E+FLVNFTA+  V+
Sbjct  125  NVRKGALPWHVLLGIFVYILALATAELGFLEKLTFLQSSGIDKYGPESFLVNFTALVVVL  184

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
            +G  V +  ++ A  E+   Y+ I
Sbjct  185  FGASVVVAAVAPARLEEPQDYAPI  208



>ref|XP_006374625.1| hypothetical protein POPTR_0015s13160g [Populus trichocarpa]
 gb|ERP52422.1| hypothetical protein POPTR_0015s13160g [Populus trichocarpa]
Length=164

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  711  MSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAV  532
            MSYKSLPLKKEVKK+IHLVLHAIA++LG VGI AAFKNHNES IANLYSLHSW+GI +  
Sbjct  1    MSYKSLPLKKEVKKLIHLVLHAIAIILGCVGIAAAFKNHNESNIANLYSLHSWLGITIIS  60

Query  531  LYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG  352
            LYGIQW+YGF+VFFYP G+  +R E LPWHVLFG FVYILAV NA LGFLEKLTFLESSG
Sbjct  61   LYGIQWIYGFLVFFYPKGSPTLRSECLPWHVLFGIFVYILAVGNAALGFLEKLTFLESSG  120

Query  351  LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            + KYGSEA LVNFTA+ TV+YG FV L++L QAP EDD SYSAI
Sbjct  121  IAKYGSEALLVNFTAVVTVLYGAFVILSVLGQAPVEDDDSYSAI  164



>ref|XP_002867604.1| hypothetical protein ARALYDRAFT_329112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43863.1| hypothetical protein ARALYDRAFT_329112 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+  + VAHA+A++ A++VLVW+I +RGGLAWE TNKNLIFNLHPVLMLIGF+I
Sbjct  1    MAVGINAMAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLIGFII  60

Query  729  LGGEAIMSY----------KSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGI  580
            LGGE   ++          +   + +  ++V      AIAL LGI GICAAFKNHNESGI
Sbjct  61   LGGEGNKNFHFAFYFHYKLQIASVGETSEEVDPPYTPAIALALGIFGICAAFKNHNESGI  120

Query  579  ANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVAN  400
             NLYSLHSWIGIGV  LYG QWVY F+VFF+PGG+ ++R   LPWH + G FVYILAV N
Sbjct  121  PNLYSLHSWIGIGVISLYGFQWVYSFIVFFFPGGSTNLRSGLLPWHAMLGLFVYILAVGN  180

Query  399  ALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTED----DHS  232
            A LGFLEKLTFLE+ GLDKYGSEAFL+NFTAI T+++  FV LT  +++P+ +    D+S
Sbjct  181  AALGFLEKLTFLENGGLDKYGSEAFLINFTAIITILFATFVVLTASAKSPSSNDDTVDYS  240

Query  231  YSAI  220
            YSAI
Sbjct  241  YSAI  244



>ref|XP_006827691.1| hypothetical protein AMTR_s00009p00257510 [Amborella trichopoda]
 gb|ERM95107.1| hypothetical protein AMTR_s00009p00257510 [Amborella trichopoda]
Length=235

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 174/225 (77%), Gaps = 3/225 (1%)
 Frame = -2

Query  891  ALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAI  712
            A PF+   H + ++ AVLVLVW I+FRGGLA+  +NK+LIFN+HPVLMLIGFV +  EAI
Sbjct  10   ATPFTFFVHGLGVIAAVLVLVWCIYFRGGLAFSSSNKSLIFNIHPVLMLIGFVFVASEAI  69

Query  711  MSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAV  532
            ++Y+ LP  KEV+K+IHL LH IALVLGIVGI AAFK HNESGI NLYSLHSWIG+G   
Sbjct  70   LAYRILPGTKEVRKIIHLSLHFIALVLGIVGIYAAFKYHNESGIVNLYSLHSWIGLGTIC  129

Query  531  LYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG  352
            L+GIQW+ G V FFYPGG+  ++   LPWHV+FG FVYILA+A A LGFLEKLTFLE+SG
Sbjct  130  LFGIQWLIGLVTFFYPGGSQTVKATILPWHVIFGLFVYILALATAELGFLEKLTFLENSG  189

Query  351  LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTE-DDHSYSAI  220
            LDKYGSEA LVNFTA+  V  G FV L+  +  PT+ +   Y+ I
Sbjct  190  LDKYGSEALLVNFTALVVVFLGAFVILS--AVLPTQREPQGYAPI  232



>ref|XP_004976346.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 2-like [Setaria italica]
Length=237

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 173/230 (75%), Gaps = 1/230 (0%)
 Frame = -2

Query  906  AIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVIL  727
             +  KA PF+  AHA+A V AVLVLVW +HFRGGLA E  NKNLIFN+HPVLMLIG++IL
Sbjct  5    GLGVKATPFTYAAHALAAVAAVLVLVWCVHFRGGLALEAPNKNLIFNVHPVLMLIGYIIL  64

Query  726  GGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            G EAIM YK  P L  +  K+ HL+LHAIA VLG  GI  AFK HN+SGIANLYSLHSW+
Sbjct  65   GSEAIMIYKVFPNLNHDTAKLTHLILHAIATVLGAFGIYCAFKFHNDSGIANLYSLHSWL  124

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG   LYGIQWV+GFV FF+PG    +RR +LPWH LFG FVY+LAV  A LGFLEKLT
Sbjct  125  GIGTISLYGIQWVFGFVTFFFPGAAPSLRRSALPWHALFGLFVYVLAVMTAELGFLEKLT  184

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FLES GLDKYG+EAFLVNFTA+  V++G  V +  ++ A  E+   Y+ I
Sbjct  185  FLESGGLDKYGAEAFLVNFTALVVVLFGASVVVAAVAPAHVEEPQGYAPI  234



>ref|XP_006401843.1| hypothetical protein EUTSA_v10014551mg [Eutrema salsugineum]
 gb|ESQ43296.1| hypothetical protein EUTSA_v10014551mg [Eutrema salsugineum]
Length=236

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 164/206 (80%), Gaps = 3/206 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGG AWE  NK LIFNLHPVL LIG V LGGEAI+SYKSLP +K VKK IHLVLH
Sbjct  31   WSISYRGGFAWESKNKTLIFNLHPVLTLIGLVFLGGEAIISYKSLPFEKRVKKSIHLVLH  90

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIA++LGI+GI AAFK+HNE  I NLY++HSWIGIG+ VLY +QW+Y  +VF +P  ++ 
Sbjct  91   AIAIILGIIGIYAAFKHHNEKHIPNLYTIHSWIGIGIIVLYALQWMYSIIVFLFPRVSST  150

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            +R  SLPWHV  G FVY+LAV N++LGFLEKLTFLE SGLDK+GSEAFLVN+ AI TV++
Sbjct  151  LRSNSLPWHVFLGVFVYVLAVGNSVLGFLEKLTFLEKSGLDKFGSEAFLVNYMAIFTVLF  210

Query  288  GVFVFLTILSQAPT---EDDHSYSAI  220
            G  V L + S++P    ED+ SYSAI
Sbjct  211  GTLVLLIVFSKSPPTADEDNFSYSAI  236



>ref|XP_008667311.1| PREDICTED: uncharacterized protein LOC100194390 isoform X1 [Zea 
mays]
 tpg|DAA36688.1| TPA: hypothetical protein ZEAMMB73_743413 [Zea mays]
Length=243

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 171/235 (73%), Gaps = 7/235 (3%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  KA PF+  AHA+A V A LVLVW +HFRGGLA E  NKNLIFN+HPVLMLIG++ILG
Sbjct  6    LGVKATPFTYAAHALAAVAAALVLVWCVHFRGGLALEAQNKNLIFNVHPVLMLIGYIILG  65

Query  723  GEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIG  547
             EAIM YK  P L  +  K+ HL+LHA+A VLG  GI  AFK HN+SGIANLYSLHSW+G
Sbjct  66   SEAIMIYKVFPNLNHDTAKLTHLILHAVATVLGAFGIYCAFKYHNDSGIANLYSLHSWLG  125

Query  546  IGVAVLYGIQ------WVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGF  385
            IG   LY IQ      WV+GFV FF PG    +RR +LPWH LFG FVY+LA+A A LGF
Sbjct  126  IGTIALYAIQSMLCSQWVFGFVTFFLPGAAPGVRRGALPWHALFGLFVYVLALATAELGF  185

Query  384  LEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            LEKLTFLES GLDKYG+EAFLVNFTA+  V+ G FV +  ++ A  E+   Y+ I
Sbjct  186  LEKLTFLESGGLDKYGAEAFLVNFTALVVVLLGAFVVVAAVTPAHAEEPRGYAPI  240



>ref|XP_003580220.2| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 2 [Brachypodium distachyon]
Length=252

 Score =   262 bits (669),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  KA PF+  AHA+    AV+VLVW IHFRGGLA++  NKNLIFN+HPVLMLIG++ILG
Sbjct  20   VGVKAAPFTYAAHALGAAAAVMVLVWCIHFRGGLAFDAVNKNLIFNVHPVLMLIGYIILG  79

Query  723  GEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIG  547
             EAIM YK  P +  +  K+ HL+LHAIA+VLG VGI  AFK HNESGIANLYSLHSW+G
Sbjct  80   SEAIMIYKIFPKVNHDTAKLTHLILHAIAIVLGAVGIYCAFKFHNESGIANLYSLHSWLG  139

Query  546  IGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTF  367
            IG   LYGIQW++GFV FFYPG    +RR +LPWHVLFG FVY+L +A A LGFLEKLTF
Sbjct  140  IGAISLYGIQWIFGFVAFFYPGAAPGVRRGALPWHVLFGLFVYVLTLATAELGFLEKLTF  199

Query  366  LESSGLDKYGSEAFLVNFTAI  304
            L+SSGLDKYG+EAFLVNFTA+
Sbjct  200  LQSSGLDKYGAEAFLVNFTAL  220



>dbj|BAJ87208.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            +A+  KA PF+  AHA+A   A +VLVW IHFRGGLA+E  NKNLIFN+HPVLMLIGF+I
Sbjct  3    IALGVKATPFTYAAHALAAAAAAMVLVWCIHFRGGLAFEAANKNLIFNVHPVLMLIGFII  62

Query  729  LGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK  P L  +  K+ HL+LHAIA+VLG VGI  AFK HN+SGIANLYSLHSW
Sbjct  63   LGSEAIMVYKVFPGLNHDTAKLTHLILHAIAIVLGAVGIYCAFKFHNDSGIANLYSLHSW  122

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GFV FF+PG   D+RR +LPWH LFG FVY+L +A A LGFLEK+
Sbjct  123  LGIGAISLYGIQWIFGFVTFFFPGAAPDVRRGALPWHALFGLFVYVLTLATAELGFLEKM  182

Query  372  TFLESSGLDKYGSEAFLVNFT  310
            TFL+SSGLDKYG EA LVNFT
Sbjct  183  TFLQSSGLDKYGPEALLVNFT  203



>dbj|BAK01821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            +A+  KA PF+  AHA+A   A +VLVW IHFRGGLA+E  NKNLIFN+HPVLMLIGF+I
Sbjct  3    IALGVKATPFTYAAHALAAAAAAMVLVWCIHFRGGLAFEAANKNLIFNVHPVLMLIGFII  62

Query  729  LGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSW  553
            LG EAIM YK  P L  +  K+ HL+LHAIA+VLG VGI  AFK HN+SGIANLYSLHSW
Sbjct  63   LGSEAIMLYKVFPGLNHDTAKLTHLILHAIAIVLGAVGIYCAFKFHNDSGIANLYSLHSW  122

Query  552  IGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKL  373
            +GIG   LYGIQW++GFV FF+PG   D+RR +LPWH LFG FVY+L +A A LGFLEK+
Sbjct  123  LGIGAISLYGIQWIFGFVTFFFPGAAPDVRRGALPWHALFGLFVYVLTLATAELGFLEKM  182

Query  372  TFLESSGLDKYGSEAFLVNFT  310
            TFL+SSGLDKYG EA LVNFT
Sbjct  183  TFLQSSGLDKYGPEALLVNFT  203



>ref|XP_009411317.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=211

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  900  AAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGG  721
            + KA PF+  +HA+AL  A +VLVW +HFRGGLA+E +NK+LIFN+HPVLMLIGF+I+G 
Sbjct  6    SVKAAPFTYASHALALASAAMVLVWCVHFRGGLAFESSNKSLIFNIHPVLMLIGFIIIGS  65

Query  720  EAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIG  541
            EAIMSYK+LP   E+ K++H  LHAIALVLG VGI AAFK HNESGI NLYSLHSW+G+G
Sbjct  66   EAIMSYKTLPWNHEMNKIVHFTLHAIALVLGAVGIYAAFKFHNESGIDNLYSLHSWVGLG  125

Query  540  VAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE  361
               LYGIQW+ GFV FF+PG    +R +SLPWHVLFG FVYILAVA A LGFLEKLTFLE
Sbjct  126  TISLYGIQWILGFVTFFFPGAPPALRGKSLPWHVLFGLFVYILAVATAELGFLEKLTFLE  185

Query  360  SSGLDKYGSEAFLVN  316
            SSGL KY SEAFLV 
Sbjct  186  SSGLYKYSSEAFLVK  200



>gb|KDO60011.1| hypothetical protein CISIN_1g0269791mg [Citrus sinensis]
Length=177

 Score =   257 bits (656),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  750  MLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANL  571
            MLIG +I+GGEAIMSYK L L+KEVKKVIHLVLHAIAL+LGI+GI AAFK HNES I NL
Sbjct  1    MLIGLIIIGGEAIMSYKGLNLRKEVKKVIHLVLHAIALILGIIGIYAAFKYHNESAIVNL  60

Query  570  YSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALL  391
            YSLHSW+GI V  LYGIQW+YGFV+FFYPGG+  +R ESLPWHVLFG FVYILAVANA +
Sbjct  61   YSLHSWLGIAVISLYGIQWLYGFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAI  120

Query  390  GFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            GFLEKLTFLE+SGL KYGSEA LVNFTA+ T++YG FV  ++ SQ P EDD+SYSAI
Sbjct  121  GFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVASQGPAEDDYSYSAI  177



>ref|NP_001053410.1| Os04g0533500 [Oryza sativa Japonica Group]
 sp|Q7XMK3.2|ACET2_ORYSJ RecName: Full=Probable ascorbate-specific transmembrane electron 
transporter 2; AltName: Full=Cytochrome b561-2 [Oryza sativa 
Japonica Group]
 emb|CAE04576.2| OSJNBb0039L24.15 [Oryza sativa Japonica Group]
 dbj|BAF15324.1| Os04g0533500 [Oryza sativa Japonica Group]
 emb|CAH67456.1| OSIGBa0159I10.1 [Oryza sativa Indica Group]
 dbj|BAG87918.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91320.1| unnamed protein product [Oryza sativa Japonica Group]
Length=236

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 176/230 (77%), Gaps = 1/230 (0%)
 Frame = -2

Query  906  AIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVIL  727
             +  KA PF+ VAHA+A+  AV+VLVW I FRGGLA+E  NKNLIFN+HPVLMLIG++IL
Sbjct  4    GLGVKAAPFTYVAHALAVAAAVMVLVWCISFRGGLAFEADNKNLIFNVHPVLMLIGYIIL  63

Query  726  GGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            G EAIM YK  P L  +  K+IHL+LHAIA+VLG VGI  AFK HNESGIANLYSLHSW+
Sbjct  64   GSEAIMIYKIFPKLNHDTTKLIHLILHAIAIVLGAVGIYCAFKFHNESGIANLYSLHSWL  123

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIG   LYGIQW++GFV FFYPG    +RR +LPWHVLFG FVY+L +A A LG LEKLT
Sbjct  124  GIGTISLYGIQWIFGFVAFFYPGAAPHVRRGALPWHVLFGLFVYVLTLATAELGLLEKLT  183

Query  369  FLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            FL+SSGLDKYG+EAFLVNFT +   ++G  V +  ++ A  E+   Y+ I
Sbjct  184  FLQSSGLDKYGAEAFLVNFTGLVVALFGAAVVVAAVAPAHVEEPEGYAPI  233



>ref|XP_009394549.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Musa acuminata subsp. malaccensis]
Length=232

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLA+E  NK+LIFN+HPVLMLIGF+I+GGEA MSY++LP  K VKK IHL+LH
Sbjct  30   WCIHFRGGLAFESANKSLIFNVHPVLMLIGFIIMGGEATMSYRTLPWSKRVKKTIHLILH  89

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            AIALVLG+ GI  AFK HNESGI NLYSLHSW+G+G   LYGIQW++GFV F YPG +  
Sbjct  90   AIALVLGVFGIYFAFKFHNESGIDNLYSLHSWMGLGTICLYGIQWIFGFVTFLYPGASVF  149

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
            +R   L WHVLFG FVY+LA+A A LGFLEKLTFLE+SG L +Y  EAFLVN TA+  ++
Sbjct  150  LRTAYLAWHVLFGVFVYLLAIATAELGFLEKLTFLETSGILHRYSPEAFLVNSTALVVIL  209

Query  291  YGVFVFLTIL  262
             G  V L+++
Sbjct  210  LGASVVLSLI  219



>dbj|BAK01196.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 153/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWED-TNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGLA    TNK LIFN+HPVLMLIGF+I+G EAIMSYK+LP   +  K++HL+L
Sbjct  24   WCVHFRGGLALSSPTNKGLIFNVHPVLMLIGFIIIGSEAIMSYKTLPWSHDTNKMVHLIL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG  GI AAFK HNESGIANLYSLHSW+G+G  +LYG+QWV GF+ FF+PG + 
Sbjct  84   HAVALFLGSFGIYAAFKFHNESGIANLYSLHSWVGLGAIILYGLQWVSGFLTFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR  LPWH+  G  VY+LA+  A LGFLEKLTFL+ +GL KY SEA LVNFTA+  ++
Sbjct  144  TLRRAVLPWHIRAGLVVYVLALLAAELGFLEKLTFLQVAGLGKYSSEALLVNFTALVVLL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V L + + A +E    YSA+
Sbjct  204  LGASVVLYVTAPAQSEHRLGYSAV  227



>gb|EMT24483.1| Cytochrome b reductase 1 [Aegilops tauschii]
Length=230

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 152/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWED-TNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HF GGLA    TNK LIFN+HPVLMLIGF+I+G EAIMSYK+LP   +  K +HL+L
Sbjct  24   WCVHFGGGLALSSPTNKGLIFNVHPVLMLIGFIIIGSEAIMSYKTLPWSHDTNKTVHLIL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG  G+  AFK HNESGIANLYSLHSW+G+G  +LYG+QWV GF+ FF+PG + 
Sbjct  84   HAVALFLGSFGVYVAFKFHNESGIANLYSLHSWVGLGAIILYGLQWVSGFLTFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR  LPWHV  G  VY+LA+  A LGFLEKLTFL+++GL KY SEA LVNFTA+  ++
Sbjct  144  TLRRAMLPWHVRAGIVVYVLALLAAELGFLEKLTFLQAAGLGKYSSEALLVNFTALVVLL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G FV L + + A +E    YS++
Sbjct  204  LGAFVVLYVTAPAQSEHRLGYSSV  227



>ref|XP_004982675.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1-like [Setaria italica]
Length=230

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 150/204 (74%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAW-EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGL+    TNK LIFN+HPVLMLIGF+ILG EAIMSYK LP   +  K++H++L
Sbjct  24   WCVHFRGGLSLGSPTNKGLIFNVHPVLMLIGFIILGSEAIMSYKILPWSHDTNKMVHMLL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG VGI AAFK HNESGIANLYSLHSWIG+G   LYGIQW+ G   FF+PG + 
Sbjct  84   HAVALFLGSVGIYAAFKFHNESGIANLYSLHSWIGLGTICLYGIQWLLGVTTFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR  LPWHV  G  VY+LA+  A LGFLEKLTFL+++GL +Y SEA LVNFTA+  V+
Sbjct  144  TVRRRMLPWHVRSGLVVYMLALLAAELGFLEKLTFLQANGLGRYSSEALLVNFTALLVVL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V L + +    E  H YSA+
Sbjct  204  LGASVVLFVTAPMHNEHTHGYSAV  227



>ref|XP_007038679.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 1 [Theobroma cacao]
 gb|EOY23180.1| Cytochrome b561/ferric reductase transmembrane protein family 
isoform 1 [Theobroma cacao]
Length=189

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  777  LIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKN  598
            L   LHPVLMLIGF+ILGGEAIMSYKSLPL K+VKK++HLVLHAIAL+LGI+GI  AFK 
Sbjct  7    LFLQLHPVLMLIGFIILGGEAIMSYKSLPLSKDVKKLMHLVLHAIALILGIIGIYTAFKY  66

Query  597  HNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVY  418
            HNES I NLYSLHSW+G+G+ VLYGIQW+YGF+VFFYP G+A +R ESLPWHVL G FVY
Sbjct  67   HNESSIVNLYSLHSWLGMGIIVLYGIQWIYGFLVFFYPEGSAGLRSESLPWHVLLGLFVY  126

Query  417  ILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQ  256
            ILAV NA LGFLEKLTFLE+SGL ++G+EA+LVNFTA+ T++YG FV  T+L+Q
Sbjct  127  ILAVGNASLGFLEKLTFLENSGLARHGAEAYLVNFTAVVTILYGAFVIFTVLNQ  180



>gb|EEC77699.1| hypothetical protein OsI_16769 [Oryza sativa Indica Group]
Length=260

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 176/254 (69%), Gaps = 25/254 (10%)
 Frame = -2

Query  906  AIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFN-------------  766
             +  KA PF+ VAHA+A+  AV+VLVW I FRGGLA+E  NKNLIFN             
Sbjct  4    GLGVKAAPFTYVAHALAVAAAVMVLVWCISFRGGLAFEADNKNLIFNYAAITIMLYESIV  63

Query  765  -----------LHPVLMLIGFVILGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIV  622
                       +HPVLMLIG++ILG EAIM YK  P L  +  K+IHL+LHAIA+VLG V
Sbjct  64   TRYCNKLDEYMVHPVLMLIGYIILGSEAIMIYKIFPKLNHDTTKLIHLILHAIAIVLGAV  123

Query  621  GICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWH  442
            GI  AFK HNESGIANLYSLHSW+GIG   LYGIQW++GFV FFYPG    +RR +LPWH
Sbjct  124  GIYCAFKFHNESGIANLYSLHSWLGIGTISLYGIQWIFGFVAFFYPGAAPHVRRGALPWH  183

Query  441  VLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTIL  262
            VLFG FVY+L +A A LG LEKLTFL+SSGLDKYG+EAFLVNFT +   ++G  V +  +
Sbjct  184  VLFGLFVYVLTLATAELGLLEKLTFLQSSGLDKYGAEAFLVNFTGLVVALFGAAVVVAAV  243

Query  261  SQAPTEDDHSYSAI  220
            + A  E+   Y+ I
Sbjct  244  APAHVEEPEGYAPI  257



>tpg|DAA36686.1| TPA: hypothetical protein ZEAMMB73_743413 [Zea mays]
Length=278

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 171/270 (63%), Gaps = 42/270 (16%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  KA PF+  AHA+A V A LVLVW +HFRGGLA E  NKNLIFN+HPVLMLIG++ILG
Sbjct  6    LGVKATPFTYAAHALAAVAAALVLVWCVHFRGGLALEAQNKNLIFNVHPVLMLIGYIILG  65

Query  723  GE-----------------------------------AIMSYKSLP-LKKEVKKVIHLVL  652
             E                                   AIM YK  P L  +  K+ HL+L
Sbjct  66   SEGNSNTKIKLILFPSSMSAVPALNVGFSRIPIHCMAAIMIYKVFPNLNHDTAKLTHLIL  125

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQ------WVYGFVVFF  490
            HA+A VLG  GI  AFK HN+SGIANLYSLHSW+GIG   LY IQ      WV+GFV FF
Sbjct  126  HAVATVLGAFGIYCAFKYHNDSGIANLYSLHSWLGIGTIALYAIQSMLCSQWVFGFVTFF  185

Query  489  YPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFT  310
             PG    +RR +LPWH LFG FVY+LA+A A LGFLEKLTFLES GLDKYG+EAFLVNFT
Sbjct  186  LPGAAPGVRRGALPWHALFGLFVYVLALATAELGFLEKLTFLESGGLDKYGAEAFLVNFT  245

Query  309  AISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            A+  V+ G FV +  ++ A  E+   Y+ I
Sbjct  246  ALVVVLLGAFVVVAAVTPAHAEEPRGYAPI  275



>gb|ACN40160.1| unknown [Picea sitchensis]
Length=218

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 144/197 (73%), Gaps = 0/197 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W I+FRGGLAWE TNK+ IFNLHPVLMLIGF+ +  EAI++YK LP  +  KK +HL L 
Sbjct  13   WCIYFRGGLAWEATNKSHIFNLHPVLMLIGFIFIASEAILAYKVLPGDRAYKKSVHLSLQ  72

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +ALVLGI+GI  AFK HNESGI NLYS HSW+G+G   L+ IQW  GF VFFYPG    
Sbjct  73   LVALVLGIIGIYTAFKYHNESGIVNLYSWHSWLGLGTICLFAIQWFVGFFVFFYPGAADP  132

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
            I+   LPWHV FG  +Y+ A+A A LGFLEKLTFLESSGL KYGSEA LVNFTA+  +I+
Sbjct  133  IKAAILPWHVFFGVLIYLFAIATAELGFLEKLTFLESSGLYKYGSEAMLVNFTAMIVLIF  192

Query  288  GVFVFLTILSQAPTEDD  238
            G  V L+ +  +  E +
Sbjct  193  GGVVILSAILPSELEPE  209



>ref|NP_001136673.1| uncharacterized protein LOC100216802 [Zea mays]
 gb|ACF82377.1| unknown [Zea mays]
 tpg|DAA49382.1| TPA: cytochrome b561 [Zea mays]
Length=230

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAW-EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGL++   TNK LIFN+HPVLMLIGF+ILG EAIMSYK  P   +  K++H++L
Sbjct  24   WCVHFRGGLSFGSPTNKGLIFNVHPVLMLIGFIILGSEAIMSYKIWPWSHDTNKMVHMLL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG VGI AAFK HNESGI NLYSLHSW+G+G   LYGIQW++G   FF+PG + 
Sbjct  84   HAVALFLGSVGIYAAFKFHNESGIDNLYSLHSWVGLGTICLYGIQWLFGVATFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR  LPWH   G  VYILA+  + LGFLEKLTFL+++GL +Y SEA LVNFTA+  ++
Sbjct  144  TVRRRMLPWHTRAGLVVYILALLASELGFLEKLTFLQAAGLGRYSSEALLVNFTALVILL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V L + +    E  H YSA+
Sbjct  204  LGASVVLYVTAPMHNEHAHGYSAV  227



>gb|ABK26244.1| unknown [Picea sitchensis]
Length=236

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 161/229 (70%), Gaps = 2/229 (1%)
 Frame = -2

Query  924  LKERDMAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLML  745
            +  + + I AK  P + V H + L   +LVLVW I+FRGGLAWE TNK+ IFNLHPVLML
Sbjct  1    MDSKRLGIVAK--PVTWVVHMLGLAAILLVLVWCIYFRGGLAWEATNKSHIFNLHPVLML  58

Query  744  IGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYS  565
            IGF+ +  EAI++YK LP  +  KK +HL L  +ALVLGI+GI  AFK HNESGI NLYS
Sbjct  59   IGFIFIASEAILAYKVLPGDRAYKKSVHLSLQLVALVLGIIGIYTAFKYHNESGIVNLYS  118

Query  564  LHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGF  385
             HSW+G+G   L+ IQW  GF VFFYPG    I+   LPWHV FG  +Y+ A+A A LGF
Sbjct  119  WHSWLGLGTICLFAIQWFVGFFVFFYPGAADPIKAAILPWHVFFGVLIYLFAIATAELGF  178

Query  384  LEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            LEKLTFLESSGL KYGSEA LVNFTA+  +I+G  V L+ +  +  E +
Sbjct  179  LEKLTFLESSGLYKYGSEAMLVNFTAMIVLIFGGVVILSAILPSELEPE  227



>gb|ACG44499.1| cytochrome b561 [Zea mays]
Length=230

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAW-EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGL++   TNK LIFN+HPVLMLIGF+ILG EAIMSYK  P   +  K++H++L
Sbjct  24   WCVHFRGGLSFGSPTNKGLIFNVHPVLMLIGFIILGSEAIMSYKIWPWSHDTNKMVHMLL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG VGI AAFK HNESGI NLYSLHSW+G+G   LYGIQW++G   FF+PG + 
Sbjct  84   HAVALFLGSVGIYAAFKFHNESGIDNLYSLHSWVGLGTICLYGIQWLFGVATFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR  LPWH   G  VYILA+  + LGFLEKLTFL+++GL +Y SEA LVNFTA+  ++
Sbjct  144  TVRRRMLPWHTRAGLVVYILALLASELGFLEKLTFLQAAGLGRYSSEALLVNFTALVILL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V L + +    E  H YSA+
Sbjct  204  LGASVVLYVTAPMHNEHAHGYSAV  227



>gb|ABK25854.1| unknown [Picea sitchensis]
Length=236

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 162/229 (71%), Gaps = 2/229 (1%)
 Frame = -2

Query  924  LKERDMAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLML  745
            +  + + I AK  P + V H + LV  +LVLVW I+FRGGLAWE TNK+ IFNLHPVLML
Sbjct  1    MDSKRLGIVAK--PVTWVVHMLGLVAILLVLVWCIYFRGGLAWEATNKSHIFNLHPVLML  58

Query  744  IGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYS  565
            IGF+ +  EAI++YK LP  +  KK +HL L  +ALVLGI+GI  AFK HNESGI NLYS
Sbjct  59   IGFIFIASEAILAYKVLPGDRAYKKSVHLSLQLVALVLGIIGIYTAFKYHNESGIVNLYS  118

Query  564  LHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGF  385
             HSW+G+G   L+ IQW+ GF VFFYPG    IR    PWHV FG  +Y+ A+A A LGF
Sbjct  119  WHSWLGLGTICLFAIQWLVGFFVFFYPGAADPIRAAIHPWHVFFGVLIYLFAIATAELGF  178

Query  384  LEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            LEKLTFLESSGL KYGSEA LVNFTA+  +I+G  V L+ +  +  E +
Sbjct  179  LEKLTFLESSGLYKYGSEAMLVNFTALIVLIFGGVVILSAILPSELEPE  227



>ref|XP_010235771.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 isoform X1 [Brachypodium distachyon]
Length=188

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = -2

Query  768  NLHPVLMLIGFVILGGEAIMSYKSLPL-KKEVKKVIHLVLHAIALVLGIVGICAAFKNHN  592
            ++HPVLMLIG++ILG EAIM YK LP    +  K+IHL+LH IALVLG+VGI  AFK HN
Sbjct  2    HVHPVLMLIGYIILGSEAIMVYKVLPTWNHDTTKLIHLILHGIALVLGVVGIYCAFKFHN  61

Query  591  ESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYIL  412
            ESGIANLYSLHSW+GIG   LYGIQWV+GF+ FF+PG   ++RR +LPWH+LFG FVYIL
Sbjct  62   ESGIANLYSLHSWLGIGTICLYGIQWVFGFLAFFFPGAAPNVRRGALPWHILFGMFVYIL  121

Query  411  AVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHS  232
            A+A A LGFLEKLTFL+SSGLDKYG+EAFLVNFTA+  V++G  V +  ++ A  E+   
Sbjct  122  ALATAELGFLEKLTFLQSSGLDKYGAEAFLVNFTALVVVLFGASVVVAAVAPARLEEPQG  181

Query  231  YSAI  220
            Y+ I
Sbjct  182  YAPI  185



>gb|AFW72528.1| hypothetical protein ZEAMMB73_083654 [Zea mays]
Length=181

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  750  MLIGFVILGGEAIMSYKSLPLKK-EVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIAN  574
            MLIG++I+GGEAIM Y+ LP    E  K+IHLVLH IALVLG VGI  AFKNHNESGIAN
Sbjct  1    MLIGYIIIGGEAIMVYRVLPTSNHETNKLIHLVLHGIALVLGAVGIYFAFKNHNESGIAN  60

Query  573  LYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANAL  394
            LYSLHSWIGIG   LYGIQW+ GFV FF+PG   ++++  LPWH+LFG FVYILA+ANA 
Sbjct  61   LYSLHSWIGIGTITLYGIQWIVGFVTFFFPGAAPNVKKGVLPWHILFGLFVYILALANAE  120

Query  393  LGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            LGFLEKLTFLESSGLDKYG+EAFLVNFTA+  V++G  V +  ++    E+   Y  I
Sbjct  121  LGFLEKLTFLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYVPI  178



>emb|CAB64376.2| putative cytochrome B 561 [Craterostigma plantagineum]
Length=190

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            + +  KALP S VAH +A+   +LVL W I FRGG AWED NKNLIFNLHPVLML G +I
Sbjct  3    LLLGVKALPISYVAHVLAVAALILVLTWTIRFRGGYAWEDANKNLIFNLHPVLMLTGIII  62

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GG+AIMSYKSLPL++  KK+IHL LHA+A  LG++GI  AFK HNES I NLYSLHSW+
Sbjct  63   IGGQAIMSYKSLPLERPTKKLIHLSLHAVAFTLGVIGIYLAFKYHNESHIPNLYSLHSWL  122

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            GIGV  LYG+QW+YGF+VF +PGGT  IR   LPWHVL G F+YILA+  A LGFLEKLT
Sbjct  123  GIGVISLYGLQWIYGFLVFVFPGGTGYIRSTVLPWHVLAGMFIYILAICTATLGFLEKLT  182

Query  369  FLESSGL  349
            FL+SSGL
Sbjct  183  FLQSSGL  189



>ref|XP_002464409.1| hypothetical protein SORBIDRAFT_01g017730 [Sorghum bicolor]
 gb|EER91407.1| hypothetical protein SORBIDRAFT_01g017730 [Sorghum bicolor]
Length=230

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 144/204 (71%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAW-EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGL+     NK LIFN+HPVLMLIGF+ILG EA+M YK  P   +  K++H++L
Sbjct  24   WCVHFRGGLSLGSPANKGLIFNVHPVLMLIGFIILGSEAVMGYKIWPWSHDANKMVHMLL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG VGI AAFK HNESGI NLYSLHSW+G+G   LY IQW+ G   FF+PG + 
Sbjct  84   HAVALFLGSVGIYAAFKFHNESGIDNLYSLHSWVGLGTICLYSIQWLLGVATFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR  LPWH+  G  VYILA+  A LGFLEKLTFL+++GL +Y SEA LVNFTA+  ++
Sbjct  144  TVRRRMLPWHIRAGLVVYILALLAAELGFLEKLTFLQAAGLGRYSSEALLVNFTALLILL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V L + +    E    YSA+
Sbjct  204  LGASVVLYVTAPMHNEHTQGYSAV  227



>gb|EAY79128.1| hypothetical protein OsI_34235 [Oryza sativa Indica Group]
Length=230

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 152/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWED-TNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGLA    TNK LIFN+HPVLMLIGF+ILG EAIM YK  P   +  K++HL+L
Sbjct  24   WCVHFRGGLALSSPTNKGLIFNVHPVLMLIGFIILGSEAIMGYKIWPWGHDTNKMVHLLL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HAIAL+LG VGI AAFK HNESGIANLYSLHSW+G+G   LYG+QW++GFV FF+PG + 
Sbjct  84   HAIALLLGSVGIYAAFKFHNESGIANLYSLHSWVGLGTICLYGVQWIFGFVTFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR +LPWHV  G  VYILA+  A LGFLEKLTFLE+ GL +Y SEA LVNFTA+  ++
Sbjct  144  SLRRAALPWHVRSGLLVYILALLAAELGFLEKLTFLEAGGLGRYSSEALLVNFTAVLVIL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V + + S    E  H YSA+
Sbjct  204  LGSAVVMYVTSPMHNEHSHGYSAV  227



>ref|NP_001065002.1| Os10g0504200 [Oryza sativa Japonica Group]
 gb|AAG13625.1|AC078840_16 putative cytochrome b-561 [Oryza sativa Japonica Group]
 gb|AAP54504.1| Cytochrome b561 family protein, expressed [Oryza sativa Japonica 
Group]
 gb|AAX95713.1| Cytochrome b561 [Oryza sativa Japonica Group]
 dbj|BAF26916.1| Os10g0504200 [Oryza sativa Japonica Group]
 gb|EAZ16612.1| hypothetical protein OsJ_32085 [Oryza sativa Japonica Group]
Length=230

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 152/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWED-TNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGLA    TNK LIFN+HPVLMLIGF+ILG EAIM YK  P   +  K++HL+L
Sbjct  24   WCVHFRGGLALSSPTNKGLIFNVHPVLMLIGFIILGSEAIMGYKIWPWGHDTNKMVHLLL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HAIAL+LG VGI AAFK HNESGIANLYSLHSW+G+G   LYG+QW++GFV FF+PG + 
Sbjct  84   HAIALLLGSVGIYAAFKFHNESGIANLYSLHSWVGLGTICLYGVQWIFGFVTFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
             +RR +LPWHV  G  VYILA+  A LGFLEKLTFLE+ GL +Y SEA LVNFTA+  ++
Sbjct  144  SLRRAALPWHVRSGLLVYILALLAAELGFLEKLTFLEAGGLGRYSSEALLVNFTAVLVIL  203

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V + + +    E  H YSA+
Sbjct  204  LGSAVVMYVTAPMHNEHSHGYSAV  227



>ref|XP_006652569.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 2-like [Oryza brachyantha]
Length=237

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  KA PF+ VAHA+A+V AV+VLVW I FRGGLA+E  NKNLIFN+HPVLMLIG++ILG
Sbjct  5    LGVKAAPFTYVAHALAVVAAVMVLVWCISFRGGLAFEADNKNLIFNVHPVLMLIGYIILG  64

Query  723  GEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIG  547
             EAIM YK  P L  +  K+IHL+LHAIA+VLG VGI  AFK HNESGIANLYSLHSW+G
Sbjct  65   SEAIMIYKIFPKLNHDTTKLIHLILHAIAIVLGAVGIYCAFKFHNESGIANLYSLHSWLG  124

Query  546  IGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTF  367
            IG   LYGIQW++GF  FF+PG    +RR +LPWHVLFG  VY+L +A A LG LEKLTF
Sbjct  125  IGTISLYGIQWIFGFAAFFFPGAAPHVRRGALPWHVLFGLLVYVLTLATAELGLLEKLTF  184

Query  366  LESSGLDKYGSEAFLVNFTAI  304
            L+SSGLDKYG+EAFLVNFT +
Sbjct  185  LQSSGLDKYGAEAFLVNFTGL  205



>ref|XP_002967611.1| hypothetical protein SELMODRAFT_88335 [Selaginella moellendorffii]
 gb|EFJ30958.1| hypothetical protein SELMODRAFT_88335 [Selaginella moellendorffii]
Length=233

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 147/200 (74%), Gaps = 2/200 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGGL W   NKNL+FN+HPVLM+IGF+ +  EAI+ YKS+P  K  +K +HL L 
Sbjct  30   WSISYRGGLNWNAVNKNLVFNIHPVLMVIGFIFVSSEAILVYKSVPGSKVYRKGVHLSLQ  89

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            A+AL LGI GICAAFK HNES I NLYSLHSW+G+G  +L+ IQW+ GFV F+YPG  A+
Sbjct  90   AVALGLGIFGICAAFKYHNESKIDNLYSLHSWLGLGTIILFAIQWIAGFVTFWYPGAAAN  149

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVI  292
             RR  LPWHV  G F+Y+LA+A+A  G LEK+TFL++S +   Y +EA++ NFTA++ ++
Sbjct  150  TRRSVLPWHVFLGIFIYVLAIASAQTGVLEKVTFLQTSKVFGHYDNEAYIANFTALAVLL  209

Query  291  YGVFVFL-TILSQAPTEDDH  235
             GVF  L  ++  A  E+++
Sbjct  210  LGVFTVLGAVIPTASAEEEY  229



>ref|XP_003574161.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Brachypodium distachyon]
Length=233

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 149/208 (72%), Gaps = 6/208 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWED-TNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGGLA    TNK LIFN+HPVLMLIG +ILG EAIMSYK+LP  +   K++HLVL
Sbjct  24   WCVHFRGGLALNSPTNKGLIFNVHPVLMLIGLIILGSEAIMSYKTLPWNRGTNKIVHLVL  83

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            HA+AL LG  G+ AAFK HNESGI NLYSLHSW+G+G  +LYG+QWV GF  FF+PG + 
Sbjct  84   HAVALFLGSFGVYAAFKFHNESGIDNLYSLHSWVGLGAILLYGLQWVSGFATFFFPGASP  143

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE--SSGLDKYGSEAFLVNFTAIST  298
             +RR  LP+H   G   Y+LA+  A LGFLEK+TFL+  ++G+ +Y SEA +VNFTAI  
Sbjct  144  TLRRAVLPYHARAGLVAYVLALLAAELGFLEKITFLQAGAAGVGRYSSEALMVNFTAIVV  203

Query  297  VIYGVFVFLTILSQAPTEDDH--SYSAI  220
             + G  V L + +    +++H   YSA+
Sbjct  204  SLLGASVVLYVTAPG-QQNEHILGYSAV  230



>ref|XP_007152286.1| hypothetical protein PHAVU_004G116800g [Phaseolus vulgaris]
 gb|ESW24280.1| hypothetical protein PHAVU_004G116800g [Phaseolus vulgaris]
Length=233

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 176/225 (78%), Gaps = 2/225 (1%)
 Frame = -2

Query  921  KERDMAIAAK--ALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLM  748
            K+++M +      LP + V H +A+   ++VLVW+IHFRGG ++  +NK+LIFN+HPVLM
Sbjct  6    KDKNMVLGKHDGVLPLTFVVHLLAIPPILMVLVWSIHFRGGFSFNSSNKSLIFNIHPVLM  65

Query  747  LIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLY  568
            LIG +I+GGEAI+SYKSLPLKK+ KK+IHLVLH +AL+LGI+GI A FK HNESGI NLY
Sbjct  66   LIGIIIIGGEAIVSYKSLPLKKKSKKLIHLVLHGMALILGIIGIYAVFKFHNESGIVNLY  125

Query  567  SLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLG  388
            SLHSW+GIGV VLYG+QW++GFV+F   GG + +R  ++ WHV  G FVY+L VA A LG
Sbjct  126  SLHSWLGIGVIVLYGVQWLFGFVMFICHGGNSSLRSSTVHWHVKMGLFVYLLGVATASLG  185

Query  387  FLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA  253
            FLEKLTFL+SSGL K+ SEA LVNFTAI T+ Y  FV L+ +S +
Sbjct  186  FLEKLTFLQSSGLPKHSSEAILVNFTAILTIFYAAFVVLSAVSPS  230



>ref|XP_002981734.1| hypothetical protein SELMODRAFT_233794 [Selaginella moellendorffii]
 gb|EFJ17216.1| hypothetical protein SELMODRAFT_233794 [Selaginella moellendorffii]
Length=233

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 2/200 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W+I +RGGL W   NKNL+FN+HPVLM+IGF+ +  EAI+ YKS+P  K  +K +HL L 
Sbjct  30   WSISYRGGLNWNAVNKNLVFNIHPVLMVIGFIFVSSEAILVYKSVPGSKVYRKGVHLSLQ  89

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            A+AL LGI GICAAFK HNES I NLYSLHSW+G+G  +L+ IQW+ GFV F+YPG  A+
Sbjct  90   AVALGLGIFGICAAFKYHNESKIDNLYSLHSWLGLGTIILFAIQWIAGFVTFWYPGAAAN  149

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVI  292
             RR  LPWHV  G F+Y+LA+A+A  G LEK+TFL++S +   Y +EA++ NFTA+  ++
Sbjct  150  TRRSVLPWHVFLGIFIYVLAIASAQTGVLEKVTFLQTSKVFGHYDNEAYIANFTALVVLL  209

Query  291  YGVFVFL-TILSQAPTEDDH  235
             GVF  L  ++     E+++
Sbjct  210  LGVFTVLGAVIPTVSAEEEY  229



>gb|ACG35739.1| cytochrome b561 [Zea mays]
Length=181

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = -2

Query  750  MLIGFVILGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIAN  574
            MLIG++ILG EAIM YK  P L  +  K+ HL+LHA+A VLG  GI  AFK HN+SGIAN
Sbjct  1    MLIGYIILGSEAIMIYKVFPNLNHDTAKLTHLILHAVATVLGAFGIYCAFKYHNDSGIAN  60

Query  573  LYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANAL  394
            LYSLHSW+GIG   LY IQWV+GFV FF PG    +RR +LPWH LFG FVY+LA+A A 
Sbjct  61   LYSLHSWLGIGTIALYAIQWVFGFVTFFLPGAAPGVRRGALPWHALFGLFVYVLALATAE  120

Query  393  LGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            LGFLEKLTFLES GLDKYG+EAFLVNFTA+  V+ G FV +  ++ A  E+   Y+ I
Sbjct  121  LGFLEKLTFLESGGLDKYGAEAFLVNFTALVVVLLGAFVVVAAVTPAHAEEPRGYAPI  178



>dbj|BAD26572.1| cytochrome b561 [Citrullus lanatus]
Length=144

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -2

Query  645  IALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADI  466
            IAL LGIVGI AAFKNHNESGIANLYSLHSWIGIGV  LYG+QWVYGFV FFYPGG+AD+
Sbjct  1    IALALGIVGIIAAFKNHNESGIANLYSLHSWIGIGVISLYGLQWVYGFVTFFYPGGSADL  60

Query  465  RRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYG  286
            RR SLPWHVLFG  +YILAV N+ LGFLEKLTFLESSGL KYG+EAFLVNFTAI+TV++ 
Sbjct  61   RRASLPWHVLFGITIYILAVGNSALGFLEKLTFLESSGLAKYGTEAFLVNFTAITTVVFA  120

Query  285  VFVFLTILSQAPTEDDH--SYSAI  220
            +FV L+++SQ   ++D+   YSAI
Sbjct  121  LFVILSVISQPCVQEDNHGDYSAI  144



>ref|XP_008378265.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Malus 
domestica]
Length=272

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 162/200 (81%), Gaps = 3/200 (2%)
 Frame = -2

Query  813  RGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALV  634
            R    W+     L+  LHPVLML+G +ILGGEA++SYKSLP  K++KKVIHLVLHA+AL 
Sbjct  74   RASCVWDPLEFGLMV-LHPVLMLLGLIILGGEAMVSYKSLPFNKKMKKVIHLVLHALALA  132

Query  633  LGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRES  454
            LGI+GI  AFKNHN SGIAN+YSLH+WIGIGV VLYGIQW YGFV FF+PGG+  +RRES
Sbjct  133  LGIIGIYLAFKNHNVSGIANMYSLHAWIGIGVIVLYGIQWTYGFVTFFFPGGSPTLRRES  192

Query  453  LPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVF  274
            + WHV+FG  VY+LAV ++ LGFLEKLTFLE SGLDK+G+EAFLVNFT I TV++GVFV 
Sbjct  193  ILWHVVFGIIVYVLAVGDSSLGFLEKLTFLERSGLDKFGTEAFLVNFTTIITVLFGVFVI  252

Query  273  LTILSQA--PTEDDHSYSAI  220
             +++S+A  P E  +SYS+I
Sbjct  253  FSVISEAPPPVEVYYSYSSI  272



>gb|EEE61401.1| hypothetical protein OsJ_15584 [Oryza sativa Japonica Group]
Length=332

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = -2

Query  786  NKNLIFNLHPVLMLIGFVILGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLGIVGICA  610
            NK   + +HPVLMLIG++ILG EAIM YK  P L  +  K+IHL+LHAIA+VLG VGI  
Sbjct  140  NKLDEYMVHPVLMLIGYIILGSEAIMIYKIFPKLNHDTTKLIHLILHAIAIVLGAVGIYC  199

Query  609  AFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFG  430
            AFK HNESGIANLYSLHSW+GIG   LYGIQW++GFV FFYPG    +RR +LPWHVLFG
Sbjct  200  AFKFHNESGIANLYSLHSWLGIGTISLYGIQWIFGFVAFFYPGAAPHVRRGALPWHVLFG  259

Query  429  TFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAP  250
             FVY+L +A A LG LEKLTFL+SSGLDKYG+EAFLVNFT +   ++G  V +  ++ A 
Sbjct  260  LFVYVLTLATAELGLLEKLTFLQSSGLDKYGAEAFLVNFTGLVVALFGAAVVVAAVAPAH  319

Query  249  TEDDHSYSAI  220
             E+   Y+ I
Sbjct  320  VEEPEGYAPI  329


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 74/117 (63%), Gaps = 25/117 (21%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFN--------------  766
            +  KA PF+ VAHA+A+  AV+VLVW I FRGGLA+E  NKNLIFN              
Sbjct  5    LGVKAAPFTYVAHALAVAAAVMVLVWCISFRGGLAFEADNKNLIFNYAAITIMLYESIVT  64

Query  765  ----------LHPVLMLIGFVILGGEAIMSYKSLP-LKKEVKKVIHLVLHAIALVLG  628
                      +HPVLMLIG++ILG EAIM YK  P L  +  K+IHL+LHAIA+VLG
Sbjct  65   RYCNKLDEYMVHPVLMLIGYIILGSEAIMIYKIFPKLNHDTTKLIHLILHAIAIVLG  121



>ref|XP_002488860.1| hypothetical protein SORBIDRAFT_3247s002010 [Sorghum bicolor]
 gb|EES20470.1| hypothetical protein SORBIDRAFT_3247s002010 [Sorghum bicolor]
Length=223

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLA    +K LIFN+HPVLM++G ++L GEAI+SY+SLPL ++ +K +HL LH
Sbjct  22   WCIHFRGGLALRSQDKPLIFNVHPVLMVLGPIVLAGEAILSYRSLPLARDARKKVHLALH  81

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            A  L  G++G+ A FK H ESGI NLYSLHSW+GI    LYG+QW  GF+ +F+PG +  
Sbjct  82   AAGLAGGVLGVYAVFKFHVESGIPNLYSLHSWVGIATVTLYGLQWTAGFLTYFFPGASPT  141

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG--LDKYGSEAFLVNFT  310
             RR +LPWH +FG  +++LAV  A LGFLEKLTF++     L KYG+EA L+NFT
Sbjct  142  TRRRTLPWHAVFGLLIFVLAVGTAQLGFLEKLTFMQGQPLRLPKYGAEALLINFT  196



>dbj|BAK07054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 141/208 (68%), Gaps = 9/208 (4%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLP--LKKEVKKVIHLV  655
            W I FRGGLA+  +NK  IFN+HP LMLIG V++ GEAI++Y++ P  + ++ +K  HL 
Sbjct  36   WCIGFRGGLAFRSSNKQQIFNVHPPLMLIGLVVIAGEAILAYRTFPASVSRDARKKAHLA  95

Query  654  LHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGT  475
            LHA  L +G+VG+ A FK H E+ I NLYSLH+WIGI    LY +QW+ GF+ FF+PG  
Sbjct  96   LHAAGLAVGLVGVYAVFKFHAEADIPNLYSLHAWIGIATITLYALQWLAGFLAFFFPGAA  155

Query  474  ADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG---LDKYGSEAFLVNFTAI  304
             + RR ++PWH + G  V+ LAV NA LGFLEKLTFL+S     + KYG+EA LVNFTA+
Sbjct  156  PETRRSAVPWHAVLGLLVFALAVGNAQLGFLEKLTFLQSPPARLVGKYGAEALLVNFTAV  215

Query  303  STVIYGVFVFLTILSQAPTEDDHSYSAI  220
              ++ G+ V +  ++     D   Y+A+
Sbjct  216  IVLLLGIAVVIATVN----ADATRYTAM  239



>ref|XP_010032611.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Eucalyptus grandis]
 gb|KCW52025.1| hypothetical protein EUGRSUZ_J01463 [Eucalyptus grandis]
Length=228

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    +K+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL L 
Sbjct  28   WAVHFRGGLALVSDDKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKSFKKLVHLTLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L +VGI AA+K HNE GI N YSLHSW+G+G  +L+GIQW  GFV+++YPGG+  
Sbjct  88   LLAFCLSMVGIWAAWKFHNEKGIDNFYSLHSWLGLGCILLFGIQWALGFVIYWYPGGSRT  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A AL GFLEK TFL++   + +Y  EA L+N   I  V+
Sbjct  148  SRGTLLPWHVFFGVYIYALAIATALTGFLEKATFLQTKEVISRYSPEALLMNSLGILVVV  207

Query  291  YGVFVFLTILSQA  253
             G F+ L IL+ A
Sbjct  208  LGGFIVLAILAPA  220



>ref|XP_008679491.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Zea mays]
 gb|AFW65039.1| hypothetical protein ZEAMMB73_122069 [Zea mays]
Length=231

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLA    +K LIFN+HPVLM++G ++LGGEAI+SY+SLPL ++ +K +HL LH
Sbjct  30   WCIHFRGGLALRSQDKPLIFNVHPVLMVLGPIVLGGEAILSYRSLPLARDARKKVHLALH  89

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            A  L  G++G+ A FK H ESGI NLYSLHSW+GI    LYG+QW  GF+ +F+PG +  
Sbjct  90   AAGLAAGVLGVYAVFKFHVESGIPNLYSLHSWVGIAAITLYGLQWTAGFLAYFFPGASPA  149

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG--LDKYGSEAFLVNFTAIS  301
             RR +LPWH +FG  V++LAV  A LGFLEKLTF++     L KYG+EA LVNFT+++
Sbjct  150  TRRRTLPWHAVFGLLVFVLAVGTAQLGFLEKLTFMQGPPLRLPKYGAEALLVNFTSVT  207



>ref|XP_007033344.1| Cytochrome B561-1 isoform 1 [Theobroma cacao]
 gb|EOY04270.1| Cytochrome B561-1 isoform 1 [Theobroma cacao]
Length=232

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 135/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG V+L GEA+++YK++P  K  KK++HL + 
Sbjct  28   WTLHYRGGLALISDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVPGTKSFKKLVHLTVQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A +L I+G+ AA K HN+ GI N YSLHSW+G+    L+GIQW  GF  F+YPGG+ +
Sbjct  88   CVAFILSIIGLWAALKFHNDKGIDNFYSLHSWLGLACLFLFGIQWAAGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESS-GLDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG + Y LAVA A  G LEKLTFL+++  + +Y +EA LVN   I  V+
Sbjct  148  GRAALLPWHVFFGMYTYALAVATATTGILEKLTFLQTNLVISRYSTEALLVNSLGILIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L  L+    + D
Sbjct  208  LGGFVILATLTPVNGKSD  225



>gb|ABK22502.1| unknown [Picea sitchensis]
Length=225

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 127/187 (68%), Gaps = 0/187 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IH+ GGLA+ D NK  IFN+HPV M +GF+ L  +AI++YK +P KKEV+K +HLVL 
Sbjct  35   WCIHYNGGLAFHDQNKTKIFNVHPVFMFVGFIFLSSQAILAYKMIPAKKEVQKTVHLVLQ  94

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A+VLG +GI A FK HNES I NLYSLHSW+GI    L+G+QW+   + F +PG +  
Sbjct  95   GSAIVLGAIGIYAVFKFHNESKIKNLYSLHSWLGIATISLFGLQWIAALLAFAFPGASKQ  154

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R    PWHV  G F+Y +A+  A LG LE+LTF + SG+D++  EA LVN T +  +I+
Sbjct  155  RREAIYPWHVFLGVFLYAMAIGTAELGILERLTFQQFSGMDRFSKEAMLVNSTGLIILIF  214

Query  288  GVFVFLT  268
             + V L+
Sbjct  215  SMLVVLS  221



>ref|XP_010924199.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Elaeis guineensis]
Length=233

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 136/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  HFRGG+A    NK+LIFN+HPVLM+IGF++L GEA+++YK+    K  KKV+HL + 
Sbjct  29   WATHFRGGMALISDNKDLIFNVHPVLMVIGFILLNGEAMLAYKTTSGTKNFKKVVHLTIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L +VGI AA K HN+ GI N YSLHSW+G+   +L+GIQW  GFV F+YPGG+  
Sbjct  89   FLALCLALVGIWAALKFHNDKGIDNFYSLHSWLGLACLLLFGIQWGIGFVTFWYPGGSGH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y  AVA A  G LEK TFL+S+  + +Y +EAFL+N   I  V+
Sbjct  149  RRTFLLPWHVFFGAYIYAFAVATATTGLLEKATFLQSNNVISRYSNEAFLINSLGILLVL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +DD
Sbjct  209  LGGFVILAVITPGAVKDD  226



>gb|KHG00377.1| putative transmembrane ascorbate ferrireductase 2 -like protein 
[Gossypium arboreum]
Length=240

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 132/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG V+L GEA+++YK++P  K  KK++HL + 
Sbjct  36   WTVHYRGGLALISDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVPGTKSFKKLVHLTVQ  95

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A +L  +G+ AA K HN+ GI N YSLHSW+GI    L+GIQW  GF  F+YPGG+ +
Sbjct  96   CLAFILSTIGVWAALKFHNDKGIENFYSLHSWLGIACLFLFGIQWAAGFATFWYPGGSRN  155

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG + Y LAVA A  G LEKLTFL+++  + +Y  EA LVN   I  V+
Sbjct  156  SRAALLPWHVFFGMYTYALAVATATTGILEKLTFLQTNRVISRYSMEALLVNSLGILIVV  215

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L  L+    + D
Sbjct  216  LGGLVILATLTPVNGKSD  233



>ref|XP_010924200.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X2 [Elaeis guineensis]
Length=231

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 136/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  HFRGG+A    NK+LIFN+HPVLM+IGF++L GEA+++YK+    K  KKV+HL + 
Sbjct  29   WATHFRGGMALISDNKDLIFNVHPVLMVIGFILLNGEAMLAYKTTSGTKNFKKVVHLTIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L +VGI AA K HN+ GI N YSLHSW+G+   +L+GIQW  GFV F+YPGG+  
Sbjct  89   FLALCLALVGIWAALKFHNDKGIDNFYSLHSWLGLACLLLFGIQWGIGFVTFWYPGGSGH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y  AVA A  G LEK TFL+S+  + +Y +EAFL+N   I  V+
Sbjct  149  RRTFLLPWHVFFGAYIYAFAVATATTGLLEKATFLQSNNVISRYSNEAFLINSLGILLVL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +DD
Sbjct  209  LGGFVILAVITPGAVKDD  226



>emb|CDP02400.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = -2

Query  819  HFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIA  640
            H+RGGLA   TNK+LIFN+HPVLM+IG V+L GEA+++YK++P  K  KK++HL+L  +A
Sbjct  31   HYRGGLALVSTNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVPGTKSFKKLVHLLLQFLA  90

Query  639  LVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRR  460
            L   ++G+ AA+K HN+ GI N YSLHSW+G+    L+ IQW  GFV F+YPGG+ + R 
Sbjct  91   LSFSVIGLWAAWKFHNDKGIDNFYSLHSWLGLACLFLFAIQWAAGFVTFWYPGGSRNSRA  150

Query  459  ESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVIYGV  283
              LPWHV FG ++Y LA+A    G LEK TFL+++  + +Y  EA LVN   I  V  G 
Sbjct  151  SLLPWHVFFGVYIYALAIATCTTGILEKATFLQTNQIMSRYSKEALLVNSLGILIVALGG  210

Query  282  FVFLTILSQAPTEDDHSYSAI  220
            FV L ++S A  + D + S +
Sbjct  211  FVILAVISPANGKSDVTKSTV  231



>gb|EMS57351.1| Cytochrome b reductase 1 [Triticum urartu]
Length=230

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 137/227 (60%), Gaps = 43/227 (19%)
 Frame = -2

Query  771  FNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHN  592
              +HPVLMLIGF+I+G EAIMSYK+LP   +  K +HL+LHA+AL LG  GI AAFK HN
Sbjct  1    MQVHPVLMLIGFIIIGSEAIMSYKTLPWSHDTNKKVHLILHAVALFLGSFGIYAAFKFHN  60

Query  591  ESGIANLYSLHSWIGIGVAVLYGI------------------------------------  520
            ESGIANLYSLHSW+G+G  +LYG+                                    
Sbjct  61   ESGIANLYSLHSWVGLGTIILYGLQDTSQLMEDLRAIHTKISQMGSVSLNHLLTRLIPIS  120

Query  519  -------QWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE  361
                   QWV GF+ FF+PG +  +RR  LPWHV  G  VY+LA+  A LGFLEKLTFL+
Sbjct  121  DTGVSIMQWVSGFLTFFFPGASPTLRRAVLPWHVRAGLVVYVLALLAAELGFLEKLTFLQ  180

Query  360  SSGLDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDHSYSAI  220
            ++GL KY SEA LVNFTA+  ++ G  V L + + A +E    YS++
Sbjct  181  TAGLGKYSSEALLVNFTALVVLLLGASVVLYVTAPAQSEHRLGYSSV  227



>ref|XP_008775288.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X2 [Phoenix dactylifera]
Length=233

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGG+A    NK+LIFN+HPVLM+IGF++L GEAI++YK++   K +KK++HL + 
Sbjct  29   WAMHFRGGMALISDNKDLIFNVHPVLMVIGFILLNGEAILAYKTISGTKNLKKLVHLTIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++G+ AA K HN+ GI N YSLHSW+G+   +L+G+QW  GFV F+YPGG+  
Sbjct  89   FVALCLALIGVWAALKFHNDKGIDNFYSLHSWLGLACLLLFGVQWGTGFVTFWYPGGSRH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG  +Y LAVA A  G LEK TFL+SS  + +Y +EAFL+N   I  V+
Sbjct  149  GRAFLLPWHVFFGACIYALAVATAATGLLEKATFLQSSQVISRYSNEAFLINSLGILLVL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + D
Sbjct  209  LGGFVILAVITPGAVKGD  226



>ref|XP_011012662.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Populus euphratica]
Length=233

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG V+L GEA+++YK++   K  KK++HL L 
Sbjct  29   WTVHYRGGLALVSDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVSGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA K HN+ GI N YSLHSW+G+   +L+GIQW  GFV F+YPGGT +
Sbjct  89   FLAFCLSLIGLWAALKFHNDKGIDNFYSLHSWLGLACLLLFGIQWAAGFVTFWYPGGTRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA A  G LEK TFL+++  +  Y +EA LVN   I  ++
Sbjct  149  SRATLLPWHVFFGVYIYALAVATATTGILEKATFLQTNKVISHYSTEALLVNSLGILMIV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L  ++   ++ D
Sbjct  209  LGGLVVLATITSLNSKGD  226



>ref|XP_008775287.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Phoenix dactylifera]
Length=238

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGG+A    NK+LIFN+HPVLM+IGF++L GEAI++YK++   K +KK++HL + 
Sbjct  29   WAMHFRGGMALISDNKDLIFNVHPVLMVIGFILLNGEAILAYKTISGTKNLKKLVHLTIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++G+ AA K HN+ GI N YSLHSW+G+   +L+G+QW  GFV F+YPGG+  
Sbjct  89   FVALCLALIGVWAALKFHNDKGIDNFYSLHSWLGLACLLLFGVQWGTGFVTFWYPGGSRH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG  +Y LAVA A  G LEK TFL+SS  + +Y +EAFL+N   I  V+
Sbjct  149  GRAFLLPWHVFFGACIYALAVATAATGLLEKATFLQSSQVISRYSNEAFLINSLGILLVL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + D
Sbjct  209  LGGFVILAVITPGAVKGD  226



>ref|XP_004233407.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Solanum lycopersicum]
Length=232

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            WN+H+RGGLA    NK LIFN+HPVLM+IG V+L GEA+++YK++   K  +K +HLVL 
Sbjct  28   WNVHYRGGLALISDNKALIFNVHPVLMVIGLVLLNGEAMLAYKTVSGTKSFRKSVHLVLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA+K HN+ GI N YSLHSW+G+    L+G+QW  GF  F+YPGG+ +
Sbjct  88   FLAFFLSLIGLWAAWKFHNDKGIDNFYSLHSWLGLFCLFLFGVQWAVGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A    GFLEK TFL++S  + +Y +EA LVN   + TV+
Sbjct  148  SRATLLPWHVFFGIYIYALAIATCATGFLEKATFLQASHIISRYSTEALLVNCLGVLTVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L ++S      D
Sbjct  208  LGGLVILAVVSPMNGRSD  225



>ref|XP_002305954.2| hypothetical protein POPTR_0004s10360g [Populus trichocarpa]
 gb|EEE86465.2| hypothetical protein POPTR_0004s10360g [Populus trichocarpa]
Length=233

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG V+L GEA+++YK++   K  KK++HL L 
Sbjct  29   WTVHYRGGLALVSDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVSGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA+K HN+ GI N YSLHSW+G+   +L+GIQW  GFV F+YPGG+ +
Sbjct  89   FLAFCLSLIGLWAAWKFHNDKGINNFYSLHSWLGLACLLLFGIQWAAGFVTFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA A  G LEK TFL+++  +  Y +EA LVN   I  + 
Sbjct  149  SRATLLPWHVFFGVYIYALAVATATTGILEKATFLQTNKVISHYSAEALLVNLLGILMIA  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L  ++   ++ D
Sbjct  209  LGGLVVLATITSLNSKGD  226



>emb|CAN62730.1| hypothetical protein VITISV_001339 [Vitis vinifera]
 emb|CBI16862.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 133/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+A    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL L 
Sbjct  28   WAVHYRGGMALISENKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKNYKKLVHLSLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L +VG+ AA K HNE GI N YSLHSW+G+    L+GIQW  GF  F+YPGG+ +
Sbjct  88   FLAFCLSLVGVWAAVKFHNERGIDNFYSLHSWLGLACLFLFGIQWATGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV F  ++Y LAVA A  G LEK TFL+S+  + +Y  EA LVN   I  V+
Sbjct  148  SRASLLPWHVFFAVYIYALAVATATTGILEKATFLQSNKVISRYSMEALLVNSLGILIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++ A  + D
Sbjct  208  LGGFVILAVVTPANGKGD  225



>gb|KDP32926.1| hypothetical protein JCGZ_12957 [Jatropha curcas]
Length=232

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W++H+RGGLA    NK+LIFN+HPVLM+IG +++ GEA+++YK++   K  KK++HL L 
Sbjct  28   WSVHYRGGLALVSDNKDLIFNVHPVLMVIGLILMNGEAMLAYKTVQGTKNFKKLVHLTLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA K HN+ GI N YSLHSW+G+    L+GIQW   FV ++YPGG+ +
Sbjct  88   LLAFSLSLIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFGIQWASAFVTYWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA A  G LEK TFL+++  + +Y +EA LVN   +  ++
Sbjct  148  SRATLLPWHVFFGVYIYALAVATATTGILEKATFLQTNKVISRYSTEALLVNSLGVLIIV  207

Query  291  YGVFVFLTILSQAPTEDDHSYSA  223
             G FV L  ++    ++D + +A
Sbjct  208  LGGFVVLATITPLRAKEDITRNA  230



>ref|XP_010924962.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X2 [Elaeis guineensis]
Length=233

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGG+A    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL + 
Sbjct  29   WAMHFRGGMALISDNKDLIFNVHPVLMVIGLILLNGEALLAYKTITGTKNFKKMVHLTIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++G+ AA K HN+ GI N YSLHSW+G+   +L+GIQW  GFV F+YPGG+  
Sbjct  89   FLALCLALIGVWAALKFHNDKGIDNFYSLHSWLGLACLLLFGIQWGSGFVTFWYPGGSRH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A+A  G LEK TFL+SS  + +Y +EAFL+N   I  V+
Sbjct  149  GRAFLLPWHVFFGAYIYALALASAATGLLEKATFLQSSSVISRYSNEAFLINSLGILLVL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + D
Sbjct  209  LGGFVILAVITPGAVKGD  226



>ref|XP_010924953.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Elaeis guineensis]
Length=238

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGG+A    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL + 
Sbjct  29   WAMHFRGGMALISDNKDLIFNVHPVLMVIGLILLNGEALLAYKTITGTKNFKKMVHLTIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++G+ AA K HN+ GI N YSLHSW+G+   +L+GIQW  GFV F+YPGG+  
Sbjct  89   FLALCLALIGVWAALKFHNDKGIDNFYSLHSWLGLACLLLFGIQWGSGFVTFWYPGGSRH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A+A  G LEK TFL+SS  + +Y +EAFL+N   I  V+
Sbjct  149  GRAFLLPWHVFFGAYIYALALASAATGLLEKATFLQSSSVISRYSNEAFLINSLGILLVL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + D
Sbjct  209  LGGFVILAVITPGAVKGD  226



>ref|XP_009416757.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Musa acuminata subsp. malaccensis]
Length=232

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+LIFN+HPVLM+IGF++L GEAI++YK++P  K  KK +HL + 
Sbjct  28   WAVHFRGGLALISDNKDLIFNVHPVLMVIGFILLNGEAILAYKTMPGTKSFKKAVHLSIQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL LG++G  AA K HN+ GI N YSLHSW+G+   +L+ IQW  GF  F+YPGG+  
Sbjct  88   FLALCLGLIGTWAALKFHNDKGIDNFYSLHSWLGLACILLFSIQWGMGFATFWYPGGSRS  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAV  A+ G LEK TFL++S  + +Y +EA L+N   I  V+
Sbjct  148  SRAFLLPWHVFFGAYIYALAVVTAITGLLEKATFLQASKTILRYSNEALLINSLGILLVL  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++      D
Sbjct  208  LGGFVILALVTPGTARSD  225



>ref|XP_002283161.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Vitis vinifera]
Length=265

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 133/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+A    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL L 
Sbjct  61   WAVHYRGGMALISENKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKNYKKLVHLSLQ  120

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L +VG+ AA K HNE GI N YSLHSW+G+    L+GIQW  GF  F+YPGG+ +
Sbjct  121  FLAFCLSLVGVWAAVKFHNERGIDNFYSLHSWLGLACLFLFGIQWATGFATFWYPGGSRN  180

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV F  ++Y LAVA A  G LEK TFL+S+  + +Y  EA LVN   I  V+
Sbjct  181  SRASLLPWHVFFAVYIYALAVATATTGILEKATFLQSNKVISRYSMEALLVNSLGILIVV  240

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++ A  + D
Sbjct  241  LGGFVILAVVTPANGKGD  258



>ref|XP_009395542.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=271

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 133/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + FRGGLA    N++L+FN+HPVLM+IGF++L GEAI++YK+L   K  KK +HL + 
Sbjct  67   WVVRFRGGLALNSDNRDLVFNVHPVLMVIGFILLYGEAILAYKTLSGTKNFKKAMHLTIQ  126

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL LG +G+ AA K HN  GI N YSLHSW+G+   +L+GIQW  GF  F+YPGGT +
Sbjct  127  FLALCLGFIGVWAALKFHNGKGIDNFYSLHSWLGLTCLLLFGIQWGIGFATFWYPGGTRN  186

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLD-KYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAV  A  G LEK TFL+SS +  +Y +EAFL+NF  I  V 
Sbjct  187  GRAFLLPWHVFFGLYIYALAVITATTGLLEKATFLQSSSIVLRYSNEAFLINFLGILIVA  246

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV   +++    + D
Sbjct  247  LGGFVVFAVITPGSVKPD  264



>ref|XP_006373463.1| hypothetical protein POPTR_0017s14010g [Populus trichocarpa]
 gb|ERP51260.1| hypothetical protein POPTR_0017s14010g [Populus trichocarpa]
Length=233

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 133/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN HPVLM+IG V++ GEA+++YK++P  K  KK++HL L 
Sbjct  29   WTVHYRGGLALVSANKDLIFNAHPVLMVIGLVLVNGEAMLAYKTVPGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G  AA K HN+ GI N YSLHSW+G+    L+ IQW  GFV F+YPGG+ +
Sbjct  89   FLAFCLSLIGFWAALKFHNDKGIDNFYSLHSWLGLACLFLFSIQWASGFVTFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G ++Y L+VA A  G LEK+TFL+++  + +Y +EA LVN   I  ++
Sbjct  149  SRATLLPWHVFSGVYIYALSVATATTGILEKVTFLQTNNVISRYSTEALLVNSLGILMIV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L  +S   ++ D
Sbjct  209  LGGFVVLASVSSLNSKGD  226



>gb|AFK36991.1| unknown [Medicago truncatula]
Length=150

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+PF+ VAH + +V  VLVL WN+HFRGGLAW   NK  IFNLHPVLMLIG +I
Sbjct  1    MALGVPAVPFTYVAHLLGIVAIVLVLFWNLHFRGGLAWNSDNKAQIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPLKKEVKK+IHLVLHA ALVLGI+GICAAFKNHNESGIANLYSLHSW+
Sbjct  61   IGGEAIISYKSLPLKKEVKKLIHLVLHAHALVLGIIGICAAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYP  484
            GIGV  LYGIQW++G    F P
Sbjct  121  GIGVISLYGIQWIFGVCGIFLP  142



>ref|XP_010262598.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Nelumbo nucifera]
Length=231

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 133/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGLA    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK +HL + 
Sbjct  28   WALRYRGGLALISENKDLIFNVHPVLMVIGLILLNGEAMLAYKTVMGTKTFKKAVHLAVQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++G+ AA K HNE GI N YSLHSW+G+    L+GIQW  GF  F+YPGG  +
Sbjct  88   FLALCLSVIGVWAALKFHNEKGIDNFYSLHSWLGLACLFLFGIQWAAGFATFWYPGGGRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA A  G LEK TFL+++  + +Y +EA LVN   I  V+
Sbjct  148  SRAALLPWHVFFGVYIYALAVATATTGILEKATFLQTNQVITRYSTEALLVNTLGILIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++   ++ D
Sbjct  208  MGGFVILAVITPTISKGD  225



>gb|KDP29352.1| hypothetical protein JCGZ_18273 [Jatropha curcas]
Length=240

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 138/204 (68%), Gaps = 2/204 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGL+   TNK+LIFN+HPVL++IG ++L GEA+++YK++   K  +K +HL + 
Sbjct  29   WALHFRGGLSLSSTNKDLIFNVHPVLVVIGLILLNGEAMLAYKTISRSKNFRKAVHLAIQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            +++  L ++G+ AA+K HNE GI N YSLHSW+G+    L+G QW  GF  F+YPGG+ +
Sbjct  89   SVSFCLSVIGVWAAYKFHNEKGIDNFYSLHSWLGLACLFLFGTQWAAGFSTFWYPGGSVN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+  A  G LEK TFL+++  + +Y SEA L+NF  +  V+
Sbjct  149  CRASLLPWHVFFGIYIYALAIGTAATGILEKATFLQTNHVILRYSSEALLLNFLGMLIVV  208

Query  291  YGVFVFLTILSQAPTEDDHSYSAI  220
             G  V L +++    + D +YS +
Sbjct  209  LGGCVILAVITPKIDKAD-AYSPL  231



>ref|XP_010097840.1| putative transmembrane ascorbate ferrireductase 2 [Morus notabilis]
 gb|EXB72263.1| putative transmembrane ascorbate ferrireductase 2 [Morus notabilis]
Length=251

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 133/203 (66%), Gaps = 1/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  HFRGGLA    NK+LIFN+HPVLM+IG V+L GEA+++YK++   K  KK++HL L 
Sbjct  47   WTNHFRGGLALISDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTISGTKSFKKLVHLGLQ  106

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA K HN+ GI N YSLHSW+G+    L+GIQW  GFV F+ PGGTA 
Sbjct  107  FLAFCLSIIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFGIQWAAGFVTFWNPGGTAS  166

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A    G LEK TFL+++  + +Y +EA LVN   +  V 
Sbjct  167  NRASLLPWHVFFGVYIYALAIATVTTGILEKATFLQTNKVISRYSTEALLVNSLGVLVVA  226

Query  291  YGVFVFLTILSQAPTEDDHSYSA  223
             G FV L +++    + D+   A
Sbjct  227  LGGFVILALVTSTNDKVDNVREA  249



>ref|XP_010029474.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Eucalyptus grandis]
Length=236

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 133/200 (67%), Gaps = 1/200 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGLA     K+LIFN+HPVLM+IG ++L GEAI++YK+ P  K  KK++HL L 
Sbjct  28   WAVRYRGGLALVSDRKDLIFNVHPVLMVIGLILLNGEAILAYKTFPGTKSFKKLVHLTLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L IVG+ AA+K H + GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  88   FLALCLSIVGLWAAWKFHVDKGIDNFYSLHSWLGLACLSLFSIQWATGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA    GFLEK TFL+++  +  Y SEA LVN   I  V+
Sbjct  148  SRTTLLPWHVFFGVYIYALAVATCATGFLEKATFLQTNHIISHYSSEALLVNSLGILVVV  207

Query  291  YGVFVFLTILSQAPTEDDHS  232
             G  V L ++S A ++ D +
Sbjct  208  LGGLVTLAVVSPANSKVDSA  227



>ref|XP_006482300.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482301.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
isoform X2 [Citrus sinensis]
Length=231

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 136/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGL+    NK+LIFN+HPVLM+IG V+L GEA+++YK++   K+++K++HL L 
Sbjct  28   WTVQYRGGLSLASDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVSGTKKLRKLVHLSLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IA +L ++G+ AA K HN+ GI N YSLHSW+G+    L+GIQW  GF  F+YPGG+ +
Sbjct  88   FIAFLLSLIGVWAALKFHNDKGIDNFYSLHSWLGLACVFLFGIQWAAGFTTFWYPGGSKN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G ++Y LAVA A  G LEK+TFL+++  + +Y +EA LVN   I  V+
Sbjct  148  GRASLLPWHVFLGVYIYALAVATAATGILEKVTFLQTNHVISRYSTEALLVNSLGILIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + +
Sbjct  208  LGGFVILALITPENGKSE  225



>ref|XP_006430824.1| hypothetical protein CICLE_v10012646mg [Citrus clementina]
 gb|ESR44064.1| hypothetical protein CICLE_v10012646mg [Citrus clementina]
Length=231

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 136/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGL+    NK+LIFN+HPVLM+IG V+L GEA+++YK++   K+++K++HL L 
Sbjct  28   WTVQYRGGLSLASDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVSGTKKLRKLVHLSLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IA +L ++G+ AA K HN+ GI N YSLHSW+G+    L+GIQW  GF  F+YPGG+ +
Sbjct  88   FIAFLLSLIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFGIQWAAGFTTFWYPGGSKN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G ++Y LAVA A  G LEK+TFL+++  + +Y +EA LVN   I  V+
Sbjct  148  GRASLLPWHVFLGVYIYALAVATAATGILEKVTFLQTNHVISRYSTEALLVNSLGILIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + +
Sbjct  208  LGGFVILALITPENGKSE  225



>gb|KCW56404.1| hypothetical protein EUGRSUZ_I02130 [Eucalyptus grandis]
Length=333

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 133/200 (67%), Gaps = 1/200 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGLA     K+LIFN+HPVLM+IG ++L GEAI++YK+ P  K  KK++HL L 
Sbjct  125  WAVRYRGGLALVSDRKDLIFNVHPVLMVIGLILLNGEAILAYKTFPGTKSFKKLVHLTLQ  184

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L IVG+ AA+K H + GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  185  FLALCLSIVGLWAAWKFHVDKGIDNFYSLHSWLGLACLSLFSIQWATGFATFWYPGGSRN  244

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA    GFLEK TFL+++  +  Y SEA LVN   I  V+
Sbjct  245  SRTTLLPWHVFFGVYIYALAVATCATGFLEKATFLQTNHIISHYSSEALLVNSLGILVVV  304

Query  291  YGVFVFLTILSQAPTEDDHS  232
             G  V L ++S A ++ D +
Sbjct  305  LGGLVTLAVVSPANSKVDSA  324



>ref|XP_002525965.1| cytochrome B561, putative [Ricinus communis]
 gb|EEF36389.1| cytochrome B561, putative [Ricinus communis]
Length=232

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 132/198 (67%), Gaps = 2/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK++IFN+HPVLM+I  +++ GEA+++YK++   K  KK++HL L 
Sbjct  28   WTVHYRGGLALASDNKDVIFNVHPVLMVIALILINGEAMLTYKTVSGTKNFKKLVHLTLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++G  AA K HNE GI N YSLHSW+G+    L+G+Q+  GFV F+YPGG+  
Sbjct  88   LVALCLSLIGAWAALKFHNEKGIDNFYSLHSWLGLACLFLFGVQYAAGFVTFWYPGGSGK  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA A  G LEK TFL+++  + +Y +EA LVN   I  ++
Sbjct  148  SRATLLPWHVFFGVYIYALAVATATTGILEKATFLQTNKVISRYSTEALLVNSMGILIIV  207

Query  291  YGVFVFL-TILSQAPTED  241
             G FV L TI    P E 
Sbjct  208  LGGFVVLATITPLHPKES  225



>ref|XP_006344832.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Solanum tuberosum]
Length=232

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 132/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            WN+H+RGGLA    NK LIFN+HPV+M+IG V+L GEA+++YK++   K  +K +HLVL 
Sbjct  28   WNVHYRGGLALISDNKALIFNVHPVVMVIGLVLLNGEAMLAYKTVSGTKSFRKSVHLVLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA+K HN+ GI N YSLHSW+G+    L+G+QW  GF  F+YPGG+ +
Sbjct  88   FLAFFLSLIGLWAAWKFHNDKGIDNFYSLHSWLGLFCLFLFGVQWAVGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWH  FG ++Y LA+A    GFLEK TFL++S  + +Y +EA LVN   +  V+
Sbjct  148  SRATLLPWHAFFGIYIYALAIATCATGFLEKATFLQASHIISRYSTEALLVNCLGVLIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L ++S      D
Sbjct  208  LGGLVILAVVSPMNGRSD  225



>gb|KCW56403.1| hypothetical protein EUGRSUZ_I02130 [Eucalyptus grandis]
Length=336

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 133/200 (67%), Gaps = 1/200 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGLA     K+LIFN+HPVLM+IG ++L GEAI++YK+ P  K  KK++HL L 
Sbjct  125  WAVRYRGGLALVSDRKDLIFNVHPVLMVIGLILLNGEAILAYKTFPGTKSFKKLVHLTLQ  184

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L IVG+ AA+K H + GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  185  FLALCLSIVGLWAAWKFHVDKGIDNFYSLHSWLGLACLSLFSIQWATGFATFWYPGGSRN  244

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA    GFLEK TFL+++  +  Y SEA LVN   I  V+
Sbjct  245  SRTTLLPWHVFFGVYIYALAVATCATGFLEKATFLQTNHIISHYSSEALLVNSLGILVVV  304

Query  291  YGVFVFLTILSQAPTEDDHS  232
             G  V L ++S A ++ D +
Sbjct  305  LGGLVTLAVVSPANSKVDSA  324



>ref|XP_011021197.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Populus euphratica]
Length=233

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 131/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN HPVLM+ G V++ GEA+++YK++P  K  KK++HL L 
Sbjct  29   WTVHYRGGLALVSVNKDLIFNAHPVLMVTGLVLVNGEAMLAYKTVPGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G  AA K HN+ GI N YSLHSW+G+    L+ IQW  GFV F+YPGG+ +
Sbjct  89   FLAFCLSLIGFWAALKFHNDKGIDNFYSLHSWLGLACLFLFSIQWASGFVTFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G ++Y L+VA A  G LEK+TFL+++  + +Y +EA LVN   I  ++
Sbjct  149  SRATLLPWHVFSGVYIYALSVATATTGILEKVTFLQTNNVISRYSTEALLVNSLGILMIV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L   +   ++ D
Sbjct  209  LGGFVVLASATSLESKGD  226



>gb|ADE77752.1| unknown [Picea sitchensis]
Length=237

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGG+A    +KNLIFN+HP LMLIGF++L GEA++ YK++P  K  KK +HLVL 
Sbjct  28   WVLHFRGGMALISDDKNLIFNVHPTLMLIGFILLSGEAMLVYKTVPGTKNYKKAVHLVLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L ++GI AA+K HN+ GI N YSLHSW+G+   +L+GIQW  GF  F+YPGG+ +
Sbjct  88   GLALGLAMIGIWAAYKFHNDKGIDNFYSLHSWLGVACVLLFGIQWAVGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWH   G ++Y LAVA A  G LEKLTFL++S  + +Y +EA LVN   +   +
Sbjct  148  SRATVLPWHSFLGLYIYGLAVATAETGLLEKLTFLQASKTIARYSTEALLVNCLGLLLAL  207

Query  291  YGVFVFLTILSQAPTEDD  238
                V L+ +S A  + D
Sbjct  208  LSGCVILSTISPANAKGD  225



>gb|KCW56402.1| hypothetical protein EUGRSUZ_I02130 [Eucalyptus grandis]
Length=368

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 141/230 (61%), Gaps = 15/230 (7%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGLA     K+LIFN+HPVLM+IG ++L GEAI++YK+ P  K  KK++HL L 
Sbjct  125  WAVRYRGGLALVSDRKDLIFNVHPVLMVIGLILLNGEAILAYKTFPGTKSFKKLVHLTLQ  184

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL L IVG+ AA+K H + GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  185  FLALCLSIVGLWAAWKFHVDKGIDNFYSLHSWLGLACLSLFSIQWATGFATFWYPGGSRN  244

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA    GFLEK TFL+++  +  Y SEA LVN   I  V+
Sbjct  245  SRTTLLPWHVFFGVYIYALAVATCATGFLEKATFLQTNHIISHYSSEALLVNSLGILVVV  304

Query  291  YGVFVFLTILSQAPTEDDHSYSAI*W--------------HISTIILPVD  184
             G  V L ++S A ++ D +   + W              H+ TI  P D
Sbjct  305  LGGLVTLAVVSPANSKVDSAEVQMLWKYYHPFNDWILHEFHLITIFAPSD  354



>ref|XP_010271183.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Nelumbo nucifera]
Length=224

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 132/194 (68%), Gaps = 4/194 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGL  +  NK+ +FN+HP LM  GFV L GEAIM+YK+ P++K+V+K IH++LH
Sbjct  34   WLLHFRGGLDLDSDNKDKVFNVHPFLMYAGFVFLAGEAIMAYKTFPMEKKVRKFIHMLLH  93

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+VLGIVGI AAFK HNE GI N++SLHSW+G+G   L+ +QW+Y FV FF+PG    
Sbjct  94   LVAIVLGIVGINAAFKFHNEVGIPNMFSLHSWLGMGTFCLFCLQWLYSFVTFFFPGAEVS  153

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWH + G  +  +AV  A  G +EK T +      ++G+E+ L+NFT ++ + +
Sbjct  154  TRGRMLPWHKVGGRTLLYMAVCTAESGLMEKATVMNL----RHGTESRLMNFTGLAILFF  209

Query  288  GVFVFLTILSQAPT  247
            G+ V  TI  +  T
Sbjct  210  GIAVDFTISVRVST  223



>ref|XP_010692471.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 136/203 (67%), Gaps = 1/203 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+I  V++ GEA+++YK++P  K  KK++HLVL 
Sbjct  28   WTLHYRGGLALISENKDLIFNIHPVLMVISLVLINGEAMLAYKTVPGTKAFKKLVHLVLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA+K HN+ GI N YSLHSW+G+    L+ +QW  GF  F+YPGG+ +
Sbjct  88   FLAFCLAIIGVWAAWKFHNDKGIDNFYSLHSWLGLACLFLFTLQWAGGFTTFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+   + G LEK TFL+++  + +Y +EA LVN   I  V+
Sbjct  148  NRSSLLPWHVFFGVYIYALAIVTTVTGILEKATFLQTNHVISRYSTEALLVNSMGILIVV  207

Query  291  YGVFVFLTILSQAPTEDDHSYSA  223
             G FV L +++    + +   SA
Sbjct  208  LGGFVILALVAPLNGKGEIPRSA  230



>ref|XP_004306029.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Fragaria vesca subsp. vesca]
Length=262

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 130/197 (66%), Gaps = 1/197 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W IHFRGGLA    NK+LIFN+HPVLM+IG VIL GEA+++YK++   K  KK++HL L 
Sbjct  29   WTIHFRGGLALISDNKDLIFNVHPVLMVIGLVILNGEAMLAYKTVSGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IA  L IVG+ AA K HN+ GI N YSLHSW+G+    L+ IQ   GFV ++YPGG+ +
Sbjct  89   FIAFCLSIVGVWAALKFHNDKGIDNFYSLHSWLGLACVFLFTIQGAAGFVTYWYPGGSKN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   +PWHV FG ++Y LAV     G LEK TFL+++  + +Y +EA L+N   I  V 
Sbjct  149  SRANLMPWHVFFGVYIYALAVVTVTTGILEKATFLQANHVISRYSTEALLINSLGILVVA  208

Query  291  YGVFVFLTILSQAPTED  241
             G FV L +++ A   D
Sbjct  209  LGGFVILAVIAPANKGD  225



>gb|EPS73361.1| hypothetical protein M569_01396 [Genlisea aurea]
Length=234

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 140/206 (68%), Gaps = 3/206 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + +RGGLA    +K LIFN+HPVLM+IG V++ GEAI++YK++P  K  KK++HL L 
Sbjct  28   WKVRYRGGLALAAEDKILIFNVHPVLMVIGLVVIHGEAILAYKTVPGTKRFKKLVHLSLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A +L I+G+ AA+K H E GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  88   FLAFLLSIIGLWAAWKFHVERGIDNFYSLHSWLGLACLFLFAIQWGAGFYTFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG +VY+LAVA  L GFLEKLTFL+S+ +  +Y +EA LVN   I  ++
Sbjct  148  SRASLLPWHVFFGIYVYVLAVATCLTGFLEKLTFLQSAKMVTRYSTEALLVNSLGILLIV  207

Query  291  YGVFVFLTILSQAP--TEDDHSYSAI  220
                + L ++S +   ++ D + +A+
Sbjct  208  LSGLMVLGVVSNSAVISKGDLNRAAV  233



>ref|XP_009357027.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Pyrus x bretschneideri]
Length=234

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 1/191 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL+L 
Sbjct  29   WTVHFRGGLALISDNKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKNSKKLVHLMLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA K HN+ GI N YSLHSW+G+   +L+ +QW  GFV +++PGG+  
Sbjct  89   FLAFCLSIIGVWAALKFHNDKGIDNFYSLHSWLGLACLLLFTLQWAAGFVTYWFPGGSKH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG + Y LAV     G LEK+TFL+++  + +Y +EA LVN   I  V+
Sbjct  149  SRANLLPWHVFFGVYTYALAVVTVTTGILEKVTFLQTNQVISRYSTEALLVNSLGILVVV  208

Query  291  YGVFVFLTILS  259
             G FV L +++
Sbjct  209  LGGFVILAVIT  219



>ref|XP_006828023.1| hypothetical protein AMTR_s00008p00250900 [Amborella trichopoda]
 gb|ERM95439.1| hypothetical protein AMTR_s00008p00250900 [Amborella trichopoda]
Length=225

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 148/215 (69%), Gaps = 1/215 (0%)
 Frame = -2

Query  903  IAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILG  724
            +  +A P++ VA  + +  +VL+LVWNIHFRGGLA+   NK LIFN+HPVLM IGF+ + 
Sbjct  9    LGMRARPWTLVALLLGVAASVLMLVWNIHFRGGLAFRSANKQLIFNIHPVLMFIGFIFVS  68

Query  723  GEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGI  544
            G AI++YK +P  K+ +K IH++LH +ALVLGI G+ A FK H ES I ++YSLHSW G+
Sbjct  69   GNAIVAYKMVPGSKKGQKSIHMLLHLVALVLGITGVYAVFKFHRESKIHDMYSLHSWFGM  128

Query  543  GVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFL  364
            G   LYG+Q+++GF+ F++P      R + +P H   G  ++++A   A +G LEKLTFL
Sbjct  129  GTICLYGLQFIWGFLFFWFPKVGTSRRSKLVPLHWFIGLILFLMATCTAEMGLLEKLTFL  188

Query  363  ES-SGLDKYGSEAFLVNFTAISTVIYGVFVFLTIL  262
            E   GL  YG EA LVNFT I+ +++ + V L ++
Sbjct  189  ELFGGLKVYGREALLVNFTGIAILLFAIAVTLCVI  223



>ref|XP_008230380.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Prunus mume]
Length=234

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 132/200 (66%), Gaps = 3/200 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W I FRGGLA    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL L 
Sbjct  29   WTIRFRGGLALISDNKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA K HN+ GI N YSLHSW+G+    L+ +QW  GFV ++YPGG+ +
Sbjct  89   FLAFCLSIIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFTLQWAAGFVTYWYPGGSKN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G + Y LAV     G LEK TFL+++  + +Y +EA LVN   I  V+
Sbjct  149  SRATLLPWHVFVGIYTYALAVVTVTTGILEKATFLQTNHIISRYSTEALLVNSLGILVVV  208

Query  291  YGVFVFLTILSQAPTEDDHS  232
             G FV L +++  PT ++ S
Sbjct  209  LGGFVILAVIT--PTNNNRS  226



>gb|EYU44300.1| hypothetical protein MIMGU_mgv1a013024mg [Erythranthe guttata]
Length=232

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 133/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+I  V+L GEA+++YK++   K +KK++HL L 
Sbjct  28   WTVHYRGGLALISDNKDLIFNVHPVLMVISLVLLNGEAMLAYKTVSGTKSLKKLVHLSLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA+K H + GI N YSLHSW+G+    L+GIQW  GFV F+YPGG+  
Sbjct  88   CMAFCLSIIGVWAAWKFHVDKGIDNFYSLHSWLGLACLFLFGIQWAAGFVTFWYPGGSRS  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G ++Y LAVA    G LEK+TFL+++  + +Y +EA +VN   +  V+
Sbjct  148  SRVSLMPWHVFIGIYIYALAVATCTTGILEKVTFLQTNKVITRYSAEALMVNSLGVLLVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
               FV L ++S A  + D
Sbjct  208  LAGFVILGVVSPANGKAD  225



>ref|XP_008341861.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Malus domestica]
Length=234

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 133/199 (67%), Gaps = 3/199 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            WN+HFRGGLA    +K+LIFN+HPVLM+IG ++L GEA+++YK++   K +KK++HL L 
Sbjct  29   WNVHFRGGLALISDDKSLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  + I+G+ AA K HN+ GI N YSLHSW+G+    L+ +QW  GFV +++PGG+  
Sbjct  89   FLAFCVSIIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFTLQWAAGFVTYWFPGGSKH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG + Y LAV     G LEK+TFL++   + +Y +EA LVN   I  ++
Sbjct  149  SRANLLPWHVFFGVYTYALAVVTVTTGILEKVTFLQTHQVISRYSTEALLVNSLGILVIV  208

Query  291  YGVFVFLTILSQAPTEDDH  235
             G FV L +++  P  D+ 
Sbjct  209  LGGFVILAVIT--PMNDNR  225



>ref|XP_008379502.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Malus domestica]
Length=234

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 133/198 (67%), Gaps = 3/198 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL+L 
Sbjct  29   WTVHFRGGLALISDNKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGPKNSKKLVHLMLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA K HN+ GI N YSLHSW+G+    L+ +QW  GFV +++PGG+  
Sbjct  89   FLAFCLSIIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFTLQWAAGFVTYWFPGGSKH  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG + Y LAV     G LEK+TFL+++  + +Y +EA LVN   I  V+
Sbjct  149  SRANLLPWHVFFGVYTYALAVVTVTTGILEKVTFLQTNQVISRYSTEALLVNSLGILVVV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++  P  ++
Sbjct  209  LGGFVILAVIT--PMNNN  224



>ref|XP_009371014.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Pyrus x bretschneideri]
Length=233

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 145/226 (64%), Gaps = 3/226 (1%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+     P       I +++A LVL WN+HFRGGLA    +K+LIFN+HPVLM+IG ++
Sbjct  1    MAVPVVPFPILNAVRVIGVIVAALVLTWNVHFRGGLALISDDKSLIFNVHPVLMVIGLIL  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            L GEA+++YK++   K +KK++HL L  +A  L I+G+ AA K HN+ GI N YSLHSW+
Sbjct  61   LNGEAMLAYKTVSGTKNLKKLVHLTLQFLAFCLSIIGVWAALKFHNDKGIDNFYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            G+    L+ +QW  GFV +++PGG+   R   LPWHV FG + Y LAV     G LEK+T
Sbjct  121  GLACLFLFTLQWAAGFVTYWFPGGSKHSRANLLPWHVFFGVYTYALAVVTVTTGILEKVT  180

Query  369  FLESSG-LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDDH  235
            FL++   + +Y +EA LVN   I  V+ G FV L +++  P  ++ 
Sbjct  181  FLQTHQVISRYSTEALLVNSLGILVVVLGGFVILAVIT--PMNNNR  224



>ref|XP_007215912.1| hypothetical protein PRUPE_ppa010828mg [Prunus persica]
 gb|EMJ17111.1| hypothetical protein PRUPE_ppa010828mg [Prunus persica]
Length=234

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 132/199 (66%), Gaps = 3/199 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W I FRGGLA    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL L 
Sbjct  29   WTIRFRGGLALISDNKDLIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKSFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA K HN+ GI N YSLHSW+G+    L+ +QW  GFV ++YPGG+ +
Sbjct  89   FLAFCLSIIGVWAALKFHNDKGIDNFYSLHSWLGLACLFLFTLQWTAGFVTYWYPGGSKN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G + Y LAV     G LEK+TFL+++  + +Y +EA LVN   I  V+
Sbjct  149  SRATLLPWHVFVGIYTYALAVVTVTTGILEKVTFLQTNHIISRYSTEALLVNSLGILVVV  208

Query  291  YGVFVFLTILSQAPTEDDH  235
             G FV L +++  PT ++ 
Sbjct  209  LGGFVILAVIT--PTNNNR  225



>dbj|BAE46407.1| cytochrome b561 [Citrullus lanatus]
Length=232

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 134/198 (68%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+ IFN+HPVLM+IG ++L GEA+++YK++   K  KK++HL L 
Sbjct  28   WTLHFRGGLALISENKDHIFNVHPVLMVIGLILLNGEAMLAYKTVSGTKNFKKLVHLALQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++GI AA K HN+ GI N YSLHSW+G+    L+GIQW  GFV F+YPGG+ +
Sbjct  88   FVAFFLSLIGIWAALKFHNDKGIDNFYSLHSWLGLVSIFLFGIQWSAGFVTFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y L++A  + G LEK TFL++S  + +Y +EA L+N   +  V+
Sbjct  148  SRATLLPWHVFFGIYIYGLSIATTVTGLLEKATFLQTSKVILRYSNEALLINSLGVLIVL  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L +++ +  + D
Sbjct  208  LGGLVILAVIAPSNAKGD  225



>ref|XP_007151758.1| hypothetical protein PHAVU_004G072300g [Phaseolus vulgaris]
 gb|ESW23752.1| hypothetical protein PHAVU_004G072300g [Phaseolus vulgaris]
Length=232

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 132/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+LIFN+HPVLM+IG +++ GE +++YK+L   K  KK +HL L 
Sbjct  29   WALHFRGGLALVSDNKDLIFNVHPVLMVIGLILINGEGMLAYKTLSGTKSFKKSVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL+L ++GI AA+K H + GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  89   FVALILSLIGIWAAWKFHIDKGIDNFYSLHSWLGLACFFLFSIQWAAGFATFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A A  G LEK TFL+ +  + +Y +EA L+N   I  VI
Sbjct  149  RRATLLPWHVFFGIYIYALAIATAATGILEKATFLQVNNIISRYSNEALLINSLGILIVI  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + D
Sbjct  209  LGGFVILGLVTPVYGKAD  226



>ref|XP_004141495.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Cucumis sativus]
 ref|XP_004156182.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Cucumis sativus]
 gb|KGN52567.1| hypothetical protein Csa_5G643950 [Cucumis sativus]
Length=232

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 145/225 (64%), Gaps = 1/225 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+     P       + +++A L+ +W +HFRGGLA    NK+ IFN+HPVLM+ G ++
Sbjct  1    MAVPVVQFPIFLAVRVLGMLVAALLFMWTLHFRGGLALISDNKDHIFNVHPVLMVTGLIL  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            L GEA+++YK++   K  KK++HL L  +A  L ++GI AA K HN+ GI N YSLHSW+
Sbjct  61   LNGEAMLAYKTVSGTKNFKKLVHLTLQFVAFFLSLIGIWAALKFHNDKGIENFYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            G+    L+G+QW  GFV F+YPGG+ + R   LPWHV FG ++Y L++A  + G LEK T
Sbjct  121  GLVSIFLFGVQWSAGFVTFWYPGGSRNSRATLLPWHVFFGVYIYGLSIATTVTGLLEKAT  180

Query  369  FLESSG-LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            FL++S  + +Y +EA L+N   +  V+ G  V L +++ +  + D
Sbjct  181  FLQTSKVISRYSNEALLINSLGVLIVLLGGLVILAVIAPSYAKGD  225



>ref|XP_008459454.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Cucumis melo]
Length=232

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 145/225 (64%), Gaps = 1/225 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+     P       + +++A L+ +W +HFRGGLA    NK+ IFN+HPVLM+ G ++
Sbjct  1    MAVPVVQFPIFLAVRVLGMLVAALLFIWTLHFRGGLALISDNKDHIFNVHPVLMVTGLIL  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            L GEA+++YK++   K  KK++HL L  +A  L ++GI AA K HN+ GI N YSLHSW+
Sbjct  61   LNGEAMLAYKTVSGTKNFKKLVHLTLQFVAFFLSLIGIWAALKFHNDKGIDNFYSLHSWL  120

Query  549  GIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLT  370
            G+    L+GIQW  GFV F+YPGG+ + R   LPWHV FG ++Y L++A  + G LEK T
Sbjct  121  GLVSIFLFGIQWSAGFVTFWYPGGSRNSRATLLPWHVFFGVYIYGLSIATTVTGLLEKAT  180

Query  369  FLESSG-LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPTEDD  238
            FL++S  + +Y +EA L+N   +  V+ G  V L +++ +  + D
Sbjct  181  FLQTSKVILRYSNEALLINSLGVLIVLLGGLVILAVIAPSNAKGD  225



>ref|NP_001060763.1| Os08g0101700 [Oryza sativa Japonica Group]
 dbj|BAD03555.1| putative cytochrome b561 [Oryza sativa Japonica Group]
 dbj|BAD33151.1| putative cytochrome b561 [Oryza sativa Japonica Group]
 dbj|BAF22677.1| Os08g0101700 [Oryza sativa Japonica Group]
 gb|EAZ05277.1| hypothetical protein OsI_27480 [Oryza sativa Indica Group]
 gb|EAZ41218.1| hypothetical protein OsJ_25723 [Oryza sativa Japonica Group]
 dbj|BAG96507.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87771.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91769.1| unnamed protein product [Oryza sativa Japonica Group]
Length=238

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 125/178 (70%), Gaps = 5/178 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPL---KKEVKKVIHL  658
            W +HFRGGLA    NK LIFN HPVLM++G V+L  EAI+SY+SL +    ++ +K +HL
Sbjct  35   WCVHFRGGLALRSHNKQLIFNTHPVLMVLGLVVLAAEAILSYRSLSIIVSSRDARKKVHL  94

Query  657  VLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGG  478
             LHA+ L LG VGI A FK H E+ I NLYSLHSWIGI    LY + W+  F+ FF+PG 
Sbjct  95   GLHAVGLALGGVGIYAVFKYHAEADIPNLYSLHSWIGIATISLYALHWLLAFLTFFFPGA  154

Query  477  TADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG--LDKYGSEAFLVNFT  310
            + D RR ++PWH L G  V+ LAV NA LGFLEKLTFL++    L +YG+EA LVNFT
Sbjct  155  SHDTRRSAVPWHALLGLLVFALAVGNAQLGFLEKLTFLQAPPLRLSRYGAEALLVNFT  212



>ref|XP_003638361.1| Cytochrome b reductase [Medicago truncatula]
Length=142

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+PF+ VAH + +V  VLVL WN+HFRGGLAW   NK  IFNLHPVLMLIG +I
Sbjct  1    MALGVPAVPFTYVAHLLGIVAIVLVLFWNLHFRGGLAWNSDNKAQIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+SYKSLPLKKEVKK+IHLVLHA ALVLGI+GICAAFKNHNESGIANLYSLHSW+
Sbjct  61   IGGEAIISYKSLPLKKEVKKLIHLVLHAHALVLGIIGICAAFKNHNESGIANLYSLHSWL  120

Query  549  GIGVAVLYGIQ  517
            GIGV  LYGIQ
Sbjct  121  GIGVISLYGIQ  131



>ref|XP_003555094.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Glycine max]
 gb|KHN28344.1| Putative transmembrane ascorbate ferrireductase 2 [Glycine soja]
Length=232

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 130/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+LIFN+HPVLM+IG V++ GE +++YK+L   K  KK +HL L 
Sbjct  29   WAVHFRGGLALVSDNKDLIFNVHPVLMVIGLVLINGEGMLAYKTLSGTKNFKKSVHLALQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              AL+L ++G+ AA+K H + GI N YSLHSW+G+    L+ IQW  GF  F+YPGG+ +
Sbjct  89   FAALILSLIGVWAAWKFHIDKGIDNFYSLHSWLGLACLFLFTIQWGAGFATFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+A    G LEK TFL+ +  + +Y +EA LVN   I  VI
Sbjct  149  SRAALLPWHVFFGIYIYCLAIATTATGILEKATFLQVNNIISRYSNEALLVNSLGILIVI  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L I++    + D
Sbjct  209  LGGFVILGIVTPVYGKAD  226



>ref|XP_009623679.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Nicotiana tomentosiformis]
Length=232

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 131/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W++H+RGGLA    NK LIFN+HPVLM+I  V+L GEA+++YK++   K  +K++HLVL 
Sbjct  28   WSVHYRGGLALISDNKALIFNVHPVLMVISLVLLNGEAMLAYKTVSGTKSFQKLVHLVLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA+K H + GI N YSLHSW+G+    L+G+QW  GF  F+YPGG+ +
Sbjct  88   FMAFFLSLIGVWAAWKFHIDKGIDNFYSLHSWLGLACLFLFGVQWAAGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LA+     G LEK TFL++S  + +Y +EA LVN   +  V+
Sbjct  148  SRASLLPWHVFFGIYIYALAIVTCATGILEKATFLQASHIISRYSTEALLVNCLGVLIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L I+S    + D
Sbjct  208  LGGLVILAIVSPMNGKGD  225



>ref|XP_004513358.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Cicer arietinum]
Length=232

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 130/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    NK+LIFN+HPVLM+IG V++ GE +++YK+L   K  KK +HL   
Sbjct  29   WALHFRGGLALVSDNKDLIFNVHPVLMVIGLVLINGEGMLAYKTLSGTKNFKKSVHLAFQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL+L ++G+ AA+K HN+ GI N YSLHSW+GI   VL+ IQ   GF  F+YPGG+ +
Sbjct  89   FLALILSLIGLWAAWKFHNDKGIDNFYSLHSWLGIACLVLFSIQLGAGFATFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   +PWHV FG ++Y LA+A    G LEK TFL+ +  + +Y +EA +VN   I  V 
Sbjct  149  SRAALMPWHVFFGIYIYALAIATTTTGLLEKATFLQVNNIISRYSNEALVVNILGILIVA  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L I++    + D
Sbjct  209  LGGFVILGIVTPTYNKGD  226



>ref|XP_010435775.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Camelina sativa]
 ref|XP_010440995.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Camelina sativa]
 ref|XP_010450887.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X1 [Camelina sativa]
Length=230

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 129/198 (65%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+ IFN+HPV+M+IG ++  GEA+++YKS    K +KK++HL L 
Sbjct  29   WTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSFQGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L ++G+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G ++Y LA+  A  G LEKLTFL+ +  + +Y +EA LVN T +  ++
Sbjct  149  SRVSLMPWHVFLGIYIYALALVTATTGILEKLTFLQVNQVITRYSTEAMLVNTTGVLILV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVILGVVTPVNGKDQ  226



>ref|XP_009774999.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Nicotiana sylvestris]
Length=232

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 130/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W++H+RGGLA    NK LIFN+HPVLM+I  V+L GEA+++YK++   K  +K++HLVL 
Sbjct  28   WSVHYRGGLALISDNKALIFNVHPVLMVISLVLLNGEAMLAYKTVSGTKSFRKLVHLVLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L ++G+ AA+K H + GI N YSLHSW+G+    L+G+QW  GF  F+YPGG+ +
Sbjct  88   FMAFFLSLIGVWAAWKFHIDKGIDNFYSLHSWLGLACLFLFGVQWAAGFATFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G ++Y LA+     G LEK TFL++S  + +Y +EA LVN   +  V+
Sbjct  148  SRASLLPWHVFCGIYIYALAIVTCATGILEKATFLQASHIISRYSTEALLVNCLGVLIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L ++S    + D
Sbjct  208  LGGLVILAVVSPMNGKGD  225



>ref|XP_006405734.1| hypothetical protein EUTSA_v10027908mg [Eutrema salsugineum]
 gb|ESQ47187.1| hypothetical protein EUTSA_v10027908mg [Eutrema salsugineum]
Length=230

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 131/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            WN+H+RGGLA    +K+LIFN+HPVLM+IG ++  GEA+++YKS+   K +KK++HL L 
Sbjct  29   WNVHYRGGLALASDSKDLIFNVHPVLMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L ++G+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G ++Y LA+  A  G LEKLTFL+ +  + +Y +EA +VN   +  ++
Sbjct  149  SRASLMPWHVFLGIYIYALAIMTATTGILEKLTFLQVNQVITRYSTEAMVVNTMGVLILL  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    ++ 
Sbjct  209  LGGFVVLALVTPVNGKNQ  226



>emb|CDX74514.1| BnaA04g08750D [Brassica napus]
Length=230

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 127/198 (64%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG V+  GEA+++YKS+   K  KK++HL L 
Sbjct  29   WTVHYRGGLALSSDNKDLIFNVHPVLMVIGLVLFNGEAMLAYKSVQGTKNFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L +VG+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FAAFILSLVGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWASGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G  +Y LA+     G LEKLTFL+ +  + +Y +EA LVN   +  ++
Sbjct  149  SRASLMPWHVFLGVAIYALALVTVTTGILEKLTFLQVNQVITRYSTEAMLVNTMGVLILV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVVLGVVTPLNAKDQ  226



>ref|XP_009139798.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Brassica rapa]
Length=230

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 127/198 (64%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG V+  GEA+++YKS+   K  KK++HL L 
Sbjct  29   WTVHYRGGLALSSDNKDLIFNVHPVLMVIGLVLFNGEAMLAYKSVQGTKNFKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L +VG+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FAAFILSLVGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWASGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G  +Y LA+     G LEKLTFL+ +  + +Y +EA LVN   +  ++
Sbjct  149  SRASLMPWHVFLGVAIYALALVTVTTGILEKLTFLQVNKVITRYSTEAMLVNTMGVLILV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVVLGVVTPLNAKDQ  226



>ref|XP_011030107.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like isoform 
X3 [Populus euphratica]
Length=197

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  +ALP + VAHA+A   AV+VLVWN+++RGGLAWE TNK+LIFNLHPVLMLIG +I
Sbjct  1    MAIGVEALPLTFVAHALAAAAAVMVLVWNLYYRGGLAWEATNKSLIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYKSLPLKKEVKKVIHLVLHAIA++LG VGI AAFKNHNES IANLYSLHSW+
Sbjct  61   IGGEAIMSYKSLPLKKEVKKVIHLVLHAIAIILGSVGIAAAFKNHNESNIANLYSLHSWL  120

Query  549  GIGVAVLYGIQ  517
            GI +  LYG Q
Sbjct  121  GISIISLYGFQ  131



>dbj|BAK02812.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=234

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 137/199 (69%), Gaps = 2/199 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWE-DTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFRGG+A+  + +K LIFN+HPVLMLIG V+L GEA+++YK++P  K++KK++HL L
Sbjct  29   WAVHFRGGMAFSAEKDKLLIFNVHPVLMLIGLVVLNGEALLAYKTVPGTKKLKKLVHLTL  88

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
              +A+ + +VG+ A +K H+E  I +LY+LHSW+G+   +++ +QW  GF+ F+YPGG+ 
Sbjct  89   QFLAMFMSLVGLWAVWKFHDEKEIDHLYTLHSWLGLSCIIIFSLQWAAGFLTFWYPGGSR  148

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTV  295
              R   LPWHV  G F+Y+LA+A ++ G LEK  F++S+ +  ++ +EA L+N   +  +
Sbjct  149  SDRSSLLPWHVFLGVFLYVLAIATSVTGLLEKSIFMQSAKMIGRFSTEAMLMNTLGMMLI  208

Query  294  IYGVFVFLTILSQAPTEDD  238
            + G  V L I +    + D
Sbjct  209  LLGALVILAIFNPGAGKMD  227



>ref|XP_011030105.1| PREDICTED: uncharacterized protein LOC105129652 isoform X1 [Populus 
euphratica]
Length=276

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MAI  +ALP + VAHA+A   AV+VLVWN+++RGGLAWE TNK+LIFNLHPVLMLIG +I
Sbjct  1    MAIGVEALPLTFVAHALAAAAAVMVLVWNLYYRGGLAWEATNKSLIFNLHPVLMLIGLII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAIMSYKSLPLKKEVKKVIHLVLHAIA++LG VGI AAFKNHNES IANLYSLHSW+
Sbjct  61   IGGEAIMSYKSLPLKKEVKKVIHLVLHAIAIILGSVGIAAAFKNHNESNIANLYSLHSWL  120

Query  549  GIGVAVLYGIQ  517
            GI +  LYG Q
Sbjct  121  GISIISLYGFQ  131



>emb|CDY01648.1| BnaC04g31040D [Brassica napus]
Length=230

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 128/198 (65%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG ++  GEA+++YKS+   K +KK++HL L 
Sbjct  29   WTVHYRGGLALSSGNKDLIFNVHPVLMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L +VG+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FAAFILSLVGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWASGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G  +Y LA+     G LEKLTFL+ +  + +Y +EA LVN   +  ++
Sbjct  149  SRASLMPWHVFLGVAIYALALVTVTTGILEKLTFLQVNQVITRYSTEAMLVNTMGVLILV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVVLGVVTPLNAKDQ  226



>ref|XP_003574424.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Brachypodium distachyon]
Length=234

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 136/199 (68%), Gaps = 2/199 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWE-DTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W IHFRGG+A   + +K LIFN+HPVLMLIG V+L GEA+++YK++P  K++KK++HL L
Sbjct  29   WAIHFRGGMALSSEKDKLLIFNVHPVLMLIGLVVLNGEALLAYKTVPGTKKLKKLVHLSL  88

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
              +A+ L ++G+ A +K H+E GI +LY+LHSW+G+   + + +QW  GF  F+YPGG+ 
Sbjct  89   QFLAMFLSLLGLWAVWKFHDEKGIDHLYTLHSWLGLSCIIFFTLQWASGFWTFWYPGGSR  148

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTV  295
              R   LPWHV FG F+Y+LA+A ++ G LEK  F++++ +  ++  EA L+N   +  V
Sbjct  149  SGRASLLPWHVFFGVFLYVLAIATSISGLLEKSIFMQTAKMIGRFSMEAMLMNSLGMLLV  208

Query  294  IYGVFVFLTILSQAPTEDD  238
            + G  V L ++S    + D
Sbjct  209  LLGALVILAVVSPGAGKID  227



>gb|KFK33241.1| hypothetical protein AALP_AA6G348500 [Arabis alpina]
Length=230

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 128/198 (65%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG ++  GEA+++YKS+   K +KK++HL L 
Sbjct  29   WTVHYRGGLALASDNKDLIFNVHPVLMVIGLILFNGEAMLAYKSVKGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L ++G+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FAAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLSCLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G  +Y LA+     G LEKLTFL+ +  + +Y +EA LVN   +  ++
Sbjct  149  SRANLMPWHVFLGISIYALALVTVTTGILEKLTFLQVNQVITRYSTEAMLVNSMGVLILV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVVLGVVTPVNGKDQ  226



>ref|NP_198679.1| probable transmembrane ascorbate ferrireductase 2 [Arabidopsis 
thaliana]
 sp|Q9SWS1.1|ACFR2_ARATH RecName: Full=Probable transmembrane ascorbate ferrireductase 
2; AltName: Full=Cytochrome b561-1; Short=Artb561-2; Short=AtCytb561; 
AltName: Full=Protein b561A.tha4 [Arabidopsis thaliana]
 pdb|4O6Y|A Chain A, Crystal Structure Of Cytochrome B561
 pdb|4O6Y|B Chain B, Crystal Structure Of Cytochrome B561
 pdb|4O79|A Chain A, Crystal Structure Of Ascorbate-bound Cytochrome B561, 
Crystal Soaked In 1 M L-ascorbate For 10 Minutes
 pdb|4O79|B Chain B, Crystal Structure Of Ascorbate-bound Cytochrome B561, 
Crystal Soaked In 1 M L-ascorbate For 10 Minutes
 pdb|4O7G|A Chain A, Crystal Structure Of Ascorbate-bound Cytochrome B561, 
Crystal Soaked In 1 M L-ascorbate For 40 Minutes
 pdb|4O7G|B Chain B, Crystal Structure Of Ascorbate-bound Cytochrome B561, 
Crystal Soaked In 1 M L-ascorbate For 40 Minutes
 gb|AAD45585.1|AF132115_1 cytochrome b-561 [Arabidopsis thaliana]
 dbj|BAB10153.1| cytochrome b-561 [Arabidopsis thaliana]
 dbj|BAB21521.1| cytochrome b561 [Arabidopsis thaliana]
 gb|AAM61586.1| cytochrome b-561 [Arabidopsis thaliana]
 dbj|BAC41943.1| putative cytochrome b-561 [Arabidopsis thaliana]
 gb|ABD43009.1| At5g38630 [Arabidopsis thaliana]
 gb|AED94343.1| probable transmembrane ascorbate ferrireductase 2 [Arabidopsis 
thaliana]
Length=230

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 128/198 (65%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+ IFN+HPV+M+IG ++  GEA+++YKS+   K +KK++HL L 
Sbjct  29   WTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L ++G+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   LTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G  +Y LA+  A  G LEK+TFL+ +  + +Y +EA LVN   +  +I
Sbjct  149  SRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILI  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVILGVVTPVSGKDQ  226



>ref|XP_002870832.1| hypothetical protein ARALYDRAFT_916464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47091.1| hypothetical protein ARALYDRAFT_916464 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 128/197 (65%), Gaps = 1/197 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+ IFN+HPV+M+IG ++  GEA+++YKS+   K +KK++HL L 
Sbjct  29   WTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L ++G+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   LTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G ++Y LA+  A  G LEK TFL+ +  + +Y +EA LVN   +  +I
Sbjct  149  SRASLMPWHVFLGIYIYALALVTATTGILEKATFLQVNQVITRYSTEAMLVNTMGVLILI  208

Query  291  YGVFVFLTILSQAPTED  241
             G FV L +++    +D
Sbjct  209  LGGFVILGLVTPVNGKD  225



>ref|XP_006284470.1| hypothetical protein CARUB_v10005654mg [Capsella rubella]
 gb|EOA17368.1| hypothetical protein CARUB_v10005654mg [Capsella rubella]
Length=230

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 128/198 (65%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+ IFN+HPV+M+IG V+  GEA+++YKS+   K +KK++HL L 
Sbjct  29   WTVHYRGGLALSSDNKDHIFNVHPVMMVIGLVLFNGEAMLAYKSVQGTKNLKKLVHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L ++G+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   FSAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVNFTAISTVI  292
             R   +PWHV  G ++Y LA+     G LEKLTFL+ +  + +Y +EA +VN   +  ++
Sbjct  149  SRVSLMPWHVFLGIYIYALALVTVTTGILEKLTFLQVNQVITRYSTEAMIVNTMGVLVLV  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    +D 
Sbjct  209  LGGFVILAVVTPVNGKDQ  226



>ref|XP_010105549.1| putative transmembrane ascorbate ferrireductase 3 [Morus notabilis]
 gb|EXC05044.1| putative transmembrane ascorbate ferrireductase 3 [Morus notabilis]
Length=230

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 131/189 (69%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RG + ++  N + +FN+HPVLM +G++ L G+A+M+YK++P  +  +K IH++LH
Sbjct  35   WLLHYRGNIDYDSENPDYVFNVHPVLMFVGYIFLSGQAMMAYKTVPAARGTRKFIHMLLH  94

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL++GIVGICA FK HN   I ++YSLHSWIG+G   LY +QW+ GFVVF   G +AD
Sbjct  95   VIALIMGIVGICAVFKYHNMKNIEDMYSLHSWIGLGTFCLYVLQWLLGFVVFMLNGASAD  154

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             +   L WH+  G  +  +++  AL G +EK  FL   GL ++ +EA LVNFT +S +++
Sbjct  155  AKFSMLGWHMAGGRALLFMSICAALTGLMEKAHFL---GL-RHQTEARLVNFTGLSILLF  210

Query  288  GVFVFLTIL  262
            GVFV  T++
Sbjct  211  GVFVDFTVV  219



>ref|XP_008343726.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Malus 
domestica]
Length=158

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  909  MAIAAKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVI  730
            MA+   A+ F+ V H + +    LVLVW IHFRGGLAWE TNKNLIFNLHPVLML+G +I
Sbjct  1    MALKVPAVAFTFVVHTLGVTALALVLVWTIHFRGGLAWEATNKNLIFNLHPVLMLLGIII  60

Query  729  LGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWI  550
            +GGEAI+S+KSLP  KE KKVIHLVLH +AL LGI+GI   FKNHNESGIANLYSLHSWI
Sbjct  61   MGGEAIVSHKSLPFNKETKKVIHLVLHTLALALGIIGIYLVFKNHNESGIANLYSLHSWI  120

Query  549  GIGVAVLYGIQ  517
            GIGV VLYGIQ
Sbjct  121  GIGVIVLYGIQ  131



>ref|XP_002978638.1| hypothetical protein SELMODRAFT_109639 [Selaginella moellendorffii]
 gb|EFJ20085.1| hypothetical protein SELMODRAFT_109639 [Selaginella moellendorffii]
Length=258

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 124/196 (63%), Gaps = 1/196 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  + RGGL W   NK+L+FN HPVLM+ GFV + G+A ++Y++L   +  KK IH +  
Sbjct  63   WCGNVRGGLLWNSPNKDLLFNFHPVLMIAGFVFVHGQANLTYRTLTGSRNYKKAIHFLAQ  122

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +ALVLG VG  AA K HN+ GI N YSLHSW+G+    L+  QW  GFV F+YPGG+  
Sbjct  123  GLALVLGAVGFLAALKFHNDRGIDNFYSLHSWLGLTTMTLFVTQWTVGFVSFWYPGGSTA  182

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESS-GLDKYGSEAFLVNFTAISTVI  292
             R   LPWH+  G F+Y L++  A  G LEKLTFL++S  ++++G E+ LVN   +  V+
Sbjct  183  ARSSILPWHIFSGIFLYTLSLVTAETGLLEKLTFLQTSKAIERFGRESTLVNSLGLILVL  242

Query  291  YGVFVFLTILSQAPTE  244
             G F  L +L+  P  
Sbjct  243  LGFFHALALLTPKPPR  258



>ref|XP_009395543.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=227

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + FRGGLA    N++L+FN+HPVLM+IGF++L GEAI++YK+L   K  KK +HL + 
Sbjct  67   WVVRFRGGLALNSDNRDLVFNVHPVLMVIGFILLYGEAILAYKTLSGTKNFKKAMHLTIQ  126

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL LG +G+ AA K HN  GI N YSLHSW+G+   +L+GIQW  GF  F+YPGGT +
Sbjct  127  FLALCLGFIGVWAALKFHNGKGIDNFYSLHSWLGLTCLLLFGIQWGIGFATFWYPGGTRN  186

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLD  346
             R   LPWHV FG ++Y LAV  A  G LEK TFL+SS + 
Sbjct  187  GRAFLLPWHVFFGLYIYALAVITATTGLLEKATFLQSSSIS  227



>ref|XP_004514369.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3-like 
[Cicer arietinum]
Length=211

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+R G+ ++  +   +FN+HP++M +GF+ L GEA+M+++++P ++ + K +H+ LH
Sbjct  24   WLLHYREGIDYDSDDGFQVFNVHPLMMFLGFIFLVGEAVMAFQTVPRERHMGKFVHMTLH  83

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL+LGIVG+CA FK HN   I ++YSLHSWIGIG   L+G+QW++GF+VF +PG    
Sbjct  84   LIALILGIVGLCAVFKFHNMRNIDDIYSLHSWIGIGTFCLFGLQWLFGFIVFVFPGAQDA  143

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             RR+  PWH   G  + ++A+  A  G +EK  FL    L  Y  E  LVNFT ++ +++
Sbjct  144  TRRKVRPWHKASGRVLLLMAICAAETGLMEKSGFLN---LKPYQRETNLVNFTGLTILLF  200

Query  288  GVFVFLTI  265
            GVFV +++
Sbjct  201  GVFVNMSV  208



>gb|KCW52026.1| hypothetical protein EUGRSUZ_J01463 [Eucalyptus grandis]
Length=189

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 121/172 (70%), Gaps = 1/172 (1%)
 Frame = -2

Query  765  LHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNES  586
            +HPVLM+IG ++L GEA+++YK++   K  KK++HL L  +A  L +VGI AA+K HNE 
Sbjct  10   VHPVLMVIGLILLNGEAMLAYKTVSGTKSFKKLVHLTLQLLAFCLSMVGIWAAWKFHNEK  69

Query  585  GIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAV  406
            GI N YSLHSW+G+G  +L+GIQW  GFV+++YPGG+   R   LPWHV FG ++Y LA+
Sbjct  70   GIDNFYSLHSWLGLGCILLFGIQWALGFVIYWYPGGSRTSRGTLLPWHVFFGVYIYALAI  129

Query  405  ANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQA  253
            A AL GFLEK TFL++   + +Y  EA L+N   I  V+ G F+ L IL+ A
Sbjct  130  ATALTGFLEKATFLQTKEVISRYSPEALLMNSLGILVVVLGGFIVLAILAPA  181



>ref|XP_004973300.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Setaria italica]
Length=235

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 133/200 (67%), Gaps = 3/200 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWE--DTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLV  655
            W +H+RGG+A    + +K  IFN+HPVLMLIG V L GEA+++YK++P  K++KK++HL 
Sbjct  29   WAVHYRGGMALSTNEESKLSIFNVHPVLMLIGLVALNGEALLAYKTVPGTKKLKKLVHLA  88

Query  654  LHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGT  475
            L   A+ L I+G+ A +K H+E  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+
Sbjct  89   LQFFAMFLCIIGLWAVWKFHDERKIDHLYTLHSWLGLTCIIFFSLQWATGFWTFWYPGGS  148

Query  474  ADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAIST  298
               R   LPWHV FG F+Y+LA+A ++ G LEK  F++S+ +  ++ +EA  +N   +  
Sbjct  149  RSGRASLLPWHVFFGIFIYVLAIATSVSGLLEKSIFMQSTKMIGRFSTEAMFMNSLGMLL  208

Query  297  VIYGVFVFLTILSQAPTEDD  238
            V+ G  V L I+S  P + D
Sbjct  209  VVLGALVILAIVSPGPGKID  228



>ref|XP_006659365.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2-like 
[Oryza brachyantha]
Length=234

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -2

Query  819  HFRGGLAWE-DTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAI  643
            HFRGG+A+  +T+K LIFN+HPVLMLIG V+  GEA+++YK++P  K++KK++HL L  +
Sbjct  32   HFRGGMAFSSETDKLLIFNVHPVLMLIGLVVFNGEALLAYKTVPGTKKLKKLVHLALQFL  91

Query  642  ALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIR  463
            A++L ++G+   +K HNE  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+   R
Sbjct  92   AMLLSLIGLWTVWKFHNEREIDHLYTLHSWLGLACIIFFSLQWATGFYTFWYPGGSRSGR  151

Query  462  RESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVIYG  286
               LPWHV FG F+Y+LA+A ++ G LEK  F++S+ +  ++ +EA  +N   +  V+ G
Sbjct  152  ASLLPWHVFFGLFLYVLAIATSVSGLLEKSIFMQSAKMIGRFSTEALFMNSLGMLLVLLG  211

Query  285  VFVFLTILSQAPTEDD  238
              V L ++S    + D
Sbjct  212  ALVILAVVSPGSGKID  227



>ref|XP_010066551.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Eucalyptus grandis]
 gb|KCW64461.1| hypothetical protein EUGRSUZ_G02076 [Eucalyptus grandis]
Length=223

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 124/189 (66%), Gaps = 3/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W + F+ G+A    NK+ IFNLHP+LM+ G ++ GGEAIM YK++P  +E +K IHL+LH
Sbjct  32   WLLKFQDGVALSSANKSKIFNLHPLLMVFGLILAGGEAIMVYKTIPATREAQKTIHLILH  91

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IALVLG VG+ A FK HNE  IANLY+LHSW+GI    L+G+QWV GF  F +P   + 
Sbjct  92   LIALVLGSVGVYAVFKFHNELHIANLYTLHSWLGITTISLFGLQWVLGFFSFVFPKARSY  151

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   +PWHV  G+ V++LA+  A  G +EK TFL+   L     EA +VNF  +   ++
Sbjct  152  ARASFIPWHVFLGSVVFLLAICTAESGLVEKFTFLK---LQSGQQEALIVNFIGLLIFLF  208

Query  288  GVFVFLTIL  262
             + V LT++
Sbjct  209  ALSVGLTVV  217



>ref|XP_003637054.1| Cytochrome b561 [Medicago truncatula]
 gb|AFK40604.1| unknown [Medicago truncatula]
 gb|KEH25309.1| transmembrane ascorbate ferrireductase [Medicago truncatula]
Length=232

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 129/198 (65%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA    +K+LIFN+HPVLM+IG V++ GE +++YK++   K  +K +HL   
Sbjct  29   WVVHFRGGLALVSDDKSLIFNVHPVLMVIGLVLINGEGMLAYKTVSGTKSFRKSVHLASQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL+L ++G+ AA+K HN+ GI N YSLHSW+G+    L+ IQ   GF  F+YPGG+ +
Sbjct  89   FLALILSLIGLWAAWKFHNDKGIDNFYSLHSWLGLACLFLFFIQLAAGFATFWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   +PWHV FG ++Y LA+A    G LEK TFL++   + +Y +E+ LVN   I  V 
Sbjct  149  SRVALMPWHVFFGIYIYALAIATTATGLLEKATFLQTGNVISRYSNESLLVNCLGILIVA  208

Query  291  YGVFVFLTILSQAPTEDD  238
             G FV L +++    + D
Sbjct  209  LGGFVILGLVTPTYNKAD  226



>gb|EAZ06841.1| hypothetical protein OsI_29077 [Oryza sativa Indica Group]
Length=234

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -2

Query  819  HFRGGLAWE-DTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAI  643
            HFRGG+A   +T+K LIFN+HPVLMLIG V+L GEAI++YK++P  K++KK++HL L  +
Sbjct  32   HFRGGMALSSETDKLLIFNVHPVLMLIGLVVLNGEAILAYKTVPGTKKLKKLVHLALQFL  91

Query  642  ALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIR  463
            A++L ++G+   +K H+E  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+   R
Sbjct  92   AMLLSLIGLWTVWKFHDERQIDHLYTLHSWLGLSCIIFFSLQWATGFYTFWYPGGSRSGR  151

Query  462  RESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVIYG  286
               LPWHV FG F+Y+LA+A ++ G LEK  F++S+ +  ++ +EA  +N   +  V+ G
Sbjct  152  ASLLPWHVFFGLFLYVLAIATSVSGLLEKSIFMQSAKMIGRFSTEAMFMNSLGMLLVLLG  211

Query  285  VFVFLTILSQAPTEDD  238
              V L +++    + D
Sbjct  212  ALVILAVVTPGVGKID  227



>dbj|BAD05824.1| putative cytochrome b-561 [Oryza sativa Japonica Group]
 gb|EAZ42582.1| hypothetical protein OsJ_27146 [Oryza sativa Japonica Group]
 dbj|BAH01644.1| unnamed protein product [Oryza sativa Japonica Group]
Length=234

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -2

Query  819  HFRGGLAWE-DTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAI  643
            HFRGG+A   +T+K LIFN+HPVLMLIG V+L GEAI++YK++P  K++KK++HL L  +
Sbjct  32   HFRGGMALSSETDKLLIFNVHPVLMLIGLVVLNGEAILAYKTVPGTKKLKKLVHLALQFL  91

Query  642  ALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIR  463
            A++L ++G+   +K H+E  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+   R
Sbjct  92   AMLLSLIGLWTVWKFHDERQIDHLYTLHSWLGLSCIIFFSLQWATGFYTFWYPGGSRSGR  151

Query  462  RESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVIYG  286
               LPWHV FG F+Y+LA+A ++ G LEK  F++S+ +  ++ +EA  +N   +  V+ G
Sbjct  152  ASLLPWHVFFGLFLYVLAIATSVSGLLEKSIFMQSAKMIGRFSTEAMFMNSLGMLLVLLG  211

Query  285  VFVFLTILSQAPTEDD  238
              V L +++    + D
Sbjct  212  ALVILAVVTPGVGKID  227



>ref|XP_006364056.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1-like [Solanum tuberosum]
Length=221

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR GLA+  +NK  IFN+HP+LM+IGFV++ GEAIM+Y + P  ++  K+ H++LH
Sbjct  36   WLLHFREGLAFSSSNKPKIFNIHPLLMVIGFVLMAGEAIMAYTTTPTSRKNHKLFHMILH  95

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL+ GI+G+ A FK HNESGI ++Y+ HSWIG+   +L+G+QW+  F+ F YP   + 
Sbjct  96   LIALLTGIIGVIAVFKFHNESGIPHMYTFHSWIGLSTIILFGLQWILSFLTFLYPRARSS  155

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R    PWH L G  ++ +A+  A  G ++K  FL   GL +   E  +VNF  +  +++
Sbjct  156  TRSRVAPWHALIGITIFFMAIVAAETGLVQKFIFL---GLTR-NQEGLIVNFIGLLILLF  211

Query  288  GVFVFLTIL  262
            G+ V +T+L
Sbjct  212  GISVGVTVL  220



>ref|XP_003555842.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1-like [Glycine max]
 gb|KHN32262.1| Transmembrane ascorbate ferrireductase 1 [Glycine soja]
Length=220

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -2

Query  828  WNIHFRGGLAW-EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVL  652
            W +HFR G+A+   +N   IFNLHP+LM+IGF+++GGEAIM YKS+P K+   KV+HL+L
Sbjct  30   WLLHFREGVAFFSSSNPVKIFNLHPLLMVIGFILVGGEAIMIYKSVPEKRRSVKVVHLLL  89

Query  651  HAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTA  472
            H IALV GI+GI A FK+  E+G+A++Y+LHSW+G+    L+G+Q+++GF  +F+PG   
Sbjct  90   HLIALVAGIIGIIAVFKSKKEAGLADMYTLHSWLGMSAISLFGLQYIFGFFAYFFPGAEM  149

Query  471  DIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVI  292
              R   LPWH   G  +++LAVA A  G +E   FL+         EA ++N T +   +
Sbjct  150  SARASLLPWHRFMGMAIFLLAVATAETGLVEYFQFLQLFRTQ----EALIINSTGLLLFL  205

Query  291  YGVFVFLTILSQ  256
            + VFV L+++ Q
Sbjct  206  FAVFVTLSVILQ  217



>gb|EYU45963.1| hypothetical protein MIMGU_mgv1a013302mg [Erythranthe guttata]
Length=224

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 139/212 (66%), Gaps = 4/212 (2%)
 Frame = -2

Query  897  AKALPFSCvahaialvlavlvlVWNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGE  718
            A A P + +AH  A  +  LVLVW +HFR GLA++  NK  IFNLHP+LM++GFV++ GE
Sbjct  11   ASAFPATVLAHVSAAAIVTLVLVWLLHFREGLAFKSDNKAKIFNLHPLLMVLGFVLISGE  70

Query  717  AIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGV  538
             I++YK++P  +E +K+ HL+LH  ALV GI+GI A F+ H   GI ++YSLHSW+G+  
Sbjct  71   GIIAYKTIPAIRETQKLFHLLLHLTALVSGIIGIYAVFRFHYLKGIPDMYSLHSWLGMST  130

Query  537  AVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLES  358
              L+ IQWV+    F+YP   A  R    PWH + GT ++++A+ +A  G +EK  FL  
Sbjct  131  ICLFAIQWVFSLFTFWYPRAQASTRARLAPWHTVLGTVIFVMAILSAETGLVEKFFFL--  188

Query  357  SGLDKYGSEAFLVNFTAISTVIYGVFVFLTIL  262
             GL +   EA ++NF  +   ++GVFV L+++
Sbjct  189  -GLRR-SQEALIINFVGLLIFLFGVFVGLSVV  218



>ref|XP_011099288.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Sesamum indicum]
Length=232

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 132/198 (67%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM++G V+L GEA+++YKS+   K  KK++HL L 
Sbjct  28   WTVHYRGGLALISENKDLIFNVHPVLMVVGLVVLNGEAMLAYKSVSGTKSFKKLVHLSLQ  87

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A  L I+G+ AA+K H + GI N YSLHSW+G+    L+G+QW  GFV F+YPGG+ +
Sbjct  88   FLAFCLSIIGLWAAWKFHIDKGIDNFYSLHSWLGVACLFLFGLQWAAGFVTFWYPGGSRN  147

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVI  292
             R   LPWHV  G ++Y LAVA    GFLEK TFL+++  + +Y  EA LVN   I  V+
Sbjct  148  SRASLLPWHVFVGIYIYALAVATCTTGFLEKATFLQTNKVISRYSMEALLVNSLGILIVV  207

Query  291  YGVFVFLTILSQAPTEDD  238
               FV L ++S    + D
Sbjct  208  LAGFVILGVVSPVYGKGD  225



>ref|XP_002444276.1| hypothetical protein SORBIDRAFT_07g019370 [Sorghum bicolor]
 gb|EES13771.1| hypothetical protein SORBIDRAFT_07g019370 [Sorghum bicolor]
Length=235

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 136/200 (68%), Gaps = 3/200 (2%)
 Frame = -2

Query  828  WNIHFRGGLAW--EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLV  655
            W +H+RGG+A   ++ +K  +FN+HPVLMLIG V L GEA+++YK++P  K++KK++HL 
Sbjct  29   WAVHYRGGMALSTDEESKLPLFNVHPVLMLIGLVALNGEALLAYKTVPGTKKLKKLVHLA  88

Query  654  LHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGT  475
            +  +A+ L ++G+ A +K H+E  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+
Sbjct  89   VQFLAMFLSLIGLWAVWKFHDERKIDHLYTLHSWLGLTCFIFFSLQWAAGFWTFWYPGGS  148

Query  474  ADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAIST  298
               R   LPWHV FG F+Y+LA+A ++ G LEK  F++S+ + +++ +EA  +N   +  
Sbjct  149  RSGRAFLLPWHVFFGIFIYVLAIATSVTGLLEKSIFMQSAKMIERFSTEAMFMNSLGMLL  208

Query  297  VIYGVFVFLTILSQAPTEDD  238
            V+    V L I+S  P++ D
Sbjct  209  VLLSGLVILAIVSPGPSKID  228



>ref|XP_004228748.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Solanum lycopersicum]
Length=221

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR GLA+  +NK  IFN+HP+LM+IG+V++ GEAIM+Y + P  ++  K+ H++LH
Sbjct  36   WLLHFREGLAFTSSNKAKIFNIHPMLMVIGYVLMAGEAIMAYTTTPTSRKNHKLFHMILH  95

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL+ GI+G+ A FK HNESGI ++Y+ HSWIG+   +L+G+QW+  F+ F YPG  + 
Sbjct  96   LIALLSGIIGVIAVFKFHNESGIPHMYTFHSWIGLSTIILFGLQWIMSFLTFLYPGARSS  155

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R    PWH L G  ++ +A+     G ++K  FL   GL +   E  +VNF  +  +++
Sbjct  156  TRSRVAPWHALIGITIFFMAIVATETGLVQKFIFL---GLTR-NQEGLIVNFIGLLILLF  211

Query  288  GVFVFLTIL  262
            G+ V +++L
Sbjct  212  GISVGVSVL  220



>ref|XP_004142327.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Cucumis 
sativus]
 ref|XP_004170145.1| PREDICTED: transmembrane ascorbate ferrireductase 1-like [Cucumis 
sativus]
Length=219

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 125/189 (66%), Gaps = 5/189 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  HF GG+A +  NK  I NLH +LM IGF++ GG+AIM+YKS+P +K  +KV+HLVLH
Sbjct  31   WIFHFSGGVAIKSDNKLKILNLHVILM-IGFILFGGQAIMAYKSIPGRKYWRKVVHLVLH  89

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +AL  GI G+C AFK H+E  +++L SLHSWIG+    LY  QW++GF V+F+PG  A 
Sbjct  90   LMALACGIFGVCMAFKFHHEIKLSDLLSLHSWIGLIAVSLYAFQWIFGFFVYFFPGAEAR  149

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWHV FG F++++A  NA LG L++   L    +  +  +  +VNFT +  ++Y
Sbjct  150  RRGNMLPWHVYFGVFIFLIATCNAELGLLQRFNTL----VLGHSQQGLIVNFTGLLLLLY  205

Query  288  GVFVFLTIL  262
               V LT++
Sbjct  206  AATVVLTVI  214



>ref|XP_006659727.1| PREDICTED: ascorbate-specific transmembrane electron transporter 
1-like [Oryza brachyantha]
Length=242

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLP---LKKEVKKVIHL  658
            W+IHFRGGLA    +K LIFN HPVLML+G V+L  EAI+SY+S P   L ++ +K  HL
Sbjct  43   WSIHFRGGLALRSHDKQLIFNTHPVLMLLGLVVLAAEAILSYRSFPHLLLSRDARKKTHL  102

Query  657  VLHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGG  478
             LHA+AL LG +GI A FK H E+GI NLYSLHSWIGI    LY + W+  F+ FF+PG 
Sbjct  103  ALHAVALALGALGIYAVFKYHAEAGIPNLYSLHSWIGIATISLYALHWLAAFLTFFFPGA  162

Query  477  TADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSG--LDKYGSEAFLVNFTAI  304
                RR +LPWH L G  V+ LAV NA LGFLEKLTF+++    L +YG EA LVNFTA+
Sbjct  163  PHPTRRSALPWHALLGLLVFALAVGNAQLGFLEKLTFMQAPPLRLSRYGPEALLVNFTAL  222

Query  303  STVIYGVFVFL  271
              +  GV V L
Sbjct  223  VVLFLGVAVLL  233



>ref|XP_004169141.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3-like 
[Cucumis sativus]
Length=229

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 126/199 (63%), Gaps = 4/199 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA++  N NL+FN HP  ML+GFV + GEA+M+Y+++  +K  KK++H+ LH
Sbjct  34   WLLHYRGGLAYDSPNSNLVFNCHPFFMLLGFVFMSGEAMMAYRTVRAEKRTKKIVHMALH  93

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+ +GI+GI AAFK H++  + ++YSLHSWIGI    LYG+QWV G   F +PG   +
Sbjct  94   LVAICMGIIGINAAFKFHDQVNLEDMYSLHSWIGIVTFCLYGLQWVVGLFTFLFPGADGE  153

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             +   LPWH+  G  + ++ +  AL G  EK T L  +       E+ L+NFTA   +++
Sbjct  154  TKTRLLPWHITGGRALLLMIICTALTGLSEKATSLRLTS----SHESRLLNFTAFFVLLF  209

Query  288  GVFVFLTILSQAPTEDDHS  232
            G+ + ++I        DH+
Sbjct  210  GISIDISIGFARFMHVDHT  228



>ref|XP_004142817.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3-like 
[Cucumis sativus]
 gb|KGN51448.1| hypothetical protein Csa_5G548140 [Cucumis sativus]
Length=229

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 126/199 (63%), Gaps = 4/199 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA++  N NL+FN HP  ML+GFV + GEA+M+Y+++  +K  KK++H+ LH
Sbjct  34   WLLHYRGGLAYDSPNSNLVFNCHPFFMLLGFVFMSGEAMMAYRTVRAEKRTKKIVHMALH  93

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+ +GI+GI AAFK H++  + ++YSLHSWIGI    LYG+QWV G   F +PG   +
Sbjct  94   LVAICMGIIGINAAFKFHDQVNLEDMYSLHSWIGIVTFCLYGLQWVVGLFTFLFPGADRE  153

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             +   LPWH+  G  + ++ +  AL G  EK T L  +       E+ L+NFTA   +++
Sbjct  154  TKTRLLPWHITGGRALLLMIICTALTGLSEKATSLRLTS----SHESRLLNFTAFFVLLF  209

Query  288  GVFVFLTILSQAPTEDDHS  232
            G+ + ++I        DH+
Sbjct  210  GISIDISIGFARFMHVDHT  228



>gb|KEH40688.1| eukaryotic cytochrome b561 protein [Medicago truncatula]
Length=219

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGG+A+  +NK  IFNLHP+LM+IGF+++GGEAI++YKS+P K+   KV+HL+LH
Sbjct  30   WLLHFRGGVAFNSSNKIKIFNLHPLLMVIGFILVGGEAIITYKSIPGKRSSAKVVHLLLH  89

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL  GI+GI A FK+  E+ + N+++LHSW+GI     YG+Q++  F  +F+PG  + 
Sbjct  90   VIALASGILGIIAVFKSKKEADLPNMFTLHSWLGIAAISAYGLQYIVAFFAYFFPGAESS  149

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             +   LPWH   G  ++ LAV  A  G +E   FL+         E+ +VNFT +   ++
Sbjct  150  AKATFLPWHKFIGMVIFFLAVGTAETGLVEYSRFLDLF----RNQESLIVNFTGLLLFLF  205

Query  288  GVFVFLTIL  262
             VFV L+++
Sbjct  206  AVFVSLSVI  214



>ref|XP_009351583.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Pyrus x bretschneideri]
Length=227

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+ +E  N + +FN+HP LM  GF+   GEA+M+YK++  + +V+K  H +LH
Sbjct  35   WLLHYRGGIDYESDNSDRVFNVHPFLMFFGFIFFAGEAMMAYKTVMAEHKVQKYTHFLLH  94

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL  GI GICAAF+ H+   I ++YSLHSWIG+G  +LYG+QW++G   F +PG T +
Sbjct  95   VIALCTGIFGICAAFRYHDMRQIDDMYSLHSWIGLGTFILYGLQWLFGAAAFLFPGATPE  154

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKY--GSEAFLVNFTAISTV  295
             R   +PWH+  G  +  L++  AL G ++K TFL   GL K     E+ L+NFTA++ +
Sbjct  155  SRMRLIPWHMSMGRTILYLSICAALTGLMQKFTFL---GLSKVMGERESHLINFTALAIL  211

Query  294  IYGVFVFLTI  265
            ++G+FV L++
Sbjct  212  LFGIFVDLSV  221



>gb|KEH40690.1| transmembrane ascorbate ferrireductase [Medicago truncatula]
Length=211

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 120/188 (64%), Gaps = 3/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR G+ +   N   +FN+HP++M +  + L GEAIM+++++P ++ +KK  H+ LH
Sbjct  24   WLLHFREGIDYASVNPFRVFNVHPLMMFLSLIFLAGEAIMAFQTVPAQRHIKKFFHMALH  83

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IA+VLGIVG+CA FK H+   I +LYSLH WIGI     YG+QWV+G V F  PG    
Sbjct  84   LIAIVLGIVGLCAVFKFHDMLHIPHLYSLHGWIGILTLCSYGLQWVFGLVTFLVPGAQDA  143

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWH + G  ++++A+  A  G +EK  FL    L  + +E  LV FT +S +++
Sbjct  144  TRARVLPWHKIGGKVLFLMAICAAETGLMEKAGFLS---LKAHQTETSLVTFTGLSILLF  200

Query  288  GVFVFLTI  265
            G FVF++I
Sbjct  201  GAFVFVSI  208



>ref|XP_009802978.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Nicotiana sylvestris]
 ref|XP_009802979.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Nicotiana sylvestris]
 ref|XP_009802980.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Nicotiana sylvestris]
Length=221

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 123/189 (65%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR GL +  TNK  IFN+HP+LM+IGF++L GEAIM+Y ++P   +  K+ H++LH
Sbjct  31   WLLHFREGLDFTSTNKPKIFNIHPLLMVIGFLLLAGEAIMAYTTVPTSSKKHKLYHMILH  90

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IALV  ++G+ A FK H ESGI ++Y+ HSWIG+   +L+ +QW+  F+ F +PG    
Sbjct  91   FIALVAAVIGLYAVFKYHKESGIPHMYTFHSWIGLSTIILFALQWLLSFLTFLFPGARTS  150

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R    PWH L G  +++LA+  A  G ++K  FL   GL +   E  ++NFTA+  +++
Sbjct  151  TRSRVAPWHALIGIIIFLLAIVAAETGLVQKFIFL---GLTR-NQEGLILNFTALLILLF  206

Query  288  GVFVFLTIL  262
            G+ V + +L
Sbjct  207  GISVGVAVL  215



>ref|XP_009611647.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Nicotiana tomentosiformis]
Length=221

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 123/189 (65%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR GLA+  TNK  IFN+HP+LM+IGF++L GEAIM+Y ++P   +  K+ H++LH
Sbjct  31   WLLHFREGLAFTSTNKPKIFNIHPLLMVIGFLLLAGEAIMAYTTVPTSSKKHKLYHMILH  90

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IALV  ++G+ A FK H E+GI ++Y+ HSWIG+   +L+ +QW+  F+ F +PG    
Sbjct  91   FIALVAAVIGLYAVFKYHKEAGIPHMYTFHSWIGLSTIILFALQWLLSFLTFLFPGARTS  150

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   +PWH L G  ++ LA+  A  G ++K  FL   GL +   E  +VNFT +  +++
Sbjct  151  TRSRVVPWHALIGIIIFFLAIVAAETGLVQKFIFL---GLTR-NQEGLIVNFTGLLILLF  206

Query  288  GVFVFLTIL  262
            G+ V + +L
Sbjct  207  GISVGVAVL  215



>ref|NP_001141146.1| uncharacterized protein LOC100273232 [Zea mays]
 gb|ACF85524.1| unknown [Zea mays]
 tpg|DAA49145.1| TPA: cytochrome b561 [Zea mays]
Length=235

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 135/200 (68%), Gaps = 3/200 (2%)
 Frame = -2

Query  828  WNIHFRGGLAW--EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLV  655
            W +HFRGG+A   E+ +K  +FN+HPVLMLIG V L GEA+++YK++P  K++KK++HL 
Sbjct  29   WAVHFRGGMALSTEEESKLPLFNVHPVLMLIGLVALNGEALLAYKTVPGTKKLKKLVHLA  88

Query  654  LHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGT  475
            +  +A+ L ++G+ A +K H+E  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+
Sbjct  89   VQFLAMFLSLIGLWAVWKFHDERKIDHLYTLHSWLGLTCFIFFSLQWAAGFWTFWYPGGS  148

Query  474  ADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAIST  298
               R   LPWHV FG F+Y+LA+A ++ G LEK  F++S+ + +++ +EA  +N   +  
Sbjct  149  RSGRAFLLPWHVFFGIFIYVLAIATSVTGLLEKSIFMQSAKMIERFSTEAMFMNSLGMLL  208

Query  297  VIYGVFVFLTILSQAPTEDD  238
            V+    V L ++S  P+  D
Sbjct  209  VLLSSLVILALVSPGPSMID  228



>ref|XP_006469332.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1-like [Citrus sinensis]
Length=221

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 125/184 (68%), Gaps = 4/184 (2%)
 Frame = -2

Query  813  RGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALV  634
            R GLA++  N+  IFNLHP+LM+IGFV++GGEA+M+YK++P  +  +K +H +LH IAL+
Sbjct  38   REGLAFKSDNQLKIFNLHPLLMIIGFVLIGGEAVMAYKTIPGTRRAQKTVHWLLHLIALL  97

Query  633  LGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRES  454
             G++GI A FK H+ESGI N+Y+LHSW+G+    LYG+QW+  F  + +PG     R   
Sbjct  98   AGVIGIYAVFKFHHESGIPNMYTLHSWLGMITICLYGLQWLLAFFSYVFPGAEMSARGSF  157

Query  453  LPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVF  274
            LPWH  FG  ++ LA+  A  G ++K  FL   GL +   EA +VNFT +  +++G+ V 
Sbjct  158  LPWHSFFGLVIFFLAICTAETGLVQKFIFL---GLFR-DQEALIVNFTGLLILLFGISVG  213

Query  273  LTIL  262
            LT++
Sbjct  214  LTVV  217



>gb|EYU30174.1| hypothetical protein MIMGU_mgv1a013281mg [Erythranthe guttata]
Length=225

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR GL  +  + N IFN+HP LM  GF+ L GEA+M+YK++  +++V+K IH+ +H
Sbjct  36   WLLHFREGLDLDSDDPNRIFNVHPFLMFFGFIFLAGEAMMAYKTVGAERKVQKYIHMFVH  95

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+VLGIVG+ AAFK H + GI+NLYSLHSWIGIG   L+ +QW+ G  VF +PG   +
Sbjct  96   LVAIVLGIVGLHAAFKFHEKRGISNLYSLHSWIGIGTFSLFCLQWLLGMSVFLFPGAPME  155

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R  +  WHV  G  +  +A+  AL G +EK+ FL   G  ++ SEA ++NF  +S +++
Sbjct  156  TRARAAAWHVSGGRALMFMAICTALTGLMEKVGFL---GQLRH-SEARVINFLGLSILLF  211

Query  288  GVFVFLTI  265
            G+ V L++
Sbjct  212  GISVDLSV  219



>emb|CDP05494.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 122/188 (65%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFR G+  +  N   IFN+HP LM  GF  L G+A+M+YK++   + V+KV H+ LH
Sbjct  31   WLLHFREGMNLDSDNPFRIFNVHPFLMFFGFTFLAGQAMMAYKTVLAARNVQKVAHMFLH  90

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+ LGIVG+ A FK H+ + I NLYSLHSWIGIG   LY +QW++GF+ F  P  + D
Sbjct  91   LVAITLGIVGLHAVFKFHDRANIRNLYSLHSWIGIGTFSLYILQWLFGFITFMIPQSSLD  150

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R  +LPWH+  G  +  +A+  A  G +EK+TFLE     ++G E  LVNF  ++ +++
Sbjct  151  SRARALPWHISGGRALLYMAICAAETGLMEKVTFLEL----QHGRETLLVNFLGLAILLF  206

Query  288  GVFVFLTI  265
            G+ V +++
Sbjct  207  GITVDVSV  214



>ref|XP_010528463.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
[Tarenaya hassleriana]
Length=230

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA    NK+LIFN+HPVLM+IG ++L GEA+++YK++   K  +K+IHL L 
Sbjct  29   WAVHYRGGLALVSDNKDLIFNVHPVLMVIGLILLNGEAMLAYKTVQGTKNTRKLIHLTLQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A +L +VG+ AA K H + GI N YSLHSW+G+    L+  QW  GFV ++YPGG+ +
Sbjct  89   LTAFILSLVGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLE-SSGLDKYGSEAFLVN  316
             R   LPWHV FG ++Y LA+A A+ G LEK TFL+ +  + +Y +EA LVN
Sbjct  149  SRSSLLPWHVFFGVYIYALAIAAAVTGLLEKATFLQVNRVITRYCTEAMLVN  200



>gb|ABK25459.1| unknown [Picea sitchensis]
Length=165

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 0/161 (0%)
 Frame = -2

Query  750  MLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAFKNHNESGIANL  571
            M +GF+ L  +AI++YK +P KKEV+K +HLVL   A+VLG +GI A FK HNES I NL
Sbjct  1    MFVGFIFLSSQAILAYKMIPAKKEVQKTVHLVLQGSAIVLGAIGIYAVFKFHNESKIKNL  60

Query  570  YSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTFVYILAVANALL  391
            YSLHSW+GI    L+G+QW+   + F +PG +   R    PWHV  G F+Y +A+  A L
Sbjct  61   YSLHSWLGIATISLFGLQWIAALLAFAFPGASKQRREAIYPWHVFLGVFLYAMAIGTAEL  120

Query  390  GFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVFVFLT  268
            G LE+LTF + SG+D++  EA LVN T +  +I+ + V L+
Sbjct  121  GILERLTFQQFSGMDRFSKEAMLVNSTGLIILIFSMLVVLS  161



>ref|XP_011021733.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Populus euphratica]
Length=235

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 120/188 (64%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+ +   N + +FN HP  M  GF+ L GEA+M+YK++  ++ VKK IH++LH
Sbjct  46   WLLHYRGGIEYHSDNSDRVFNAHPFFMFCGFIFLVGEAMMAYKTVLSQRIVKKSIHMLLH  105

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL LGIVGICA FK H+     ++YSLHSWIG+    L+ +QWV GF  F +P   A 
Sbjct  106  LIALCLGIVGICAVFKYHDMIHAEDVYSLHSWIGLVTFCLFCLQWVMGFAAFMFPKAAAG  165

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWHV  G  +  +A+  AL G +EK TFL+     K   E+ L+NFT +  +++
Sbjct  166  TRASMLPWHVSGGRALLYMAICAALTGLMEKSTFLDL----KNHRESRLINFTGLFVLLF  221

Query  288  GVFVFLTI  265
            G+FV L++
Sbjct  222  GIFVDLSV  229



>ref|XP_008365813.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Malus domestica]
Length=227

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+ ++  N + +FN+HP LM  GF+   GEA+M+YK++  + + +K +H +LH
Sbjct  35   WLLHYRGGIDYDSDNSDRVFNVHPFLMFFGFIFFAGEAMMAYKTVMSEHQGQKYMHALLH  94

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL  GI GICAAF+ H+   I ++Y+LHSWIG+G  +LYG+QW+ G   F +PGGTA+
Sbjct  95   LIALCTGIFGICAAFRYHDMRQIDDMYTLHSWIGLGTFILYGLQWLVGAAAFLFPGGTAE  154

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKY--GSEAFLVNFTAISTV  295
             R   +PWH+  G  +  L++  AL G ++K TFL   GL K     E+ L+NFTA++ +
Sbjct  155  SRLRLIPWHMSMGRTILYLSICAALTGLMQKFTFL---GLSKALGDRESHLINFTALAIL  211

Query  294  IYGVFVFLTI  265
            ++G+FV L++
Sbjct  212  LFGIFVDLSV  221



>ref|XP_008466953.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Cucumis melo]
Length=229

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 126/199 (63%), Gaps = 4/199 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGGLA++  + NL+FN HP  ML+GFV + GEA+M+Y+++  +K  KK++H+ LH
Sbjct  34   WLLHYRGGLAYDSPDANLVFNCHPFFMLLGFVFMSGEAMMAYRTVRAEKITKKIVHMGLH  93

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+ +GI+GI AAFK H++  + ++YSLHSWIGI    LYG+QW+ G   F +PG  A 
Sbjct  94   LVAICMGIIGINAAFKFHDQVNLEDMYSLHSWIGIVTFCLYGLQWLLGLFTFLFPGADAM  153

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             +   LPWH+  G  + ++ +  AL G  EK T L  +G      E+ L NFTA   +++
Sbjct  154  TKTRLLPWHISGGRALLMMIICTALTGLSEKATSLRLTG----SHESRLFNFTAFFVLLF  209

Query  288  GVFVFLTILSQAPTEDDHS  232
            G+ + ++I        DH+
Sbjct  210  GISIDISISFARFMHVDHT  228



>ref|XP_002281627.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Vitis vinifera]
 emb|CBI26789.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 126/189 (67%), Gaps = 4/189 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HF+GGLA++  + + IFNLHP LM++GF+++ GEAIMSYK++P  K  +K++HL+LH
Sbjct  33   WLLHFQGGLAFKSGDNDKIFNLHPFLMIVGFIMIAGEAIMSYKTVPGTKRTQKLVHLILH  92

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL  GI G+  AF+ H++  I ++Y+LHSW+G+    L+G+QWV+ F  F++PG    
Sbjct  93   FIALGAGIFGVYIAFRYHDKESIPDMYTLHSWLGLSTICLFGLQWVFAFFSFWFPGAEMP  152

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   +PWH   G  ++++A+  A  G +++   LE     K G EA +VNFT +  +++
Sbjct  153  TRGRLMPWHWFAGMVIFLMAILTAETGLVQRFKDLEL----KPGQEALIVNFTGLLILLF  208

Query  288  GVFVFLTIL  262
             + V L+++
Sbjct  209  AIAVSLSVI  217



>ref|XP_002281620.1| PREDICTED: probable ascorbate-specific transmembrane electron 
transporter 1 [Vitis vinifera]
Length=248

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 126/192 (66%), Gaps = 7/192 (4%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +HFRGGLA++  NK  IFN+HP+LM++GF+++GGEAIMS K++  K+    ++HL+LH
Sbjct  33   WLLHFRGGLAFKSDNKEKIFNVHPLLMIVGFIMIGGEAIMSCKAVQGKRRAPILVHLILH  92

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IALV GI G+C AF+ H+   + ++Y+LHSW+G+    L+G+QW++ F  F+YPG    
Sbjct  93   FIALVAGIFGVCMAFRYHHVESMPDMYTLHSWLGLCTICLFGLQWMFAFFSFWYPGVKKP  152

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             RR  +PWH   G  ++++A+  A  G +++ T+L          EA +VNFT +  +++
Sbjct  153  RRRRLMPWHWFAGMVIFLMAILTAETGLVQRSTYLRR-------QEALIVNFTGLLILLF  205

Query  288  GVFVFLTILSQA  253
               V L+++  +
Sbjct  206  ATAVGLSVIHPS  217



>gb|ACG32872.1| cytochrome b561 [Zea mays]
Length=235

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 135/200 (68%), Gaps = 3/200 (2%)
 Frame = -2

Query  828  WNIHFRGGLAW--EDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLV  655
            W +HFRGG+A   E+ +K  +FN+HPVLMLIG V L GEA+++YK++P  K++KK+++L 
Sbjct  29   WAVHFRGGMALSTEEESKLPLFNVHPVLMLIGLVALNGEALLAYKTVPGTKKLKKLVYLA  88

Query  654  LHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGT  475
            +  +A+ L ++G+ A +K H+E  I +LY+LHSW+G+   + + +QW  GF  F+YPGG+
Sbjct  89   VQFLAMFLSLIGLWAVWKFHDERKIDHLYTLHSWLGLTCFIFFSLQWAAGFWTFWYPGGS  148

Query  474  ADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAIST  298
               R   LPWHV FG F+Y+LA+A ++ G LEK  F++S+ + +++ +EA  +N   +  
Sbjct  149  RSGRAFLLPWHVFFGIFIYVLAIATSVTGLLEKSIFMQSAKMIERFSTEAMFMNSLGMLL  208

Query  297  VIYGVFVFLTILSQAPTEDD  238
            V+    V L ++S  P+  D
Sbjct  209  VLLSSLVILALVSPGPSMID  228



>ref|XP_004298488.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3-like 
[Fragaria vesca subsp. vesca]
Length=226

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 119/185 (64%), Gaps = 1/185 (1%)
 Frame = -2

Query  819  HFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIA  640
            H+RGGL ++  N   +FN+HP LM  GF+ L GEA+M+YK++  + +V+K +H   H +A
Sbjct  37   HYRGGLDYDSGNSQQVFNVHPFLMFFGFIFLAGEAMMAYKTVMAQHKVQKYVHGFFHLVA  96

Query  639  LVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRR  460
            L  GI GICA F+ H+   + ++YS+HSWIG+   +LYG+QW+ GF  F +P  +   R 
Sbjct  97   LCCGIWGICAVFRFHDMEKLDDMYSIHSWIGLTTIILYGLQWLIGFATFLFPRASEQSRA  156

Query  459  ESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIYGVF  280
            +  PWH+  G  +  L++  AL G +EK TFL + G      E  L+NFTA+S +++G+F
Sbjct  157  QIAPWHMSLGRVLLYLSICAALTGLMEKSTFLRTGG-QISERELHLINFTALSILLFGIF  215

Query  279  VFLTI  265
            V L++
Sbjct  216  VDLSV  220



>ref|XP_006448096.1| hypothetical protein CICLE_v10016590mg [Citrus clementina]
 ref|XP_006469296.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3-like 
[Citrus sinensis]
 gb|ESR61336.1| hypothetical protein CICLE_v10016590mg [Citrus clementina]
 gb|KDO60843.1| hypothetical protein CISIN_1g027354mg [Citrus sinensis]
Length=224

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+R G+ ++  + + +FN+HP LM  GFV L G+A+M+YK++   + V+K +H++LH
Sbjct  35   WLLHYRDGIEYDSDDPHRVFNVHPFLMFCGFVFLAGQAMMAYKTVFASRIVQKTVHMLLH  94

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
              A  LG+VG+CA FK H+ +G+ ++YSLHSWIG+G   L+G+QW++GF ++   G T  
Sbjct  95   LTAFCLGVVGLCAVFKYHDMAGLTDMYSLHSWIGMGTFCLFGLQWLFGFSIYMLRGPTEA  154

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWHV  G  +  +A+ +AL G +E  TFL+      +  E  L+NFT +S +++
Sbjct  155  RRAIMLPWHVCGGRALLYMAICSALTGLMEAATFLKL----HHEREGRLLNFTGLSILLF  210

Query  288  GVFVFLTI  265
            G+FV L++
Sbjct  211  GLFVDLSV  218



>ref|XP_002311430.2| hypothetical protein POPTR_0008s11430g [Populus trichocarpa]
 gb|EEE88797.2| hypothetical protein POPTR_0008s11430g [Populus trichocarpa]
Length=240

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 118/172 (69%), Gaps = 1/172 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  HFRGGLA    NK+LIFN+HPVL++IG V+L GEA+++YK++   K  +K++HL + 
Sbjct  29   WTFHFRGGLALSSDNKSLIFNVHPVLLVIGLVLLNGEAMLAYKTVSGTKSFRKIVHLTMQ  88

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            ++A  L  +G+ AA+K H+E G+ + Y+LHSW+G+    L+G QW  GF  F+YPGG+ +
Sbjct  89   SMAFCLSTIGVWAAYKFHSEKGVDHFYTLHSWLGLTCLFLFGTQWAAGFYTFWYPGGSIN  148

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVN  316
             R   LPWHV FG ++Y LAVA    G LEK TFL+   +   Y +EA+LVN
Sbjct  149  SRAALLPWHVFFGIYIYALAVATTATGILEKATFLQMHNITSPYSTEAYLVN  200



>ref|XP_010692475.1| PREDICTED: probable transmembrane ascorbate ferrireductase 2 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 123/188 (65%), Gaps = 1/188 (1%)
 Frame = -2

Query  783  KNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLHAIALVLGIVGICAAF  604
            +  +F +HPVLM+I  V++ GEA+++YK++P  K  KK++HLVL  +A  L I+G+ AA+
Sbjct  16   QGFVFWIHPVLMVISLVLINGEAMLAYKTVPGTKAFKKLVHLVLQFLAFCLAIIGVWAAW  75

Query  603  KNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTADIRRESLPWHVLFGTF  424
            K HN+ GI N YSLHSW+G+    L+ +QW  GF  F+YPGG+ + R   LPWHV FG +
Sbjct  76   KFHNDKGIDNFYSLHSWLGLACLFLFTLQWAGGFTTFWYPGGSRNNRSSLLPWHVFFGVY  135

Query  423  VYILAVANALLGFLEKLTFLESSG-LDKYGSEAFLVNFTAISTVIYGVFVFLTILSQAPT  247
            +Y LA+   + G LEK TFL+++  + +Y +EA LVN   I  V+ G FV L +++    
Sbjct  136  IYALAIVTTVTGILEKATFLQTNHVISRYSTEALLVNSMGILIVVLGGFVILALVAPLNG  195

Query  246  EDDHSYSA  223
            + +   SA
Sbjct  196  KGEIPRSA  203



>ref|XP_002984576.1| hypothetical protein SELMODRAFT_17233, partial [Selaginella moellendorffii]
 gb|EFJ14221.1| hypothetical protein SELMODRAFT_17233, partial [Selaginella moellendorffii]
Length=173

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 104/158 (66%), Gaps = 0/158 (0%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  + RGGL W   NK+L+FN HPVLM+ GFV + G+A ++Y++L   +  KK IH +  
Sbjct  16   WCGNVRGGLLWNSPNKDLLFNFHPVLMIAGFVFVHGQANLTYRTLTGSRNYKKAIHFLAQ  75

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +ALVLG VG  AA K HN+ GI N YSLHSW+G+    L+  QW  GFV F+YPGG+  
Sbjct  76   GLALVLGAVGFLAALKFHNDRGIDNFYSLHSWLGLTTMTLFVTQWTVGFVSFWYPGGSTA  135

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESS  355
             R   LPWH+  G F+Y L++  A  G LEKLTFL++S
Sbjct  136  ARSSILPWHIFSGIFLYTLSLVTAETGLLEKLTFLQTS  173



>ref|XP_002312480.1| cytochrome B561 family protein [Populus trichocarpa]
 gb|EEE89847.1| cytochrome B561 family protein [Populus trichocarpa]
Length=222

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 116/188 (62%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+ +   N + +FN HP  M  G + L GEA+M+YK++     V+K IH+ LH
Sbjct  33   WLLHYRGGIEYHSDNPDRVFNAHPFFMFCGLIFLAGEAMMTYKTISSAMIVQKSIHMFLH  92

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL LGIVGICA F+ H+     ++YSLHSW+G+    L+ +QWV+GF  F +P     
Sbjct  93   LIALCLGIVGICAVFRFHDMIQAEDVYSLHSWVGLSTFCLFCLQWVFGFFTFMFPKAGKQ  152

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWHV  G  +  +A   AL G +EK TFLE     K+  E+ L+NFT +  +++
Sbjct  153  TRASMLPWHVCGGRALLYMATCAALTGLIEKATFLEL----KHHRESHLINFTGLFILLF  208

Query  288  GVFVFLTI  265
            G+FV L++
Sbjct  209  GIFVDLSV  216



>ref|XP_011070533.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Sesamum indicum]
 ref|XP_011070534.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Sesamum indicum]
Length=225

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 123/188 (65%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+R G+  +  + + +FN+HP LM  GF+ + GEA+M+YK++  ++EV+K +H+ +H
Sbjct  36   WLLHYREGIDLDSDSSSRVFNVHPFLMFFGFIFMAGEAMMAYKTVVAEREVQKFVHMFVH  95

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             +A+VLGIVG+ AAFK H   G+ NLYSLHSWIGIG   LY +QW+ G  VF  PG + D
Sbjct  96   LVAIVLGIVGLHAAFKFHERRGLTNLYSLHSWIGIGTFSLYCLQWLIGLSVFLLPGASHD  155

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R     WHV  G  +  +A+  AL G  EK T +   GL ++ SEA  +NF  +S +++
Sbjct  156  SRARVASWHVSGGRILLFMAICAALTGLTEKATVM---GL-QHQSEARTINFLGLSVLLF  211

Query  288  GVFVFLTI  265
            G+FV L++
Sbjct  212  GIFVDLSV  219



>ref|XP_003529234.1| PREDICTED: probable transmembrane ascorbate ferrireductase 3 
[Glycine max]
 gb|KHN10905.1| Putative transmembrane ascorbate ferrireductase 3 [Glycine soja]
Length=213

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+R G+ ++  N   +FN HP+LM   F+ L GEA+M ++++P +++VKK +H+ LH
Sbjct  24   WLLHYREGIDYDSDNGFRVFNAHPLLMYSCFIFLAGEAMMVFQTIPSERKVKKFVHMTLH  83

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IA+VLGIVG+ A FK H+   I N+YSLHSWIGIG   L+ +QW++GFVVF   G +A 
Sbjct  84   LIAIVLGIVGLNAVFKFHDMQNIPNVYSLHSWIGIGTFCLFALQWLFGFVVFMLQGASAT  143

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R + LPWH + G  +  +AV  A  G +EK +FL +  L  +  E+ L+NFT ++ +++
Sbjct  144  TRAKVLPWHKVGGRALLFMAVCAAETGLMEKSSFLTNLKL-LHERESNLINFTGLAILLF  202

Query  288  GVFV  277
            GVFV
Sbjct  203  GVFV  206



>ref|XP_011028017.1| PREDICTED: uncharacterized protein LOC105128167 [Populus euphratica]
Length=538

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 130/198 (66%), Gaps = 1/198 (1%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W  HFRGGLA    NK+LIFN+HPVL++IG V+L GEA+++YK++   K  +K++HL + 
Sbjct  327  WTFHFRGGLALSSDNKSLIFNVHPVLLVIGLVLLNGEAMLAYKTVSGTKSFRKIVHLTMQ  386

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
            ++A  L I+G+ AA+K H+E G+ + Y+LHSW+G+    L+G QW  GF  F+YPGG+  
Sbjct  387  SMAFCLSIIGVWAAYKFHSEKGVDHFYTLHSWLGLTCLFLFGTQWAAGFYTFWYPGGSIY  446

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGL-DKYGSEAFLVNFTAISTVI  292
             R   LPWHV FG ++Y LAVA    G LEK TFL++  +   Y +EA+L+N   +  V+
Sbjct  447  SRAALLPWHVFFGIYIYALAVATTATGILEKATFLQTHNITSPYSTEAYLINSLGMLVVV  506

Query  291  YGVFVFLTILSQAPTEDD  238
             G  V L I++    + D
Sbjct  507  LGGCVILAIVTPMSAKGD  524


 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 109/174 (63%), Gaps = 4/174 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNK-NLIFN-LHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLV  655
            W + F+     + T++ +LI+  LHP+LM+IGF+++ GEAI+ +K LP  +  KK +HL 
Sbjct  30   WALVFKSSFLPQSTSQEDLIYAVLHPLLMVIGFILISGEAILVHKWLPGSRGFKKSVHLC  89

Query  654  LHAIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGT  475
            L  +AL  GI GI   F   N+  +AN +SLHSW+G+    L+G QW+ GF+ F++ G  
Sbjct  90   LQGLALACGIFGIWTKFHG-NDGIVANFFSLHSWMGLICISLFGAQWLMGFMSFWHRGEM  148

Query  474  ADIRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLES-SGLDKYGSEAFLVN  316
              +R   LPWH+  G + Y LAVA A  G LEK+TFL++   + K+  E+ +VN
Sbjct  149  RTVRITVLPWHIFLGLYTYGLAVATAETGLLEKITFLQTKKDVSKHTPESMVVN  202



>ref|XP_002314762.1| hypothetical protein POPTR_0010s11290g [Populus trichocarpa]
 gb|EEF00933.1| hypothetical protein POPTR_0010s11290g [Populus trichocarpa]
Length=222

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 117/188 (62%), Gaps = 4/188 (2%)
 Frame = -2

Query  828  WNIHFRGGLAWEDTNKNLIFNLHPVLMLIGFVILGGEAIMSYKSLPLKKEVKKVIHLVLH  649
            W +H+RGG+ +   N + +FN HP  M  GF+ L GEA+M+YK++  +  VKK IH++LH
Sbjct  33   WLLHYRGGIEYHSDNPDRVFNAHPFFMFCGFIFLVGEAMMAYKTVLSRGIVKKSIHMILH  92

Query  648  AIALVLGIVGICAAFKNHNESGIANLYSLHSWIGIGVAVLYGIQWVYGFVVFFYPGGTAD  469
             IAL LGIVGICA FK H+     ++YSLHSWIG+    L+ +QWV GF  F +P     
Sbjct  93   LIALCLGIVGICAVFKYHDMIHAEDVYSLHSWIGLVTFCLFCLQWVLGFSAFMFPKAAPS  152

Query  468  IRRESLPWHVLFGTFVYILAVANALLGFLEKLTFLESSGLDKYGSEAFLVNFTAISTVIY  289
             R   LPWHV  G  +  +A+  AL G +EK TFL      K   EA L+NFT +  +++
Sbjct  153  TRASMLPWHVSGGRALLYMAICAALTGLMEKSTFLNL----KNHREARLINFTGLFVLLF  208

Query  288  GVFVFLTI  265
            G+FV L++
Sbjct  209  GIFVDLSV  216



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2581342896576