BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30574_g1_i1 len=1310 path=[1:0-1309]

Length=1310
                                                                      Score     E

ref|XP_009759099.1|  PREDICTED: peroxidase N                            487   6e-168   
ref|XP_009620838.1|  PREDICTED: peroxidase N                            483   4e-166   
ref|XP_004228346.1|  PREDICTED: peroxidase N-like                       476   2e-163   
emb|CDP17671.1|  unnamed protein product                                473   1e-162   
ref|XP_006356455.1|  PREDICTED: peroxidase N-like                       468   2e-159   
ref|XP_007014796.1|  Peroxidase superfamily protein                     461   2e-157   
ref|XP_011083137.1|  PREDICTED: peroxidase N                            458   1e-156   
gb|KDO56405.1|  hypothetical protein CISIN_1g020050mg                   456   7e-156   
ref|XP_006492728.1|  PREDICTED: peroxidase 59-like                      455   3e-155   
ref|XP_004228694.1|  PREDICTED: peroxidase N-like isoform X1            453   1e-154   
gb|KHG30456.1|  Peroxidase N                                            451   6e-154   
ref|XP_007154627.1|  hypothetical protein PHAVU_003G134600g             451   1e-153   
ref|XP_004295168.1|  PREDICTED: peroxidase N-like                       444   4e-151   
ref|XP_003549216.1|  PREDICTED: peroxidase N-like                       444   6e-151   
ref|XP_008361464.1|  PREDICTED: peroxidase N-like                       444   8e-151   
gb|KEH32489.1|  peroxidase family protein                               443   1e-150   
ref|XP_009364156.1|  PREDICTED: peroxidase N-like                       443   2e-150   
gb|KDP34262.1|  hypothetical protein JCGZ_12830                         442   3e-150   
ref|XP_004507960.1|  PREDICTED: peroxidase N-like                       441   8e-150   
gb|ACU24431.1|  unknown                                                 440   2e-149   Glycine max [soybeans]
ref|NP_001240914.1|  uncharacterized protein LOC100787073 precursor     440   2e-149   
ref|XP_003549220.1|  PREDICTED: peroxidase N isoform X1                 439   5e-149   
ref|XP_009376683.1|  PREDICTED: peroxidase 59-like                      439   8e-149   
ref|XP_007206866.1|  hypothetical protein PRUPE_ppb006944mg             436   5e-148   
ref|XP_010265936.1|  PREDICTED: peroxidase N                            436   9e-148   
ref|XP_010316021.1|  PREDICTED: peroxidase N-like isoform X2            435   1e-147   
ref|XP_010087404.1|  Peroxidase 59                                      435   2e-147   
ref|XP_002285642.1|  PREDICTED: peroxidase N isoform X2                 435   3e-147   Vitis vinifera
ref|XP_008351692.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    432   3e-146   
ref|XP_008228270.1|  PREDICTED: peroxidase 59                           432   3e-146   
ref|XP_009390336.1|  PREDICTED: peroxidase 59-like                      430   2e-145   
ref|XP_010541735.1|  PREDICTED: peroxidase N                            429   4e-145   
ref|XP_010043876.1|  PREDICTED: peroxidase N                            428   1e-144   
gb|AHL39128.1|  class III peroxidase                                    427   1e-144   
ref|XP_011025200.1|  PREDICTED: peroxidase N                            426   5e-144   
ref|XP_002304020.2|  peroxidase family protein                          426   7e-144   Populus trichocarpa [western balsam poplar]
ref|XP_010651318.1|  PREDICTED: peroxidase N isoform X1                 425   3e-143   
ref|XP_010673530.1|  PREDICTED: peroxidase N-like                       424   4e-143   
ref|XP_009408603.1|  PREDICTED: peroxidase N-like                       421   8e-142   
ref|XP_004142143.1|  PREDICTED: peroxidase N-like                       420   2e-141   
ref|XP_004162079.1|  PREDICTED: peroxidase N-like                       420   2e-141   
ref|XP_006400553.1|  hypothetical protein EUTSA_v10014080mg             419   3e-141   
gb|KGN54106.1|  hypothetical protein Csa_4G286310                       418   3e-141   
ref|XP_008449769.1|  PREDICTED: peroxidase N                            416   4e-140   
ref|XP_008787878.1|  PREDICTED: peroxidase N                            416   5e-140   
gb|AFK46680.1|  unknown                                                 416   8e-140   
ref|XP_008352132.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 59      415   1e-139   
ref|XP_002873970.1|  peroxidase                                         415   2e-139   
ref|XP_010939956.1|  PREDICTED: peroxidase N                            411   5e-138   
ref|XP_006828876.1|  hypothetical protein AMTR_s00001p00177360          409   2e-137   
pdb|1QGJ|A  Chain A, Arabidopsis Thaliana Peroxidase N                  408   3e-137   
sp|Q42517.1|PERN_ARMRU  RecName: Full=Peroxidase N; AltName: Full...    409   3e-137   Armoracia rusticana [horseradish]
emb|CAA67092.1|  peroxidase                                             409   4e-137   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65571.1|  peroxidase ATP N                                        409   4e-137   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568385.1|  peroxidase 59                                         408   7e-137   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17685.1|  Peroxidase N                                            404   3e-136   
emb|CDY42313.1|  BnaC02g09190D                                          405   6e-136   
ref|XP_010420808.1|  PREDICTED: peroxidase N                            405   9e-136   
emb|CDX92492.1|  BnaA10g15310D                                          405   1e-135   
ref|XP_004513441.1|  PREDICTED: peroxidase N-like                       405   1e-135   
emb|CDY35842.1|  BnaC09g37740D                                          405   1e-135   
ref|XP_009126399.1|  PREDICTED: peroxidase N-like isoform X1            404   2e-135   
gb|KHN06632.1|  Peroxidase N                                            402   3e-135   
ref|XP_006600453.1|  PREDICTED: peroxidase N isoform X2                 400   1e-134   
ref|XP_008228368.1|  PREDICTED: peroxidase N-like                       400   3e-134   
ref|XP_009405166.1|  PREDICTED: peroxidase 59-like                      401   5e-134   
gb|KEH32490.1|  peroxidase family protein                               399   5e-134   
ref|XP_010454279.1|  PREDICTED: peroxidase 59-like                      400   5e-134   
ref|XP_007206483.1|  hypothetical protein PRUPE_ppa019052mg             400   7e-134   
ref|XP_010493079.1|  PREDICTED: peroxidase 59                           400   1e-133   
ref|XP_009120848.1|  PREDICTED: peroxidase N                            400   1e-133   
ref|XP_003595237.1|  Peroxidase                                         395   7e-132   
gb|ABN09112.1|  Haem peroxidase, plant/fungal/bacterial                 396   9e-132   Medicago truncatula
ref|XP_006290154.1|  hypothetical protein CARUB_v10003822mg             393   6e-131   
gb|ACJ84502.1|  unknown                                                 392   1e-130   Medicago truncatula
ref|XP_003561850.1|  PREDICTED: peroxidase N-like                       385   1e-127   
ref|XP_002465590.1|  hypothetical protein SORBIDRAFT_01g041760          382   8e-127   Sorghum bicolor [broomcorn]
gb|EYU17995.1|  hypothetical protein MIMGU_mgv1a021857mg                379   1e-126   
gb|KDO40104.1|  hypothetical protein CISIN_1g045752mg                   377   9e-126   
ref|XP_006492730.1|  PREDICTED: peroxidase N-like                       380   5e-125   
ref|XP_004985086.1|  PREDICTED: peroxidase N-like                       377   1e-124   
tpg|DAA49837.1|  TPA: peroxidase R11                                    376   2e-124   
ref|XP_004983337.1|  PREDICTED: peroxidase N-like                       375   7e-124   
ref|XP_006354231.1|  PREDICTED: peroxidase N-like                       372   8e-124   
ref|XP_010257483.1|  PREDICTED: peroxidase N-like                       374   1e-123   
ref|NP_001140689.1|  uncharacterized protein LOC100272764 precursor     373   2e-123   Zea mays [maize]
dbj|BAA08499.1|  peroxidase                                             373   3e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89165.1|  hypothetical protein OsI_10661                          373   4e-123   Oryza sativa Indica Group [Indian rice]
dbj|BAA03373.1|  putative peroxidase                                    372   6e-123   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049483.1|  Os03g0235000                                       372   7e-123   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146489.1|  uncharacterized protein LOC100280077 precursor     372   9e-123   Zea mays [maize]
ref|XP_006649694.1|  PREDICTED: peroxidase N-like                       371   3e-122   
ref|XP_008644819.1|  PREDICTED: peroxidase N-like                       368   3e-121   
ref|XP_008368030.1|  PREDICTED: peroxidase N-like                       367   7e-121   
ref|XP_007162335.1|  hypothetical protein PHAVU_001G143300g             365   4e-120   
ref|XP_002464560.1|  hypothetical protein SORBIDRAFT_01g020830          365   4e-120   Sorghum bicolor [broomcorn]
dbj|BAJ94281.1|  predicted protein                                      365   5e-120   
ref|XP_009126400.1|  PREDICTED: peroxidase N-like isoform X2            362   4e-119   
ref|XP_003535116.1|  PREDICTED: peroxidase 53-like                      361   2e-118   
gb|EMT06858.1|  Peroxidase N                                            360   3e-118   
ref|XP_006575205.1|  PREDICTED: peroxidase 53-like                      360   6e-118   
gb|KEH41719.1|  peroxidase family protein                               358   2e-117   
gb|KHN41710.1|  Peroxidase 53                                           358   3e-117   
gb|KHN07440.1|  Peroxidase 15                                           357   6e-117   
ref|XP_006661598.1|  PREDICTED: peroxidase N-like                       356   1e-116   
ref|XP_003521220.1|  PREDICTED: peroxidase 15-like                      355   2e-116   
ref|XP_004497888.1|  PREDICTED: peroxidase 53-like                      355   3e-116   
ref|XP_009784679.1|  PREDICTED: peroxidase 15-like                      354   9e-116   
ref|XP_006848540.1|  hypothetical protein AMTR_s00169p00032570          353   9e-116   
gb|KDO70903.1|  hypothetical protein CISIN_1g019976mg                   353   1e-115   
ref|XP_007145698.1|  hypothetical protein PHAVU_007G260700g             353   3e-115   
ref|XP_006492847.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    353   4e-115   
ref|XP_003625275.1|  Peroxidase                                         354   4e-115   
ref|NP_001064031.1|  Os10g0109600                                       352   4e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010491253.1|  PREDICTED: peroxidase 54-like                      353   5e-115   
dbj|BAA84764.1|  peroxidase                                             351   1e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77487.1|  hypothetical protein OsI_32530                          350   3e-114   Oryza sativa Indica Group [Indian rice]
gb|EYU20688.1|  hypothetical protein MIMGU_mgv1a009598mg                350   3e-114   
dbj|BAA03372.1|  putative peroxidase                                    350   3e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004497889.1|  PREDICTED: peroxidase 53-like                      350   4e-114   
ref|XP_009610510.1|  PREDICTED: peroxidase 15 {ECO:0000303|PubMed...    350   5e-114   
ref|XP_006399147.1|  hypothetical protein EUTSA_v10013916mg             350   7e-114   
emb|CDX98950.1|  BnaC09g48850D                                          349   2e-113   
ref|XP_010452613.1|  PREDICTED: peroxidase 54                           349   2e-113   
ref|XP_007145699.1|  hypothetical protein PHAVU_007G260800g             347   4e-113   
prf||2114377B  peroxidase:ISOTYPE=RPN                                   347   4e-113
sp|Q9LEH3.1|PER15_IPOBA  RecName: Full=Peroxidase 15; Short=Prx15...    347   5e-113   Ipomoea batatas [batate]
ref|XP_004251296.1|  PREDICTED: peroxidase 15-like                      347   5e-113   
ref|XP_008798950.1|  PREDICTED: peroxidase 15-like                      347   5e-113   
ref|XP_002530724.1|  Peroxidase 53 precursor, putative                  347   7e-113   Ricinus communis
gb|AFK39887.1|  unknown                                                 347   1e-112   
ref|XP_010058197.1|  PREDICTED: peroxidase A2-like                      346   1e-112   
gb|AAP42504.1|  anionic peroxidase swpa5                                345   2e-112   Ipomoea batatas [batate]
gb|AGN03454.1|  class III secretory peroxidase                          345   2e-112   
gb|KHN45426.1|  Peroxidase 15                                           345   3e-112   
emb|CDP10156.1|  unnamed protein product                                346   3e-112   
gb|AAM66044.1|  peroxidase                                              346   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520028.1|  PREDICTED: peroxidase A2-like                      345   5e-112   
ref|XP_007029017.1|  Peroxidase 2                                       344   6e-112   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  344   6e-112   Ricinus communis
gb|AFY97686.1|  peroxidase 3                                            345   6e-112   
gb|KDP24640.1|  hypothetical protein JCGZ_25556                         344   7e-112   
ref|XP_007202211.1|  hypothetical protein PRUPE_ppa008390mg             344   7e-112   
ref|XP_003553432.1|  PREDICTED: peroxidase 15-like                      344   8e-112   
emb|CDX98949.1|  BnaC09g48860D                                          344   8e-112   
ref|XP_011039460.1|  PREDICTED: peroxidase A2-like                      344   8e-112   
emb|CDX70074.1|  BnaA10g24230D                                          345   9e-112   
ref|XP_009122284.1|  PREDICTED: peroxidase A2                           345   1e-111   
ref|XP_009375169.1|  PREDICTED: peroxidase A2-like                      344   1e-111   
ref|XP_008787874.1|  PREDICTED: peroxidase 15                           343   2e-111   
ref|XP_006363346.1|  PREDICTED: peroxidase 15-like                      343   2e-111   
ref|XP_011078985.1|  PREDICTED: peroxidase 15-like                      343   2e-111   
ref|XP_006373791.1|  hypothetical protein POPTR_0016s05860g             343   2e-111   
ref|NP_196291.1|  peroxidase 54                                         343   5e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65211.1|  peroxidase                                              342   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399146.1|  hypothetical protein EUTSA_v10014029mg             342   6e-111   
ref|XP_006492672.1|  PREDICTED: peroxidase 15-like                      342   8e-111   
ref|XP_009409636.1|  PREDICTED: peroxidase A2-like                      342   9e-111   
ref|XP_010491252.1|  PREDICTED: peroxidase 53                           341   1e-110   
pdb|1PA2|A  Chain A, Arabidopsis Thaliana Peroxidase A2                 340   1e-110   
ref|XP_008240914.1|  PREDICTED: peroxidase A2-like                      341   1e-110   
emb|CCJ34833.1|  horseradish peroxidase isoenzyme HRP_4663              342   1e-110   
gb|ACM47317.1|  peroxidase                                              340   2e-110   Capsicum annuum
ref|XP_010423310.1|  PREDICTED: peroxidase 53-like                      341   2e-110   
ref|XP_009375132.1|  PREDICTED: peroxidase A2-like                      341   2e-110   
gb|AAR15704.3|  peroxidase                                              339   2e-110   Brassica napus [oilseed rape]
gb|AFN41087.1|  peroxidase precursor                                    340   2e-110   
ref|NP_196290.1|  peroxidase 53                                         340   3e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362277.1|  PREDICTED: peroxidase 15-like                      340   3e-110   
ref|XP_006288143.1|  hypothetical protein CARUB_v10001380mg             340   4e-110   
ref|XP_006492671.1|  PREDICTED: peroxidase 15-like                      340   5e-110   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      339   5e-110   
emb|CCJ34825.1|  horseradish peroxidase isoenzyme HRP_A2A               340   5e-110   
ref|XP_009122283.1|  PREDICTED: peroxidase A2                           339   7e-110   
ref|XP_010257485.1|  PREDICTED: peroxidase A2-like                      338   1e-109   
emb|CCJ34826.1|  horseradish peroxidase isoenzyme HRP_A2B               338   2e-109   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      337   4e-109   
ref|XP_010935535.1|  PREDICTED: peroxidase 10                           337   5e-109   
ref|XP_008390167.1|  PREDICTED: peroxidase A2-like                      336   5e-109   
gb|KDO62915.1|  hypothetical protein CISIN_1g018873mg                   337   5e-109   
ref|XP_008228052.1|  PREDICTED: peroxidase A2-like                      338   5e-109   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         337   6e-109   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      336   6e-109   
ref|XP_009369457.1|  PREDICTED: peroxidase A2-like                      337   6e-109   
ref|XP_009780492.1|  PREDICTED: peroxidase 10-like                      336   8e-109   
ref|XP_006425837.1|  hypothetical protein CICLE_v10026130mg             335   9e-109   
ref|XP_006492677.1|  PREDICTED: peroxidase 15-like                      337   1e-108   
ref|XP_007205439.1|  hypothetical protein PRUPE_ppa007826mg             337   1e-108   
ref|XP_008387221.1|  PREDICTED: peroxidase A2-like                      336   1e-108   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       335   1e-108   
ref|XP_006466643.1|  PREDICTED: peroxidase 10-like                      336   1e-108   
dbj|BAF33316.1|  peroxidase                                             335   2e-108   Populus alba [abele]
ref|XP_004249178.1|  PREDICTED: peroxidase A2                           335   2e-108   
ref|XP_009586909.1|  PREDICTED: peroxidase 10-like                      335   3e-108   
ref|XP_010058152.1|  PREDICTED: peroxidase A2-like                      335   3e-108   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      334   4e-108   
gb|KDO62910.1|  hypothetical protein CISIN_1g018796mg                   335   5e-108   
dbj|BAJ93823.1|  predicted protein                                      334   5e-108   
ref|XP_007205419.1|  hypothetical protein PRUPE_ppa007654mg             335   6e-108   
dbj|BAA82306.1|  peroxidase                                             333   6e-108   Nicotiana tabacum [American tobacco]
ref|XP_006494804.1|  PREDICTED: peroxidase 15-like                      335   7e-108   
ref|XP_002263033.2|  PREDICTED: peroxidase 10-like                      333   9e-108   Vitis vinifera
ref|XP_006492673.1|  PREDICTED: peroxidase 15-like                      334   9e-108   
ref|XP_006492674.1|  PREDICTED: peroxidase C3-like isoform X1           334   1e-107   
gb|ABG46370.1|  rubber peroxidase 1                                     334   1e-107   Hevea brasiliensis [jebe]
gb|KDO62916.1|  hypothetical protein CISIN_1g018871mg                   334   1e-107   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           333   1e-107   
gb|AGF25268.1|  peroxidase 1                                            333   1e-107   
ref|XP_002980452.1|  hypothetical protein SELMODRAFT_444510             333   1e-107   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      333   2e-107   
ref|XP_002962639.1|  hypothetical protein SELMODRAFT_230146             333   2e-107   
emb|CAD92857.1|  peroxidase                                             333   2e-107   Picea abies
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      332   2e-107   
sp|P80679.1|PERA2_ARMRU  RecName: Full=Peroxidase A2                    332   2e-107   Armoracia rusticana [horseradish]
dbj|BAF33314.1|  peroxidase                                             332   2e-107   Populus alba [abele]
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      332   3e-107   
ref|XP_002279920.1|  PREDICTED: peroxidase A2                           332   3e-107   Vitis vinifera
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      332   3e-107   
ref|XP_006409192.1|  hypothetical protein EUTSA_v10022774mg             332   4e-107   
ref|XP_010268504.1|  PREDICTED: peroxidase 10                           332   4e-107   
pdb|4CUO|A  Chain A, Banyan Peroxidase With Glycosylation               331   4e-107   
gb|AHL39106.1|  class III peroxidase                                    332   6e-107   
ref|XP_003563125.1|  PREDICTED: peroxidase N-like                       332   6e-107   
ref|XP_010058168.1|  PREDICTED: peroxidase A2-like                      332   6e-107   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      331   7e-107   
ref|XP_008227949.1|  PREDICTED: peroxidase A2-like isoform X2           334   8e-107   
ref|XP_006849541.1|  hypothetical protein AMTR_s00024p00166170          331   8e-107   
ref|XP_011025201.1|  PREDICTED: peroxidase A2-like                      332   1e-106   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              331   1e-106   
ref|XP_009761466.1|  PREDICTED: peroxidase 10-like                      331   1e-106   
ref|XP_007047175.1|  Peroxidase superfamily protein isoform 1           331   1e-106   
ref|XP_009381003.1|  PREDICTED: peroxidase A2-like                      332   1e-106   
ref|XP_006492676.1|  PREDICTED: peroxidase C3-like isoform X3           331   1e-106   
ref|XP_002285652.2|  PREDICTED: peroxidase A2                           331   2e-106   Vitis vinifera
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             330   2e-106   
emb|CAA66037.1|  peroxidase                                             330   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      330   3e-106   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       330   3e-106   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      329   4e-106   
ref|XP_006386069.1|  hypothetical protein POPTR_0003s21640g             330   4e-106   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       329   5e-106   
ref|XP_009625722.1|  PREDICTED: peroxidase 10-like                      329   5e-106   
ref|XP_006492675.1|  PREDICTED: peroxidase C3-like isoform X2           330   5e-106   
ref|XP_006338218.1|  PREDICTED: peroxidase 10-like                      329   5e-106   
gb|ABG49115.1|  peroxidase                                              330   7e-106   Citrus maxima [buntan]
ref|XP_006492678.1|  PREDICTED: peroxidase 15-like                      329   8e-106   
gb|ABK21983.1|  unknown                                                 329   8e-106   Picea sitchensis
ref|XP_004233638.1|  PREDICTED: peroxidase 10-like                      328   1e-105   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       328   1e-105   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       328   1e-105   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      328   1e-105   
ref|XP_008227874.1|  PREDICTED: peroxidase A2-like isoform X1           332   1e-105   
ref|XP_002992293.1|  hypothetical protein SELMODRAFT_3562               327   1e-105   
ref|XP_002978872.1|  hypothetical protein SELMODRAFT_418626             328   2e-105   
emb|CAH10839.1|  peroxidase                                             327   2e-105   Picea abies
ref|XP_008805717.1|  PREDICTED: peroxidase 10                           327   2e-105   
gb|AHL39126.1|  class III peroxidase                                    328   2e-105   
ref|XP_002299152.2|  hypothetical protein POPTR_0001s05050g             328   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       327   3e-105   
emb|CAL25299.1|  properoxidase                                          328   3e-105   Picea abies
emb|CDP13933.1|  unnamed protein product                                327   3e-105   
ref|XP_002304885.1|  peroxidase family protein                          328   3e-105   Populus trichocarpa [western balsam poplar]
gb|AHL39125.1|  class III peroxidase                                    327   3e-105   
emb|CDY46313.1|  BnaA07g01880D                                          327   4e-105   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      326   4e-105   
gb|ABK22680.1|  unknown                                                 327   4e-105   Picea sitchensis
ref|XP_010268491.1|  PREDICTED: peroxidase 10-like                      327   5e-105   
ref|XP_002987837.1|  hypothetical protein SELMODRAFT_235372             327   5e-105   
gb|EYU44369.1|  hypothetical protein MIMGU_mgv1a018146mg                326   5e-105   
ref|XP_009102275.1|  PREDICTED: peroxidase 15                           327   5e-105   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      326   5e-105   
ref|XP_002304884.1|  hypothetical protein POPTR_0003s21610g             327   6e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             326   7e-105   
gb|KHG09190.1|  Peroxidase 4                                            326   7e-105   
ref|XP_010432175.1|  PREDICTED: peroxidase 49                           326   9e-105   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        325   9e-105   Gossypium hirsutum [American cotton]
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             326   9e-105   
emb|CDM82666.1|  unnamed protein product                                326   1e-104   
ref|XP_006346525.1|  PREDICTED: peroxidase 10-like                      326   1e-104   
emb|CDY25140.1|  BnaC07g03670D                                          326   1e-104   
ref|XP_010446794.1|  PREDICTED: peroxidase 49-like                      325   1e-104   
ref|XP_009404154.1|  PREDICTED: peroxidase A2-like                      325   1e-104   
ref|XP_011099203.1|  PREDICTED: peroxidase 10-like isoform X1           325   1e-104   
gb|KFK40198.1|  hypothetical protein AALP_AA3G342700                    325   2e-104   
ref|XP_010467620.1|  PREDICTED: peroxidase 15-like                      325   2e-104   
dbj|BAF33315.1|  peroxidase                                             325   2e-104   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            325   2e-104   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            325   2e-104   
ref|XP_004232052.1|  PREDICTED: peroxidase 10-like                      325   2e-104   
emb|CAL25298.1|  properoxidase                                          325   2e-104   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           325   2e-104   
ref|XP_008352115.1|  PREDICTED: peroxidase A2-like                      326   2e-104   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      325   2e-104   
ref|XP_008344683.1|  PREDICTED: peroxidase A2-like                      326   2e-104   
emb|CCJ34840.1|  horseradish peroxidase isoenzyme HRP_6117              325   3e-104   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              324   3e-104   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       324   3e-104   
ref|XP_010058176.1|  PREDICTED: peroxidase A2-like                      325   3e-104   
emb|CDY25139.1|  BnaC07g03680D                                          325   4e-104   
ref|XP_002988477.1|  hypothetical protein SELMODRAFT_235541             323   4e-104   
ref|XP_006299700.1|  hypothetical protein CARUB_v10015891mg             325   4e-104   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           324   4e-104   
ref|XP_010489511.1|  PREDICTED: peroxidase 15                           324   4e-104   
pir||S60055  peroxidase (EC 1.11.1.7) A4a precursor - Japanese as...    325   5e-104
ref|XP_010413957.1|  PREDICTED: peroxidase 15-like                      324   5e-104   
ref|XP_004967776.1|  PREDICTED: peroxidase 72-like                      324   6e-104   
emb|CDY64926.1|  BnaAnng19770D                                          324   6e-104   
ref|XP_004230797.1|  PREDICTED: peroxidase 10                           324   6e-104   
emb|CDY32701.1|  BnaA02g07630D                                          323   6e-104   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            323   6e-104   
gb|KHN37486.1|  Peroxidase 10                                           324   6e-104   
ref|XP_010535899.1|  PREDICTED: peroxidase E5-like                      325   7e-104   
ref|XP_006296673.1|  hypothetical protein CARUB_v10016420mg             324   7e-104   
ref|XP_002455405.1|  hypothetical protein SORBIDRAFT_03g010240          324   7e-104   
dbj|BAD97438.1|  peroxidase                                             324   7e-104   
ref|NP_001240064.1|  uncharacterized protein LOC100805712 precursor     323   8e-104   
gb|KDP44300.1|  hypothetical protein JCGZ_19167                         324   8e-104   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             323   8e-104   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                323   8e-104   
gb|EAY73397.1|  hypothetical protein OsI_01277                          324   8e-104   
ref|XP_010550378.1|  PREDICTED: peroxidase 10-like                      323   8e-104   
ref|XP_008363339.1|  PREDICTED: peroxidase A2-like                      324   9e-104   
ref|XP_009126754.1|  PREDICTED: peroxidase 67                           323   9e-104   
gb|AAR31106.1|  peroxidase precursor                                    323   9e-104   
ref|XP_006480139.1|  PREDICTED: peroxidase 10-like                      323   9e-104   
ref|XP_010109818.1|  Peroxidase 54                                      323   1e-103   
ref|NP_001042657.1|  Os01g0263300                                       323   1e-103   
gb|EMT23112.1|  Peroxidase 72                                           323   1e-103   
gb|ABI37011.1|  peroxidase                                              323   1e-103   
ref|XP_002285649.1|  PREDICTED: lignin-forming anionic peroxidase       323   1e-103   
ref|XP_010257484.1|  PREDICTED: peroxidase 15-like                      323   1e-103   
ref|XP_009129875.1|  PREDICTED: peroxidase 49-like                      323   2e-103   
emb|CDM82668.1|  unnamed protein product                                323   2e-103   
pir||S60054  peroxidase (EC 1.11.1.7) A3a precursor - Japanese as...    323   2e-103
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    323   2e-103   
emb|CDM82669.1|  unnamed protein product                                323   2e-103   
emb|CDO97144.1|  unnamed protein product                                322   2e-103   
gb|KDO49149.1|  hypothetical protein CISIN_1g020451mg                   322   2e-103   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       322   2e-103   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            322   2e-103   
emb|CAH10840.1|  peroxidase                                             322   2e-103   
ref|XP_008352125.1|  PREDICTED: peroxidase A2-like                      323   2e-103   
gb|ABK23423.1|  unknown                                                 322   2e-103   
dbj|BAJ94181.1|  predicted protein                                      322   2e-103   
ref|XP_009138426.1|  PREDICTED: peroxidase 49                           322   2e-103   
ref|XP_004141924.1|  PREDICTED: peroxidase 10-like                      322   2e-103   
emb|CDY02817.1|  BnaC02g10720D                                          322   2e-103   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       322   3e-103   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       322   3e-103   
ref|NP_179407.1|  peroxidase 15                                         322   3e-103   
emb|CDM82667.1|  unnamed protein product                                322   3e-103   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       322   3e-103   
gb|AFR44628.1|  class III secretory peroxidase                          322   3e-103   
gb|AAM61616.1|  putative peroxidase                                     322   3e-103   
ref|NP_001049482.1|  Os03g0234900                                       322   3e-103   
ref|NP_196153.1|  peroxidase 52                                         322   3e-103   
gb|EMT08942.1|  Peroxidase 15                                           322   3e-103   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              321   4e-103   
gb|EMS54022.1|  Peroxidase 72                                           322   4e-103   
ref|XP_002886150.1|  hypothetical protein ARALYDRAFT_480719             322   4e-103   
ref|XP_010548306.1|  PREDICTED: peroxidase 49                           322   4e-103   
ref|XP_002299142.2|  hypothetical protein POPTR_0001s04840g             322   4e-103   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              321   4e-103   
ref|XP_006649693.1|  PREDICTED: peroxidase 15-like                      322   4e-103   
ref|XP_002972031.1|  hypothetical protein SELMODRAFT_96952              322   4e-103   
ref|XP_006644025.1|  PREDICTED: peroxidase 72-like                      322   4e-103   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       321   4e-103   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             321   5e-103   
ref|XP_010437350.1|  PREDICTED: peroxidase 49-like                      322   5e-103   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      321   6e-103   
ref|XP_007011229.1|  Peroxidase superfamily protein                     321   6e-103   
ref|XP_004145303.1|  PREDICTED: cationic peroxidase 1-like              321   6e-103   
emb|CDX75574.1|  BnaA01g01280D                                          321   6e-103   
ref|XP_010254703.1|  PREDICTED: peroxidase 72-like                      321   6e-103   
gb|AAR31108.1|  peroxidase precursor                                    321   6e-103   
gb|EMT08941.1|  Peroxidase 72                                           321   7e-103   
ref|XP_006412001.1|  hypothetical protein EUTSA_v10025683mg             321   7e-103   
ref|XP_006284092.1|  hypothetical protein CARUB_v10005221mg             321   8e-103   
dbj|BAJ94853.1|  predicted protein                                      321   9e-103   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         321   9e-103   
emb|CAA71492.1|  peroxidase                                             320   1e-102   
emb|CDX69223.1|  BnaC01g02300D                                          320   1e-102   
ref|XP_007206842.1|  hypothetical protein PRUPE_ppa027053mg             320   1e-102   
ref|XP_004288061.1|  PREDICTED: peroxidase 10-like                      320   1e-102   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              320   2e-102   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       320   2e-102   
ref|XP_009396319.1|  PREDICTED: peroxidase 72-like                      320   2e-102   
ref|XP_003561851.1|  PREDICTED: peroxidase A2-like                      320   2e-102   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       321   2e-102   
ref|XP_010535901.1|  PREDICTED: peroxidase E5-like                      321   2e-102   
ref|XP_002521844.1|  Peroxidase 10 precursor, putative                  320   2e-102   
ref|XP_008440251.1|  PREDICTED: peroxidase 10                           320   2e-102   
ref|NP_195361.1|  peroxidase 49                                         320   2e-102   
gb|KFK30268.1|  hypothetical protein AALP_AA7G239300                    320   2e-102   
ref|XP_002974373.1|  hypothetical protein SELMODRAFT_101253             320   2e-102   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              319   2e-102   
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           319   2e-102   
ref|XP_010924103.1|  PREDICTED: peroxidase 72-like                      320   2e-102   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           319   3e-102   
ref|XP_001769208.1|  predicted protein                                  320   3e-102   
gb|EMT23111.1|  Peroxidase 72                                           320   3e-102   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    319   3e-102   
emb|CDY02820.1|  BnaC02g10690D                                          319   3e-102   
ref|XP_003566714.1|  PREDICTED: peroxidase 72-like                      320   3e-102   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           319   3e-102   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       319   3e-102   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      319   3e-102   
ref|XP_007014789.1|  Peroxidase superfamily protein, putative           320   3e-102   
ref|XP_002304018.2|  hypothetical protein POPTR_0003s21600g             320   4e-102   
ref|XP_002873275.1|  peroxidase                                         319   4e-102   
ref|XP_010058186.1|  PREDICTED: peroxidase A2-like                      319   4e-102   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              319   4e-102   
ref|XP_002521512.1|  Peroxidase 72 precursor, putative                  319   4e-102   
ref|XP_008784965.1|  PREDICTED: peroxidase 72-like                      319   4e-102   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       319   4e-102   
ref|XP_008228153.1|  PREDICTED: peroxidase 15-like                      319   4e-102   
gb|KHG02293.1|  Peroxidase 15                                           320   4e-102   
gb|ACU17608.1|  unknown                                                 318   5e-102   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      318   5e-102   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        318   5e-102   
ref|XP_002306459.2|  peroxidase family protein                          318   5e-102   
dbj|BAA11853.1|  peroxidase                                             319   5e-102   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       318   6e-102   
ref|XP_007048724.1|  Peroxidase superfamily protein                     318   6e-102   
ref|XP_004967774.1|  PREDICTED: peroxidase 72-like                      320   6e-102   
ref|XP_006342215.1|  PREDICTED: peroxidase 10-like                      320   6e-102   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      318   6e-102   
gb|KEH37050.1|  peroxidase family protein                               319   6e-102   
ref|XP_002455406.1|  hypothetical protein SORBIDRAFT_03g010250          319   6e-102   
ref|NP_001148509.1|  peroxidase 72 precursor                            318   7e-102   
gb|AFK35177.1|  unknown                                                 319   7e-102   
ref|XP_003616748.1|  Peroxidase                                         318   8e-102   
gb|KHG18057.1|  Peroxidase 52 -like protein                             318   8e-102   
gb|ABR17480.1|  unknown                                                 319   9e-102   
gb|KFK27367.1|  hypothetical protein AALP_AA8G373800                    318   9e-102   
ref|XP_002987834.1|  hypothetical protein SELMODRAFT_235371             317   1e-101   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             318   1e-101   
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              318   1e-101   
dbj|BAD97439.1|  peroxidase                                             319   1e-101   
ref|XP_010058158.1|  PREDICTED: peroxidase A2-like                      318   1e-101   
ref|XP_004288062.1|  PREDICTED: peroxidase 10-like                      318   1e-101   
ref|XP_010936646.1|  PREDICTED: peroxidase 72-like                      318   1e-101   
ref|XP_010519956.1|  PREDICTED: peroxidase E5                           318   1e-101   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             317   2e-101   
ref|XP_004238604.1|  PREDICTED: peroxidase 10-like                      318   2e-101   
ref|XP_009386276.1|  PREDICTED: peroxidase A2-like                      318   2e-101   
gb|EPS67864.1|  hypothetical protein M569_06908                         317   2e-101   
ref|XP_009417065.1|  PREDICTED: peroxidase 72-like                      318   2e-101   
ref|XP_010275548.1|  PREDICTED: peroxidase 72-like                      318   2e-101   
ref|XP_003566702.1|  PREDICTED: peroxidase 72-like                      318   2e-101   
gb|ACT35473.1|  peroxidase 52                                           317   2e-101   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              317   2e-101   
emb|CAL25300.1|  properoxidase                                          317   2e-101   
ref|XP_009144604.1|  PREDICTED: peroxidase 49-like                      317   2e-101   
ref|XP_011037955.1|  PREDICTED: peroxidase A2-like                      318   2e-101   
emb|CCJ34843.1|  horseradish peroxidase isoenzyme HRP_08562.1           317   2e-101   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             317   2e-101   
gb|AII99873.1|  peroxidase                                              318   2e-101   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             317   2e-101   
ref|XP_007046814.1|  Peroxidase superfamily protein                     317   2e-101   
ref|XP_010252387.1|  PREDICTED: peroxidase 72-like                      317   2e-101   
emb|CDX98835.1|  BnaC09g50000D                                          317   2e-101   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       316   2e-101   
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       317   3e-101   
ref|XP_002299141.2|  hypothetical protein POPTR_0001s04820g             317   3e-101   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            317   3e-101   
ref|XP_004985087.1|  PREDICTED: peroxidase 15-like                      319   3e-101   
gb|AAB47602.1|  peroxidase                                              318   3e-101   
gb|KHN44724.1|  Peroxidase 4                                            317   3e-101   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       317   3e-101   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       316   3e-101   
gb|KHN08835.1|  Peroxidase 4                                            317   4e-101   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     316   4e-101   
ref|XP_003544922.1|  PREDICTED: peroxidase 4                            317   4e-101   
dbj|BAK05179.1|  predicted protein                                      317   4e-101   
ref|XP_002982182.1|  hypothetical protein SELMODRAFT_421525             317   4e-101   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       317   4e-101   
ref|XP_010252386.1|  PREDICTED: peroxidase 72-like                      317   4e-101   
emb|CDX70158.1|  BnaA10g25070D                                          316   4e-101   
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       317   4e-101   
gb|ABK26974.1|  unknown                                                 317   4e-101   
gb|EMT06857.1|  Peroxidase 53                                           317   4e-101   
dbj|BAM28608.1|  putative peroxidase                                    316   4e-101   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       316   4e-101   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            316   4e-101   
gb|ABK25962.1|  unknown                                                 316   4e-101   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       316   4e-101   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              316   5e-101   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              316   5e-101   
ref|XP_004967775.1|  PREDICTED: peroxidase 72-like                      317   5e-101   
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      316   5e-101   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          316   5e-101   
ref|XP_003615995.1|  Peroxidase                                         316   5e-101   
emb|CAA66035.1|  peroxidase                                             317   5e-101   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                316   5e-101   
emb|CAA66034.1|  peroxidase                                             317   6e-101   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           316   6e-101   
ref|XP_011037954.1|  PREDICTED: peroxidase E5-like                      317   6e-101   
ref|XP_002299144.2|  hypothetical protein POPTR_0001s04850g             317   6e-101   
gb|AFK41406.1|  unknown                                                 316   6e-101   



>ref|XP_009759099.1| PREDICTED: peroxidase N [Nicotiana sylvestris]
Length=332

 Score =   487 bits (1254),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 235/305 (77%), Positives = 264/305 (87%), Gaps = 1/305 (0%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CPN+ KVVRKEVQNAIKNEMRMAASLLRLHFHDCFV+GCD S+LLDGNST
Sbjct  26    QLTTDFYSKTCPNVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVSGCDASLLLDGNST  85

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             TSEKF   NLNSARGFEVID+IK+AVE+ACSGVVSCADILAIAARDSVLLSGGP W+VLL
Sbjct  86    TSEKFTPANLNSARGFEVIDNIKTAVENACSGVVSCADILAIAARDSVLLSGGPFWKVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG  ANF+ ++ + LP PFD L+ II+KF AVGLN+TD+V+LSGAHTIGLAKCA F 
Sbjct  146   GRRDGLAANFSGSN-TALPAPFDPLNTIISKFDAVGLNVTDVVSLSGAHTIGLAKCATFD  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PDPTLD +L+ ELQ  CP   DGNNTAPLDRNSTDLFDNHYFKNL+ GR
Sbjct  205   NRLRNFSGTGAPDPTLDTTLVSELQNLCPLTSDGNNTAPLDRNSTDLFDNHYFKNLINGR  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL+SDQ+LFSSD A  T+K LV+TY+N S  FF+DFV SM+KMGNISPL GSDGEIRKN
Sbjct  265   GLLESDQVLFSSDDAIQTTKTLVETYSNSSKFFFSDFVNSMIKMGNISPLVGSDGEIRKN  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVVN  329



>ref|XP_009620838.1| PREDICTED: peroxidase N [Nicotiana tomentosiformis]
Length=332

 Score =   483 bits (1242),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 233/305 (76%), Positives = 261/305 (86%), Gaps = 1/305 (0%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CPN+ KVVRKEVQNAIKNEMRMAASLLRLHFHDCFV+GCD SVLLDGNST
Sbjct  26    QLTTDFYSKTCPNVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVSGCDASVLLDGNST  85

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             TSEKF   NLNSARGFEVID+IK+AVE+AC GVVSCADILAIAARDSVLLSGGP W+VLL
Sbjct  86    TSEKFTPANLNSARGFEVIDNIKTAVENACGGVVSCADILAIAARDSVLLSGGPFWKVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG  AN + ++ + LP PFD L+ II+KF AVGLN+TD+V+LSGAHTIGLAKCA F 
Sbjct  146   GRRDGLAANISGSN-TALPAPFDPLNTIISKFEAVGLNVTDVVSLSGAHTIGLAKCATFD  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD TLD +L+ ELQ  CP   DGNNTAPLDRNSTDLFDNHYFKNL+ GR
Sbjct  205   NRLRNFSGTGAPDTTLDTTLVSELQNLCPLTSDGNNTAPLDRNSTDLFDNHYFKNLINGR  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL+SDQ+LFSSD A  T+K LV+TY+N S  FF+DFV SM+KMGNISPL GSDGEIRKN
Sbjct  265   GLLESDQVLFSSDDAIQTTKTLVETYSNSSQFFFSDFVNSMIKMGNISPLVGSDGEIRKN  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVVN  329



>ref|XP_004228346.1| PREDICTED: peroxidase N-like [Solanum lycopersicum]
Length=330

 Score =   476 bits (1225),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/305 (76%), Positives = 260/305 (85%), Gaps = 1/305 (0%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FYA +CPN+ KVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGS+LLDGNST
Sbjct  27    QLTTDFYAKTCPNVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSLLLDGNST  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             TSEKFA  N+NSARGFEVID+IK AVE ACSGVVSCADILAIAARD+VLLSGGPTW+V L
Sbjct  87    TSEKFAAGNINSARGFEVIDNIKKAVEDACSGVVSCADILAIAARDAVLLSGGPTWKVRL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG + N + A++  LP PF S D II+ F  VGLN+TD+V+LSGAHTIGLAKCA F 
Sbjct  147   GRRDGLVGNISGANSG-LPAPFHSRDTIISMFQDVGLNVTDVVSLSGAHTIGLAKCATFD  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL+NF  +G PD TLD +L+ ELQ  CPS  DGNNTAPLDRNSTDLFDNHYFKNL+  R
Sbjct  206   NRLTNFNGSGEPDTTLDTALVTELQNLCPSTSDGNNTAPLDRNSTDLFDNHYFKNLINQR  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL+SDQILFSS+ A  T+K LV+ Y+N S+ FF+DFV SM+KMGNISPLTGS+GEIRKN
Sbjct  266   GLLESDQILFSSNDAIATTKTLVEIYSNSSSVFFSDFVNSMIKMGNISPLTGSNGEIRKN  325

Query  1163  CRTRN  1177
             CR  N
Sbjct  326   CRVIN  330



>emb|CDP17671.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   473 bits (1218),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 226/305 (74%), Positives = 265/305 (87%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY+++CPNL K+VR EVQ AI NE+RMAASLLRLHFHDCFVNGCD S+LLDG  +
Sbjct  26    QLSIDFYSSTCPNLLKIVRTEVQKAIMNEIRMAASLLRLHFHDCFVNGCDASLLLDG--S  83

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK AVPNLNSARGFEV+D+IK+AVESAC+GVVSCADILAIAARDSVLLSGGP WRVLL
Sbjct  84    NSEKLAVPNLNSARGFEVVDTIKNAVESACAGVVSCADILAIAARDSVLLSGGPAWRVLL  143

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN TAA+ASVLPGPFDS++ IIAKF AVGL++TD+VALSGAHTIGLAKCAVFS
Sbjct  144   GRRDGLVANQTAANASVLPGPFDSVNTIIAKFAAVGLDVTDVVALSGAHTIGLAKCAVFS  203

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             +RL N   TG+PD T+D S++ +LQ+ C    DGNNTAPLDRNS DLFDNHYF+NLL G+
Sbjct  204   SRLFNSSGTGAPDSTMDTSMVSDLQSLCSQTSDGNNTAPLDRNSRDLFDNHYFQNLLSGK  263

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLLQSDQIL+SSDAA +T++++V+ Y+ +S  FF DFV SM+KMGNISPLTGS G+IRKN
Sbjct  264   GLLQSDQILYSSDAAASTTRSIVENYSKNSVLFFNDFVNSMIKMGNISPLTGSSGQIRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVVN  328



>ref|XP_006356455.1| PREDICTED: peroxidase N-like [Solanum tuberosum]
Length=383

 Score =   468 bits (1203),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/305 (76%), Positives = 262/305 (86%), Gaps = 1/305 (0%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FYA +CP++ KVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGS+LLDGNST
Sbjct  80    QLTTDFYAKTCPSVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSLLLDGNST  139

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             TSEKFA  N+NSARGFEVID+IK AVE ACSGVVSCADILAIAARDSVLLSGGPTW+V L
Sbjct  140   TSEKFAAGNINSARGFEVIDNIKKAVEDACSGVVSCADILAIAARDSVLLSGGPTWKVRL  199

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG + N + A++  LP PF SL+ II+ F  VGLN+TD+V+LSGAHTIGLAKCA F 
Sbjct  200   GRRDGLIGNVSGANSG-LPAPFHSLNTIISMFQVVGLNVTDVVSLSGAHTIGLAKCATFD  258

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL+NF  +G PD TLD +L+ ELQ  CPS  DGNNTAPLDRNSTDLFDNHYFKNLL  R
Sbjct  259   NRLTNFSGSGGPDTTLDTTLVTELQNLCPSTSDGNNTAPLDRNSTDLFDNHYFKNLLNQR  318

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL+SDQIL+SS+ A  T+K LV+TY+N S+ FF+DFV SM+KMGNISPLTGS+GEIRKN
Sbjct  319   GLLESDQILYSSNDAIPTTKTLVETYSNSSSVFFSDFVNSMIKMGNISPLTGSNGEIRKN  378

Query  1163  CRTRN  1177
             CR  N
Sbjct  379   CRVIN  383



>ref|XP_007014796.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY32415.1| Peroxidase superfamily protein [Theobroma cacao]
Length=329

 Score =   461 bits (1185),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 219/305 (72%), Positives = 265/305 (87%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CP+L  +VR++VQ+A+K EMRMAASLLRLHFHDCFVNGCD SVLLDG++T
Sbjct  26    QLTTDFYSKTCPSLLSIVRRQVQSAVKTEMRMAASLLRLHFHDCFVNGCDASVLLDGDNT  85

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             T EKFA+PNLNSARGFEV+D+IK+AVE+ACSGVVSCADILAIAARDSV+LSGGPTWRVLL
Sbjct  86    T-EKFALPNLNSARGFEVVDAIKTAVENACSGVVSCADILAIAARDSVVLSGGPTWRVLL  144

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+A+ LP PF++LD II KFV VGLN+TD+V+LSG HTIGLAKCA FS
Sbjct  145   GRRDGLISNATLANAA-LPSPFEALDAIIQKFVNVGLNITDVVSLSGGHTIGLAKCATFS  203

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD T++AS++ +LQ+ CP NGDGN T  LDRNSTDLFDNHYF+NLL G+
Sbjct  204   NRLLNFSGTGAPDTTMEASMLSDLQSFCPVNGDGNKTTVLDRNSTDLFDNHYFQNLLNGK  263

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQIL SS+ A +T+K+LV++Y+++S  FF DF  SM+KMGNISPLTGS+G+IR N
Sbjct  264   GLLGSDQILHSSELATSTTKSLVESYSSNSQLFFQDFANSMIKMGNISPLTGSNGQIRTN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRAVN  328



>ref|XP_011083137.1| PREDICTED: peroxidase N [Sesamum indicum]
Length=325

 Score =   458 bits (1178),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 224/305 (73%), Positives = 256/305 (84%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY+ SCPNL  +VR+EV+NAI+NEMRMAASLLRLHFHDCFVNGCDGSVLLDG  +
Sbjct  23    QLTVDFYSTSCPNLLALVRREVKNAIRNEMRMAASLLRLHFHDCFVNGCDGSVLLDG--S  80

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PNLNSARGFEVID+IKSAVESAC  +VSCADIL IAARDSVLLSGGP+W+VLL
Sbjct  81    DGEKFAAPNLNSARGFEVIDAIKSAVESACPNIVSCADILTIAARDSVLLSGGPSWKVLL  140

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ S LP PF+SLD IIAKF AVGLN TD+VALSG HTIGL++CA FS
Sbjct  141   GRRDGLVSNQTGANLS-LPSPFESLDAIIAKFAAVGLNTTDVVALSGGHTIGLSRCAFFS  199

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             +RLSNF  TG+PD TLD+SLIP+LQ  CP+N DGNNT  LD  S DLFDNHYF NL+ GR
Sbjct  200   DRLSNFSGTGAPDSTLDSSLIPDLQAACPANSDGNNTVALDVTSRDLFDNHYFVNLVNGR  259

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             G+LQSDQ LFSSD A +T+K + Q Y+N+S  FF DFV SM+KMG+ISPLTGS+GEIRKN
Sbjct  260   GILQSDQSLFSSDLALSTTKNIAQLYSNNSAVFFGDFVNSMIKMGSISPLTGSNGEIRKN  319

Query  1163  CRTRN  1177
             CR  N
Sbjct  320   CRVVN  324



>gb|KDO56405.1| hypothetical protein CISIN_1g020050mg [Citrus sinensis]
Length=332

 Score =   456 bits (1174),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 221/306 (72%), Positives = 265/306 (87%), Gaps = 6/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ +CPN+ ++VR+EVQ AIK EMRMAASL+RLHFHDCFVNGCD SVLLDG  +
Sbjct  27    QLSTNFYSKTCPNVLQIVRREVQKAIKVEMRMAASLIRLHFHDCFVNGCDASVLLDG--S  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEKFA PN NSARGFEVID+IK+AVE  CSGVVSCADILAIAARDSVLLSGGPTW+VLL
Sbjct  85    DSEKFAAPNRNSARGFEVIDAIKTAVERQCSGVVSCADILAIAARDSVLLSGGPTWKVLL  144

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSG-AHTIGLAKCAVF  799
             GRRDG +AN T A+A  LP PF+ L+ + AKF AVGLN+TD+V+LSG AHTIGLAKCA F
Sbjct  145   GRRDGLVANQTGANA--LPSPFEGLNILTAKFAAVGLNITDLVSLSGGAHTIGLAKCAFF  202

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRLSNF  TG+PD T+D SL+ EL++ C +NGDGNNTAPLDRNS DLFDNHYF+NL+  
Sbjct  203   SNRLSNFSGTGAPDATMDTSLVSELRSLC-ANGDGNNTAPLDRNSIDLFDNHYFQNLINN  261

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQIL+SSD A++T+K+LV++Y+++SN FFA+FV SM+KMGN+SPLTG++GEIRK
Sbjct  262   KGLLSSDQILYSSDEAKSTTKSLVESYSSNSNLFFANFVNSMIKMGNVSPLTGTNGEIRK  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRAVN  327



>ref|XP_006492728.1| PREDICTED: peroxidase 59-like [Citrus sinensis]
Length=332

 Score =   455 bits (1170),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/306 (72%), Positives = 264/306 (86%), Gaps = 6/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ +CPN+ ++VR+EVQ AIK EMRMAASL+RLHFHDCFVNGCD SVLLDG  +
Sbjct  27    QLSTNFYSKTCPNVLQIVRREVQKAIKVEMRMAASLIRLHFHDCFVNGCDASVLLDG--S  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEKFA PN NSARGFEVID+IK+AVE  CSGVVSCADILAIAARDSVLLSGGPTW+VLL
Sbjct  85    DSEKFAAPNRNSARGFEVIDAIKTAVERQCSGVVSCADILAIAARDSVLLSGGPTWKVLL  144

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSG-AHTIGLAKCAVF  799
             GRRDG +AN T A+A  LP PF+ L+ + AKF AVGLN+TD+V+LSG AHTIGLAKCA F
Sbjct  145   GRRDGLVANQTGANA--LPSPFEGLNILTAKFAAVGLNITDLVSLSGGAHTIGLAKCAFF  202

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRLSNF  TG+PD T+D SL+ EL++ C +NGDGNNT PLDRNS DLFDNHYF+NL+  
Sbjct  203   SNRLSNFSGTGAPDATMDTSLVSELRSLC-ANGDGNNTTPLDRNSIDLFDNHYFQNLINN  261

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQIL+SSD A++T+K+LV++Y+++SN FFA+FV SM+KMGN+SPLTG++GEIRK
Sbjct  262   KGLLSSDQILYSSDEAKSTTKSLVESYSSNSNLFFANFVNSMIKMGNVSPLTGTNGEIRK  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRAVN  327



>ref|XP_004228694.1| PREDICTED: peroxidase N-like isoform X1 [Solanum lycopersicum]
Length=330

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 256/305 (84%), Gaps = 1/305 (0%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY+ +CPNL +VVR+EVQ+AIKNEMRMAASLLRLHFHDCFVNGCD S+LLDGNS+
Sbjct  27    QLTPNFYSKTCPNLLRVVRREVQSAIKNEMRMAASLLRLHFHDCFVNGCDASLLLDGNSS  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             TSEKFA  NLNSARG+EVID+IK+ +E+ C+G+VSCADILAIA RDSVLLSGGP W+VLL
Sbjct  87    TSEKFAPGNLNSARGYEVIDNIKTVLENTCTGIVSCADILAIAVRDSVLLSGGPFWKVLL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG  ANF+ + ++ LP PFD L+ II+KF  VGLNLTD+V+LSGAH+IGLA+C  F 
Sbjct  147   GRRDGLAANFSGS-SNGLPTPFDPLNTIISKFQDVGLNLTDVVSLSGAHSIGLARCTTFD  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T SPD TLD +++ ELQ  CPS  DGNNT PLDRNST+LFDNH+FKNL+ GR
Sbjct  206   NRLRNFNGTSSPDTTLDTTIVSELQNLCPSTSDGNNTTPLDRNSTNLFDNHFFKNLINGR  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL+SDQILFSSD A  T+K LV+TY+N+S  FF DFV SM+KMGNISPL GS+G+IR N
Sbjct  266   GLLESDQILFSSDDAITTTKTLVETYSNNSTFFFNDFVNSMIKMGNISPLIGSNGQIRTN  325

Query  1163  CRTRN  1177
             CR  N
Sbjct  326   CRVIN  330



>gb|KHG30456.1| Peroxidase N [Gossypium arboreum]
Length=332

 Score =   451 bits (1161),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 219/305 (72%), Positives = 261/305 (86%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CP+L   VRK+VQ+AIK EMRMAASLLRLHFHDCFVNGCD SVLLDG+++
Sbjct  29    QLTTDFYSQTCPSLLSTVRKQVQSAIKTEMRMAASLLRLHFHDCFVNGCDASVLLDGDNS  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             T EKFA+ N+NSARGFEVID+IKSAVES+CSGVVSCADILAIAARDSV+LSGGPTWRVLL
Sbjct  89    T-EKFALANVNSARGFEVIDAIKSAVESSCSGVVSCADILAIAARDSVVLSGGPTWRVLL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+A+ LP PF++LD I  KFV VGLN+TD+V+LSG HTIGLAKCA F 
Sbjct  148   GRRDGLVSNGTLANAA-LPSPFEALDAITQKFVDVGLNITDVVSLSGGHTIGLAKCATFD  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD T++A+++ +LQ+ CP NGD N    LDRNSTDLFDNHYFKNLL G+
Sbjct  207   NRLFNFSGTGAPDSTMEATMLADLQSFCPVNGDSNRFTALDRNSTDLFDNHYFKNLLNGK  266

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQIL+SSD A +T+K LV++Y+++S  FF DFV SM+KMGNISPLTG++GEIRKN
Sbjct  267   GLLGSDQILYSSDLAVSTTKNLVESYSSNSILFFNDFVNSMIKMGNISPLTGTNGEIRKN  326

Query  1163  CRTRN  1177
             CR  N
Sbjct  327   CRDVN  331



>ref|XP_007154627.1| hypothetical protein PHAVU_003G134600g [Phaseolus vulgaris]
 gb|ESW26621.1| hypothetical protein PHAVU_003G134600g [Phaseolus vulgaris]
Length=329

 Score =   451 bits (1159),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/305 (72%), Positives = 255/305 (84%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY++SCPNL K+VRKEVQ A+ NEMRM ASLLRLHFHDCFVNGCDGS+LLDG + 
Sbjct  27    QLTTDFYSSSCPNLSKIVRKEVQKALMNEMRMGASLLRLHFHDCFVNGCDGSILLDGGAD  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK A+PNLNS RG+EV+D+IKS+VESACSGVVSCADI+AIAARDSV LSGGP+W+VLL
Sbjct  87    V-EKSAIPNLNSVRGYEVVDTIKSSVESACSGVVSCADIVAIAARDSVFLSGGPSWKVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ S LP PF+SLD II+KF   GLNLTD+V+LSGAHTIG A+C  FS
Sbjct  146   GRRDGTVSNGTLAN-SALPSPFESLDSIISKFSDAGLNLTDVVSLSGAHTIGRARCTFFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLSNF  TGSPD TLD +++ +LQ+ C  NGDGN TA LDRNSTDLFDNHYFKNL  G+
Sbjct  205   NRLSNFSGTGSPDTTLDTAMLSDLQSLC-QNGDGNATAVLDRNSTDLFDNHYFKNLQSGK  263

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A +T+K LV++Y  DS  FF DF+ SM+KMGNI+P TGSDGEIRKN
Sbjct  264   GLLSSDQILFSSDEANSTAKPLVESYIKDSGLFFGDFINSMIKMGNINPKTGSDGEIRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVIN  328



>ref|XP_004295168.1| PREDICTED: peroxidase N-like [Fragaria vesca subsp. vesca]
Length=335

 Score =   444 bits (1143),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  SCP L ++VRKEVQNAIK+EMRMAASLLRLHFHDCFVNGCD S+LLD   
Sbjct  31    AQLSTDFYQQSCPKLLQIVRKEVQNAIKSEMRMAASLLRLHFHDCFVNGCDASLLLD--L  88

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T  EK A+PN+NSARGFEVID+IKS+VES+CSGVVSCADIL IAARDSV+LSGG +W+VL
Sbjct  89    TDGEKSAIPNVNSARGFEVIDAIKSSVESSCSGVVSCADILTIAARDSVVLSGGNSWKVL  148

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+A  LP PFD+LD II+KF  VGLN+TD+V+LSGAHTIGLA C  F
Sbjct  149   LGRRDGLVANQTGANAG-LPSPFDTLDAIISKFANVGLNVTDVVSLSGAHTIGLATCRTF  207

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PD TLD+++  +LQ  CP+  DG NTAPLDRNS DLFDNHYF+NLL G
Sbjct  208   SNRLFNFSGTGAPDSTLDSTMATDLQNQCPTTSDGFNTAPLDRNSRDLFDNHYFQNLLTG  267

Query  980   RGLLQSDQILFSSDAAQNTS-KALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GLL SDQ+LFS DAA+ TS K+LVQ+Y+++SN F  DF  SM+KMG+ISPLTGS GEIR
Sbjct  268   KGLLSSDQLLFSGDAAETTSTKSLVQSYSSNSNLFLTDFANSMIKMGSISPLTGSAGEIR  327

Query  1157  KNCRTRN  1177
             +NCR  N
Sbjct  328   QNCRVLN  334



>ref|XP_003549216.1| PREDICTED: peroxidase N-like [Glycine max]
Length=332

 Score =   444 bits (1142),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 254/305 (83%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LTT FY +SCPN+ K+VR+EV+ A+ NEMRMAASLLRLHFHDCFVNGCDGS+LLDG   
Sbjct  29    ELTTDFYKSSCPNVSKIVRREVKKALTNEMRMAASLLRLHFHDCFVNGCDGSILLDGGDD  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK AVPNLNSARG++V+D+IKS+VES C GVVSCADILAIAARDSV LSGGP+W+VLL
Sbjct  89    -GEKSAVPNLNSARGYDVVDTIKSSVESECDGVVSCADILAIAARDSVFLSGGPSWKVLL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ + LP PFD LD II+KF  +GLNLTD+V+LSGAHTIG A+C +FS
Sbjct  148   GRRDGTVSNGTLANEA-LPAPFDPLDTIISKFANMGLNLTDVVSLSGAHTIGRARCTLFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLSNF  TG+PD TLD  ++ +LQ+ CP NGDGN T  LDRNS+DLFDNHYF+NLL G+
Sbjct  207   NRLSNFSGTGAPDTTLDTDMLSDLQSLCPQNGDGNVTTVLDRNSSDLFDNHYFENLLSGK  266

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A +T+K LVQ+Y+NDS  FF DF  SM+KMGNI+  TG+DGEIRKN
Sbjct  267   GLLSSDQILFSSDEANSTTKPLVQSYSNDSGLFFGDFSNSMIKMGNINIKTGTDGEIRKN  326

Query  1163  CRTRN  1177
             CR  N
Sbjct  327   CRVIN  331



>ref|XP_008361464.1| PREDICTED: peroxidase N-like [Malus domestica]
Length=332

 Score =   444 bits (1141),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 257/307 (84%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP++ K+VR+EV NA+K+EMRMAASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  28    AQLSTDFYKATCPDVLKIVRREVLNAVKSEMRMAASLLRLHFHDCFVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A PNLNSARGFEV+D IKS+VES+CSGVVSCADILAIAARDSVLLSGG +W+VL
Sbjct  86    TDSEKNARPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIAARDSVLLSGGTSWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + A+ S LP P ++LD II+KF AVGLN+TD+V+LSGAHTIGLA+CA F
Sbjct  146   LGRRDGLVANQSGAN-SGLPAPTEALDIIISKFAAVGLNITDVVSLSGAHTIGLARCATF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PD TL+ S++ +LQ  CP   DGNNTAPLDRNSTDLFDNHYF+NL+ G
Sbjct  205   SNRLFNFSGTGAPDSTLEQSMLTDLQNQCPQTSDGNNTAPLDRNSTDLFDNHYFQNLING  264

Query  980   RGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GLL SDQILFSSDAA  T +K+LVQ+Y ++ N F ADF  SM+KMGNISPLTGS GEIR
Sbjct  265   KGLLGSDQILFSSDAAVTTGTKSLVQSYNSNLNLFLADFANSMIKMGNISPLTGSAGEIR  324

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  325   LNCRAVN  331



>gb|KEH32489.1| peroxidase family protein [Medicago truncatula]
Length=330

 Score =   443 bits (1140),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 252/305 (83%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY +SCPNL K+VRKEV  A+KNEMRM ASLLRLHFHDCFVNGCDGS+LLDG   
Sbjct  27    QLTTDFYKSSCPNLTKIVRKEVVKALKNEMRMGASLLRLHFHDCFVNGCDGSILLDGGDD  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK A PN+NS RGF+V+D+IK+AVESACSGVVSCADILAIAARDSVLLSGGP+W V+L
Sbjct  87    F-EKSAFPNINSVRGFDVVDTIKTAVESACSGVVSCADILAIAARDSVLLSGGPSWSVML  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N + A+  VLP PFD LD I++KF  VGLNLTD+V+LSGAHTIG A+CA+FS
Sbjct  146   GRRDGTISNGSLANV-VLPSPFDPLDTIVSKFTNVGLNLTDVVSLSGAHTIGRARCALFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TGSPD TL+  ++ +LQ  CP  GDGN TA LDRNSTDLFDNHY+KNLL G+
Sbjct  205   NRLFNFSGTGSPDSTLETGMLTDLQNLCPQTGDGNTTAVLDRNSTDLFDNHYYKNLLNGK  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQIL S+D A +TSK LVQ+Y +++  FF DFV SM+KMGNI+P TGSDGEIRK+
Sbjct  265   GLLSSDQILISTDEANSTSKPLVQSYNDNATLFFGDFVKSMIKMGNINPKTGSDGEIRKS  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVIN  329



>ref|XP_009364156.1| PREDICTED: peroxidase N-like [Pyrus x bretschneideri]
Length=332

 Score =   443 bits (1139),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP++ K+VR+EV NA+K+EMRMAASLLRLHFHDCFVNGCD S+LLDGN 
Sbjct  28    AQLSTDFYNATCPDVLKIVRREVLNAVKSEMRMAASLLRLHFHDCFVNGCDASLLLDGND  87

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PNLNSARGFEV+D IKS+VES+CSGVVSCADILAIAARDSVLLSGG +W+VL
Sbjct  88    --SEKNARPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIAARDSVLLSGGTSWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+ S LP P ++LD II+KF AVGLN+ D+V+LSGAHTIGLA+CA F
Sbjct  146   LGRRDGLVANQTGAN-SALPAPTEALDIIISKFAAVGLNIRDVVSLSGAHTIGLARCATF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PD T++ S+  +LQ  CP   DGNNTAPLDRNSTDLFDNHYF+NL+ G
Sbjct  205   SNRLFNFSGTGAPDSTMEQSMQTDLQNRCPQTSDGNNTAPLDRNSTDLFDNHYFQNLING  264

Query  980   RGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GLL SDQILFSSD A  T +K+LVQ+Y ++ N F ADF  SM+KMGNISPLTGS GEIR
Sbjct  265   KGLLGSDQILFSSDEAVTTGTKSLVQSYNSNLNLFLADFANSMIKMGNISPLTGSAGEIR  324

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  325   KNCRAVN  331



>gb|KDP34262.1| hypothetical protein JCGZ_12830 [Jatropha curcas]
Length=328

 Score =   442 bits (1137),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 249/305 (82%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL++ FY+ +CP L ++VRKEVQNAIK EMRMAASLLRLHFHDCFVNGCDGSVLLDG  T
Sbjct  26    QLSSDFYSKTCPKLLQIVRKEVQNAIKFEMRMAASLLRLHFHDCFVNGCDGSVLLDG--T  83

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFAV N NSARGFEV+DSIK+AVES CSG+VSCADILAIAARDSVLLSGGP+W+VLL
Sbjct  84    DGEKFAVANRNSARGFEVVDSIKTAVESQCSGIVSCADILAIAARDSVLLSGGPSWKVLL  143

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRD  + N   A+ S LP PF+ LD IIAKF AVGLN+TD+V+LSG HTIG AKCA FS
Sbjct  144   GRRDALIGNQAQANIS-LPSPFEGLDAIIAKFDAVGLNITDVVSLSGGHTIGQAKCATFS  202

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF   G PD TLD S++ +LQ  CP NGDGN T  LDRNSTDLFDNHYF+NL+  +
Sbjct  203   NRLYNFSGPGVPDATLDTSMLSDLQNLCPVNGDGNKTTALDRNSTDLFDNHYFQNLVNNK  262

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSS  A +T+  LVQ+Y++++  FF DF  SM+KMGNISPLTGS+GEIRKN
Sbjct  263   GLLGSDQILFSSAEAVSTTLNLVQSYSSNTKLFFDDFANSMIKMGNISPLTGSNGEIRKN  322

Query  1163  CRTRN  1177
             CR  N
Sbjct  323   CRVVN  327



>ref|XP_004507960.1| PREDICTED: peroxidase N-like [Cicer arietinum]
Length=331

 Score =   441 bits (1134),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 253/305 (83%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY +SCPNLFK+VRKEV  A+ NEMRM ASLLRLHFHDCFVNGCDGSVLLDG   
Sbjct  28    QLTTDFYNSSCPNLFKIVRKEVVKALINEMRMGASLLRLHFHDCFVNGCDGSVLLDGGED  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A+PN+NS RGF+VID+IKS+VE+AC+G VSCADIL IAARDSV LSGGP+W+VLL
Sbjct  88    -SEKSALPNVNSLRGFDVIDTIKSSVENACNGTVSCADILTIAARDSVSLSGGPSWKVLL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N + A+  V+P PFD +D I++KF   GLNLTD+V+LSGAHTIG A+CA+FS
Sbjct  147   GRRDGTISNGSLANL-VIPSPFDPMDTIVSKFTNAGLNLTDVVSLSGAHTIGRARCALFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TGSPD TLD +++ +LQ  CP NGDGN TA LDRNSTDLFDNHYFKNLL G+
Sbjct  206   NRLFNFSGTGSPDSTLDTTMLTDLQNLCPQNGDGNATAVLDRNSTDLFDNHYFKNLLNGK  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A +T+K LVQ+Y N+ + FF DFV SM++MGNI+P  GSDGEIRK+
Sbjct  266   GLLSSDQILFSSDEANSTTKPLVQSYINNGSLFFGDFVKSMIRMGNINPKVGSDGEIRKS  325

Query  1163  CRTRN  1177
             CR  N
Sbjct  326   CRVIN  330



>gb|ACU24431.1| unknown [Glycine max]
Length=332

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 253/305 (83%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LTT FY +SCPN+ K+VR+EV+ A+ NEMRMAASLL LHFHDCFVNGCDGS+LLDG   
Sbjct  29    ELTTDFYKSSCPNVSKIVRREVKKALTNEMRMAASLLCLHFHDCFVNGCDGSILLDGGDD  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK AVPNLNSARG++V+D+IKS+VES C GVVSCADILAIAARDSV LSGGP+W+VLL
Sbjct  89    -GEKSAVPNLNSARGYDVVDTIKSSVESECDGVVSCADILAIAARDSVFLSGGPSWKVLL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ + LP PFD LD II+KF  +GLNLTD+V+LSGAHTIG A+C +FS
Sbjct  148   GRRDGTVSNGTLANEA-LPAPFDPLDTIISKFANMGLNLTDVVSLSGAHTIGRARCTLFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLSNF  TG+PD TLD  ++ +LQ+ CP NGDGN T  LDRNS+DLFDNHYF+NLL G+
Sbjct  207   NRLSNFSGTGAPDTTLDTDMLSDLQSLCPQNGDGNVTTVLDRNSSDLFDNHYFENLLSGK  266

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A +T+K LVQ+Y+NDS  FF DF  SM+KMGNI+  TG+DGEIRKN
Sbjct  267   GLLSSDQILFSSDEANSTTKPLVQSYSNDSGLFFGDFSNSMIKMGNINIKTGTDGEIRKN  326

Query  1163  CRTRN  1177
             CR  N
Sbjct  327   CRVIN  331



>ref|NP_001240914.1| uncharacterized protein LOC100787073 precursor [Glycine max]
 gb|ACU20812.1| unknown [Glycine max]
Length=330

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 252/305 (83%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY +SCPN+ K+VR+EVQ A+ NE+RMAASLLRLHFHDCFVNGCDGS+LLDG   
Sbjct  27    QLTTDFYKSSCPNVSKIVRREVQKALMNEIRMAASLLRLHFHDCFVNGCDGSILLDGGDD  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK A PNLNSARG+EV+D+IKS+VESACSGVVSCADILAIAARDSV LSGGP+W+VLL
Sbjct  87    -GEKSAAPNLNSARGYEVVDTIKSSVESACSGVVSCADILAIAARDSVFLSGGPSWKVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ + LP PFD LD II+KF  +GLNLTD+V+LSGAHTIG A+C +F 
Sbjct  146   GRRDGTVSNGTLANEA-LPSPFDPLDTIISKFTNMGLNLTDVVSLSGAHTIGRARCTLFG  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD TLD  ++ +LQ+ CP NGDGN T  LDRNS+DLFD+HYFKNLL G 
Sbjct  205   NRLFNFSGTGAPDSTLDTDMLSDLQSLCPQNGDGNVTTVLDRNSSDLFDSHYFKNLLSGM  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A +T+K LVQ+Y+NDS  FF DF  SM+KMGNI+  TG++GEIRKN
Sbjct  265   GLLSSDQILFSSDEANSTTKPLVQSYSNDSGLFFGDFANSMIKMGNINIKTGTNGEIRKN  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVIN  329



>ref|XP_003549220.1| PREDICTED: peroxidase N isoform X1 [Glycine max]
Length=331

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 251/305 (82%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY +SCPNL K+VR+EVQ A+ NE+RMAASLLRLHFHDCFVNGCDGS+LLDG   
Sbjct  27    QLTTDFYKSSCPNLSKIVRREVQKALMNEIRMAASLLRLHFHDCFVNGCDGSILLDGGDD  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK A PNLNSARG+EV+D+IKS+VESACSGVVSCADILAIAARDSV LSGGP W+V L
Sbjct  87    -GEKSAAPNLNSARGYEVVDTIKSSVESACSGVVSCADILAIAARDSVFLSGGPFWKVPL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A   VLP PFD L+ II+KF  +GLNLTD+V+LSGAHTIG A+C +FS
Sbjct  146   GRRDGTVSNGTLA-TEVLPAPFDPLNTIISKFTNMGLNLTDVVSLSGAHTIGRARCTLFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD TL+  ++ +LQ+ CP NGDGN T  LDRNS+DLFD HYFKNLL G+
Sbjct  205   NRLFNFSGTGAPDSTLETGMLSDLQSLCPQNGDGNVTTVLDRNSSDLFDIHYFKNLLSGK  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A +T+K LVQ+Y+NDS +FF DF  SM+KMGNI+  TG+DGEIRKN
Sbjct  265   GLLSSDQILFSSDEANSTTKPLVQSYSNDSGQFFGDFANSMIKMGNINIKTGTDGEIRKN  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVIN  329



>ref|XP_009376683.1| PREDICTED: peroxidase 59-like [Pyrus x bretschneideri]
Length=332

 Score =   439 bits (1128),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP+LFK+VR+EVQNA+K+EMRMAASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  28    AQLSTDFYKATCPDLFKIVRREVQNAVKSEMRMAASLLRLHFHDCFVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A PNLNSARGFEV+D IKS+VES+C+GVVSCADILAIAARDSVLLSGG  W+VL
Sbjct  86    TGSEKDAGPNLNSARGFEVVDRIKSSVESSCNGVVSCADILAIAARDSVLLSGGSLWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+ + LP PF++LD II+KF AVGLN+ D+V+LSGAHTIGLA+C  F
Sbjct  146   LGRRDGLVANQTGANRA-LPAPFEALDSIISKFAAVGLNVNDVVSLSGAHTIGLARCGTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              +RL NF  TG+PD TL+ S++ +LQ  CP   DG+ TAP DR S DLFDNHYF+NL+ G
Sbjct  205   RDRLFNFSGTGAPDITLEQSMLTDLQHLCPLTADGSITAPFDRKSADLFDNHYFQNLING  264

Query  980   RGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GL+ SDQILFSSDAA  T +K+LVQ+Y ++ NRFFADF  SM+KMGNISPLTGS GEIR
Sbjct  265   KGLISSDQILFSSDAAVTTGTKSLVQSYNSNINRFFADFANSMIKMGNISPLTGSAGEIR  324

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  325   KNCRAVN  331



>ref|XP_007206866.1| hypothetical protein PRUPE_ppb006944mg [Prunus persica]
 gb|EMJ08065.1| hypothetical protein PRUPE_ppb006944mg [Prunus persica]
Length=332

 Score =   436 bits (1122),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 252/307 (82%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP+L K+VR+EV NAIK EMRMAASLLRLHFHDCFVNGCD S+LLD   
Sbjct  28    AQLSTDFYKATCPDLLKIVRREVLNAIKTEMRMAASLLRLHFHDCFVNGCDASLLLD--V  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A+PNLNSARGFEV+D IKS+VESACSGVVSCADILAIAARDSV+LSGG  W+VL
Sbjct  86    TDSEKAALPNLNSARGFEVVDRIKSSVESACSGVVSCADILAIAARDSVVLSGGTPWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+   LP PF++LD II+KF  VGL++ D+V+LSG HTIGLAKC+ F
Sbjct  146   LGRRDGLVANQTGANNG-LPSPFETLDVIISKFATVGLDVKDVVSLSGGHTIGLAKCSTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TGSPD TLD S++ +LQ  CP  GDG+NTAP DRNS DLFDNHYF+NL+ G
Sbjct  205   SNRLFNFSGTGSPDSTLDQSMLTDLQNLCPLTGDGSNTAPFDRNSADLFDNHYFQNLING  264

Query  980   RGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GLL SDQILFSSDAA  T +K+LV +Y+++S  F +DF  SMVKMGNISPLTGS GEIR
Sbjct  265   KGLLGSDQILFSSDAAVTTNTKSLVLSYSSNSRLFLSDFADSMVKMGNISPLTGSAGEIR  324

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  325   KNCRLVN  331



>ref|XP_010265936.1| PREDICTED: peroxidase N [Nelumbo nucifera]
Length=333

 Score =   436 bits (1121),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 253/307 (82%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL++ FY ++CPNL K+VRK+V  AI NE+RMAASLLRLHFHDCFVNGCD SVLLDG  +
Sbjct  30    QLSSDFYNSTCPNLLKIVRKQVNTAIMNEIRMAASLLRLHFHDCFVNGCDASVLLDG--S  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK AVPNLNSARGF+VID+IKSAVES C GVVSCADILAIAARDSVLLSGGP+W+VLL
Sbjct  88    DSEKLAVPNLNSARGFDVIDTIKSAVESECPGVVSCADILAIAARDSVLLSGGPSWKVLL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP PF+S+D+I AKF AVGLNLTD+V+LSG HTIGLA+CA FS
Sbjct  148   GRRDGLVANQTGANNG-LPSPFESVDEIAAKFAAVGLNLTDVVSLSGGHTIGLARCATFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
              RL NF  TG+PD T++  ++ +LQ  CP +GDGN T  LDRNSTDLFDNHYFKNLL  +
Sbjct  207   TRLFNFSGTGAPDTTMNTDMVTDLQNLCPQSGDGNKTTALDRNSTDLFDNHYFKNLLNAK  266

Query  983   GLLQSDQILFSSDAAQ--NTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             GLL SDQ LFS+ ++Q  +T+KALV++Y+N S  FF DFV SM+KMGNISPLTG++G+IR
Sbjct  267   GLLFSDQNLFSNTSSQAGSTTKALVESYSNSSKLFFQDFVNSMIKMGNISPLTGTNGQIR  326

Query  1157  KNCRTRN  1177
              NC   N
Sbjct  327   NNCSVVN  333



>ref|XP_010316021.1| PREDICTED: peroxidase N-like isoform X2 [Solanum lycopersicum]
Length=323

 Score =   435 bits (1119),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/305 (69%), Positives = 250/305 (82%), Gaps = 8/305 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY+ +CPNL +VVR+EVQ+AIKNEMRMAASLLRLHFHDCFVNGCD S+LLDGNS+
Sbjct  27    QLTPNFYSKTCPNLLRVVRREVQSAIKNEMRMAASLLRLHFHDCFVNGCDASLLLDGNSS  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             TSEKFA  NLNSARG+EVID+IK+ +E+ C+G+VSCADILAIA       SGGP W+VLL
Sbjct  87    TSEKFAPGNLNSARGYEVIDNIKTVLENTCTGIVSCADILAIA-------SGGPFWKVLL  139

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG  ANF+ + ++ LP PFD L+ II+KF  VGLNLTD+V+LSGAH+IGLA+C  F 
Sbjct  140   GRRDGLAANFSGS-SNGLPTPFDPLNTIISKFQDVGLNLTDVVSLSGAHSIGLARCTTFD  198

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T SPD TLD +++ ELQ  CPS  DGNNT PLDRNST+LFDNH+FKNL+ GR
Sbjct  199   NRLRNFNGTSSPDTTLDTTIVSELQNLCPSTSDGNNTTPLDRNSTNLFDNHFFKNLINGR  258

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL+SDQILFSSD A  T+K LV+TY+N+S  FF DFV SM+KMGNISPL GS+G+IR N
Sbjct  259   GLLESDQILFSSDDAITTTKTLVETYSNNSTFFFNDFVNSMIKMGNISPLIGSNGQIRTN  318

Query  1163  CRTRN  1177
             CR  N
Sbjct  319   CRVIN  323



>ref|XP_010087404.1| Peroxidase 59 [Morus notabilis]
 gb|EXB29014.1| Peroxidase 59 [Morus notabilis]
Length=334

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 249/305 (82%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY  +CP L  +VRK + NA+K EMRMAASL+RLHFHDCFVNGCD S+LLDG   
Sbjct  31    QLTTDFYYKTCPKLGMIVRKGLFNALKTEMRMAASLIRLHFHDCFVNGCDASLLLDGED-  89

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A PNLNSARGFEVID+IKSAVES CSGVVSCADILA+AARDSVLLSGG +WRVLL
Sbjct  90    -SEKLAGPNLNSARGFEVIDTIKSAVESECSGVVSCADILALAARDSVLLSGGRSWRVLL  148

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+  +LP PFDSL+ II KF+  GLN+TD+VALSGAHTIG AKCA F+
Sbjct  149   GRRDGLVANKTGANI-LLPSPFDSLETIITKFLNPGLNITDVVALSGAHTIGQAKCAFFN  207

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+ DPTL+ +++ +LQ+ CP N DGN T  LDRNSTDLFDNHYF NLL+G+
Sbjct  208   NRLFNFSGTGAGDPTLETTMLNDLQSLCPLNEDGNKTTALDRNSTDLFDNHYFTNLLVGK  267

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSS AA NT+K+LV++Y+ + + F  DFV SM KMGNISPLTGS GEIRKN
Sbjct  268   GLLSSDQILFSSAAAVNTTKSLVESYSTNPDLFLEDFVNSMRKMGNISPLTGSAGEIRKN  327

Query  1163  CRTRN  1177
             CR  N
Sbjct  328   CRVVN  332



>ref|XP_002285642.1| PREDICTED: peroxidase N isoform X2 [Vitis vinifera]
Length=332

 Score =   435 bits (1118),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 247/305 (81%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY  SCPNL  +VRK V+NAIK E RMAASL+RLHFHDCFVNGCDGSVLLDG+  
Sbjct  30    QLTTDFYNESCPNLLTIVRKAVKNAIKTETRMAASLVRLHFHDCFVNGCDGSVLLDGSD-  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EK A+PNLNS RGF+V+D+IKS+VESAC GVVSCADILAIAARDSVLLSGG TW+V L
Sbjct  89    -GEKSALPNLNSVRGFDVVDTIKSSVESACPGVVSCADILAIAARDSVLLSGGNTWKVFL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP P DSLD I  KF  VGLN TD+V+LSGAHTIGLA+C  FS
Sbjct  148   GRRDGLVANQTGANNG-LPFPTDSLDTITQKFANVGLNQTDVVSLSGAHTIGLARCTTFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             +RL NF  TG+ D T+D  ++ +LQT CP +GDGN T  LD+NSTDLFDNHYFKNLL+G+
Sbjct  207   SRLFNFSGTGAADSTMDTEMVSDLQTLCPQSGDGNTTTSLDQNSTDLFDNHYFKNLLVGK  266

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILF+ DAA +T+K+LVQ Y++DS  FF+DF  SM+KMGNI+P TGS+GEIR N
Sbjct  267   GLLSSDQILFTGDAAASTTKSLVQNYSSDSGLFFSDFTNSMIKMGNINPKTGSNGEIRTN  326

Query  1163  CRTRN  1177
             CR  N
Sbjct  327   CRVVN  331



>ref|XP_008351692.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 59-like [Malus domestica]
Length=332

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 251/307 (82%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP+LFK+VR+EVQNA+K EMRM  SLLRLHFHDC VNGCD S+LLDG  
Sbjct  28    AQLSTDFYKATCPDLFKIVRREVQNAVKFEMRMXCSLLRLHFHDCLVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A PNLNSARGFEV+D IKS+VES+CSGVVSCADILAIAARDSVLLSGG +W+VL
Sbjct  86    TGSEKDAGPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIAARDSVLLSGGTSWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+ + LP PF++LD II+KF AVGLN+ D+V+LSGAHTIGLA+C  F
Sbjct  146   LGRRDGLVANQTGANRA-LPAPFEALDSIISKFAAVGLNVNDVVSLSGAHTIGLARCGTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              +RL NF  TG+PD TL+ S++ +LQ  CP   DG+ TAP DR S DLFDNHYF+NL+ G
Sbjct  205   RDRLFNFAGTGAPDITLEQSMLTDLQHLCPLTADGSITAPFDRKSADLFDNHYFQNLING  264

Query  980   RGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GL+ SDQILFSSD A  T +K+LVQ+Y ++ NRFFADF  SM+KMGNISPLTGS GEIR
Sbjct  265   KGLISSDQILFSSDTAVTTGTKSLVQSYNSNINRFFADFANSMIKMGNISPLTGSAGEIR  324

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  325   KNCRAVN  331



>ref|XP_008228270.1| PREDICTED: peroxidase 59 [Prunus mume]
Length=333

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 252/308 (82%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP+L K+VR+EV +AIK EMRMAASLLRLHFHDCFVNGCD S+LLD  +
Sbjct  28    AQLSTDFYRATCPDLLKIVRREVLSAIKTEMRMAASLLRLHFHDCFVNGCDASLLLD--A  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A PNLNSARGFEV+D IKS+VESACSGVVSCADILAIAARDSV+LSGG +W+VL
Sbjct  86    TDSEKAAAPNLNSARGFEVVDRIKSSVESACSGVVSCADILAIAARDSVVLSGGTSWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+   LP PF++LD II+KF  VGL++ D+V+LSG HTIGLAKC+ F
Sbjct  146   LGRRDGLVANQTGANNG-LPSPFETLDVIISKFATVGLDVKDVVSLSGGHTIGLAKCSTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDG-NNTAPLDRNSTDLFDNHYFKNLLI  976
             SNRL NF  TGSPD TL+ S++ +LQ  CP  GDG NNTA  DRNS DLFDNHYF+NL+ 
Sbjct  205   SNRLFNFSGTGSPDSTLEQSMLTDLQNLCPRTGDGSNNTAAFDRNSADLFDNHYFQNLIN  264

Query  977   GRGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             G+GLL SDQILFSSDAA  T +K+LVQ+Y+++S  F  DF  SMVKMGNISPLTGS GEI
Sbjct  265   GKGLLGSDQILFSSDAAVTTNTKSLVQSYSSNSGLFLRDFADSMVKMGNISPLTGSAGEI  324

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  325   RKNCRLVN  332



>ref|XP_009390336.1| PREDICTED: peroxidase 59-like [Musa acuminata subsp. malaccensis]
Length=330

 Score =   430 bits (1106),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 250/305 (82%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY  SCPN+FKVVR+ V NA+KNEMRMAASLLRLHFHDCFVNGCDGS+LLDG  +
Sbjct  29    QLTTDFYVTSCPNVFKVVRRVVVNALKNEMRMAASLLRLHFHDCFVNGCDGSILLDG--S  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PN+NSARGF+V+DSIK+AVE+ C+G VSCADILAIAARDSV+LSGGPTW+VLL
Sbjct  87    DGEKFAFPNINSARGFDVVDSIKTAVENECNGTVSCADILAIAARDSVVLSGGPTWKVLL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+++ LP PFDS++ II KF AVGLN TD+VALSG HTIGLA+C  F+
Sbjct  147   GRRDGLVANQTGANSN-LPSPFDSINTIITKFAAVGLNTTDVVALSGGHTIGLARCVTFN  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLSNF  T S DPTLD+S+  +LQ  C  + DGN T  LDRNSTD+FDNHYFKNLL  +
Sbjct  206   NRLSNFSTTESVDPTLDSSMAADLQGLCSQSSDGNATTALDRNSTDVFDNHYFKNLLSQK  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD     ++ LVQ Y+N S+ FF+DFV SM+KMG+ISPLTGS GEIR+N
Sbjct  266   GLLSSDQGLFSSDEGVAATEGLVQIYSNSSSAFFSDFVISMIKMGSISPLTGSAGEIRRN  325

Query  1163  CRTRN  1177
             CR  N
Sbjct  326   CRAVN  330



>ref|XP_010541735.1| PREDICTED: peroxidase N [Tarenaya hassleriana]
Length=328

 Score =   429 bits (1103),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 252/306 (82%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FYA SCPNLF+VVRK+V  A+K E+RMAASL+RLHFHDCFVNGCD S+LLDGN+ 
Sbjct  24    QLNPYFYAQSCPNLFQVVRKQVMTALKAEIRMAASLIRLHFHDCFVNGCDASILLDGNN-  82

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN+NSARG+EVIDSIK+AVE+AC GVVSCADILAIAARDSVLLSGGP+WRV L
Sbjct  83    -GEKFAIPNVNSARGYEVIDSIKTAVENACPGVVSCADILAIAARDSVLLSGGPSWRVPL  141

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN ++A+   LP PFD LD +I+KF AVGLN+TD+VALSGAHT G AKC +FS
Sbjct  142   GRRDGLVANQSSANN--LPSPFDPLDVLISKFQAVGLNITDVVALSGAHTFGQAKCDLFS  199

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD TL+ +++ +LQ+ CP  G+GN T  LDRNSTDLFDNHYFKN+L G+
Sbjct  200   NRLFNFSGTGAPDTTLETTVLSDLQSFCPVGGNGNRTTSLDRNSTDLFDNHYFKNILEGK  259

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNI-SPLTGSDGEIRK  1159
             GLL SDQILFSSD A NT+K+LV  Y ++   FF DF +SMV+MGNI +P+  S+GEIRK
Sbjct  260   GLLSSDQILFSSDLATNTTKSLVVAYGSNQTLFFMDFTSSMVRMGNIMNPVNESNGEIRK  319

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  320   NCRVIN  325



>ref|XP_010043876.1| PREDICTED: peroxidase N [Eucalyptus grandis]
Length=334

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 248/307 (81%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ SCPNL  +VRKEVQNAIK E RM ASLLRLHFHDCFVNGCDGSVLLDG  +
Sbjct  29    QLTTDFYSTSCPNLLSIVRKEVQNAIKAETRMGASLLRLHFHDCFVNGCDGSVLLDG--S  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PNLNSARGF+V+D+IK+AVES+CSGVVSCADILAIAARDSVLLSGGPTW+V L
Sbjct  87    DGEKFAGPNLNSARGFDVVDNIKTAVESSCSGVVSCADILAIAARDSVLLSGGPTWKVPL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T ++   LP PFD LD II+KF AVGLN+TD+VALSG HTIGLA+CA FS
Sbjct  147   GRRDGLVANQTGSNNG-LPAPFDPLDTIISKFAAVGLNVTDVVALSGGHTIGLARCATFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF      DPTLD ++  +LQ+ CP NGDGN T  LDRNSTDLFDNHYFKNL + +
Sbjct  206   NRLFNFSANSGSDPTLDTTMTSDLQSLCPVNGDGNKTTALDRNSTDLFDNHYFKNLAVNK  265

Query  983   GLLQSDQILF--SSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             GLL SDQ+L+   S  A +T+K+LV++Y ++ N F  DF  SM+KMG+ISPLTGS GEIR
Sbjct  266   GLLSSDQVLYSGDSSTASSTTKSLVESYGSNPNLFITDFTNSMIKMGSISPLTGSKGEIR  325

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  326   KNCRVVN  332



>gb|AHL39128.1| class III peroxidase [Populus trichocarpa]
Length=326

 Score =   427 bits (1099),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/305 (69%), Positives = 244/305 (80%), Gaps = 5/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CPNL ++VR+EVQ AIK E RMAASL+RLHFHDCFVNGCD SVLLDGN  
Sbjct  26    QLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLDGND-  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN+NSARGFEV+D+IK+AVES CSGVVSCADILAIAARDSVLLSGG +WRVLL
Sbjct  85    -GEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILAIAARDSVLLSGGKSWRVLL  143

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+A  LP PF+ +D II KF AVGLN+ D+VALSGAHTIG A+CA F+
Sbjct  144   GRRDGLVANQTGANAK-LPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARCATFN  202

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD T+++S++ +LQ  CP   DGN T  LDRNSTDLFD HYF+NLL  +
Sbjct  203   NRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGNKTTVLDRNSTDLFDIHYFQNLLNNK  262

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSS     T+KALVQTY+ + N F  DF  SM+KMGNISPLTGS GEIRK 
Sbjct  263   GLLSSDQELFSS--TNLTTKALVQTYSTNQNLFLNDFANSMIKMGNISPLTGSSGEIRKK  320

Query  1163  CRTRN  1177
             C   N
Sbjct  321   CSVVN  325



>ref|XP_011025200.1| PREDICTED: peroxidase N [Populus euphratica]
Length=326

 Score =   426 bits (1095),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 243/305 (80%), Gaps = 5/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CPNL ++VR+EVQ AIK E RMAASL+RLHFHDCFVNGCD SVLLDGN  
Sbjct  26    QLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLDGND-  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN+NSARGFEV+D+IK+AVES CSGVVSCADILAIAARDSVLLSGG +WRVLL
Sbjct  85    -GEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILAIAARDSVLLSGGKSWRVLL  143

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+A  LP PF+ +D II KF AVGLN+ D+VALSGAHTIG A+CA F+
Sbjct  144   GRRDGLVANQTGANAK-LPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARCATFN  202

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD T+++S++ +LQ  CP   DGN T  LDRNSTDLFDNHYF+NLL  +
Sbjct  203   NRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGNKTTALDRNSTDLFDNHYFQNLLNSK  262

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSS     T+K LVQ Y+ + N F  DF  SM++MGNISPLTGS GEIRK 
Sbjct  263   GLLSSDQELFSS--TNLTTKVLVQAYSANQNLFLNDFANSMIRMGNISPLTGSSGEIRKK  320

Query  1163  CRTRN  1177
             C   N
Sbjct  321   CSVVN  325



>ref|XP_002304020.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE78999.2| peroxidase family protein [Populus trichocarpa]
Length=326

 Score =   426 bits (1094),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 210/305 (69%), Positives = 243/305 (80%), Gaps = 5/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ +CPNL ++VR+EVQ AIK E RMAASL+RLHFHDCFVNGCD SVLLDGN  
Sbjct  26    QLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLDGND-  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN+NSARGFEV+D+IK+AVES CSGVVSCADIL IAARDSVLLSGG +WRVLL
Sbjct  85    -GEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILTIAARDSVLLSGGKSWRVLL  143

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+A  LP PF+ +D II KF AVGLN+ D+VALSGAHTIG A+CA F+
Sbjct  144   GRRDGLVANQTGANAK-LPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARCATFN  202

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD T+++S++ +LQ  CP   DGN T  LDRNSTDLFD HYF+NLL  +
Sbjct  203   NRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGNKTTVLDRNSTDLFDIHYFQNLLNNK  262

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSS     T+KALVQTY+ + N F  DF  SM+KMGNISPLTGS GEIRK 
Sbjct  263   GLLSSDQELFSS--TNLTTKALVQTYSTNQNLFLNDFANSMIKMGNISPLTGSSGEIRKK  320

Query  1163  CRTRN  1177
             C   N
Sbjct  321   CSVVN  325



>ref|XP_010651318.1| PREDICTED: peroxidase N isoform X1 [Vitis vinifera]
Length=346

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 247/319 (77%), Gaps = 17/319 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY  SCPNL  +VRK V+NAIK E RMAASL+RLHFHDCFVNGCDGSVLLDG  +
Sbjct  30    QLTTDFYNESCPNLLTIVRKAVKNAIKTETRMAASLVRLHFHDCFVNGCDGSVLLDG--S  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLS---------  595
               EK A+PNLNS RGF+V+D+IKS+VESAC GVVSCADILAIAARDSVLLS         
Sbjct  88    DGEKSALPNLNSVRGFDVVDTIKSSVESACPGVVSCADILAIAARDSVLLSVSAGMKLRR  147

Query  596   -----GGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALS  760
                  GG TW+V LGRRDG +AN T A+   LP P DSLD I  KF  VGLN TD+V+LS
Sbjct  148   NPLQSGGNTWKVFLGRRDGLVANQTGANNG-LPFPTDSLDTITQKFANVGLNQTDVVSLS  206

Query  761   GAHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTD  940
             GAHTIGLA+C  FS+RL NF  TG+ D T+D  ++ +LQT CP +GDGN T  LD+NSTD
Sbjct  207   GAHTIGLARCTTFSSRLFNFSGTGAADSTMDTEMVSDLQTLCPQSGDGNTTTSLDQNSTD  266

Query  941   LFDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGN  1120
             LFDNHYFKNLL+G+GLL SDQILF+ DAA +T+K+LVQ Y++DS  FF+DF  SM+KMGN
Sbjct  267   LFDNHYFKNLLVGKGLLSSDQILFTGDAAASTTKSLVQNYSSDSGLFFSDFTNSMIKMGN  326

Query  1121  ISPLTGSDGEIRKNCRTRN  1177
             I+P TGS+GEIR NCR  N
Sbjct  327   INPKTGSNGEIRTNCRVVN  345



>ref|XP_010673530.1| PREDICTED: peroxidase N-like [Beta vulgaris subsp. vulgaris]
Length=330

 Score =   424 bits (1090),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 250/305 (82%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FYA +CPNLF +VR++VQ A+ NEMRMAASLLRLHFHDCFVNGCDGSVLLDG  +
Sbjct  28    QLTADFYATTCPNLFHIVRRQVQIAVMNEMRMAASLLRLHFHDCFVNGCDGSVLLDG--S  85

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A PN NS RGFEV+D+IK+AVES+CSGVVSCADILAIAARDS++LSGG ++RVL+
Sbjct  86    DSEKLAFPNQNSLRGFEVVDTIKTAVESSCSGVVSCADILAIAARDSIVLSGGHSYRVLV  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+ + LP PFD LD +I++F   GLNLTD+VAL GAHTIGLA+CAVFS
Sbjct  146   GRRDGMMANQTGANTN-LPSPFDPLDIVISRFADQGLNLTDVVALQGAHTIGLARCAVFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             +RL NF  +G+ D T+D+SL+ +LQ+ CP NGDGN T  LD+NSTD+FDNHYFKNL+  +
Sbjct  205   SRLFNFSGSGAADSTIDSSLVSQLQSLCPVNGDGNQTTALDQNSTDVFDNHYFKNLINNK  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             G+L SDQ L+SSD A  T+K++V++Y+ +   F  DF+ SM+KMGN++P+TGS G+IR N
Sbjct  265   GILLSDQDLYSSDMANTTTKSIVESYSTNPQLFLTDFIKSMIKMGNVNPITGSSGQIRTN  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVIN  329



>ref|XP_009408603.1| PREDICTED: peroxidase N-like [Musa acuminata subsp. malaccensis]
Length=332

 Score =   421 bits (1082),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 243/306 (79%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FYANSCP +F+VVR+++ +A++N+ RMAASLLRLHFHDCFVNGCDGSVLLDG  +
Sbjct  31    QLSTNFYANSCPAVFRVVRRQLLSALRNDTRMAASLLRLHFHDCFVNGCDGSVLLDG--S  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A+PN NSARGF+VID+IK+AVE+AC+  VSCADIL IAARDSV LSGGP W VLL
Sbjct  89    DSEKLALPNRNSARGFDVIDTIKTAVENACNATVSCADILTIAARDSVYLSGGPYWNVLL  148

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP PFDS+D II KFVAVGLN TD+V+LSG HTIG A+C  FS
Sbjct  149   GRRDGLVANQTGAND--LPSPFDSIDTIIDKFVAVGLNTTDVVSLSGGHTIGRARCVTFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              RL +F +  S DPTLD S+  ELQT CP S GDGN TAPLDRNS   FDNHYFKNL+  
Sbjct  207   GRLYDFSEDSSVDPTLDPSMATELQTLCPQSGGDGNATAPLDRNSNYAFDNHYFKNLVEQ  266

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ LFSSD  Q  +KALVQ Y+N S  FF DFV SM+KMGNISPLT S GEIR+
Sbjct  267   KGLLSSDQGLFSSDEGQAATKALVQAYSNSSILFFRDFVNSMIKMGNISPLTSSAGEIRR  326

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  327   NCRVVN  332



>ref|XP_004142143.1| PREDICTED: peroxidase N-like [Cucumis sativus]
Length=334

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 245/301 (81%), Gaps = 4/301 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  SCPN+ ++VR+EV NA+KN+MRMAASLLRLHFHDCFV+GCD SVLLDG  +
Sbjct  32    QLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFHDCFVSGCDASVLLDG--S  89

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               E+ A+PN+NS RG EV+D+IK+ VE++C GVVSCADIL IAARDSVLLSGGP W+VLL
Sbjct  90    DGEQNALPNINSLRGLEVMDNIKAVVENSCPGVVSCADILTIAARDSVLLSGGPAWKVLL  149

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP PF+SLD II KF+ VGLN+TD+ ALSGAHT G A+CA+F+
Sbjct  150   GRRDGLVANRTGAEE--LPSPFESLDGIIKKFIQVGLNVTDVAALSGAHTFGFARCAMFN  207

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  + SPDPT+++ ++ +LQ  CP   DGN T  LDRNSTDLFDNHY+KNLL  +
Sbjct  208   NRLFNFSGSDSPDPTMESMMVSDLQALCPLTDDGNKTTVLDRNSTDLFDNHYYKNLLNQK  267

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD AQ T+K LV+ Y++++  FF+DFV +M+KMGN+SPLTGS+G+IR N
Sbjct  268   GLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMIKMGNMSPLTGSNGQIRNN  327

Query  1163  C  1165
             C
Sbjct  328   C  328



>ref|XP_004162079.1| PREDICTED: peroxidase N-like [Cucumis sativus]
Length=334

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 245/301 (81%), Gaps = 4/301 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  SCPN+ ++VR+EV NA+KN+MRMAASLLRLHFHDCFV+GCD SVLLDG  +
Sbjct  32    QLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFHDCFVSGCDASVLLDG--S  89

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               E+ A+PN+NS RG EV+D+IK+ VE++C GVVSCADIL IAARDSVLLSGGP W+VLL
Sbjct  90    DGEQNALPNINSLRGLEVMDNIKAVVENSCPGVVSCADILTIAARDSVLLSGGPAWKVLL  149

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP PF+SLD II KF+ VGLN+TD+ ALSGAHT G A+CA+F+
Sbjct  150   GRRDGLVANRTGAEE--LPSPFESLDGIIKKFIQVGLNVTDVAALSGAHTFGFARCAMFN  207

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  + SPDPT+++ ++ +LQ  CP   DGN T  LDRNSTDLFDNHY+KNLL  +
Sbjct  208   NRLFNFSGSDSPDPTMESMMVSDLQALCPLTDDGNKTTVLDRNSTDLFDNHYYKNLLNQK  267

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD AQ T+K LV+ Y++++  FF+DFV +M+KMGN+SPLTGS+G+IR N
Sbjct  268   GLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMIKMGNMSPLTGSNGQIRNN  327

Query  1163  C  1165
             C
Sbjct  328   C  328



>ref|XP_006400553.1| hypothetical protein EUTSA_v10014080mg [Eutrema salsugineum]
 gb|ESQ42006.1| hypothetical protein EUTSA_v10014080mg [Eutrema salsugineum]
Length=331

 Score =   419 bits (1078),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/307 (67%), Positives = 243/307 (79%), Gaps = 5/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+   YA SCPNL ++VRK+V  A+K EMRMAASL+RLHFHDCFVNGCD SVLLDG  
Sbjct  28    AQLSPDIYAKSCPNLMQIVRKQVMVALKAEMRMAASLIRLHFHDCFVNGCDASVLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A+PN+NSARGFEV+D+IK AVE+AC GVVSCADIL +AARDSV LSGGP WRV 
Sbjct  86    TDSEKLAIPNVNSARGFEVVDTIKDAVENACPGVVSCADILTLAARDSVFLSGGPQWRVA  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN ++A+   LP PF+ LD IIAKFVAVGLN++D+VALSGAHT G AKC VF
Sbjct  146   LGRKDGLVANQSSANN--LPSPFEPLDAIIAKFVAVGLNVSDVVALSGAHTFGQAKCDVF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+++L+  LQT CP  G+GN TAPLDRNSTD FDN+YFKNLL G
Sbjct  204   SNRLFNFTGAGTPDATLESTLLSNLQTVCPVGGNGNQTAPLDRNSTDAFDNNYFKNLLEG  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLT-GSDGEIR  1156
             +GLL SDQILFSSD A NT+K LV+ Y+     FF DF  SM++MG I+ L  GS GE+R
Sbjct  264   KGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTCSMIRMGGITNLVNGSSGEVR  323

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  324   KNCRVIN  330



>gb|KGN54106.1| hypothetical protein Csa_4G286310 [Cucumis sativus]
Length=311

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 245/301 (81%), Gaps = 4/301 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  SCPN+ ++VR+EV NA+KN+MRMAASLLRLHFHDCFV+GCD SVLLDG  +
Sbjct  9     QLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFHDCFVSGCDASVLLDG--S  66

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               E+ A+PN+NS RG EV+D+IK+ VE++C GVVSCADIL IAARDSVLLSGGP W+VLL
Sbjct  67    DGEQNALPNINSLRGLEVMDNIKAVVENSCPGVVSCADILTIAARDSVLLSGGPAWKVLL  126

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP PF+SLD II KF+ VGLN+TD+ ALSGAHT G A+CA+F+
Sbjct  127   GRRDGLVANRTGAEE--LPSPFESLDGIIKKFIQVGLNVTDVAALSGAHTFGFARCAMFN  184

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  + SPDPT+++ ++ +LQ  CP   DGN T  LDRNSTDLFDNHY+KNLL  +
Sbjct  185   NRLFNFSGSDSPDPTMESMMVSDLQALCPLTDDGNKTTVLDRNSTDLFDNHYYKNLLNQK  244

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD AQ T+K LV+ Y++++  FF+DFV +M+KMGN+SPLTGS+G+IR N
Sbjct  245   GLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMIKMGNMSPLTGSNGQIRNN  304

Query  1163  C  1165
             C
Sbjct  305   C  305



>ref|XP_008449769.1| PREDICTED: peroxidase N [Cucumis melo]
Length=334

 Score =   416 bits (1070),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 244/301 (81%), Gaps = 4/301 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  SCPN+ ++VR+EV NA+KN+MRMAASLLRLHFHDCFV+GCDGSVLLDG  +
Sbjct  32    QLTVDFYKRSCPNVLRMVRREVINALKNDMRMAASLLRLHFHDCFVSGCDGSVLLDG--S  89

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               E+ A+PN+NS RG EV+D IK+ VE++C GVVSCADIL IAARDSVLLSGGP W+VLL
Sbjct  90    DGEQNALPNINSLRGLEVVDRIKAVVENSCPGVVSCADILTIAARDSVLLSGGPAWKVLL  149

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP PF+SLD I  KF  VGL+ TD+VALSGAHTIG A+CA+F+
Sbjct  150   GRRDGLVANRTGAEE--LPSPFESLDAITKKFNDVGLDTTDVVALSGAHTIGFARCAMFN  207

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  + SPDPT++++++ +LQ  CP   DGN T  LDRNSTDLFDNHY+KNLL  +
Sbjct  208   NRLFNFSGSDSPDPTMESTMVSDLQALCPLTDDGNKTTVLDRNSTDLFDNHYYKNLLNQK  267

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSS+ AQ T+KALV+ Y+++   FF DFV +M+KMGN+SPLTGS+G+IR N
Sbjct  268   GLLGSDQILFSSNEAQTTTKALVEAYSSNVTLFFNDFVKAMIKMGNMSPLTGSNGQIRNN  327

Query  1163  C  1165
             C
Sbjct  328   C  328



>ref|XP_008787878.1| PREDICTED: peroxidase N [Phoenix dactylifera]
Length=328

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 205/305 (67%), Positives = 243/305 (80%), Gaps = 4/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FYA SCP +F VVR+EV  A+ NEMRM ASLLRLHFHDCFVNGCDGSVLLDG  +
Sbjct  28    QLTTDFYATSCPTVFTVVRREVIKALMNEMRMGASLLRLHFHDCFVNGCDGSVLLDG--S  85

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A PN NSARGF+V+D+IK+AVE+ACSG VSCADILAIAARDSV+LSGGP W+VL+
Sbjct  86    NSEKLAFPNRNSARGFDVVDAIKTAVENACSGTVSCADILAIAARDSVVLSGGPAWQVLV  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN + A++  LP P D ++ IIAKF AVGL+ TD+V+LSG HTIG A+CA F+
Sbjct  146   GRRDGLVANLSGANSG-LPAPTDPINTIIAKFNAVGLDTTDVVSLSGGHTIGRARCATFT  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+ DPT+D+++  ELQT C   GDGN T  LD NS D+FDNHYF NLL  +
Sbjct  205   NRLFNFSGTGAADPTMDSTMASELQTLC-RGGDGNATTVLDHNSADVFDNHYFINLLNQK  263

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             G+L SDQ LFSSD     +KALVQTY+++ N+F  DFVTS++KMGNI PLTGS GEIRKN
Sbjct  264   GVLSSDQGLFSSDEGVAATKALVQTYSSNGNQFLKDFVTSIIKMGNIRPLTGSSGEIRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVVN  328



>gb|AFK46680.1| unknown [Lotus japonicus]
Length=331

 Score =   416 bits (1068),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 242/305 (79%), Gaps = 2/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FYA +CP+LF +VR+EVQNA+KNEMRM ASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  28    QLSPYFYAKTCPDLFGIVRREVQNALKNEMRMGASLLRLHFHDCFVNGCDGSILLDGDED  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEKFA PNLNSARGFEVID IKS+VESACSGVVSCADILAIAARDSV LSGGP W V  
Sbjct  88    -SEKFAAPNLNSARGFEVIDRIKSSVESACSGVVSCADILAIAARDSVQLSGGPFWFVPQ  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ S+ P P D+LD II+KF  VGL+  D+V LSG+HTIG AKCA FS
Sbjct  147   GRRDGLVSNGTLANISI-PAPTDTLDTIISKFNNVGLDHKDVVTLSGSHTIGRAKCASFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
              RL NF + G+PD T++   + ELQ  CP +GDGN T+ LD++S D FDNHYFKNLL G+
Sbjct  206   KRLFNFSEIGAPDDTIETDTLTELQNLCPESGDGNITSVLDQDSADQFDNHYFKNLLHGK  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSS+ A  T+K LVQ Y+ +   F  +F  +MVKMGNI+PLTGS+GEIRKN
Sbjct  266   GLLGSDQILFSSEDATATTKPLVQFYSENERFFLMEFAYAMVKMGNINPLTGSEGEIRKN  325

Query  1163  CRTRN  1177
             CR  N
Sbjct  326   CRVVN  330



>ref|XP_008352132.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 59 [Malus domestica]
Length=332

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 246/307 (80%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY  +CP+LFK+VR+EVQNA+K+EMRMAASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  28    AQLSTDFYKATCPDLFKIVRREVQNAVKSEMRMAASLLRLHFHDCFVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A PNLNSARGFEV+D IKS+VES CSGVVSCADILA+AARDSVLLSGG +W+VL
Sbjct  86    TGSEKDAGPNLNSARGFEVVDRIKSSVESLCSGVVSCADILAMAARDSVLLSGGTSWKVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             L RRDG +AN T A+ + LP PF++LD II+KF+ V  ++  +    GAHTIGLA+C  F
Sbjct  146   LXRRDGLVANQTGANRA-LPAPFEALDSIISKFLPVDXSVKGVXLCVGAHTIGLARCGTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              +RL NF  TG+PD TL+ S++ +LQ  CP   DG+ TAP DR S DLFDNHYF+NL+ G
Sbjct  205   RDRLFNFAGTGAPDITLEQSMLTDLQHLCPLTADGSITAPFDRKSADLFDNHYFQNLING  264

Query  980   RGLLQSDQILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             +GL+ SDQILFSSD A  T +K+LVQ+Y ++ NRFFADF  SM+KMGNISPLTGS GEIR
Sbjct  265   KGLISSDQILFSSDTAVTTGTKSLVQSYNSNINRFFADFANSMIKMGNISPLTGSAGEIR  324

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  325   KNCRAVN  331



>ref|XP_002873970.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50229.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 240/306 (78%), Gaps = 6/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+   YA SCPNL ++VR++V  A+K E+RMAASL+RLHFHDCFVNGCD SVLLDG  
Sbjct  28    AQLSFDIYAKSCPNLVQIVRRQVIIALKAEIRMAASLIRLHFHDCFVNGCDASVLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PN+NSARGFEVID+IK AVE+AC GVVSCADIL +AARDSV LSGGP WRV 
Sbjct  86    ADSEKLAIPNINSARGFEVIDTIKDAVENACPGVVSCADILTLAARDSVFLSGGPQWRVA  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN  +A+   LP PF+ LD IIAKFVAV LN+TD+VALSGAHT G AKCAVF
Sbjct  146   LGRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+ SL+  LQT CP  G+ N TAPLDRNSTD FDN+YFKNLL G
Sbjct  204   SNRLFNFTGAGTPDATLETSLLSNLQTVCPLGGNSNTTAPLDRNSTDAFDNNYFKNLLEG  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSSD A NT+K LV+ Y+   N FF DF  SM++MGNI+   G+ GE+RK
Sbjct  264   KGLLSSDQILFSSDLAVNTTKRLVEAYSRSQNLFFRDFTCSMIRMGNIA--NGASGEVRK  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRVIN  327



>ref|XP_010939956.1| PREDICTED: peroxidase N [Elaeis guineensis]
Length=328

 Score =   411 bits (1056),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 205/305 (67%), Positives = 238/305 (78%), Gaps = 4/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FYA SCP +F VVR+EV  A+ NEMRM ASLLRLHFHDCFVNGCDGS+LLDG++ 
Sbjct  28    QLTTDFYATSCPTVFTVVRQEVIKALMNEMRMGASLLRLHFHDCFVNGCDGSILLDGSN-  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A PN NS RGF+V+D+IK+AVE+ C+  VSCADILAIAARDSV LSGGP W+VL+
Sbjct  87    -SEKLAFPNRNSVRGFDVVDTIKAAVENECNDTVSCADILAIAARDSVFLSGGPEWQVLV  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+   LP P DS++ II KF  VGLN TD+V LSG HTIG A+C  FS
Sbjct  146   GRRDGLVANQTGANIG-LPAPTDSINTIITKFNNVGLNTTDVVVLSGGHTIGRARCVTFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T + DPTLD+++  ELQT C   GDGN T  LDRNS DLFDNHY+ NLL  +
Sbjct  205   NRLFNFSSTDATDPTLDSTMASELQTLC-QGGDGNTTTVLDRNSADLFDNHYYINLLNQK  263

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD     +KALVQTY++DS++F  DFVTS++KMGNISPLTGS GEIRKN
Sbjct  264   GLLSSDQGLFSSDEGVAATKALVQTYSSDSSQFMEDFVTSIIKMGNISPLTGSAGEIRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVVN  328



>ref|XP_006828876.1| hypothetical protein AMTR_s00001p00177360 [Amborella trichopoda]
 gb|ERM96292.1| hypothetical protein AMTR_s00001p00177360 [Amborella trichopoda]
Length=325

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/305 (65%), Positives = 243/305 (80%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL++ FY+NSCPNL +VVR++V+ A+K+E RMAASLLRLHFHDCFVNGCD S+LLDG  +
Sbjct  24    QLSSSFYSNSCPNLLQVVREKVKEAVKSETRMAASLLRLHFHDCFVNGCDASLLLDG--S  81

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA  NLNSARGF+V+D+IKSAVE+AC+  VSCADILAIAARD+VLLSGGP+W+VLL
Sbjct  82    DGEKFAGGNLNSARGFDVVDNIKSAVENACNNTVSCADILAIAARDAVLLSGGPSWKVLL  141

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN + A++  LP P +S+ Q++AKFVAVGLN TD+V+LSG HTIG A+C  FS
Sbjct  142   GRRDGLVANRSGANSG-LPTPLESVPQVLAKFVAVGLNATDLVSLSGGHTIGRARCTTFS  200

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             +RL NF  T +PD T++   +  LQ  CP NGDGN T  LD  S DLFD++YFKNLL G+
Sbjct  201   HRLFNFSNTDAPDSTVETDYLATLQGLCPQNGDGNVTTSLDTGSIDLFDSNYFKNLLNGK  260

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLLQ+DQ LFS D A N +K++V++Y N    FF DF  SM+KMGNISPLTGS GEIRKN
Sbjct  261   GLLQTDQELFSGDDAVNVTKSIVESYNNSQGLFFKDFAASMIKMGNISPLTGSSGEIRKN  320

Query  1163  CRTRN  1177
             CR  N
Sbjct  321   CRVVN  325



>pdb|1QGJ|A Chain A, Arabidopsis Thaliana Peroxidase N
 pdb|1QGJ|B Chain B, Arabidopsis Thaliana Peroxidase N
Length=300

 Score =   408 bits (1048),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 241/305 (79%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+   YA SCPNL ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD S+LLDG   
Sbjct  1     QLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHDCFVNGCDASLLLDG--A  58

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A+PN+NSARGFEVID+IK+AVE+AC GVVSCADIL +AARDSV+LSGGP WRV L
Sbjct  59    DSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTLAARDSVVLSGGPGWRVAL  118

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN  +A+   LP PF+ LD IIAKFVAV LN+TD+VALSGAHT G AKCAVFS
Sbjct  119   GRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVFS  176

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF   G+PD TL+ SL+  LQT CP  G+ N TAPLDR++TD FDN+YFKNLL G+
Sbjct  177   NRLFNFTGAGNPDATLETSLLSNLQTVCPLGGNSNITAPLDRSTTDTFDNNYFKNLLEGK  236

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  +M++MGNIS   G+ GE+R N
Sbjct  237   GLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIRMGNIS--NGASGEVRTN  294

Query  1163  CRTRN  1177
             CR  N
Sbjct  295   CRVIN  299



>sp|Q42517.1|PERN_ARMRU RecName: Full=Peroxidase N; AltName: Full=Neutral peroxidase; 
Flags: Precursor [Armoracia rusticana]
 emb|CAA40796.1| peroxidase [Armoracia rusticana]
Length=327

 Score =   409 bits (1051),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 241/306 (79%), Gaps = 6/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+   YA SCPNL ++VR +V+ A+K E+RMAASL+RLHFHDCFVNGCD SVLLDG  
Sbjct  28    AQLSPDIYAKSCPNLLQIVRDQVKIALKAEIRMAASLIRLHFHDCFVNGCDASVLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A+PN+NS RGFEVID+IK+AVE+AC GVVSCADIL +AARDSV LSGGP WRV 
Sbjct  86    TNSEKLAIPNVNSVRGFEVIDTIKAAVENACPGVVSCADILTLAARDSVYLSGGPQWRVA  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN ++A+   LP PF+ LD IIAKF AVGLN+TD+VALSGAHT G AKC +F
Sbjct  146   LGRKDGLVANQSSANN--LPSPFEPLDAIIAKFAAVGLNVTDVVALSGAHTFGQAKCDLF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+ +L+ +LQT CP  G+GN TAPLDRNSTD FDN+YFKNLL G
Sbjct  204   SNRLFNFTGAGTPDSTLETTLLSDLQTVCPIGGNGNKTAPLDRNSTDAFDNNYFKNLLEG  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSSD A NT+K LV+ Y+     FF DF  SM++MG++  + G+ GE+R 
Sbjct  264   KGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTCSMIRMGSL--VNGASGEVRT  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRVIN  327



>emb|CAA67092.1| peroxidase [Arabidopsis thaliana]
Length=328

 Score =   409 bits (1050),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 241/306 (79%), Gaps = 6/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+   YA SCPNL ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD S+LLDG  
Sbjct  28    AQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHDCFVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PN+NSARGFEVID+IK+AVE+AC GVVSCADIL +AARDSV+LSGGP WRV 
Sbjct  86    ADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTLAARDSVVLSGGPGWRVA  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN  +A+   LP PF+ LD IIAKFVAV LN+TD+VALSGAHT G AKCAVF
Sbjct  146   LGRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+ SL+  LQT CP  G+ N TAPLDR++TD FDN+YFKNLL G
Sbjct  204   SNRLFNFTGAGNPDATLETSLLSNLQTVCPLGGNSNITAPLDRSTTDTFDNNYFKNLLEG  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  +M++MGNIS   G+ GE+R 
Sbjct  264   KGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIRMGNIS--NGASGEVRT  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRVIN  327



>gb|AAM65571.1| peroxidase ATP N [Arabidopsis thaliana]
Length=328

 Score =   409 bits (1050),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 241/306 (79%), Gaps = 6/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+   YA SCPNL ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD S+LLDG  
Sbjct  28    AQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHDCFVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PN+NSARGFEVID+IK+AVE+AC GVVSCADIL +AARDSV+LSGGP WRV 
Sbjct  86    ADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTLAARDSVVLSGGPGWRVA  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN  +A+   LP PF+ LD IIAKFVAV LN+TD+VALSGAHT G AKCAVF
Sbjct  146   LGRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+ SL+  LQT CP  G+ N TAPLDR++TD FDN+YFKNLL G
Sbjct  204   SNRLFNFTGAGNPDATLETSLLSNLQTVCPLGGNSNITAPLDRSTTDTFDNNYFKNLLEG  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  +M++MGNIS   G+ GE+R 
Sbjct  264   KGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIRMGNIS--NGASGEVRT  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRVIN  327



>ref|NP_568385.1| peroxidase 59 [Arabidopsis thaliana]
 sp|Q39034.2|PER59_ARATH RecName: Full=Peroxidase 59; Short=Atperox P59; AltName: Full=ATPN; 
AltName: Full=Peroxidase N; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM74498.1| AT5g19890/F28I16_40 [Arabidopsis thaliana]
 gb|AAN18151.1| At5g19890/F28I16_40 [Arabidopsis thaliana]
 gb|AED92762.1| peroxidase 59 [Arabidopsis thaliana]
Length=328

 Score =   408 bits (1048),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 241/306 (79%), Gaps = 6/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+   YA SCPNL ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD S+LLDG  
Sbjct  28    AQLSPDIYAKSCPNLVQIVRKQVAIALKAEIRMAASLIRLHFHDCFVNGCDASLLLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PN+NSARGFEVID+IK+AVE+AC GVVSCADIL +AARDSV+LSGGP WRV 
Sbjct  86    ADSEKLAIPNINSARGFEVIDTIKAAVENACPGVVSCADILTLAARDSVVLSGGPGWRVA  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN  +A+   LP PF+ LD IIAKFVAV LN+TD+VALSGAHT G AKCAVF
Sbjct  146   LGRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+ SL+  LQT CP  G+ N TAPLDR++TD FDN+YFKNLL G
Sbjct  204   SNRLFNFTGLGNPDATLETSLLSNLQTVCPLGGNSNITAPLDRSTTDTFDNNYFKNLLEG  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  +M++MGNIS   G+ GE+R 
Sbjct  264   KGLLSSDQILFSSDLAVNTTKKLVEAYSRSQSLFFRDFTCAMIRMGNIS--NGASGEVRT  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRVIN  327



>gb|KHN17685.1| Peroxidase N [Glycine soja]
Length=275

 Score =   404 bits (1039),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/276 (71%), Positives = 230/276 (83%), Gaps = 2/276 (1%)
 Frame = +2

Query  350   MRMAASLLRLHFHDCFVNGCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVESA  529
             MRMAASLLRLHFHDCFVNGCDGS+LLDG     EK AVPNLNSARG++V+D+IKS+VES 
Sbjct  1     MRMAASLLRLHFHDCFVNGCDGSILLDGGDD-GEKSAVPNLNSARGYDVVDTIKSSVESE  59

Query  530   CSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQII  709
             C GVVSCADILAIAARDSV LSGGP+W+VLLGRRDG ++N T A+ + LP PFD LD II
Sbjct  60    CDGVVSCADILAIAARDSVFLSGGPSWKVLLGRRDGTVSNGTLANEA-LPAPFDPLDTII  118

Query  710   AKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCP  889
             +KF  +GLNLTD+V+LSGAHTIG A+C +FSNRLSNF  TG+PD TLD  ++ +LQ+ CP
Sbjct  119   SKFANMGLNLTDVVSLSGAHTIGRARCTLFSNRLSNFSGTGAPDSTLDTDMLSDLQSLCP  178

Query  890   SNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTND  1069
              NGDGN T  LDRNS+DLFDNHYF+NLL G+GLL SDQILFSSD A +T+K LVQ+Y+ND
Sbjct  179   QNGDGNVTTVLDRNSSDLFDNHYFENLLSGKGLLSSDQILFSSDEANSTTKPLVQSYSND  238

Query  1070  SNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTRN  1177
             S  FF DF  SM+KMGNI+  TG+DGEIRKNCR  N
Sbjct  239   SGLFFGDFANSMIKMGNINIKTGTDGEIRKNCRVIN  274



>emb|CDY42313.1| BnaC02g09190D [Brassica napus]
Length=324

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 237/307 (77%), Gaps = 5/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL    YA SCP L  +VR++V NA+K + RMAASL+RLHFHDCFVNGCD SVLLDG+ 
Sbjct  21    AQLNPNIYAKSCPYLVPIVRRQVMNALKADTRMAASLIRLHFHDCFVNGCDASVLLDGDD  80

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PNLNSARGF+VID+IK+AVE AC GVVSCADIL +AARDSV+LSGGP WRV 
Sbjct  81    --SEKLAIPNLNSARGFDVIDTIKAAVEYACPGVVSCADILTLAARDSVVLSGGPQWRVA  138

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN ++A+   LP PF+ LD I AKFVAVGLN  D+VALSGAHT G AKC VF
Sbjct  139   LGRKDGLVANQSSANN--LPSPFEPLDAITAKFVAVGLNAADVVALSGAHTFGQAKCDVF  196

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   GSPD TL+ +L+ +L+T CP+ G GN TAPLDRNST  FDN+YFKNLL G
Sbjct  197   SNRLFNFDGAGSPDATLETTLLSDLRTVCPAGGSGNQTAPLDRNSTYAFDNNYFKNLLEG  256

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLT-GSDGEIR  1156
             +GLL SDQILFSSD A NT+K LV+ Y+     FF DF  SM+KMG I+ L  GS GE+R
Sbjct  257   KGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTRSMIKMGGITNLVNGSSGEVR  316

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  317   KNCRVIN  323



>ref|XP_010420808.1| PREDICTED: peroxidase N [Camelina sativa]
Length=329

 Score =   405 bits (1041),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 240/305 (79%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL    YA SCP+L ++VR +V  A+  E RMAASL+RLHFHDCFVNGCD S+LLDG  T
Sbjct  30    QLNPDIYAKSCPSLGQIVRNQVTIAMNAEKRMAASLIRLHFHDCFVNGCDASILLDG--T  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A+PNLNSARGFEV+D+IK+AVE+AC GVVSCADIL +AARDSV LSGGP WRV L
Sbjct  88    DSEKLAIPNLNSARGFEVVDTIKAAVENACPGVVSCADILTLAARDSVSLSGGPRWRVAL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN ++A+   LP PF+SLD IIAKFVAVGLN+TD+VALSGAHT G AKC +FS
Sbjct  148   GRKDGLVANQSSANN--LPSPFESLDAIIAKFVAVGLNITDVVALSGAHTFGQAKCDLFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD TL+ SL+  LQ+ CP  G+GN TAPLD  STD FDN+YFKNLL G+
Sbjct  206   NRLFNFTGTGTPDATLETSLLSNLQSVCPLGGNGNITAPLDSGSTDAFDNNYFKNLLQGK  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A NT+K LV+ Y+ +   FF DF  SM++MGNI+   G+ GE+RKN
Sbjct  266   GLLSSDQILFSSDLAVNTTKTLVEAYSRNQYLFFRDFTCSMIRMGNIA--NGASGEVRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVIN  328



>emb|CDX92492.1| BnaA10g15310D [Brassica napus]
Length=327

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 241/306 (79%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+ G Y  SCP L ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD SVLLDG   
Sbjct  25    QLSPGIYDKSCPYLVQIVRKQVNMALKAEIRMAASLIRLHFHDCFVNGCDASVLLDG--A  82

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK ++ N NSARGFEV+D+IK+AVESAC GVVSCADIL +AAR+SV ++GGP WRV L
Sbjct  83    DSEKLSISNANSARGFEVVDTIKAAVESACPGVVSCADILTLAARESVYMTGGPMWRVAL  142

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN ++A+   LP PF+ LD IIAKF AVGLN+TD+VALSGAHT G AKC +F 
Sbjct  143   GRKDGLVANQSSANN--LPSPFEPLDAIIAKFQAVGLNVTDVVALSGAHTFGQAKCDLFR  200

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF   GSPD TL+ +L+ +L+T CP  G+GN TAPLDRNSTD+FDN+YFKNLL G+
Sbjct  201   NRLFNFTGQGSPDATLETTLLSDLRTVCPIGGNGNVTAPLDRNSTDVFDNNYFKNLLQGK  260

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNI-SPLTGSDGEIRK  1159
             GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  SM++MG I +P+ GS GE+RK
Sbjct  261   GLLSSDQILFSSDLAVNTTKRLVEAYSQSQSLFFRDFTCSMIRMGGIMNPINGSSGEVRK  320

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  321   NCRVIN  326



>ref|XP_004513441.1| PREDICTED: peroxidase N-like [Cicer arietinum]
Length=335

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 237/307 (77%), Gaps = 4/307 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY+ +CP+L+ +VR EV NA+K+E+R+AASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  29    QLTPDFYSTTCPDLWNIVRNEVLNAMKDEIRIAASLLRLHFHDCFVNGCDGSILLDGDED  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEKFA PNLNSARGFEVID IK++VE +CSGVVSCADILAIAARDSVLLSGGP W V  
Sbjct  89    -SEKFATPNLNSARGFEVIDKIKNSVERSCSGVVSCADILAIAARDSVLLSGGPFWYVNQ  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ ++ P PFD+LD II+KF  VGLNL D+V LSGAHTIG A+C  FS
Sbjct  148   GRRDGLVSNKTLANLAI-PSPFDTLDTIISKFDNVGLNLKDLVTLSGAHTIGRARCTFFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T  PD TL+  ++ ELQ  CP N DGN T  LD NS DLFDNHYF NL  G+
Sbjct  207   NRLFNFSGTEEPDSTLETEMLIELQNLCPQNEDGNTTTVLDSNSDDLFDNHYFNNLQYGK  266

Query  983   GLLQSDQILFSSDAAQNTS--KALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             GLL SDQILFSSD  + TS  K LVQ Y+++   FF +F  +M KMGNI+PL G +GEIR
Sbjct  267   GLLSSDQILFSSDDDETTSTTKNLVQYYSHNQRIFFMEFAYAMAKMGNINPLVGFEGEIR  326

Query  1157  KNCRTRN  1177
             K+CR  N
Sbjct  327   KDCRVVN  333



>emb|CDY35842.1| BnaC09g37740D [Brassica napus]
Length=331

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 240/306 (78%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+ G Y  SCP L ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD SVLLDG   
Sbjct  29    QLSPGIYDKSCPYLVQIVRKQVTMALKAEIRMAASLIRLHFHDCFVNGCDASVLLDG--A  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK ++PN NSARGFEV+D+IK AVE+AC GVVSCADIL +AAR+SV L+GGP WRV L
Sbjct  87    DSEKLSIPNANSARGFEVVDTIKDAVENACPGVVSCADILTLAARESVYLTGGPMWRVAL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN ++A+   LP PF+ LD IIAKF AVGLN+TD+VALSGAHT G AKC +F 
Sbjct  147   GRKDGLVANQSSANN--LPSPFEPLDAIIAKFQAVGLNVTDVVALSGAHTFGQAKCDLFR  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF   GSPD TL+ +L+ +L+T CP  G+GN TAPLDRNSTD+FDN+YFKNLL G+
Sbjct  205   NRLFNFTGQGSPDATLETTLLSDLRTVCPIGGNGNVTAPLDRNSTDVFDNNYFKNLLQGK  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNI-SPLTGSDGEIRK  1159
             GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  SM++MG I +P  GS GE+RK
Sbjct  265   GLLSSDQILFSSDLAVNTTKRLVEAYSQSQSLFFRDFTCSMIRMGGIMNPANGSSGEVRK  324

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  325   NCRVIN  330



>ref|XP_009126399.1| PREDICTED: peroxidase N-like isoform X1 [Brassica rapa]
 emb|CDY44951.1| BnaA02g04560D [Brassica napus]
Length=324

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 236/307 (77%), Gaps = 5/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL    YA SCP L  +VR++V NA+K + RMAASL+RLHFHDCFVNGCD SVLLDG+ 
Sbjct  21    AQLNPNIYAKSCPYLVLIVRRQVMNALKADTRMAASLIRLHFHDCFVNGCDASVLLDGDD  80

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PNLNSARGFEVID+IK+ VE AC GVVSCADIL +AARDSV+LSGGP WRV 
Sbjct  81    --SEKLAIPNLNSARGFEVIDTIKADVEYACPGVVSCADILTLAARDSVVLSGGPQWRVA  138

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR DG +AN ++A+   LP PF+ LD I AKFVAVGLN+ D+VALSGAHT G AKC VF
Sbjct  139   LGRTDGLVANQSSANN--LPSPFEPLDAITAKFVAVGLNVADVVALSGAHTFGQAKCDVF  196

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   GSPD TL+ +L+ +L+T CP+ G GN TAPLDRNST  FDN+YFKNLL G
Sbjct  197   SNRLFNFDGAGSPDATLETTLLSDLRTVCPAGGSGNQTAPLDRNSTYAFDNNYFKNLLEG  256

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLT-GSDGEIR  1156
             +GLL SDQILFSSD A NT+K LV+ Y+     FF DF  SM+KMG I+ L  GS GE+R
Sbjct  257   KGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTRSMIKMGGITNLVNGSSGEVR  316

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  317   KNCRVIN  323



>gb|KHN06632.1| Peroxidase N [Glycine soja]
Length=278

 Score =   402 bits (1033),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/278 (71%), Positives = 230/278 (83%), Gaps = 2/278 (1%)
 Frame = +2

Query  344   NEMRMAASLLRLHFHDCFVNGCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVE  523
             NE+RMAASLLRLHFHDCFVNGCDGS+LLDG     EK A PNLNSARG+EV+D+IKS+VE
Sbjct  2     NEIRMAASLLRLHFHDCFVNGCDGSILLDGGDD-GEKSAAPNLNSARGYEVVDTIKSSVE  60

Query  524   SACSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQ  703
             SACSGVVSCADILAIAARDSV LSGGP+W+VLLGRRDG  +N T A+ + LP PFD LD 
Sbjct  61    SACSGVVSCADILAIAARDSVFLSGGPSWKVLLGRRDGTASNGTLANEA-LPSPFDPLDT  119

Query  704   IIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTT  883
             II+KF  +GLNLTD+V+LSGAHTIG A+C +F NRL NF  TG+PD TLD  ++ +LQ+ 
Sbjct  120   IISKFTNMGLNLTDVVSLSGAHTIGRARCTLFGNRLFNFSGTGAPDSTLDTDMLSDLQSL  179

Query  884   CPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYT  1063
             CP NGDGN T  LDRNS+DLFD+HYFKNLL G GLL SDQILFSSD A +T+K+LVQ+Y+
Sbjct  180   CPQNGDGNVTTVLDRNSSDLFDSHYFKNLLSGMGLLSSDQILFSSDEANSTTKSLVQSYS  239

Query  1064  NDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTRN  1177
             NDS  FF DF  SM+KMGNI+  TG++GEIRKNCR  N
Sbjct  240   NDSGLFFGDFANSMIKMGNINIKTGTNGEIRKNCRVIN  277



>ref|XP_006600453.1| PREDICTED: peroxidase N isoform X2 [Glycine max]
 gb|KHN17686.1| Peroxidase N [Glycine soja]
Length=279

 Score =   400 bits (1029),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/278 (71%), Positives = 229/278 (82%), Gaps = 2/278 (1%)
 Frame = +2

Query  344   NEMRMAASLLRLHFHDCFVNGCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVE  523
             NE+RMAASLLRLHFHDCFVNGCDGS+LLDG     EK A PNLNSARG+EV+D+IKS+VE
Sbjct  2     NEIRMAASLLRLHFHDCFVNGCDGSILLDGGDD-GEKSAAPNLNSARGYEVVDTIKSSVE  60

Query  524   SACSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQ  703
             SACSGVVSCADILAIAARDSV LSGGP W+V LGRRDG ++N T A   VLP PFD L+ 
Sbjct  61    SACSGVVSCADILAIAARDSVFLSGGPFWKVPLGRRDGTVSNGTLA-TEVLPAPFDPLNT  119

Query  704   IIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTT  883
             II+KF  +GLNLTD+V+LSGAHTIG A+C +FSNRL NF  TG+PD TL+  ++ +LQ+ 
Sbjct  120   IISKFTNMGLNLTDVVSLSGAHTIGRARCTLFSNRLFNFSGTGAPDSTLETGMLSDLQSL  179

Query  884   CPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYT  1063
             CP NGDGN T  LDRNS+DLFD HYFKNLL G+GLL SDQILFSSD A +T+K LVQ+Y+
Sbjct  180   CPQNGDGNVTTVLDRNSSDLFDIHYFKNLLSGKGLLSSDQILFSSDEANSTTKPLVQSYS  239

Query  1064  NDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTRN  1177
             NDS +FF DF  SM+KMGNI+  TG+DGEIRKNCR  N
Sbjct  240   NDSGQFFGDFANSMIKMGNINIKTGTDGEIRKNCRVIN  277



>ref|XP_008228368.1| PREDICTED: peroxidase N-like [Prunus mume]
Length=308

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 237/304 (78%), Gaps = 5/304 (2%)
 Frame = +2

Query  266   LTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNSTT  445
             L   FY  +CP+L K+VRKEV++A+K EMRMAASLLRLHF DCFVNGCD S+LLDG  + 
Sbjct  10    LNADFYKQTCPDLLKIVRKEVKDALKIEMRMAASLLRLHFVDCFVNGCDASILLDG--SN  67

Query  446   SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLLG  625
             SEKFA  NLNS RGFEV+D++KSAVESACSGVVSCADILA+ ARDSVLLSGGPTW+VLLG
Sbjct  68    SEKFATLNLNSVRGFEVVDAVKSAVESACSGVVSCADILALIARDSVLLSGGPTWKVLLG  127

Query  626   RRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSN  805
             RRDG + N   A+ ++ P  +D+LD II+KF  VGLN+TD+V+LSGAHTIG A+CA FS 
Sbjct  128   RRDGLVPNQRGANLAI-PSQYDTLDTIISKFANVGLNVTDVVSLSGAHTIGQARCATFSK  186

Query  806   RLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRG  985
             RL NF +TG PD T++  ++ +L+  C  NGDGN T  LDRNS DLFDNHY++NLL G+G
Sbjct  187   RLWNFFKTGGPDSTMEKDMLSDLRHVCLVNGDGNETTALDRNSNDLFDNHYYQNLLDGKG  246

Query  986   LLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNC  1165
             LL SDQILF  +   + +K++V+ Y      FF DF+ SM+KMGNI P+TGS G+IRKNC
Sbjct  247   LLHSDQILF--NGGDDETKSVVENYRRKPKLFFDDFIKSMIKMGNIGPVTGSSGQIRKNC  304

Query  1166  RTRN  1177
             R  N
Sbjct  305   RVIN  308



>ref|XP_009405166.1| PREDICTED: peroxidase 59-like [Musa acuminata subsp. malaccensis]
Length=329

 Score =   401 bits (1030),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/305 (65%), Positives = 236/305 (77%), Gaps = 3/305 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
              L+T FYA SCPN+FKVVR EV +A+K E RMAASLLRLHFHDCFVNGCDGSVLLDG  +
Sbjct  28    HLSTNFYAESCPNVFKVVRGEVADALKKEARMAASLLRLHFHDCFVNGCDGSVLLDG--S  85

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PN NS RGF+V+DSIK+AVE+ CS  VSCADILAIAARD+V+LSGGP+W+V L
Sbjct  86    DGEKFAFPNRNSVRGFDVVDSIKTAVENECSETVSCADILAIAARDAVVLSGGPSWKVPL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN T A+ + LP PF S++ I  KF AVGL++TD+VALSG HTIG A+C  F 
Sbjct  146   GRRDGLVANQTGANTN-LPAPFHSINTIKNKFAAVGLDITDVVALSGGHTIGRARCLAFR  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             +RL +F  T S DP+LD+++  ELQ+ CP + DG+  A LDR+S + FDNHYF NLL  R
Sbjct  205   SRLLSFSPTSSADPSLDSTMASELQSLCPQDDDGSTAAALDRSSVNAFDNHYFSNLLNQR  264

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD    T+K LV+ Y+ D+  FF DF  SM+KMGNISPLTGS GEIRKN
Sbjct  265   GLLPSDQGLFSSDEGVATTKDLVEAYSKDAGLFFKDFANSMIKMGNISPLTGSVGEIRKN  324

Query  1163  CRTRN  1177
             CR  N
Sbjct  325   CRVVN  329



>gb|KEH32490.1| peroxidase family protein [Medicago truncatula]
Length=275

 Score =   399 bits (1024),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 228/276 (83%), Gaps = 2/276 (1%)
 Frame = +2

Query  350   MRMAASLLRLHFHDCFVNGCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVESA  529
             MRM ASLLRLHFHDCFVNGCDGS+LLDG     EK A PN+NS RGF+V+D+IK+AVESA
Sbjct  1     MRMGASLLRLHFHDCFVNGCDGSILLDGGDDF-EKSAFPNINSVRGFDVVDTIKTAVESA  59

Query  530   CSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQII  709
             CSGVVSCADILAIAARDSVLLSGGP+W V+LGRRDG ++N + A+  VLP PFD LD I+
Sbjct  60    CSGVVSCADILAIAARDSVLLSGGPSWSVMLGRRDGTISNGSLANV-VLPSPFDPLDTIV  118

Query  710   AKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCP  889
             +KF  VGLNLTD+V+LSGAHTIG A+CA+FSNRL NF  TGSPD TL+  ++ +LQ  CP
Sbjct  119   SKFTNVGLNLTDVVSLSGAHTIGRARCALFSNRLFNFSGTGSPDSTLETGMLTDLQNLCP  178

Query  890   SNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTND  1069
               GDGN TA LDRNSTDLFDNHY+KNLL G+GLL SDQIL S+D A +TSK LVQ+Y ++
Sbjct  179   QTGDGNTTAVLDRNSTDLFDNHYYKNLLNGKGLLSSDQILISTDEANSTSKPLVQSYNDN  238

Query  1070  SNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTRN  1177
             +  FF DFV SM+KMGNI+P TGSDGEIRK+CR  N
Sbjct  239   ATLFFGDFVKSMIKMGNINPKTGSDGEIRKSCRVIN  274



>ref|XP_010454279.1| PREDICTED: peroxidase 59-like [Camelina sativa]
Length=329

 Score =   400 bits (1029),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 237/305 (78%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL    YA SCP+L ++VR +V  A+  E RMAASL+RLHFHDCFVNGCD S+LLDG  T
Sbjct  30    QLNPEIYAKSCPSLGQIVRNQVTIAMNAEKRMAASLIRLHFHDCFVNGCDASILLDG--T  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A+PNLNSARGFEV+D+IK+AVE+AC GVVSCADIL +AARDSV LSGGP WRV L
Sbjct  88    DSEKLAIPNLNSARGFEVVDTIKAAVENACPGVVSCADILTLAARDSVSLSGGPRWRVAL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN  +A+   LP PF+ LD IIAKFVAVGLN+TD+VALSGAHT G AKC +FS
Sbjct  148   GRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVGLNITDVVALSGAHTFGQAKCGLFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF   G+PD TL+ SL+  LQ+ CP  G+GN TAPLD  STD FDN+YFKNLL G+
Sbjct  206   NRLFNFTGAGTPDATLETSLLSNLQSVCPLGGNGNITAPLDNGSTDAFDNNYFKNLLQGK  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSS+ A NT+K LV+ Y+ +   FF DF  SM++MGNI+   G+ GE+RKN
Sbjct  266   GLLSSDQILFSSELAVNTTKGLVEAYSRNQYLFFRDFTCSMIRMGNIA--NGASGEVRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVIN  328



>ref|XP_007206483.1| hypothetical protein PRUPE_ppa019052mg [Prunus persica]
 gb|EMJ07682.1| hypothetical protein PRUPE_ppa019052mg [Prunus persica]
Length=325

 Score =   400 bits (1028),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 236/304 (78%), Gaps = 5/304 (2%)
 Frame = +2

Query  266   LTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNSTT  445
             L   FY  +CP+L K+VRKEV++A+K EMRMAASLLRLHF DCFVNGCD S+LLDG  + 
Sbjct  27    LNADFYKQTCPDLLKIVRKEVKDALKIEMRMAASLLRLHFVDCFVNGCDASILLDG--SN  84

Query  446   SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLLG  625
             SEKFA PNLNS RGF+V+D++KSAVESACSGVVSCADILA+ ARDSVLLSGGPTW+VLLG
Sbjct  85    SEKFATPNLNSVRGFQVVDAVKSAVESACSGVVSCADILALIARDSVLLSGGPTWKVLLG  144

Query  626   RRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSN  805
             RRDG + N   A+ ++ P  +D+LD II+KF  VGLN+TD+V+LSGAHTIG A+CA FS 
Sbjct  145   RRDGLVPNQRGANLAI-PSQYDTLDTIISKFANVGLNVTDVVSLSGAHTIGQARCATFSK  203

Query  806   RLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRG  985
             RL NF  TG PD T++  ++ +L+  C  NGDGN T  LDRNS DLFDNHY++NLL G+G
Sbjct  204   RLWNFFNTGGPDSTMEKDMLSDLRHVCLVNGDGNETTALDRNSNDLFDNHYYQNLLDGKG  263

Query  986   LLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNC  1165
             LL SDQILF  +   + +K++V  Y      FF DF+ SM+KMGNI P+TGS G+IRKNC
Sbjct  264   LLHSDQILF--NGGDDETKSVVDNYRRKPKLFFDDFIKSMIKMGNIGPVTGSSGQIRKNC  321

Query  1166  RTRN  1177
             R  N
Sbjct  322   RVIN  325



>ref|XP_010493079.1| PREDICTED: peroxidase 59 [Camelina sativa]
Length=329

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 238/305 (78%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL    YA SCP+L ++VR +V  A+  E RMAASL+RLHFHDCFVNGCD S+LLDG  T
Sbjct  30    QLNPDSYAKSCPSLGQIVRDQVTIAMNAEKRMAASLIRLHFHDCFVNGCDASILLDG--T  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK A+PNLNSARGFEV+D+IK+AVE+AC GVVSCADILA+AARDSV LSGGP WRV L
Sbjct  88    DSEKLAIPNLNSARGFEVVDTIKAAVENACPGVVSCADILALAARDSVSLSGGPRWRVAL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN  +A+   LP PF+ LD IIAKFVAV LN+TD+VALSGAHT G AKC +FS
Sbjct  148   GRKDGLVANQNSANN--LPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCGLFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  TG+PD TL+ SL+  LQ+ CP  G+GN TAPLD  STD FDN+YFKNLL G+
Sbjct  206   NRLFNFTGTGTPDATLETSLLSNLQSVCPLGGNGNITAPLDNGSTDAFDNNYFKNLLQGK  265

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQILFSSD A NT+K LV+ Y+ +   FF DF  SM++MGNI+   G+ GE+RKN
Sbjct  266   GLLSSDQILFSSDLAVNTTKKLVEAYSRNQYLFFRDFTCSMIRMGNIA--NGASGEVRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRVIN  328



>ref|XP_009120848.1| PREDICTED: peroxidase N [Brassica rapa]
Length=328

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 239/306 (78%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+   Y  SCP L ++VRK+V  A+K E+RMAASL+RLHFHDCFVNGCD SVLLDG   
Sbjct  26    QLSPAIYDKSCPYLVQIVRKQVNMALKAEIRMAASLIRLHFHDCFVNGCDASVLLDG--A  83

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
              SEK ++ N NSARGFEV+D+IK+AVESAC GVVSCADIL +AAR+SV ++GGP WRV L
Sbjct  84    DSEKLSISNANSARGFEVVDTIKAAVESACPGVVSCADILTLAARESVYMTGGPMWRVAL  143

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN ++A+   LP PF+ LD IIAKF AVGLN+TD+VALSGAHT   AKC +F 
Sbjct  144   GRKDGLVANQSSANN--LPSPFEPLDAIIAKFQAVGLNVTDVVALSGAHTFRQAKCDLFR  201

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF   GSPD TL+ +L+ +L+T CP  G+GN TAPLDRNSTD+FDN+YFKNLL G+
Sbjct  202   NRLFNFTGQGSPDATLETTLLSDLRTVCPIGGNGNVTAPLDRNSTDVFDNNYFKNLLQGK  261

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNI-SPLTGSDGEIRK  1159
             GLL SDQILFSSD A NT+K LV+ Y+   + FF DF  SM++MG I +P+ GS GE+RK
Sbjct  262   GLLSSDQILFSSDLAVNTTKRLVEAYSQSQSLFFRDFTCSMIRMGGIMNPINGSSGEVRK  321

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  322   NCRVIN  327



>ref|XP_003595237.1| Peroxidase [Medicago truncatula]
 gb|AES65488.1| peroxidase family protein [Medicago truncatula]
Length=332

 Score =   395 bits (1015),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 235/306 (77%), Gaps = 3/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LT  FY  +CP++F +VR+EV NAI  E+RMAASLLRLHFHDCFVNGCD S+LLDG+  
Sbjct  28    KLTPYFYRTTCPDVFTIVRREVLNAINEEIRMAASLLRLHFHDCFVNGCDASILLDGDED  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PN+NSARGFEVID IKS+VES+CSGVVSCADILAI ARDSV LSGGP W V L
Sbjct  88    I-EKFATPNINSARGFEVIDRIKSSVESSCSGVVSCADILAIVARDSVHLSGGPFWYVQL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ ++ P PFDSLD II+KF  VGL++ D+V LSGAHTIG A+C  FS
Sbjct  147   GRRDGLVSNKTLANNAI-PSPFDSLDTIISKFDNVGLSVKDVVTLSGAHTIGRARCTFFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T  PD +L+  ++ ELQ  CP +GDGN T  LD  S D FDN+YFKNLL G+
Sbjct  206   NRLFNFSGTQEPDNSLEYEMLTELQNLCPQDGDGNTTTVLDPYSFDQFDNNYFKNLLNGK  265

Query  983   GLLQSDQILFSSD-AAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             GLL SDQILFSSD    +T+K LVQ Y+ +   FF +F  +M+KMGNI+PL GS+GEIRK
Sbjct  266   GLLSSDQILFSSDEETTSTTKQLVQYYSENERIFFMEFAYAMIKMGNINPLIGSEGEIRK  325

Query  1160  NCRTRN  1177
             +CR  N
Sbjct  326   SCRVIN  331



>gb|ABN09112.1| Haem peroxidase, plant/fungal/bacterial [Medicago truncatula]
Length=359

 Score =   396 bits (1017),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 235/306 (77%), Gaps = 3/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LT  FY  +CP++F +VR+EV NAI  E+RMAASLLRLHFHDCFVNGCD S+LLDG+  
Sbjct  55    KLTPYFYRTTCPDVFTIVRREVLNAINEEIRMAASLLRLHFHDCFVNGCDASILLDGDED  114

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PN+NSARGFEVID IKS+VES+CSGVVSCADILAI ARDSV LSGGP W V L
Sbjct  115   I-EKFATPNINSARGFEVIDRIKSSVESSCSGVVSCADILAIVARDSVHLSGGPFWYVQL  173

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ ++ P PFDSLD II+KF  VGL++ D+V LSGAHTIG A+C  FS
Sbjct  174   GRRDGLVSNKTLANNAI-PSPFDSLDTIISKFDNVGLSVKDVVTLSGAHTIGRARCTFFS  232

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T  PD +L+  ++ ELQ  CP +GDGN T  LD  S D FDN+YFKNLL G+
Sbjct  233   NRLFNFSGTQEPDNSLEYEMLTELQNLCPQDGDGNTTTVLDPYSFDQFDNNYFKNLLNGK  292

Query  983   GLLQSDQILFSSD-AAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             GLL SDQILFSSD    +T+K LVQ Y+ +   FF +F  +M+KMGNI+PL GS+GEIRK
Sbjct  293   GLLSSDQILFSSDEETTSTTKQLVQYYSENERIFFMEFAYAMIKMGNINPLIGSEGEIRK  352

Query  1160  NCRTRN  1177
             +CR  N
Sbjct  353   SCRVIN  358



>ref|XP_006290154.1| hypothetical protein CARUB_v10003822mg [Capsella rubella]
 gb|EOA23052.1| hypothetical protein CARUB_v10003822mg [Capsella rubella]
Length=329

 Score =   393 bits (1009),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 233/306 (76%), Gaps = 6/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL    YA SCP+L ++VR +V  A+  E R+AASL+RLHFHDCFVNGCD S+LLDG  
Sbjct  29    AQLNPDIYAKSCPSLVQIVRNQVSIAMNAEKRIAASLIRLHFHDCFVNGCDASILLDG--  86

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEK A+PN+NS RGFEVID+IK+AVE AC GVVSCADIL +AARDSV LSGGP WRV 
Sbjct  87    TDSEKLAIPNVNSVRGFEVIDTIKAAVEKACPGVVSCADILTLAARDSVCLSGGPRWRVA  146

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR+DG +AN  +A+   LP PF+ LD IIAKFVAVGLN TD+VALSGAHT G AKC +F
Sbjct  147   LGRKDGLVANQNSANN--LPSPFEPLDSIIAKFVAVGLNTTDVVALSGAHTFGQAKCDLF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF   G+PD TL+ SL+  L++ CP  G+GN TAP D NS D FDN+YFKNLL G
Sbjct  205   SNRLFNFTGAGTPDVTLETSLLSNLRSVCPVGGNGNITAPFDPNSVDAFDNNYFKNLLQG  264

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSSD A NT+K+LV+ Y+     FF DF  SM++MGNI+   G+ GE+R+
Sbjct  265   KGLLSSDQILFSSDLAVNTTKSLVEAYSRSQYLFFRDFTCSMIRMGNIA--NGASGEVRR  322

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  323   NCRVIN  328



>gb|ACJ84502.1| unknown [Medicago truncatula]
Length=332

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 234/306 (76%), Gaps = 3/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LT  FY  +CP++F +VR+EV NAI  E+RMAASLLRLHFHDCFVNGCD S+LLDG+  
Sbjct  28    KLTPYFYRTTCPDVFTIVRREVLNAINEEIRMAASLLRLHFHDCFVNGCDASILLDGDED  87

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PN+NSARGFEVID IKS+VES+CSGVVSCADILAI ARDSV LSGGP W V L
Sbjct  88    I-EKFATPNINSARGFEVIDRIKSSVESSCSGVVSCADILAIVARDSVHLSGGPFWYVQL  146

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG ++N T A+ ++ P PFDSLD II+KF  VGL++ D+V LSGAHTIG A+C  FS
Sbjct  147   GRRDGLVSNKTLANNAI-PSPFDSLDTIISKFDNVGLSVKDVVTLSGAHTIGRARCTFFS  205

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL NF  T  PD +L+  ++ ELQ  CP +GDGN T  L   S D FDN+YFKNLL G+
Sbjct  206   NRLFNFSGTQEPDNSLEYEMLTELQNLCPQDGDGNTTTVLGPYSFDQFDNNYFKNLLNGK  265

Query  983   GLLQSDQILFSSD-AAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             GLL SDQILFSSD    +T+K LVQ Y+ +   FF +F  +M+KMGNI+PL GS+GEIRK
Sbjct  266   GLLSSDQILFSSDEETTSTTKQLVQYYSENERIFFMEFAYAMIKMGNINPLIGSEGEIRK  325

Query  1160  NCRTRN  1177
             +CR  N
Sbjct  326   SCRVIN  331



>ref|XP_003561850.1| PREDICTED: peroxidase N-like [Brachypodium distachyon]
Length=334

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 229/306 (75%), Gaps = 4/306 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             G+LT  FY + CPNL ++VR  V  A+K E RM ASLLRLHFHDCFVNGCDGS+LLDG  
Sbjct  33    GELTDDFYDDCCPNLDRIVRARVSAAMKAEPRMGASLLRLHFHDCFVNGCDGSILLDG--  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             + SEK A PNLNSARGFEV+D+IK+ +E AC G VSCAD+LA+AA+  VLLSGGP + VL
Sbjct  91    SNSEKLAAPNLNSARGFEVVDAIKADIERACPGHVSCADVLALAAKYGVLLSGGPDYDVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + AD++ LPGP DS+  I  +F  VGLN TDMV LSG HTIG ++CA+F
Sbjct  151   LGRRDGLVANQSGADSN-LPGPDDSISDITKRFKDVGLNTTDMVVLSGGHTIGRSRCALF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL+NF  T S DPTLD++L   LQ  C   GDGN TA LD  S D FDNHYFKNLL  
Sbjct  210   SNRLANFSATNSVDPTLDSALASSLQQVC-RGGDGNQTAALDDGSADAFDNHYFKNLLAK  268

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQILFSS  A   +KALVQ Y  DS RFF DF  SMVKMGNI+PLTGS G+IRK
Sbjct  269   KGLLSSDQILFSSADAAAATKALVQAYGADSQRFFCDFGNSMVKMGNIAPLTGSAGQIRK  328

Query  1160  NCRTRN  1177
              CR  N
Sbjct  329   KCRAVN  334



>ref|XP_002465590.1| hypothetical protein SORBIDRAFT_01g041760 [Sorghum bicolor]
 gb|EER92588.1| hypothetical protein SORBIDRAFT_01g041760 [Sorghum bicolor]
Length=332

 Score =   382 bits (982),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 229/307 (75%), Gaps = 5/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  FY   CP+   +V+  V  A+K E RM ASLLRLHFHDCFVNGCDGS+LLDGN+
Sbjct  30    GQLTDDFYDGCCPHAEDIVKARVSAAMKAEPRMGASLLRLHFHDCFVNGCDGSILLDGNN  89

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T  EK A PNLNS RGFEV+D+IK+ +E AC GVVSCADILAIAA+  VLLSGGP + VL
Sbjct  90    T--EKLAAPNLNSVRGFEVVDAIKADLEKACPGVVSCADILAIAAKYGVLLSGGPDYDVL  147

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + A+++ LP PFD ++ I  KF  VGLN TD+V LSG HTIG A+CA+F
Sbjct  148   LGRRDGLVANQSGANSN-LPSPFDPINTITNKFNDVGLNTTDVVVLSGGHTIGRARCALF  206

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRLSNF  T S DPTL++SL   LQT C   GDGN TA LD  S D FDNHY++NLL  
Sbjct  207   SNRLSNFSTTSSVDPTLNSSLASSLQTLC-QGGDGNQTAALDAGSADTFDNHYYQNLLTQ  265

Query  980   RGLLQSDQILFSS-DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             RGLL SDQ LFSS D     +KALVQ Y+ +S RFF DF  SMVKMGNISPLTGS G+IR
Sbjct  266   RGLLSSDQGLFSSTDDGAAATKALVQAYSANSQRFFCDFGRSMVKMGNISPLTGSAGQIR  325

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  326   KNCRAVN  332



>gb|EYU17995.1| hypothetical protein MIMGU_mgv1a021857mg, partial [Erythranthe 
guttata]
Length=256

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/258 (71%), Positives = 219/258 (85%), Gaps = 3/258 (1%)
 Frame = +2

Query  404   GCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDS  583
             GCD SVLLDG  +  EKFA+PNLNSARG+EVID+IK+AVE++CSGVVSCADIL +AARDS
Sbjct  1     GCDASVLLDG--SDGEKFALPNLNSARGYEVIDTIKNAVETSCSGVVSCADILTLAARDS  58

Query  584   VLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSG  763
             VLLSGGP+W+V+LGRRDG + N T A+ S LP PF+SLD IIAKF AVGLN+TD+VALSG
Sbjct  59    VLLSGGPSWKVVLGRRDGLVGNQTGAN-SALPSPFESLDNIIAKFAAVGLNVTDVVALSG  117

Query  764   AHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDL  943
              HTIGL++CA+FSNRLSNF  TG+PD TL+ SLIPELQT CP+ GDGNNT PLD  S DL
Sbjct  118   GHTIGLSRCALFSNRLSNFSGTGAPDSTLNTSLIPELQTACPATGDGNNTVPLDNRSRDL  177

Query  944   FDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNI  1123
             FDN YF NL+ GRG+LQSDQIL SSD+AQ+T++++ Q Y+ ++  FF DFV SM+KMGNI
Sbjct  178   FDNRYFVNLVNGRGILQSDQILVSSDSAQSTTRSIAQLYSTNATVFFCDFVNSMIKMGNI  237

Query  1124  SPLTGSDGEIRKNCRTRN  1177
             SPLTGS+G+IRKNCR  N
Sbjct  238   SPLTGSNGQIRKNCRVVN  255



>gb|KDO40104.1| hypothetical protein CISIN_1g045752mg, partial [Citrus sinensis]
Length=258

 Score =   377 bits (968),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 220/258 (85%), Gaps = 5/258 (2%)
 Frame = +2

Query  404   GCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDS  583
             GCD SVLLDG  + SEKFA PN NSARGFEVID+IK+AVE  CSGVVSCADILAIAARDS
Sbjct  1     GCDASVLLDG--SDSEKFAAPNRNSARGFEVIDAIKTAVEGQCSGVVSCADILAIAARDS  58

Query  584   VLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSG  763
             VLLSGGPTW+VLLGRRDG +AN T A+A  LP PF+ L+ + AKF AVGLN+ D+V+LSG
Sbjct  59    VLLSGGPTWKVLLGRRDGLVANQTGANA--LPSPFEGLNILTAKFAAVGLNIKDLVSLSG  116

Query  764   AHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDL  943
             AHTIG AKCA FSNRLSNF  TG+PD T+D SL+ ELQ+ C +NGDGNNT PLDRNS DL
Sbjct  117   AHTIGFAKCAFFSNRLSNFSGTGAPDATMDTSLVSELQSLC-ANGDGNNTTPLDRNSIDL  175

Query  944   FDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNI  1123
             FDNHYF+NL+  +GLL SDQIL+SSD A++T+++LV++Y+++SN FFA+FV SM+KMGN+
Sbjct  176   FDNHYFQNLINNKGLLSSDQILYSSDEAKSTTESLVESYSSNSNLFFANFVNSMIKMGNV  235

Query  1124  SPLTGSDGEIRKNCRTRN  1177
             SPLTG++GEIRKNCR  N
Sbjct  236   SPLTGTNGEIRKNCRAVN  253



>ref|XP_006492730.1| PREDICTED: peroxidase N-like [Citrus sinensis]
Length=390

 Score =   380 bits (976),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/261 (70%), Positives = 221/261 (85%), Gaps = 5/261 (2%)
 Frame = +2

Query  395   FVNGCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAA  574
              + GCD SVLLDG  + SEKFA PN NSARGFEVID+IK+AVE  CSGVVSCADILAIAA
Sbjct  130   ILEGCDASVLLDG--SDSEKFAAPNRNSARGFEVIDAIKTAVEGQCSGVVSCADILAIAA  187

Query  575   RDSVLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVA  754
             RDSVLLSGGPTW+VLLGRRDG +AN T A+A  LP PF+ L+ + AKF AVGLN+ D+V+
Sbjct  188   RDSVLLSGGPTWKVLLGRRDGLVANQTGANA--LPSPFEGLNILTAKFAAVGLNIKDLVS  245

Query  755   LSGAHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNS  934
             LSGAHTIG AKCA FSNRLSNF  TG+PD T+D SL+ ELQ+ C +NGDGNNT PLDRNS
Sbjct  246   LSGAHTIGFAKCAFFSNRLSNFSGTGAPDATMDTSLVSELQSLC-ANGDGNNTTPLDRNS  304

Query  935   TDLFDNHYFKNLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKM  1114
              DLFDNHYF+NL+  +GLL SDQIL+SSD A++T+++LV++Y+++SN FFA+FV SM+KM
Sbjct  305   IDLFDNHYFQNLINNKGLLSSDQILYSSDEAKSTTESLVESYSSNSNLFFANFVNSMIKM  364

Query  1115  GNISPLTGSDGEIRKNCRTRN  1177
             GN+SPLTG++GEIRKNCR  N
Sbjct  365   GNVSPLTGTNGEIRKNCRAVN  385



>ref|XP_004985086.1| PREDICTED: peroxidase N-like [Setaria italica]
Length=332

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 224/306 (73%), Gaps = 5/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  FY + CP    +V+  V  A+K E RM ASLLRLHFHDCFVNGCDGS+LLDG  
Sbjct  32    GQLTDDFYDDCCPQAEDIVKARVSAAMKAEARMGASLLRLHFHDCFVNGCDGSILLDG--  89

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             + SEK A PNLNSARGFEV+D+IK+ +E AC GVVSCAD+LA+AA+  VLLSGGP + VL
Sbjct  90    SNSEKLAGPNLNSARGFEVVDAIKADLEKACPGVVSCADVLALAAKYGVLLSGGPDYDVL  149

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + A+++ LPGPFD +  II KF  VGLN TD+V LSG HTIG  +C +F
Sbjct  150   LGRRDGLVANQSGANSN-LPGPFDPISDIIKKFRDVGLNTTDVVVLSGGHTIGRGRCTLF  208

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRLSNF  T S DPTLD+SL   LQ  C   GDGN TA LD  S D FDNHYF+NLL  
Sbjct  209   SNRLSNFSATSSVDPTLDSSLASSLQALC-RGGDGNQTAALDAGSADAFDNHYFQNLLSQ  267

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ LFS  A  N +KALVQ Y  +S RF  DF  SMVKMGNI PLTGS G+IRK
Sbjct  268   KGLLSSDQGLFSG-AGANATKALVQLYGANSERFLCDFGRSMVKMGNILPLTGSAGQIRK  326

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  327   NCRAVN  332



>tpg|DAA49837.1| TPA: peroxidase R11 [Zea mays]
Length=328

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 230/306 (75%), Gaps = 5/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT GFY ++CP L+  V++ V +A++ EMRM ASLLRLHFHDCFVNGCD S+LLDG+ 
Sbjct  28    GQLTPGFYRSTCPQLYYTVQRHVFDAMRAEMRMGASLLRLHFHDCFVNGCDASILLDGDD  87

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
                EKFA+PN NS RGFEVID+IK+ +ES C  VVSCADI+A+AA   VL SGGP + VL
Sbjct  88    --GEKFALPNRNSVRGFEVIDAIKADLESVCPEVVSCADIVALAASYGVLFSGGPYYDVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + A+ S LP PF+ +D II KF AV LN TD+V LSGAHTIG A+CA+F
Sbjct  146   LGRRDGLVANQSGAN-SGLPSPFEPIDSIIHKFAAVDLNTTDVVVLSGAHTIGRARCALF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRLSNF  T S DPTLDA L   LQ+ C + GDGN T+ LD ++ + FDN Y+KNLL+ 
Sbjct  205   SNRLSNFSATESVDPTLDAGLAESLQSLC-AGGDGNQTSALDVSTPNAFDNAYYKNLLLE  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ LFSS      +KALV+TY+ DS  FF  F +SM+KMGNI PLT SDGEIRK
Sbjct  264   KGLLSSDQGLFSSPEGVARTKALVETYSQDSEHFFCHFASSMIKMGNI-PLTASDGEIRK  322

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  323   NCRVAN  328



>ref|XP_004983337.1| PREDICTED: peroxidase N-like [Setaria italica]
Length=327

 Score =   375 bits (962),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 189/305 (62%), Positives = 231/305 (76%), Gaps = 5/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT+ FY  +CP+L+ +V++ V  A++ EMRM ASLLRLHFHDCFVNGCDGS+LLD   +
Sbjct  27    QLTSDFYDETCPHLYTIVQQHVFTAMRAEMRMGASLLRLHFHDCFVNGCDGSILLD--RS  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PNLNS RG+EVID+IK+ +ES C  VVSCADI+A+AA   VL SGGP W VLL
Sbjct  85    DGEKFAQPNLNSVRGYEVIDAIKADLESLCPEVVSCADIVALAAGYGVLFSGGPYWDVLL  144

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN + AD   LP PF+ +D II KF AVGLN TD+V LSGAHTIG ++C +FS
Sbjct  145   GRKDGLVANQSGADNG-LPAPFEPIDSIIQKFNAVGLNTTDVVVLSGAHTIGRSRCVLFS  203

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLSNF  T S DPTLDASL   LQ+ C + GDGN T  LD +S D+FDN+Y++NLL  +
Sbjct  204   NRLSNFSATNSVDPTLDASLADSLQSLC-AGGDGNQTTALDVSSGDVFDNYYYQNLLANK  262

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSS      +K LV+TY++D ++FF DF  SM+KMGNI PLTGS+GEIRKN
Sbjct  263   GLLSSDQGLFSSPQGTANTKDLVRTYSHDEDQFFCDFGWSMIKMGNI-PLTGSEGEIRKN  321

Query  1163  CRTRN  1177
             CR  N
Sbjct  322   CRVVN  326



>ref|XP_006354231.1| PREDICTED: peroxidase N-like [Solanum tuberosum]
Length=263

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 215/259 (83%), Gaps = 2/259 (1%)
 Frame = +2

Query  404   GCDGSVLLDGNSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDS  583
             GCD S+LLDGNS+TSEKF   NLNSARG+EVID+IK+AVE+ CSGVVSCADILAIAARDS
Sbjct  6     GCDASLLLDGNSSTSEKFTPGNLNSARGYEVIDNIKTAVENTCSGVVSCADILAIAARDS  65

Query  584   VLLSGGPTWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSG  763
             VLLSGGP W+VLLGRRDG +ANF+ + ++ LP PFD L+ II+KF  VGLNLTD+V+LSG
Sbjct  66    VLLSGGPFWKVLLGRRDGLVANFSGS-SNGLPAPFDHLNTIISKFQDVGLNLTDVVSLSG  124

Query  764   AHTIGLAKCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDL  943
             AHTIGLA+C  F NRL NF  T SPD TLD +L+ ELQ  CPS  DGNNT PLDRNST+L
Sbjct  125   AHTIGLARCTTFDNRLRNFNGTSSPDTTLDTTLVSELQNLCPSTSDGNNTTPLDRNSTNL  184

Query  944   FDNHYFKNLLIGRGLLQSDQILFSS-DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGN  1120
             FDNHYFKNL+ GRGLL+SDQILFSS DA   T+K LV+TY+N S  FF DFV SM+KMGN
Sbjct  185   FDNHYFKNLINGRGLLESDQILFSSDDAITTTTKTLVETYSNSSKFFFNDFVNSMIKMGN  244

Query  1121  ISPLTGSDGEIRKNCRTRN  1177
             ISPLTGS+G+IR NCR  N
Sbjct  245   ISPLTGSNGQIRTNCRVVN  263



>ref|XP_010257483.1| PREDICTED: peroxidase N-like [Nelumbo nucifera]
Length=328

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 237/306 (77%), Gaps = 8/306 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T  Y  +CPN+F++VRKEV+ A+++EMRMAASLLRLHFHDCFVNGCDGSVLLDG+  
Sbjct  30    QLSTDVYDATCPNVFQIVRKEVKKALRSEMRMAASLLRLHFHDCFVNGCDGSVLLDGSD-  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PNLNSARGF+V+D+IKSAVESAC   VSCADILAIAARD+VLLSGGP W+VLL
Sbjct  89    -GEKFALPNLNSARGFDVVDTIKSAVESACPKTVSCADILAIAARDAVLLSGGPFWKVLL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN T A+   LP PF+SLDQI AKF AVGL+LTD+VALSG HTIGLAKCA F+
Sbjct  148   GRKDGLVANQTGANNG-LPSPFESLDQITAKFAAVGLDLTDVVALSGGHTIGLAKCATFN  206

Query  803   NRLSNFQQTGSPDP-TLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              RL N    G+ D  ++DA ++ +LQ  CP NGDGN T  LDRNS DLFD HYF NLL  
Sbjct  207   TRLFNSSTNGTTDKSSMDADMLTDLQNLCPQNGDGNKTTALDRNSRDLFDTHYFTNLLNN  266

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SD  L SSDAA+     LV+ Y+ +   FF DF  SM+KMGNISPL   +GEIR 
Sbjct  267   KGLLLSDTSLLSSDAAE----TLVENYSTNPTLFFKDFAKSMIKMGNISPLIAPNGEIRT  322

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  323   NCRVVN  328



>ref|NP_001140689.1| uncharacterized protein LOC100272764 precursor [Zea mays]
 gb|ACF84382.1| unknown [Zea mays]
Length=328

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 229/306 (75%), Gaps = 5/306 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT GFY ++CP L+  V++ V +A++ E RM ASLLRLHFHDCFVNGCD S+LLDG+ 
Sbjct  28    GQLTPGFYRSTCPQLYYTVQRHVFDAMRAETRMGASLLRLHFHDCFVNGCDASILLDGDD  87

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
                EKFA+PN NS RGFEVID+IK+ +ES C  VVSCADI+A+AA   VL SGGP + VL
Sbjct  88    --GEKFALPNRNSVRGFEVIDAIKADLESVCPEVVSCADIVALAASYGVLFSGGPYYDVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + A+ S LP PF+ +D II KF AV LN TD+V LSGAHTIG A+CA+F
Sbjct  146   LGRRDGLVANQSGAN-SGLPSPFEPIDSIIQKFAAVDLNTTDVVVLSGAHTIGRARCALF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRLSNF  T S DPTLDA L   LQ+ C + GDGN T+ LD ++ + FDN Y+KNLL+ 
Sbjct  205   SNRLSNFSATESVDPTLDAGLAESLQSLC-AGGDGNQTSALDVSTPNAFDNAYYKNLLLE  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ LFSS      +KALV+TY+ DS  FF  F +SM+KMGNI PLT SDGEIRK
Sbjct  264   KGLLSSDQGLFSSPEGVARTKALVETYSQDSEHFFCHFASSMIKMGNI-PLTASDGEIRK  322

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  323   NCRVAN  328



>dbj|BAA08499.1| peroxidase [Oryza sativa Japonica Group]
Length=335

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  +Y   CP ++++VR  V  A+K EMRM ASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  33    GQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDG--  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEKFA PN NS RG+EVID+IK+ +ESAC GVVSCADI+A+AA+  VLLSGGP + VL
Sbjct  91    TNSEKFAAPNNNSVRGYEVIDAIKADLESACPGVVSCADIVALAAKYGVLLSGGPDYDVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+++ LP PFDS+  I A+F  VGLN TD+V LSGAHTIG ++C +F
Sbjct  151   LGRRDGLVANQTGANSN-LPSPFDSISVITARFKDVGLNATDVVVLSGAHTIGRSRCLLF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL+NF  T S DPTLD+SL   LQ  C   G  +  A LD NS D FDNHY++NLL  
Sbjct  210   SNRLANFSATNSVDPTLDSSLASSLQQVC--RGGADQLAALDVNSADAFDNHYYQNLLAN  267

Query  980   RGLLQSDQILFSS--DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +GLL SDQ L SS  D A   +KALVQ Y+ +  RF  DF  SMVKMGNISPLTGS G+I
Sbjct  268   KGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQI  327

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  328   RKNCRAVN  335



>gb|EAY89165.1| hypothetical protein OsI_10661 [Oryza sativa Indica Group]
Length=335

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  +Y   CP ++++VR  V  A+K EMRM ASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  33    GQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDG--  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEKFA PN NS RG+EVID+IK+ +ESAC GVVSCADI+A+AA+  VLLSGGP + VL
Sbjct  91    TNSEKFAAPNNNSVRGYEVIDAIKADLESACPGVVSCADIVALAAKYGVLLSGGPDYDVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+++ LP PFDS+  I A+F  VGLN TD+V LSGAHTIG ++C +F
Sbjct  151   LGRRDGLVANQTGANSN-LPSPFDSISVITARFKDVGLNATDVVVLSGAHTIGRSRCLLF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL+NF  T S DPTLD+SL   LQ  C   G  +  A LD NS D FDNHY++NLL  
Sbjct  210   SNRLANFSATNSVDPTLDSSLASSLQQVC--RGGADQLAALDVNSADAFDNHYYQNLLAN  267

Query  980   RGLLQSDQILFSS--DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +GLL SDQ L SS  D A   +KALVQ Y+ +  RF  DF  SMVKMGNISPLTGS G+I
Sbjct  268   KGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQI  327

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  328   RKNCRAVN  335



>dbj|BAA03373.1| putative peroxidase [Oryza sativa Japonica Group]
Length=335

 Score =   372 bits (956),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  +Y   CP ++++VR  V  A+K EMRM ASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  33    GQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDG--  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEKFA+PN NS RG+EVID+IK+ +E AC GVVSCADI+A+AA+  VLLSGGP + VL
Sbjct  91    TNSEKFALPNKNSVRGYEVIDAIKADLEGACPGVVSCADIVALAAKYGVLLSGGPDYDVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+++ LP PFDS+  I A+F  VGLN TD+V LSGAHTIG ++C +F
Sbjct  151   LGRRDGLVANQTGANSN-LPSPFDSISVITARFKDVGLNATDVVVLSGAHTIGRSRCLLF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL+NF  T S DPTLD+SL   LQ  C   G  +  A LD NS D FDNHY++NLL  
Sbjct  210   SNRLANFSATNSVDPTLDSSLASSLQQVC--RGGADQLAALDVNSADAFDNHYYQNLLAN  267

Query  980   RGLLQSDQILFSS--DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +GLL SDQ L SS  D A   +KALVQ Y+ +  RF  DF  SMVKMGNISPLTGS G+I
Sbjct  268   KGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQI  327

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  328   RKNCRAVN  335



>ref|NP_001049483.1| Os03g0235000 [Oryza sativa Japonica Group]
 tpe|CAH69280.1| TPA: class III peroxidase 38 precursor [Oryza sativa Japonica 
Group]
 gb|ABF94830.1| Peroxidase N precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11397.1| Os03g0235000 [Oryza sativa Japonica Group]
 gb|EAZ26187.1| hypothetical protein OsJ_10056 [Oryza sativa Japonica Group]
Length=335

 Score =   372 bits (956),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  +Y   CP ++++VR  V  A+K EMRM ASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  33    GQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDG--  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEKFA PN NS RG+EVID+IK+ +ESAC GVVSCADI+A+AA+  VLLSGGP + VL
Sbjct  91    TNSEKFAAPNNNSVRGYEVIDAIKADLESACPGVVSCADIVALAAKYGVLLSGGPDYDVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+++ LP PFDS+  I A+F  VGLN TD+V LSGAHTIG ++C +F
Sbjct  151   LGRRDGLVANQTGANSN-LPSPFDSISVITARFKDVGLNATDVVVLSGAHTIGRSRCLLF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL+NF  T S DPTLD+SL   LQ  C   G  +  A LD NS D FDNHY++NLL  
Sbjct  210   SNRLANFSATNSVDPTLDSSLASSLQQVC--RGGADQLAALDVNSADAFDNHYYQNLLAN  267

Query  980   RGLLQSDQILFSS--DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +GLL SDQ L SS  D A   +KALVQ Y+ +  RF  DF  SMVKMGNISPLTGS G+I
Sbjct  268   KGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQI  327

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  328   RKNCRAVN  335



>ref|NP_001146489.1| uncharacterized protein LOC100280077 precursor [Zea mays]
 gb|ACL54130.1| unknown [Zea mays]
 tpg|DAA44277.1| TPA: hypothetical protein ZEAMMB73_507981 [Zea mays]
Length=334

 Score =   372 bits (955),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 225/307 (73%), Gaps = 5/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  FY + CP    +VR  V  A+K E RM ASLLRLHFHDCFVNGCDGS+LLDGN+
Sbjct  32    GQLTDDFYDDCCPQAENIVRARVSAAMKAEPRMGASLLRLHFHDCFVNGCDGSILLDGNN  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T  EK A PNLNSARGF+V+D+IK+ +E AC GVVSCADILAIAA+  VLLSGGP + VL
Sbjct  92    T--EKLAGPNLNSARGFDVVDAIKADLEKACPGVVSCADILAIAAKYGVLLSGGPDYDVL  149

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN + A+++ LP PFD +  I  KF  VGLN TD+V LSG HTIG A+C +F
Sbjct  150   LGRRDGLVANQSGANSN-LPSPFDPISTITKKFSDVGLNTTDVVVLSGGHTIGRARCVLF  208

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S RL+NF  T S DPTL+ASL   LQ  C   GDGN TA LD  S D FDNHY++NLL  
Sbjct  209   SGRLANFSATSSVDPTLNASLASSLQALC-RGGDGNQTAALDDGSADAFDNHYYQNLLGQ  267

Query  980   RGLLQSDQILFSS-DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             RGLL SDQ LFSS D +  T++ALVQ Y+  S RFF DF  SM+KMGNI PLTGS G+IR
Sbjct  268   RGLLSSDQGLFSSTDGSAATTRALVQAYSASSERFFCDFGRSMLKMGNILPLTGSAGQIR  327

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  328   SNCRAIN  334



>ref|XP_006649694.1| PREDICTED: peroxidase N-like [Oryza brachyantha]
Length=334

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 228/308 (74%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  +Y   CP ++++VR  V  A+K EMRM ASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  32    GQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDG--  89

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             + SEKFA PN NS RG+EVID+IK+ +ESAC GVVSCADI+A+AA+  VLLSGGP + VL
Sbjct  90    SNSEKFAAPNNNSVRGYEVIDTIKADLESACPGVVSCADIVALAAKYGVLLSGGPDYDVL  149

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+ + LP PFDS+  I   F  VGLN+TD+VALSGAHTIG ++C +F
Sbjct  150   LGRRDGLVANQTGANTN-LPSPFDSISTITKSFQNVGLNVTDVVALSGAHTIGRSRCLLF  208

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S+RL+NF  T S DPTLD+SL P LQ TC   G  N  A LD NS+D+FDNHYF+NLL  
Sbjct  209   SSRLANFSATNSVDPTLDSSLAPSLQQTC--RGGDNQLAALDVNSSDVFDNHYFQNLLAN  266

Query  980   RGLLQSDQILFSS--DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +G+L SDQ L S+  D     +KALVQ Y+ +  RF  DF  SMV+MGNISPLTG  G+I
Sbjct  267   KGVLSSDQGLVSNSDDPTVAATKALVQAYSANGQRFSCDFGRSMVRMGNISPLTGKAGQI  326

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  327   RKNCRAVN  334



>ref|XP_008644819.1| PREDICTED: peroxidase N-like [Zea mays]
 gb|AFW68685.1| anionic peroxidase H [Zea mays]
Length=331

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 231/307 (75%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT+ FY ++CP L+ VV++ V +A++ EMRM ASLLRLHFHDCFVNGCD S+LLDG+  
Sbjct  28    QLTSDFYDSTCPQLYYVVQQHVFDAMREEMRMGASLLRLHFHDCFVNGCDASILLDGDD-  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PNLNS RG+EVID+IK+ +ESAC  VVSCAD++A+AA   VL SGGP + VLL
Sbjct  87    -GEKFALPNLNSVRGYEVIDAIKADLESACPEVVSCADVVALAASYGVLFSGGPYYDVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR DG +AN + AD   LP PF+ +D II KF AVGLN TD+V LSGAHTIG A+CA+FS
Sbjct  146   GRLDGRVANQSGADNG-LPSPFEPVDSIIQKFAAVGLNTTDVVVLSGAHTIGRARCALFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             NRLSNF  T S DPTL+ASL   LQ+ C   NGDGN TA LD +S  +FDN Y+KNLL  
Sbjct  205   NRLSNFSATDSADPTLEASLADSLQSLCAGGNGDGNETAALDVSSPYVFDNDYYKNLLTE  264

Query  980   RGLLQSDQILFSS-DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             RGLL SD  LFSS +    ++K LV+ Y++D ++FF DFV SM++MGNI    GSDGE+R
Sbjct  265   RGLLSSDLGLFSSPEGVAASTKDLVEAYSSDGDQFFYDFVWSMIRMGNIPLAAGSDGEVR  324

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  325   KNCRVVN  331



>ref|XP_008368030.1| PREDICTED: peroxidase N-like [Malus domestica]
Length=312

 Score =   367 bits (941),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 230/300 (77%), Gaps = 21/300 (7%)
 Frame = +2

Query  287   NSCPNLFKVVRKEVQNAIKNE--MRMAASLLRLHFHDCFVNGCDGSVLLDGNSTTSEKFA  460
             NSC   F      + NA K+   M+M+ S           NGCD S+LLDG  T SEK A
Sbjct  30    NSCELEFY----RILNAYKDHVVMKMSES-----------NGCDASLLLDG--TDSEKNA  72

Query  461   VPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRDGF  640
              PNLNSARGFEV+D IKS+VES+CSGVVSCADILAIAARDSVLLSGG +W+VLLGRRDG 
Sbjct  73    RPNLNSARGFEVVDRIKSSVESSCSGVVSCADILAIAARDSVLLSGGTSWKVLLGRRDGL  132

Query  641   LANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLSNF  820
             +AN + A+ S LP P ++LD II+KF AVGLN+TD+V+LSGAHTIGLA+CA FSNRL NF
Sbjct  133   VANQSGAN-SGLPAPTEALDIIISKFAAVGLNITDVVSLSGAHTIGLARCATFSNRLFNF  191

Query  821   QQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQSD  1000
               TG+PD TL+ S++ +LQ  CP   DGNNTAPLDRNSTDLFDNHYF+NL+ G+GLL SD
Sbjct  192   SGTGAPDSTLEQSMLTDLQNQCPQTSDGNNTAPLDRNSTDLFDNHYFQNLINGKGLLGSD  251

Query  1001  QILFSSDAAQNT-SKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTRN  1177
             QILFSSDAA  T +K+LVQ+Y ++ N F ADF  SM+KMGNISPLTGS GEIR NCR  N
Sbjct  252   QILFSSDAAVTTGTKSLVQSYNSNLNLFLADFANSMIKMGNISPLTGSAGEIRLNCRAVN  311



>ref|XP_007162335.1| hypothetical protein PHAVU_001G143300g [Phaseolus vulgaris]
 gb|ESW34329.1| hypothetical protein PHAVU_001G143300g [Phaseolus vulgaris]
Length=331

 Score =   365 bits (937),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 232/307 (76%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL++ FY+++CPN+  +VR  +Q A++++ R+AASL+RLHFHDCFVNGCDGS+LLD  GN
Sbjct  26    QLSSTFYSSTCPNVSSIVRSVIQQALQSDTRIAASLIRLHFHDCFVNGCDGSLLLDQGGN  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK AVPN NSARGF V+D+IK+++E++C GVVSCADILA+AA  SV L GGP+W V
Sbjct  86    ITLSEKNAVPNNNSARGFNVVDNIKTSLENSCPGVVSCADILALAAEASVSLGGGPSWTV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG +AN + A++S+ P P +SL  I AKF AVGLN+TD+VALSGAHT G A+C  
Sbjct  146   LLGRRDGLIANQSGANSSI-PAPTESLANITAKFSAVGLNITDLVALSGAHTFGRAQCRF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL NF  TGSPDPTLD+S +  LQ  CP NG GN    LD +S D FDN+YF+NLL 
Sbjct  205   FNQRLFNFSGTGSPDPTLDSSYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLN  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              RGLLQ+DQ LFS++ +   S  +V  + ++ + FF  F  SM+ MGNISPLTGS GEIR
Sbjct  265   NRGLLQTDQELFSTNGSATMS--IVSNFASNQSAFFEAFAQSMINMGNISPLTGSQGEIR  322

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  323   SDCKKVN  329



>ref|XP_002464560.1| hypothetical protein SORBIDRAFT_01g020830 [Sorghum bicolor]
 gb|EER91558.1| hypothetical protein SORBIDRAFT_01g020830 [Sorghum bicolor]
Length=326

 Score =   365 bits (937),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 228/305 (75%), Gaps = 5/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LT  FY ++CP L+ +VR  V  A++ EMRM ASLLRLHFHDCFVNGCDGS+LLDG  +
Sbjct  27    ELTPNFYHSTCPQLYYIVRHHVFVAMRAEMRMGASLLRLHFHDCFVNGCDGSILLDG--S  84

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA PNLNS RG+EVID+IK+ +E  C  VVSCADI+A+AA   VL SGGP + VLL
Sbjct  85    DGEKFARPNLNSVRGYEVIDAIKADLERVCPEVVSCADIVALAASYGVLFSGGPYYNVLL  144

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN + AD   LP PF+ +D II KF  VGLN TD+V LSGAHTIG A+CA+FS
Sbjct  145   GRKDGLVANQSGADNG-LPSPFEPIDLIIQKFDDVGLNTTDVVVLSGAHTIGRARCALFS  203

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLSNF  T S DPTL+ASL   L++ C + GDGN T+ LD  S  +FDN+Y+KNLL  +
Sbjct  204   NRLSNFSTTESVDPTLEASLADSLESLC-AGGDGNQTSALDVTSPYVFDNNYYKNLLTEK  262

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSS      +K LV+TY+++S +FF DFV SM+KMGNI PLT +DGEIRKN
Sbjct  263   GLLSSDQGLFSSPEGVANTKDLVETYSSNSEQFFCDFVWSMIKMGNI-PLTANDGEIRKN  321

Query  1163  CRTRN  1177
             CR  N
Sbjct  322   CRVAN  326



>dbj|BAJ94281.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   365 bits (937),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 224/306 (73%), Gaps = 4/306 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL+  FY +SCP L  +V+  V  A+K E+RM ASLLRLHFHDCFVNGCDGS+LLDG  
Sbjct  27    GQLSDDFYDDSCPKLDSIVQARVAAAMKAEIRMGASLLRLHFHDCFVNGCDGSILLDG--  84

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PNLNS RG+EVID+IK+ +E AC G+VSCAD++A+AA+  VLLSGGP + VL
Sbjct  85    AESEKLAAPNLNSVRGYEVIDAIKADLEKACPGLVSCADVVALAAKYGVLLSGGPDYDVL  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+ + LP PFD++  II +F  VGLN TD+V LSGAHTIG ++C +F
Sbjct  145   LGRRDGLVANQTLANNN-LPSPFDNITVIIQRFKDVGLNTTDVVILSGAHTIGRSRCVLF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S+RL+NF  T S DPTLD +L   LQ  C   GDGN TA LD  S D FDNHYFKNLL  
Sbjct  204   SSRLANFSATNSVDPTLDPALASSLQQLC-RGGDGNQTAALDAGSADAFDNHYFKNLLAK  262

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ L SS      +KALVQTY+ +S RF  DF  +MV+MGNI+PLTGS G+IRK
Sbjct  263   KGLLSSDQGLVSSPDGAAATKALVQTYSYNSQRFLCDFGDAMVRMGNIAPLTGSAGQIRK  322

Query  1160  NCRTRN  1177
              C   N
Sbjct  323   KCSAVN  328



>ref|XP_009126400.1| PREDICTED: peroxidase N-like isoform X2 [Brassica rapa]
Length=301

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 220/307 (72%), Gaps = 28/307 (9%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL    YA SCP L  +VR++V NA+K + RMAASL+RLHFHDCFVNGCD SVLLDG+ 
Sbjct  21    AQLNPNIYAKSCPYLVLIVRRQVMNALKADTRMAASLIRLHFHDCFVNGCDASVLLDGDD  80

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A+PNLNSARGFEVID+IK+ VE AC GVVSCADIL +AARDSV+LSGGP WRV 
Sbjct  81    --SEKLAIPNLNSARGFEVIDTIKADVEYACPGVVSCADILTLAARDSVVLSGGPQWRVA  138

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR DG +AN ++A+   LP PF+ LD I AKFVAVGLN+ D+VALSG            
Sbjct  139   LGRTDGLVANQSSANN--LPSPFEPLDAITAKFVAVGLNVADVVALSG------------  184

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
                        SPD TL+ +L+ +L+T CP+ G GN TAPLDRNST  FDN+YFKNLL G
Sbjct  185   -----------SPDATLETTLLSDLRTVCPAGGSGNQTAPLDRNSTYAFDNNYFKNLLEG  233

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLT-GSDGEIR  1156
             +GLL SDQILFSSD A NT+K LV+ Y+     FF DF  SM+KMG I+ L  GS GE+R
Sbjct  234   KGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTRSMIKMGGITNLVNGSSGEVR  293

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  294   KNCRVIN  300



>ref|XP_003535116.1| PREDICTED: peroxidase 53-like [Glycine max]
 gb|KHN35656.1| Peroxidase 53 [Glycine soja]
Length=331

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 229/308 (74%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
             GQL++ FY+++C N+  +VR  VQ A++++ R+ ASL RLHFHDCFVNGCD S+LLD  G
Sbjct  25    GQLSSTFYSSTCSNVSSIVRSAVQQALQSDSRIGASLSRLHFHDCFVNGCDASILLDQGG  84

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK A PN+NS RGF+V+D+IKS++ES+C GVVSCADILA+AA  SV LSGGP+W 
Sbjct  85    NITQSEKNAAPNVNSIRGFDVVDNIKSSLESSCPGVVSCADILALAAESSVSLSGGPSWN  144

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRDG  AN   A++S+ P PF+SL  + +KF AVGL+ TD+VALSGAHT G A+C 
Sbjct  145   VLLGRRDGLTANQAGANSSI-PSPFESLANVTSKFSAVGLDTTDLVALSGAHTFGRAQCQ  203

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  TGSPDPTL+++ +  LQ  CP +G G+    LD ++ D FDN+YF NLL
Sbjct  204   FFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQSGSGSTLNNLDPSTPDTFDNNYFTNLL  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQ+DQ LFSS+ +   S  +V  + N+ + FF  FV SM+ MGNISPLTGS GEI
Sbjct  264   INQGLLQTDQELFSSNGSSTIS--IVNNFANNQSAFFEAFVQSMINMGNISPLTGSQGEI  321

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  322   RTDCKKLN  329



>gb|EMT06858.1| Peroxidase N [Aegilops tauschii]
Length=329

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL+  FY +SCP L  +V+  V  A+K E+RM ASLLRLHFHDCFVNGCDGS+LLDG  
Sbjct  28    GQLSDDFYDDSCPKLESIVQARVAAAMKAEIRMGASLLRLHFHDCFVNGCDGSILLDG--  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PNLNS RG+EVID+IK+ +E AC G+VSCAD++A+AA+  VLLSGGP + VL
Sbjct  86    AESEKLAAPNLNSGRGYEVIDAIKADLEKACPGLVSCADVVALAAKYGVLLSGGPDYDVL  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+ + LP PFD++  II +F  VGLN TD+V LSGAHTIG ++C +F
Sbjct  146   LGRRDGLVANQTLANNN-LPSPFDNITVIIQRFKDVGLNTTDVVILSGAHTIGRSRCVLF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S RL+NF    S DPT+D +L   LQ  C   GDGN TA LD  S D FDNHYFKNLL  
Sbjct  205   SGRLANFSAANSVDPTMDPALASSLQQLC-RGGDGNQTAALDAGSADAFDNHYFKNLLAK  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ L SS      ++ALVQ Y+ +S RF  DF  +MV+MGNI+PLTGS G+IRK
Sbjct  264   KGLLSSDQGLVSSPDGAAATRALVQAYSYNSQRFLCDFGDAMVRMGNIAPLTGSAGQIRK  323

Query  1160  NCRTRN  1177
              C   N
Sbjct  324   KCSAAN  329



>ref|XP_006575205.1| PREDICTED: peroxidase 53-like [Glycine max]
Length=331

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 228/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL   FY+++CPN+  +V   VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD  GN
Sbjct  26    QLNATFYSSTCPNVSSIVSNAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDQGGN  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK AVPN NS RGF+++D+IKS++ES+C GVVSCADILA+AA  SV LSGGP+W V
Sbjct  86    ITQSEKNAVPNFNSVRGFDIVDNIKSSLESSCPGVVSCADILALAAESSVSLSGGPSWNV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  AN   A++S LP PF+SL  + +KF AVGL+ TD+VALSGAHT G ++C  
Sbjct  146   LLGRRDGLTANQAGANSS-LPSPFESLANVSSKFSAVGLDTTDLVALSGAHTFGRSQCQF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  TGSPDPTL+++ +  LQ  CP NG+G+    LD ++ D FDN+YF NLLI
Sbjct  205   FSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQNGNGSTLNNLDPSTPDTFDNNYFTNLLI  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQ+DQ LFS++ +   S  +V  + N+ + FFA F  SM+ MGNISPLTG+ GEIR
Sbjct  265   NQGLLQTDQELFSTNGSSTIS--IVNNFANNQSAFFAAFAQSMINMGNISPLTGTQGEIR  322

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  323   TDCKKVN  329



>gb|KEH41719.1| peroxidase family protein [Medicago truncatula]
Length=328

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 224/308 (73%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
             GQL   FY+N+CPN+  +V+  VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD  G
Sbjct  22    GQLNATFYSNTCPNVSSIVKNAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDQGG  81

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK A PN NS RGF V+D+IKS++ES+CSGVVSCADILA+AA  SV L+GGP+W 
Sbjct  82    NITQSEKNAAPNFNSIRGFGVVDTIKSSLESSCSGVVSCADILALAAESSVSLAGGPSWN  141

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRDG  AN   A++S+ P PF+SL  + +KF AV L+ TDMVALSGAHT G A+C 
Sbjct  142   VLLGRRDGLTANQGGANSSI-PSPFESLANVTSKFSAVNLDTTDMVALSGAHTFGRAQCQ  200

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  TG+PDPTL+ + +  LQ  CP NG+G+    LD ++ D FDN+YF NLL
Sbjct  201   FFSQRLFNFNGTGNPDPTLNTTYLATLQQNCPQNGNGSTLNNLDPSTQDTFDNNYFTNLL  260

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQ+DQ LFS++ +   S  +V T+ N+   FF  F  SM+ MGNISPLTG+ GEI
Sbjct  261   TKMGLLQTDQHLFSTNGSSTVS--IVNTFANNQTAFFNQFAQSMINMGNISPLTGTQGEI  318

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  319   RIDCKKVN  326



>gb|KHN41710.1| Peroxidase 53 [Glycine soja]
Length=331

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 227/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL   FY+++CPN+  +V   VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD  GN
Sbjct  26    QLNATFYSSTCPNVSSIVSNAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDQGGN  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK AVPN NS RGF+++D+IKS++ES+C GVVSCADILA+AA  SV LSGGP+W V
Sbjct  86    ITQSEKNAVPNFNSVRGFDIVDNIKSSLESSCPGVVSCADILALAAESSVSLSGGPSWNV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  AN   A++S LP PF+SL  + +KF AVGL+ TD+VALSGAHT G ++C  
Sbjct  146   LLGRRDGLTANQAGANSS-LPSPFESLANVSSKFSAVGLDTTDLVALSGAHTFGRSQCQF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  TGSPDPTL+++ +  LQ  CP NG+G+    LD ++ D FDN+YF NLLI
Sbjct  205   FSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQNGNGSTLNNLDPSTPDTFDNNYFTNLLI  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQ+DQ LFS++ +   S  +V  + N+ + FF  F  SM+ MGNISPLTG+ GEIR
Sbjct  265   NQGLLQTDQELFSTNGSSTIS--IVNNFANNQSAFFEAFAQSMINMGNISPLTGTQGEIR  322

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  323   TDCKKVN  329



>gb|KHN07440.1| Peroxidase 15 [Glycine soja]
Length=330

 Score =   357 bits (916),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 228/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL++ FY+++CPN+  +VR  VQ A++++ R+AASL RLHFHDCFVNGCDGS+LLD  GN
Sbjct  25    QLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASLTRLHFHDCFVNGCDGSILLDVGGN  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK A PN NSARGF+V+D+IK+++E++C GVVSCADILA+AA  SV L GGP+W V
Sbjct  85    ITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVVSCADILALAAEVSVSLGGGPSWNV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG +AN + A+ S+ P P +SL  + AKF AVGLN+TD+VALSGAH+ G A+C  
Sbjct  145   LLGRRDGLIANQSGANTSI-PNPTESLANVTAKFAAVGLNITDLVALSGAHSFGRAQCRF  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL NF  TGSPDPTL+A+ +  LQ  CP NG GN    LD +S D FDN+YF+NLL 
Sbjct  204   FNQRLFNFSGTGSPDPTLNATYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLS  263

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQ+DQ LFS++ A   S  +V  +  +   FF  F  SM+ MGNISPLTGS GEIR
Sbjct  264   NQGLLQTDQELFSTNGAATVS--VVNNFAANQTAFFQAFAQSMINMGNISPLTGSQGEIR  321

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  322   SDCKRVN  328



>ref|XP_006661598.1| PREDICTED: peroxidase N-like [Oryza brachyantha]
Length=328

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/305 (60%), Positives = 224/305 (73%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY  +CP+++ +V+  V +A++ EMRM ASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  30    QLSDDFYDYTCPHVYNIVQHHVYSAMRTEMRMGASLLRLHFHDCFVNGCDGSILLDGDD-  88

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN NS RG+EVID+IK  +E+ C  VVSCADI+A+AA   VL SGGP + VLL
Sbjct  89    -GEKFAIPNKNSVRGYEVIDAIKEDLENICPEVVSCADIVALAAGYGVLFSGGPYYDVLL  147

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG LAN + A+   LP PF+++  II KF  VGL+ TD+V LSGAHTIG A+C +FS
Sbjct  148   GRRDGLLANQSGANNG-LPSPFENITSIIGKFGDVGLDTTDVVVLSGAHTIGRARCKLFS  206

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLS    + S DPTLDA++   LQ+ C + GDGN T  LD  S D+FDN Y++NLL  R
Sbjct  207   NRLST--TSSSADPTLDATMAANLQSLC-NGGDGNQTTALDITSADVFDNRYYQNLLNQR  263

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSS      +K LVQTY+ + +RFF DF  SMVKMGNISPLTG DG+IRKN
Sbjct  264   GLLSSDQGLFSSVDGVANTKDLVQTYSANGHRFFWDFARSMVKMGNISPLTGDDGQIRKN  323

Query  1163  CRTRN  1177
             CR  N
Sbjct  324   CRAVN  328



>ref|XP_003521220.1| PREDICTED: peroxidase 15-like [Glycine max]
Length=330

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 227/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL++ FY+++CPN+  +VR  VQ A++++ R+AASL RLHFHDCFVNGCDGS+LLD  GN
Sbjct  25    QLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASLTRLHFHDCFVNGCDGSILLDVGGN  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK A PN NSARGF+V+D+IK+++E++C GVVSCADILA+AA  SV L GGP+W V
Sbjct  85    ITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVVSCADILALAAEVSVSLGGGPSWNV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG +AN + A+ S+ P P +SL  + AKF AVGLN+TD+VALSGAH+ G A+C  
Sbjct  145   LLGRRDGLIANQSGANTSI-PNPTESLANVTAKFAAVGLNITDLVALSGAHSFGRAQCRF  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL NF  TGSPDPTL+ + +  LQ  CP NG GN    LD +S D FDN+YF+NLL 
Sbjct  204   FNQRLFNFSGTGSPDPTLNTTYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLS  263

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQ+DQ LFS++ A   S  +V  +  +   FF  F  SM+ MGNISPLTGS GEIR
Sbjct  264   NQGLLQTDQELFSTNGAATVS--VVNNFAANQTAFFQAFAQSMINMGNISPLTGSQGEIR  321

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  322   SDCKRVN  328



>ref|XP_004497888.1| PREDICTED: peroxidase 53-like [Cicer arietinum]
Length=329

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 223/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
             GQL   FY+N+CPN+  +V+  VQ A++++ R+ ASL RLHFHDCFVNGCD S+LLD  G
Sbjct  23    GQLNATFYSNTCPNVSSIVKNIVQQALQSDSRIGASLTRLHFHDCFVNGCDASILLDQGG  82

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK A PN NS RGF VID+IKS++ES+CSGVVSCADI+A+AA  SV +SGGP+W 
Sbjct  83    NITQSEKNAAPNFNSIRGFNVIDNIKSSLESSCSGVVSCADIVALAAESSVSMSGGPSWN  142

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRDG  AN   A+ S+ P PF+SL  I +KF AVGL+ TD+VALSGAHT G A+C 
Sbjct  143   VLLGRRDGLTANQGGANTSI-PSPFESLANITSKFSAVGLDTTDLVALSGAHTFGRAQCK  201

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  +GSPDPTL+++ +  LQ  CP NG+G+    LD ++ D FDN+YF NLL
Sbjct  202   FFSQRLFNFSGSGSPDPTLNSTYLATLQQNCPQNGNGSTLNNLDPSTQDTFDNNYFSNLL  261

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I  GLLQ+DQ L S++ +   S  +V  + N+   FF  F  SM+ MGNISPLTG+ GEI
Sbjct  262   INMGLLQTDQELLSTNGSSTIS--IVNNFANNQTAFFNQFAQSMINMGNISPLTGNQGEI  319

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  320   RVDCKKVN  327



>ref|XP_009784679.1| PREDICTED: peroxidase 15-like [Nicotiana sylvestris]
Length=330

 Score =   354 bits (909),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 226/309 (73%), Gaps = 6/309 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+ +CPN+  +V+  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD N+
Sbjct  25    AQLSANFYSTTCPNVSSIVQNAIQQALQSDARIGASLIRLHFHDCFVNGCDASLLLDNNA  84

Query  440   T---TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
             T    SEK A PN NSARGF+V+D+IKSAVES+C GVVSCADILA+AA  SV L+GGP+W
Sbjct  85    TANIVSEKDAAPNANSARGFDVVDNIKSAVESSCPGVVSCADILALAAEASVSLAGGPSW  144

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKC  790
              V LGRRD   AN   A+ S+ P PF+ L  I AKF AVGLN+TD+VALSGAHT G A+C
Sbjct  145   NVSLGRRDSRTANQGGANTSI-PSPFEGLSNITAKFSAVGLNVTDLVALSGAHTFGRAQC  203

Query  791   AVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNL  970
              VFS RL+NF  TG+PDPTL+ + +  L+  CP NG+    A LD  ++D FDN+YF NL
Sbjct  204   RVFSARLNNFNGTGNPDPTLNTTYLANLRQICPQNGNATALANLDPTTSDSFDNNYFTNL  263

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                +GLLQSDQ LFS+  A   S  +V T++++ N FF  FV SM+ MGNISPLTG++GE
Sbjct  264   QNNQGLLQSDQELFSTAGAATVS--IVNTFSSNQNTFFQSFVQSMITMGNISPLTGTNGE  321

Query  1151  IRKNCRTRN  1177
             IR +C+  N
Sbjct  322   IRSDCKRVN  330



>ref|XP_006848540.1| hypothetical protein AMTR_s00169p00032570 [Amborella trichopoda]
 gb|ERN10121.1| hypothetical protein AMTR_s00169p00032570 [Amborella trichopoda]
Length=311

 Score =   353 bits (907),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 224/308 (73%), Gaps = 8/308 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY +SCPNL ++V+  V  A+KN+ RMAASLLRLHFHDCFVNGCD S+LLD  + 
Sbjct  7     QLDYNFYKSSCPNLTRLVKGAVWAAVKNDSRMAASLLRLHFHDCFVNGCDASLLLDDTAN  66

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              TSEK A PN NS RGFEV+D+IK++VE  C   VSC+DILA+AARDSV L GGP W V 
Sbjct  67    FTSEKNAGPNRNSTRGFEVVDTIKASVEKECPATVSCSDILALAARDSVFLMGGPYWYVY  126

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG + + +AA++ + PGP +SLD+I  KFVA GLNL D+V LSG HT G AKC+ F
Sbjct  127   LGRRDGKVGSESAANSEI-PGPSESLDKITDKFVAKGLNLKDVVVLSGGHTFGFAKCSTF  185

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGD--GNNTAPLDRNSTDLFDNHYFKNLL  973
             S+RL N   TGSPDPTLD++L+ +LQ+ CP+N      N APLDR +T+ FDN Y+KNL+
Sbjct  186   SSRLFNHSGTGSPDPTLDSTLLEDLQSQCPNNASDTSTNLAPLDRVTTNYFDNVYYKNLI  245

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLL+SDQ L ++    N + ++V  Y+ +   FF DF+ SMVKM NIS LTG DG+I
Sbjct  246   NNLGLLKSDQALLTN----NQTASMVANYSYNQYLFFKDFMVSMVKMANISVLTGQDGDI  301

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  302   RKNCRFVN  309



>gb|KDO70903.1| hypothetical protein CISIN_1g019976mg [Citrus sinensis]
Length=333

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 226/307 (74%), Gaps = 4/307 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL + FYA +CPN+  +VR  +Q A+++++R+ ASL+RLHFHDCFVNGCDGSVLLD  GN
Sbjct  27    QLNSSFYATTCPNVTTIVRNALQQAMQSDIRIGASLIRLHFHDCFVNGCDGSVLLDRGGN  86

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK   PN NSARGF V+D+IK+AVE++C GVVSCADILA+AA  SV L+GGP+W V
Sbjct  87    ITQSEKDGGPNTNSARGFGVVDNIKTAVENSCPGVVSCADILALAAESSVSLAGGPSWNV  146

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  AN + A++S+ P P DSL  + +KF AVGL+ TD+VALSGAHT G A+C V
Sbjct  147   LLGRRDGLRANQSGANSSI-PAPIDSLSNLTSKFSAVGLDTTDLVALSGAHTFGRAQCRV  205

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  TG+PDPT++ + +  L+  CP NG+G+  A LD  + D FDN+Y+ NL  
Sbjct  206   FSGRLYNFNGTGNPDPTVNGTYLTTLRQICPQNGNGSALANLDPTTADTFDNNYYTNLQN  265

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS++       A+V  + ++   FF  FV SM+ MGNISPLTGS+GEIR
Sbjct  266   NQGLLQSDQELFSTNGPA-AIVAIVNNFASNQTAFFQQFVQSMINMGNISPLTGSNGEIR  324

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  325   ADCKKVN  331



>ref|XP_007145698.1| hypothetical protein PHAVU_007G260700g [Phaseolus vulgaris]
 gb|ESW17692.1| hypothetical protein PHAVU_007G260700g [Phaseolus vulgaris]
Length=334

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 221/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
             GQL+  FY+++C N+  +VR  VQ A+ ++ R+AASL+RLHFHDCFV+GCDGS+LLD  G
Sbjct  28    GQLSASFYSSTCSNVSSIVRDSVQQALTSDSRIAASLIRLHFHDCFVDGCDGSILLDVDG  87

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK A PN NS RGF+V+DSIKS +E++C  VVSCADILA+AA  SV LSGGP+W 
Sbjct  88    NITESEKNAAPNENSVRGFDVVDSIKSTIEASCPAVVSCADILALAAEASVSLSGGPSWN  147

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGR+DG  AN   A+ S+ P PF SL  I +KF  VGL+ TD+VALSGAHT G A+C 
Sbjct  148   VLLGRKDGLTANQAGANTSI-PSPFQSLANITSKFSDVGLDTTDLVALSGAHTFGRAQCQ  206

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  TGSPDPTL+ + +  LQ  CP NG+G     LD ++ D FDN YF NLL
Sbjct  207   FFSQRLLNFNGTGSPDPTLNTTYLGTLQQNCPQNGNGATLNNLDPSTPDTFDNKYFTNLL  266

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQ+DQ LFS+D +   S  +V  + N+ + FF  F  SM+ MGNISPLTG+ G+I
Sbjct  267   INQGLLQTDQELFSTDGSSTIS--IVNNFANNQSAFFEAFAQSMINMGNISPLTGTQGQI  324

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  325   RTDCKKVN  332



>ref|XP_006492847.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 53-like [Citrus sinensis]
Length=333

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 225/307 (73%), Gaps = 4/307 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL + FYA +CPN+  +VR  +Q A+ +++R+ ASL+RLHFHDCFVNGCDGSVLLD  GN
Sbjct  27    QLNSSFYATTCPNVTTIVRNALQQAMXSDIRIGASLIRLHFHDCFVNGCDGSVLLDRGGN  86

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK   PN NSARGF V+D+IK+AVE++C GVVSCADILA+AA  SV L+GGP+W V
Sbjct  87    ITQSEKDGGPNTNSARGFGVVDNIKTAVENSCPGVVSCADILALAAESSVSLAGGPSWNV  146

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  AN + A++S+ P P DSL  + +KF AVGL+ TD+VALSGAHT G A+C V
Sbjct  147   LLGRRDGLRANQSGANSSI-PAPIDSLSNLTSKFSAVGLDTTDLVALSGAHTFGRAQCRV  205

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  TG+PDPT++ + +  L+  CP NG+G+  A LD  + D FDN+Y+ NL  
Sbjct  206   FSGRLYNFNGTGNPDPTVNGTYLTTLRQICPQNGNGSALANLDPTTADTFDNNYYTNLQN  265

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS++       A+V  + ++   FF  FV SM+ MGNISPLTGS+GEIR
Sbjct  266   NQGLLQSDQELFSTNGPA-AIVAIVNNFASNQTAFFQQFVQSMINMGNISPLTGSNGEIR  324

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  325   ADCKKVN  331



>ref|XP_003625275.1| Peroxidase [Medicago truncatula]
 gb|AES81493.1| peroxidase family protein [Medicago truncatula]
Length=373

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 224/308 (73%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
              QLT+ FY+N+CP++  +VR  VQ A++N+ R+ ASL RLHFHDCFVNGCD S+LLD  G
Sbjct  67    AQLTSTFYSNTCPSVSSIVRNVVQQALQNDPRITASLTRLHFHDCFVNGCDASLLLDQGG  126

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK AVPN NSARGF+V+D IK++VE++C  VVSCADILA+AA  SV LSGGP+W 
Sbjct  127   NITLSEKNAVPNNNSARGFDVVDKIKTSVENSCPSVVSCADILALAAEASVSLSGGPSWN  186

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRDG +AN + A+ S+ P P +SL  + AKF AVGLN +D+VALSGAHT G  +C 
Sbjct  187   VLLGRRDGLIANQSGANTSI-PNPTESLANVTAKFAAVGLNTSDLVALSGAHTFGRGQCR  245

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              F+ RL NF  TG PDPTL+++ +  LQ  CP NG GN    LD +S + FDN+YFKNLL
Sbjct  246   FFNQRLFNFSGTGKPDPTLNSTYLATLQQNCPQNGSGNTLNNLDPSSPNNFDNNYFKNLL  305

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLLQ+DQ LFS++ A   S  +V  + ++   FF  FV SM+ MGNISPL GS GEI
Sbjct  306   KNQGLLQTDQELFSTNGAATIS--IVNNFASNQTAFFEAFVQSMINMGNISPLIGSQGEI  363

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  364   RSDCKKVN  371



>ref|NP_001064031.1| Os10g0109600 [Oryza sativa Japonica Group]
 gb|AAM08519.1|AC068654_21 Putative peroxidase [Oryza sativa Japonica Group]
 gb|AAP51824.1| Peroxidase N precursor, putative, expressed [Oryza sativa Japonica 
Group]
 tpe|CAH69368.1| TPA: class III peroxidase 126 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF25945.1| Os10g0109600 [Oryza sativa Japonica Group]
 gb|EAZ15083.1| hypothetical protein OsJ_30495 [Oryza sativa Japonica Group]
 dbj|BAG87793.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94135.1| unnamed protein product [Oryza sativa Japonica Group]
 prf||2114377A peroxidase:ISOTYPE=RPA
Length=326

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 222/305 (73%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY   CP+++ VV++ V  A++ EMRM ASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  28    QLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLHFHDCFVNGCDGSILLDGDD-  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN NS RGFEVID+IK  +E+ C  VVSCADI+A+AA   VL SGGP + VLL
Sbjct  87    -GEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADIVALAAGYGVLFSGGPYYDVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN + AD   LP PF+ +  II KF  VGL+ TD+V LSG HTIG A+C +FS
Sbjct  146   GRRDGLVANQSGADNG-LPSPFEPIKSIIQKFNDVGLDTTDVVVLSGGHTIGRARCTLFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLS    + S DPTLDA++   LQ+ C + GDGN T  LD  S  +FDN Y++NLL  +
Sbjct  205   NRLST--TSSSADPTLDATMAANLQSLC-AGGDGNETTVLDITSAYVFDNRYYQNLLNQK  261

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD     +K LV+TY+ D+++FF DF  SMVKMGNISPLTG DG+IRKN
Sbjct  262   GLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGRSMVKMGNISPLTGDDGQIRKN  321

Query  1163  CRTRN  1177
             CR  N
Sbjct  322   CRVVN  326



>ref|XP_010491253.1| PREDICTED: peroxidase 54-like [Camelina sativa]
Length=359

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 227/315 (72%), Gaps = 4/315 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD   S
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDAGS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NS RGF V+D+IK+A+E+AC G+VSC+D+LA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAPPNANSTRGFNVVDNIKTALENACPGIVSCSDVLALASEASVSLAGGPSWSVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN T A++S LP PF+ L+ I +KFVAVGLN TD+VALSGAHT G AKC  F
Sbjct  152   LGRRDGLNANLTGANSS-LPSPFEGLNNITSKFVAVGLNTTDVVALSGAHTFGRAKCVTF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG G+    LD  + D FDN YF NL   
Sbjct  211   NNRLFNFSGTGNPDPTLNSTLLSSLQQICPHNGSGSGITNLDLTTPDAFDNSYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++   FF  FV SM+ MGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELFSNTGSD--TVAIVNSFASNQTLFFEAFVQSMINMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN*IINPLTHS  1204
             +C+  N   +P T +
Sbjct  329   DCKAVNGQSSPSTEA  343



>dbj|BAA84764.1| peroxidase [Oryza sativa Japonica Group]
Length=326

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/305 (59%), Positives = 222/305 (73%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY   CP+++ V+++ V  A++ EMRM ASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  28    QLSDDFYDYICPDVYTVLQQHVYAAMRTEMRMGASLLRLHFHDCFVNGCDGSILLDGDD-  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN NS RGFEVID+IK  +E+ C  VVSCADI+A+AA   VL SGGP + VLL
Sbjct  87    -GEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADIVALAAGYGVLFSGGPYYDVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN + AD   LP PF+ +  II KF  VGL+ TD+V LSG HTIG A+C +FS
Sbjct  146   GRRDGLVANQSGADNG-LPSPFEPIKSIIQKFNDVGLDTTDVVVLSGGHTIGRARCTLFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLS    + S DPTLDA++   LQ+ C + GDGN T  LD  S  +FDN Y++NLL  +
Sbjct  205   NRLST--TSSSADPTLDATMAANLQSLC-AGGDGNETTVLDITSAYVFDNRYYQNLLNQK  261

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD     +K LV+TY+ D+++FF DF  SMVKMGNISPLTG DG+IRKN
Sbjct  262   GLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGRSMVKMGNISPLTGDDGQIRKN  321

Query  1163  CRTRN  1177
             CR  N
Sbjct  322   CRVVN  326



>gb|EAY77487.1| hypothetical protein OsI_32530 [Oryza sativa Indica Group]
Length=326

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/305 (59%), Positives = 222/305 (73%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY   CP+++ VV++ V  A++ EMRM ASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  28    QLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLHFHDCFVNGCDGSILLDGDD-  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN NS RGFEVID+IK  +E+ C  VVSCADI+A+AA   VL SGGP + VLL
Sbjct  87    -GEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADIVALAAGYGVLFSGGPYYDVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN + AD   LP PF+ +  II KF  VGL+ TD+V LSG HTIG A+C +FS
Sbjct  146   GRRDGLVANQSGADNG-LPSPFEPIKSIIQKFNDVGLDTTDVVVLSGGHTIGRARCTLFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLS    + S DPTLDA++   LQ+ C + GDGN T  LD  S  +FDN Y++NLL  +
Sbjct  205   NRLST--TSSSADPTLDATMAANLQSLC-AGGDGNETTVLDITSAYVFDNRYYQNLLNQK  261

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD     +K LV+TY+ ++++FF DF  SMVKMGNISPLTG DG+IRKN
Sbjct  262   GLLSSDQGLFSSDDGIANTKELVETYSANAHKFFWDFGRSMVKMGNISPLTGDDGQIRKN  321

Query  1163  CRTRN  1177
             CR  N
Sbjct  322   CRVVN  326



>gb|EYU20688.1| hypothetical protein MIMGU_mgv1a009598mg [Erythranthe guttata]
Length=337

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 222/308 (72%), Gaps = 4/308 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN--  436
             QL + FY+NSCPN+  +V   +Q A++++ R+ ASLLRLHFHDCFV GCDGS+LLD N  
Sbjct  29    QLNSSFYSNSCPNVSNIVTTVIQQALQSDPRIGASLLRLHFHDCFVQGCDGSILLDNNVN  88

Query  437   -STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
              +  SEK A PN NS RGF+V+D+IKSAVE++C GVVSCADILA+A++ SV L+GGP+W 
Sbjct  89    GTIQSEKDAAPNTNSTRGFDVVDNIKSAVENSCPGVVSCADILALASQSSVSLAGGPSWN  148

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRDG  AN   A+ ++ P PF++L  + AKF AVGLN+TD+VALSGAHT G A+C 
Sbjct  149   VLLGRRDGTSANQAGANTAI-PAPFENLTNLTAKFSAVGLNITDLVALSGAHTFGRAQCR  207

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
             +F NRL NF  +G PDP L+A+ +  L+  CP NG G + A LD  + D FD +YF NL 
Sbjct  208   LFRNRLYNFSGSGGPDPLLNATYLASLRQICPQNGGGFSVADLDPTTPDTFDANYFSNLQ  267

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLLQSDQ LFS+ A   T+  +V  ++ + + FF  FV SM+ MGNISPL G +GEI
Sbjct  268   SNQGLLQSDQELFSASAGAQTTLPIVNMFSGNQSAFFQSFVASMINMGNISPLIGVNGEI  327

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  328   RSNCRRVN  335



>dbj|BAA03372.1| putative peroxidase [Oryza sativa Japonica Group]
Length=326

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/305 (59%), Positives = 221/305 (72%), Gaps = 6/305 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY   CP+++ VV++ V  A++ EMRM ASLLRLHFHDCFVNGCDGS+LLDG+  
Sbjct  28    QLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLHFHDCFVNGCDGSILLDGDD-  86

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
               EKFA+PN  S RGFEVID+IK  +E+ C  VVSCADI+A+AA   VL SGGP + VLL
Sbjct  87    -GEKFALPNKTSVRGFEVIDAIKEDLENICPEVVSCADIVALAAGYGVLFSGGPYYDVLL  145

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRDG +AN + AD   LP PF+ +  II KF  VGL+ TD+V LSG HTIG A+C +FS
Sbjct  146   GRRDGLVANQSGADNG-LPSPFEPIKSIIQKFNDVGLDTTDVVVLSGGHTIGRARCTLFS  204

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRLS    + S DPTLDA++   LQ+ C + GDGN T  LD  S  +FDN Y++NLL  +
Sbjct  205   NRLST--TSSSADPTLDATMAANLQSLC-AGGDGNETTVLDITSAYVFDNRYYQNLLNQK  261

Query  983   GLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKN  1162
             GLL SDQ LFSSD     +K LV+TY+ D+++FF DF  SMVKMGNISPLTG DG+IRKN
Sbjct  262   GLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGRSMVKMGNISPLTGDDGQIRKN  321

Query  1163  CRTRN  1177
             CR  N
Sbjct  322   CRVVN  326



>ref|XP_004497889.1| PREDICTED: peroxidase 53-like [Cicer arietinum]
Length=329

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 222/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
             GQL   FY+N+CPN+  +V+  VQ A++++ R+ ASLLRLHFHDC VNGCD S+LLD  G
Sbjct  23    GQLNATFYSNTCPNVLSIVKNAVQQALQSDSRVGASLLRLHFHDCIVNGCDASILLDQGG  82

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK A PN NS RG +VID+IKS++ES+CSGVVSCADI+A+AA  SV LSGGP+W 
Sbjct  83    NITQSEKDAAPNSNSIRGLDVIDNIKSSLESSCSGVVSCADIVALAAESSVSLSGGPSWN  142

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRD   AN   A+ +++P PF+SL QI  KF  VGL+ TD+VALSGAHT G A+C 
Sbjct  143   VLLGRRDSLTANQAGAN-NLIPSPFESLAQITTKFSNVGLDTTDLVALSGAHTFGRARCQ  201

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
             +FS RL NF  +GSPDPTL+++ +  LQ  CP NG+G+     D ++ D FDN+YF NLL
Sbjct  202   LFSQRLFNFSGSGSPDPTLNSTYLATLQQNCPQNGNGSTLNNFDPSTPDTFDNNYFSNLL  261

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I  GLLQ+DQ L S++ +   S  +V  + N+   FF  F  SM+ MGNISPLTG+ GEI
Sbjct  262   INMGLLQTDQELLSTNGSSTIS--IVNNFANNQTAFFNQFAQSMINMGNISPLTGNQGEI  319

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  320   RIDCKKVN  327



>ref|XP_009610510.1| PREDICTED: peroxidase 15 {ECO:0000303|PubMed:17936696}-like [Nicotiana 
tomentosiformis]
Length=329

 Score =   350 bits (897),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/309 (57%), Positives = 223/309 (72%), Gaps = 6/309 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+ +CPN+  +V+  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD NS
Sbjct  24    AQLSANFYSTTCPNVSSIVQNVIQQALQSDSRIGASLIRLHFHDCFVNGCDASLLLDNNS  83

Query  440   T---TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
             T    SEK A PN NS RGF+V+D+IKSAVES+C GVVSCADILA+AA  SV L+GGP+W
Sbjct  84    TANIVSEKDAAPNANSVRGFDVVDNIKSAVESSCPGVVSCADILALAAEASVSLAGGPSW  143

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKC  790
              V LGRRD   AN   A+ S+ P P + L  I AKF AVGLN+TD+VALSGAHT G A+C
Sbjct  144   NVSLGRRDSRTANQGGANTSI-PSPVEGLSNITAKFSAVGLNVTDLVALSGAHTFGRAQC  202

Query  791   AVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNL  970
              VFS RL+NF  TG+PDPTL+ + +  L+  CP NG     A LD  ++D FDN+YF NL
Sbjct  203   RVFSARLNNFNGTGNPDPTLNTTYLANLRQICPQNGSATALANLDPTTSDSFDNNYFANL  262

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                +GLLQSDQ LFS+  A   S  +V T++++ N FF  FV SM+ MGNISPLTG++GE
Sbjct  263   QSNQGLLQSDQELFSTPGAATVS--IVNTFSSNQNTFFQSFVQSMINMGNISPLTGTNGE  320

Query  1151  IRKNCRTRN  1177
             IR +C+  N
Sbjct  321   IRSDCKRVN  329



>ref|XP_006399147.1| hypothetical protein EUTSA_v10013916mg [Eutrema salsugineum]
 gb|ESQ40600.1| hypothetical protein EUTSA_v10013916mg [Eutrema salsugineum]
Length=361

 Score =   350 bits (899),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 220/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD   S
Sbjct  33    QLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSILLDDSGS  92

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+AC G+VSC+D+LA+A+  SV L+GGPTW VL
Sbjct  93    IQSEKNAAPNANSARGFNVVDNIKTALENACPGIVSCSDVLALASEASVSLAGGPTWTVL  152

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN   A+ S LP PF+ L+ I +KF AVGLN TD+VALSGAHT G   C  F
Sbjct  153   LGRRDGLTANQAGANTS-LPSPFEGLNNITSKFSAVGLNTTDLVALSGAHTFGRGNCVTF  211

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG G+    LD ++ D FDN+YF NL   
Sbjct  212   NNRLFNFNGTGNPDPTLNSTLLSSLQQICPQNGSGSGITNLDLSTPDAFDNNYFTNLQSN  271

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS   +   + A+V ++ ++   FF  F  SM+KMGNISPLTGS GEIR+
Sbjct  272   NGLLQSDQELFSDTGSP--TIAIVTSFASNQTLFFEAFAQSMIKMGNISPLTGSSGEIRQ  329

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  330   DCKVIN  335



>emb|CDX98950.1| BnaC09g48850D [Brassica napus]
Length=358

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY+ +CPN+  +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD ++T
Sbjct  32    QLNATFYSGTCPNVSAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDSAT  91

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK AVPN NS RGF V+D IK+A+E+AC G+VSC+DILA+A+  SV L+GGPTW VL
Sbjct  92    IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPTWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN + A+   LP PF+ +  I AKF AVGLN TD+V LSGAHT G A CA F
Sbjct  152   LGRRDGLTANLSGANTG-LPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFGRAACATF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TGSPDPTL+++L+  LQ  CP NG+ +    LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGNASVVTNLDLSTPDAFDNNYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ L S   +   +  +V ++ ++  +FF  F  SM+KMGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELLSDTGSP--TIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKVVN  334



>ref|XP_010452613.1| PREDICTED: peroxidase 54 [Camelina sativa]
Length=358

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD   S
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDTGS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NS RGF V+D+IK+A+E+AC G+VSC+D+LA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAPPNANSTRGFNVVDNIKTALENACPGIVSCSDVLALASEASVSLAGGPSWSVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN T A++S LP PF+ L+ I +KFVAVGLN TD+VALSGAHT G  KC  F
Sbjct  152   LGRRDGLNANLTGANSS-LPSPFEGLNNITSKFVAVGLNTTDVVALSGAHTFGRGKCVTF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP N  G+    LD  + D FDN YF NL   
Sbjct  211   NNRLFNFSGTGNPDPTLNSTLLSSLQQICPQNSSGSGITNLDLTTPDAFDNSYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++   FF  FV SM+ MGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELFSNSGS--ATVAVVNSFASNQTLFFEAFVQSMINMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKVVN  334



>ref|XP_007145699.1| hypothetical protein PHAVU_007G260800g [Phaseolus vulgaris]
 gb|AAD37430.1|AF149280_1 peroxidase 5 precursor [Phaseolus vulgaris]
 gb|ESW17693.1| hypothetical protein PHAVU_007G260800g [Phaseolus vulgaris]
Length=334

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 221/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--G  433
             GQL+  FY+++C N+  +VR  VQ A+ ++ R+AASL+RLHFHDCFV+GCDGS+LLD  G
Sbjct  28    GQLSASFYSSTCSNVSSIVRDSVQQALTSDSRIAASLIRLHFHDCFVDGCDGSILLDVGG  87

Query  434   NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             N T SEK A PN NS RGF+V+DSIKS +E++C  VVSCADILA+AA  SV LS GP+W 
Sbjct  88    NITESEKNAAPNENSVRGFDVVDSIKSTIEASCPAVVSCADILALAAEASVSLSQGPSWT  147

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRD   AN   A+ S LP PF++L  + +KF AVGL+ TD+VALSGAHT G ++C 
Sbjct  148   VLLGRRDSVTANQGGANTS-LPSPFENLTNVSSKFSAVGLDTTDLVALSGAHTFGRSQCQ  206

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  TGSPDPTL+ + +  LQ  CP NG+G     LD ++ D FDN YF NLL
Sbjct  207   FFSQRLLNFNGTGSPDPTLNTTYLGTLQQNCPQNGNGATLNNLDPSTPDTFDNKYFTNLL  266

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQ+DQ LFS+D +   S  +V  + N+ + FF  F  SM+ MGNISPLTG+ G+I
Sbjct  267   INQGLLQTDQELFSTDGSSTIS--IVNNFANNQSAFFEAFAQSMINMGNISPLTGTQGQI  324

Query  1154  RKNCRTRN  1177
             R +C+  N
Sbjct  325   RTDCKKVN  332



>prf||2114377B peroxidase:ISOTYPE=RPN
Length=334

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 224/308 (73%), Gaps = 8/308 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  +Y   CP ++++VR  V  A+K EMRM ASLLRLHFHDCFVNGCD S+LLDG  
Sbjct  33    GQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDG--  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T SEKFA PN NS RG+EVID+IK+ +E AC GVVSCADI+A+AA+  VLLSGGP + VL
Sbjct  91    TNSEKFAAPNNNSVRGYEVIDAIKADLEGACPGVVSCADIVALAAKYGVLLSGGPDYDVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG +AN T A+++ LP PFDS+  I A+F  VGLN TD+V LSGAH IG A C +F
Sbjct  151   LGRRDGLVANQTGANSN-LPSPFDSISVITARFKDVGLNATDVVVLSGAH-IGRASCTLF  208

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL+NF  + S  PTLDAS +   Q+   + GD +  A LD NS D FDNHY++NLL  
Sbjct  209   SNRLANFTASNSV-PTLDASSLASSQSQV-ARGDADQLAALDVNSADAFDNHYYQNLLAN  266

Query  980   RGLLQSDQILFSS--DAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +GLL SDQ L SS  D A   +KALVQ Y+ +  RF  DF  SMVKMGNISPLTGS G+I
Sbjct  267   KGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQI  326

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  327   RKNCRAVN  334



>sp|Q9LEH3.1|PER15_IPOBA RecName: Full=Peroxidase 15; Short=Prx15; AltName: Full=Anionic 
peroxidase; Flags: Precursor [Ipomoea batatas]
 emb|CAB94692.1| peroxidase [Ipomoea batatas]
Length=327

 Score =   347 bits (890),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 218/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL++ FY+ +CPN+  +VR  VQ A++N+ R+  SL+RLHFHDCFV+GCDGS+LLD N T
Sbjct  24    QLSSTFYSTTCPNVSAIVRTVVQQALQNDARIGGSLIRLHFHDCFVDGCDGSLLLDNNGT  83

Query  443   T--SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A+PN NS RGF+V+D+IK+AVE+AC GVVSC DILA+A+  SV L+GGP+W V
Sbjct  84    TIVSEKDALPNTNSTRGFDVVDNIKTAVENACPGVVSCVDILALASESSVSLAGGPSWNV  143

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S LP PF++L  +  KF  VGLN+ D+VALSGAHT G A+C  
Sbjct  144   LLGRRDRRTANQGGANTS-LPSPFENLTNLTQKFTNVGLNVNDLVALSGAHTFGRAQCRT  202

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  TG+PDPTL+ + +  LQ  CP  G G     LD  + D FDN+YF NL  
Sbjct  203   FSPRLFNFSNTGNPDPTLNTTYLATLQQICPQGGSGFTVTNLDPTTPDTFDNNYFSNLQT  262

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              RGLLQSDQ LFS+  A   + A+V  ++ +   FF  FV SM+ MGNISPLTGS+GEIR
Sbjct  263   NRGLLQSDQELFSTSGAP--TIAIVNNFSANQTAFFESFVQSMINMGNISPLTGSNGEIR  320

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  321   SNCRRPN  327



>ref|XP_004251296.1| PREDICTED: peroxidase 15-like [Solanum lycopersicum]
Length=327

 Score =   347 bits (890),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 224/309 (72%), Gaps = 8/309 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+ +CPN+  +V+  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD N+
Sbjct  24    AQLSANFYSTTCPNVSSIVQNVIQQALQSDARIGASLIRLHFHDCFVNGCDASLLLDNNA  83

Query  440   TT---SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
             TT   SEK A PN NS RGF+V+D+IK+A+ES+C GVVSCADILA+AA  SV L+GGP+W
Sbjct  84    TTNIVSEKDAAPNTNSTRGFDVVDNIKTALESSCPGVVSCADILALAAESSVSLAGGPSW  143

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKC  790
              VLLGRRD   AN   A+ S+ P P + L  I AKF AVGLNLTD+VALSGAHT G A+C
Sbjct  144   NVLLGRRDSRTANQAGANTSI-PSPTEGLTNITAKFTAVGLNLTDLVALSGAHTFGRAQC  202

Query  791   AVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNL  970
              VFS RL NF  TG+PDP+L+ + +  L+  CP NG     A LD  ++D FDN+YF NL
Sbjct  203   RVFSARLYNFNGTGNPDPSLNTTYLSNLRQICPQNGSATALANLDPTTSDGFDNNYFANL  262

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                +GLLQSDQ LFSS     T+ ++V T++++ N FF  FV SM+ MGNISPLTG++GE
Sbjct  263   QNNQGLLQSDQELFSSA----TTLSIVNTFSSNQNTFFQSFVQSMINMGNISPLTGTNGE  318

Query  1151  IRKNCRTRN  1177
             I  +C+  N
Sbjct  319   IHLDCKRIN  327



>ref|XP_008798950.1| PREDICTED: peroxidase 15-like [Phoenix dactylifera]
Length=313

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 213/307 (69%), Gaps = 6/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             Q T GFYA SCPN+F V+R EV  A+  EMRM  S+LRLHFH CF+NGCDGSVLLD +ST
Sbjct  9     QSTIGFYATSCPNVFDVIRHEVTKALMKEMRMGKSMLRLHFHVCFINGCDGSVLLDSSST  68

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NS RGF V+D+IK+AVE AC GVVSCADILA+AA  SV  SGGP+W VL
Sbjct  69    IVSEKGAAPNANSLRGFNVVDNIKAAVERACPGVVSCADILALAAEASVRSSGGPSWSVL  128

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN  AA+   LP PFDSL  + +KF AVGL+ TD+VALSGAHT G A+C  F
Sbjct  129   LGRRDSTTANMNAANN--LPSPFDSLTGLQSKFSAVGLSNTDLVALSGAHTFGRAQCRTF  186

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDG-NNTAPLDRNSTDLFDNHYFKNLLI  976
             S+RL NF  TG PDPTL+ S    LQ  CP  G G +N   LD  + + FD +YF NL  
Sbjct  187   SSRLYNFSSTGKPDPTLNPSYRATLQQNCPQGGAGSSNLNNLDPTTPNTFDRNYFTNLQG  246

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              RGLLQSDQ L S+  A   S  +V ++ +    FF +FV SM+ MGNISPLTGS G+IR
Sbjct  247   NRGLLQSDQELLSTSGAPTAS--IVNSFASSQTVFFQNFVRSMINMGNISPLTGSRGQIR  304

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  305   SNCRKVN  311



>ref|XP_002530724.1| Peroxidase 53 precursor, putative [Ricinus communis]
 gb|EEF31678.1| Peroxidase 53 precursor, putative [Ricinus communis]
Length=335

 Score =   347 bits (890),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 217/307 (71%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FYA++CPN+  +V   VQ A +++ R+ ASL+RLHFHDCFV+GCD S+LLD  S
Sbjct  30    AQLSTTFYASTCPNITSIVTNAVQQAFQSDSRIGASLIRLHFHDCFVDGCDASILLDSTS  89

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             +  SEK A PN+NS RGF V+D+IK+A ES+C GVVSCADILA++A  SV LSGGP+W V
Sbjct  90    SIQSEKLAGPNVNSTRGFGVVDNIKTAAESSCPGVVSCADILALSAEASVSLSGGPSWNV  149

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PF+ L+ I +KF AVGLN  D+VALSGAHT G A+C  
Sbjct  150   LLGRRDSLTANQAGANTSI-PSPFEGLNNITSKFTAVGLNTNDLVALSGAHTFGRAQCRT  208

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+NRL NF  TG+PDPTL+ + +  LQ  CP NG+      LD  + D FDN+YF NL  
Sbjct  209   FNNRLFNFSNTGNPDPTLNTTYLATLQQICPQNGNTAALVNLDPTTPDTFDNNYFTNLQS  268

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V ++  +   FF  FV SM+ MGNISPLTGS+GEIR
Sbjct  269   NQGLLQSDQELFSTTGAATVS--IVNSFAGNQTAFFQSFVQSMINMGNISPLTGSNGEIR  326

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  327   ADCKKVN  333



>gb|AFK39887.1| unknown [Lotus japonicus]
Length=335

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 228/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG--N  436
             QL++ FY+++CP++  +VR  VQ A++++ R+ ASL RLHFHDCFVNGCDGS+LLD   N
Sbjct  30    QLSSTFYSSTCPSVSSIVRSVVQQALQSDSRIGASLTRLHFHDCFVNGCDGSILLDQGVN  89

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK A PN NSARGF+V+D+IK++VE++C GVVSCADILA+AA+ SV L+GGP+W V
Sbjct  90    ITLSEKNATPNNNSARGFDVVDNIKTSVENSCPGVVSCADILALAAQASVALAGGPSWNV  149

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             L+GRRDG +AN + A+AS+ P PF+SL  I AKF AVGLN+TD+VALSGAHT G A+C  
Sbjct  150   LVGRRDGVMANQSGANASI-PTPFESLAIISAKFAAVGLNITDLVALSGAHTFGRAQCRF  208

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL NF  TGSPDPTL ++ +  LQ  CP NG G     LD +S D FD++YFKNLL 
Sbjct  209   FNQRLFNFSGTGSPDPTLSSTYLATLQQNCPQNGSGTTLNNLDPSSADAFDSNYFKNLLN  268

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS++ +   S  +V  +  +   FF  F  SM+ MGN+SPLTG+ GEIR
Sbjct  269   NKGLLQSDQELFSTNGSATIS--IVNNFATNQTAFFEAFAQSMINMGNVSPLTGNQGEIR  326

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  327   SNCRKVN  333



>ref|XP_010058197.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
Length=334

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 220/307 (72%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL++ FYA SCPN+  +V+  +Q A++++ R+ ASLLRLHFHDCFV+GCDGS+LLD ++
Sbjct  29    AQLSSNFYATSCPNVSNIVQTVIQQALQSDPRITASLLRLHFHDCFVDGCDGSLLLDNSA  88

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T TSEK A PN NS RGF+V+D+IKSA+ES+C G VSCADILA+ A+ SV+LSGGP+W V
Sbjct  89    TITSEKDAAPNTNSTRGFDVVDNIKSAIESSCPGTVSCADILALGAQASVVLSGGPSWTV  148

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             L GRRD   AN   A+ S+ P PFDSL  + +KF AVGL+  D+V LSGAHT G A+C  
Sbjct  149   LSGRRDSLTANQAGANTSI-PSPFDSLANLTSKFAAVGLDTNDLVTLSGAHTFGRAQCRT  207

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  +GSPDPT+  S +  LQ  CP NG G+  A LD  + + FDN+Y+ NL  
Sbjct  208   FSPRLYNFNASGSPDPTISPSYLTTLQQLCPQNGSGSVLANLDPTTVNTFDNNYYANLQN  267

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V +++ + + FF  F  SM+ MGNISPLTGS GEIR
Sbjct  268   NQGLLQSDQELFSTSGAATIS--IVNSFSGNQSAFFQSFAQSMINMGNISPLTGSSGEIR  325

Query  1157  KNCRTRN  1177
              NC+  N
Sbjct  326   SNCKKVN  332



>gb|AAP42504.1| anionic peroxidase swpa5 [Ipomoea batatas]
Length=327

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 217/308 (70%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL++ FY+ +CPN+  +V   +Q A++N+ R+ ASL+RLHFHDCFVNGCDGS+LLD N 
Sbjct  23    AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSILLDNNG  82

Query  440   TT--SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
             TT  SEK A PN NSARGF+V+D+IK+AVE+AC GVVSCADILA+A+  +V L+ GP+W 
Sbjct  83    TTIVSEKDAAPNNNSARGFDVVDNIKTAVENACPGVVSCADILALASESAVSLASGPSWN  142

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRD   AN   A+ S+ P PF+SL  I  KF  VGLN+ D+VALSGAHT G A+C 
Sbjct  143   VLLGRRDSRTANQAGANTSI-PAPFESLSNITTKFSNVGLNVNDLVALSGAHTFGRAQCR  201

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FSNRL NF  TG+PD  L  +L+  LQ  CP  G G+    LD  + D FD+ YF NL 
Sbjct  202   TFSNRLFNFSNTGNPDSHLKHNLLSTLQQVCPQGGSGSTVTNLDPTTPDTFDSSYFSNLQ  261

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               RGLLQSDQ LFS+  A   + A+V +++ +   FF  FV SM+ MGNISPLTG+ GEI
Sbjct  262   NNRGLLQSDQELFSTSGA--ATIAIVNSFSANQTAFFQSFVQSMINMGNISPLTGTSGEI  319

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  320   RLNCRRPN  327



>gb|AGN03454.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03455.1| class III peroxidase [Ginkgo biloba]
Length=327

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 219/307 (71%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLT  +Y  SCP    ++R  VQ A++ + RMAASLLRLHFHDCFVNGCDGSVLLD  S
Sbjct  24    AQLTPLYYQTSCPTAEAIIRPVVQQAVQRDPRMAASLLRLHFHDCFVNGCDGSVLLDDTS  83

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A PNLNS RGFEVID+IK+AVE +C+ VVSCADILAIAARD+V+L+GGP+W  
Sbjct  84    TFTGEKSAGPNLNSLRGFEVIDNIKAAVEKSCNSVVSCADILAIAARDAVVLAGGPSWTP  143

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             +LGRRD   A+ + A+ +V+P P D+L  II+KF AVGL++ D V LSGAHTIG A+C+ 
Sbjct  144   MLGRRDSRTASASTAN-TVMPAPNDTLGIIISKFRAVGLSVQDCVTLSGAHTIGRARCSS  202

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS RL NF  TG+PDP ++   +  L+  CP  G+ N    LD+ + D FDN YF NL I
Sbjct  203   FSARLYNFGNTGNPDPAINPFYLNTLRGICPRGGNANAVTSLDQRTPDRFDNSYFTNLRI  262

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A  T  ALV  Y+N+   FF +F  SM+ MGNI PLTG++GEIR
Sbjct  263   NEGLLQSDQELFSTTGASTT--ALVNLYSNNQIVFFQNFQNSMINMGNIKPLTGNNGEIR  320

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  321   TNCRKVN  327



>gb|KHN45426.1| Peroxidase 15 [Glycine soja]
Length=331

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 226/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL++ FY+++CPN+  VVR  VQ A++++ R+AASL RLHFHDCFVNGCDGS+LLD  GN
Sbjct  26    QLSSTFYSSTCPNVSSVVRSVVQQALQSDPRIAASLTRLHFHDCFVNGCDGSILLDVGGN  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK A PN NSARGF+V+D+IK++VE++C GVVSCADILA+AA  SV L GGP+W V
Sbjct  86    ITLSEKNAGPNNNSARGFDVVDNIKTSVENSCPGVVSCADILALAAEASVSLGGGPSWNV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRDG +AN + A+ S+ P P +SL  + AKF AVGLN+TD+VALSGAHT G A+C  
Sbjct  146   QLGRRDGLIANQSGANTSI-PNPTESLANVTAKFAAVGLNVTDLVALSGAHTFGRAQCRF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL N   TGSPDPTL+A+ +  LQ  CP NG GN    LD +S D FDN+YF+NLL 
Sbjct  205   FNQRLFNLSGTGSPDPTLNATYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLS  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQ+DQ LFS++ A   S  +V  +  +   FF  F  SM+ MGNISPLTGS GEIR
Sbjct  265   NQGLLQTDQELFSTNGAATVS--VVNNFAANQTAFFQAFAQSMINMGNISPLTGSRGEIR  322

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  323   SDCKRVN  329



>emb|CDP10156.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 222/307 (72%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL   FY+N+CPN+  +V+  +Q A++++ R+ ASL+RLHFHDCFV+GCD S+LLD N 
Sbjct  52    AQLNATFYSNTCPNVSAIVQNVIQQALQSDPRIGASLIRLHFHDCFVDGCDASILLDNNG  111

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A PN NSARGF+V+D IK+AVE++C G+VSCAD+LA+AA  SV LSGGP+W V
Sbjct  112   TLRSEKDAAPNTNSARGFDVVDKIKTAVENSCPGIVSCADVLALAAESSVSLSGGPSWNV  171

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PF+SL  I AKF AVGLN+ D+VALSGAHT G A+C +
Sbjct  172   LLGRRDSKTANQAGANTSI-PAPFESLSNITAKFTAVGLNINDLVALSGAHTFGRAQCRL  230

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS+RL NF  +G+PDP+L+ + +  L+  CP NG     A LD  + + FDN+YF NL  
Sbjct  231   FSSRLYNFSGSGNPDPSLNTTYLATLRQICPQNGSTTALANLDFTTPNTFDNNYFSNLQT  290

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V T++++ N FF  F  SM+ MGNISPLTG++GEIR
Sbjct  291   NQGLLQSDQELFSTPGAATIS--IVNTFSSNQNAFFQSFAQSMINMGNISPLTGTNGEIR  348

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  349   SDCKKVN  355



>gb|AAM66044.1| peroxidase [Arabidopsis thaliana]
 gb|AAS17637.1| peroxidase ATP29a [Arabidopsis thaliana]
Length=358

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY+ +CPN   +VR  +Q A++++ R+  SL+RLHFHDCFVNGCDGS+LLD  S+
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHDCFVNGCDGSLLLDDTSS  91

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A  N NS RGF V+DSIK+A+E+AC G+VSC+DILA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN + A++S LP PF+ L+ I +KFVAVGLN TD+V+LSGAHT G  +C  F
Sbjct  152   LGRRDGLTANLSGANSS-LPSPFEGLNNITSKFVAVGLNTTDVVSLSGAHTFGRGQCVTF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG       LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSNTGITNLDLSTPDAFDNNYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   +  +V ++ ++   FF  FV SM+KMGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELFSNTGS--ATVPIVNSFASNQTLFFEAFVQSMIKMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKVVN  334



>ref|XP_010520028.1| PREDICTED: peroxidase A2-like [Tarenaya hassleriana]
Length=340

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 219/307 (71%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-  436
             GQL   FY+ +CPN   +VR  VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLDG+ 
Sbjct  35    GQLNATFYSGTCPNASSIVRNIVQQALQSDPRIGASLIRLHFHDCFVNGCDASILLDGSG  94

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             S  SEK A PN NS RGF V+D+IK+A+E+AC GVVSCADILA A+  SV LSGGP+W V
Sbjct  95    SVQSEKNAGPNANSVRGFGVVDNIKTALENACPGVVSCADILAFASESSVSLSGGPSWTV  154

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  AN   A+ S+ P PF+ L  I AKF AVGLN +D+VALSGAHT G A+C +
Sbjct  155   LLGRRDGLTANQAGANTSI-PSPFEGLSNITAKFSAVGLNTSDLVALSGAHTFGRAQCRL  213

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS+RL NF  TG+PDP+L+ + +  LQ  CP NG G+    LD  + D FDN YF NL  
Sbjct  214   FSSRLYNFSGTGNPDPSLNTTFLNSLQQLCPRNGSGSVITNLDLQTPDSFDNAYFANLQT  273

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   + A+V ++ ++   FF  F  SM+ MGNISPLTG+ GEIR
Sbjct  274   NQGLLQSDQELFSTRGA--ATVAIVASFASNQTLFFQAFAQSMINMGNISPLTGNSGEIR  331

Query  1157  KNCRTRN  1177
             ++C+  N
Sbjct  332   QDCKKVN  338



>ref|XP_007029017.1| Peroxidase 2 [Theobroma cacao]
 gb|EOY09519.1| Peroxidase 2 [Theobroma cacao]
Length=331

 Score =   344 bits (883),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 219/307 (71%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FYA +CPN   +VR  +Q A+++++R+ ASL+RLHFHDCFV+GCD S+LLD ++
Sbjct  26    AQLSATFYATTCPNASSIVRSVIQQALQSDIRIGASLIRLHFHDCFVDGCDASILLDNSA  85

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NS RGF V+D+IK+A+E++C G+VSCAD+LA+AA  SV L GGP+W V
Sbjct  86    NIQSEKDAAPNTNSTRGFNVVDNIKTALENSCPGIVSCADVLALAAESSVSLQGGPSWSV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A++S+ P PF+ L  I +KF AVGLN  D+VALSGAHT G A+C +
Sbjct  146   LLGRRDSLTANQAGANSSI-PSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRAQCRL  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF  TG+PDPTLD+S +  L+  CP +G G N A LD  + D FD++YF NL  
Sbjct  205   FSNRLYNFSGTGNPDPTLDSSYLTTLRQICPQSGSGFNVANLDPTTPDTFDSNYFTNLQN  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V T++ +   FF  F  SM+ MGNISPLTGS GEIR
Sbjct  265   NQGLLQSDQELFSTAGAPTIS--IVNTFSGNQTAFFQSFAQSMINMGNISPLTGSSGEIR  322

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  323   ADCKKVN  329



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   344 bits (882),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 175/302 (58%), Positives = 219/302 (73%), Gaps = 13/302 (4%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCPNLF  V+  VQ+AI  E RM ASL+RL FHDCFVNGCDGS+LLD  S+
Sbjct  25    QLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDDTSS  84

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T E+ AVPN NS RGFEVIDSIKSAVE AC GVVSCADILAIAARDS  + GGP+W V 
Sbjct  85    FTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSWNVK  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+ +AA+  + P P  +L+Q+I++F A+GL+  D+VALSGAHTIG A+C  F
Sbjct  145   LGRRDARTASLSAANNGI-PAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARCTNF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
               R+ N       D  +D+S     ++ CPS G  NN APLD  +   FDN+YFKNLL+ 
Sbjct  204   RTRIYN-------DTNIDSSFAQTRRSNCPSTGGDNNLAPLDLQTPTSFDNNYFKNLLVQ  256

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ LF++     ++ ++V+TY+N  + FF+DFV  M+KMG+ISPLTGS GEIRK
Sbjct  257   KGLLHSDQELFNN----GSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRK  312

Query  1160  NC  1165
             NC
Sbjct  313   NC  314



>gb|AFY97686.1| peroxidase 3 [Pyrus pyrifolia]
Length=350

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/311 (57%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLT  FY  SCPN   +VR  +Q A++ + R+AASL RLHFHDCFVNGCDGS+LLD ++
Sbjct  29    AQLTPTFYDESCPNATSIVRGVIQEALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNST  88

Query  440   TT-----SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGP  604
             ++     SEK A PN NS RGF+V+DSIK+A+E+AC  VVSCADILAIAA +SV LSGGP
Sbjct  89    SSTSTIDSEKTAFPNNNSVRGFDVVDSIKTALENACPAVVSCADILAIAAEESVALSGGP  148

Query  605   TWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLA  784
             +W VLLGRRD   AN TAA+ ++ P P  +LD + A F+AVGLN TD+VALSGAHT G A
Sbjct  149   SWTVLLGRRDSTTANRTAANLAI-PAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRA  207

Query  785   KCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFK  964
             +C  F+NRL NF  TGSPDPTL+++ +  L   CP NG+ +    LD  + D FD  YF 
Sbjct  208   RCQSFTNRLYNFSGTGSPDPTLNSTYLETLSEICPQNGNSSVLTNLDPVTPDTFDAEYFS  267

Query  965   NLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSD  1144
             NL + +GLLQSDQ LFS+  A   +  +V  ++ + + FF  FV SM+KMGNISPLTG+D
Sbjct  268   NLQVQQGLLQSDQELFSTSGAD--TIGIVNNFSTNQSAFFESFVESMIKMGNISPLTGTD  325

Query  1145  GEIRKNCRTRN  1177
             GEIR NCR  N
Sbjct  326   GEIRLNCRRVN  336



>gb|KDP24640.1| hypothetical protein JCGZ_25556 [Jatropha curcas]
Length=337

 Score =   344 bits (883),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 222/306 (73%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY  +CPN+  +V   +Q A++++ R+ ASL+RLHFHDCFV+GCDGS+LLD  S+
Sbjct  33    QLSATFYNTTCPNVSAIVTNVIQQALQSDPRIGASLIRLHFHDCFVDGCDGSILLDNTSS  92

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEKFA PN+NSARGF+V+D+IK+AVE++C GVVSCADILA+AA  SV L+GGP+W VL
Sbjct  93    ILSEKFAAPNVNSARGFDVVDNIKTAVENSCPGVVSCADILALAAEASVSLAGGPSWTVL  152

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             +GRRD   AN   A+ S+ P PFD L  I +KF AVGLN  D+VALSGAHT G A+C  F
Sbjct  153   VGRRDSQTANQGGANTSI-PTPFDGLTNITSKFSAVGLNTNDLVALSGAHTFGRAQCRTF  211

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PDPTL+ + +  LQ  CP  G+ +  A LD  + D FD++YF NL   
Sbjct  212   SNRLFNFSGTGNPDPTLNTTYLATLQQICPQGGNISALANLDPTTPDTFDSNYFTNLQNN  271

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLLQSDQ LFS+  A   S  +V T++++   FF  FV SM+ MGNISPLTGS+GEIR 
Sbjct  272   QGLLQSDQELFSTSGASTIS--IVNTFSSNQTAFFQSFVQSMINMGNISPLTGSNGEIRA  329

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  330   DCKKVN  335



>ref|XP_007202211.1| hypothetical protein PRUPE_ppa008390mg [Prunus persica]
 gb|EMJ03410.1| hypothetical protein PRUPE_ppa008390mg [Prunus persica]
Length=333

 Score =   344 bits (883),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 219/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL T FY+++CPN+  +VR  VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD  G+
Sbjct  28    QLNTTFYSSTCPNVTTIVRSVVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKGGS  87

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NS RGF+V+D+IK+AVE++C  VVSCADILA+AA  SV LSGG +W V
Sbjct  88    IQLSEKDAAPNTNSTRGFDVVDNIKTAVENSCPAVVSCADILALAAEASVSLSGGISWNV  147

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PF+ L  I +KF AVGLN  D+VALSGAHT G A+C  
Sbjct  148   LLGRRDSLTANQAGANTSI-PSPFEGLANITSKFSAVGLNTNDLVALSGAHTFGRAQCQR  206

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF  TG+PDPTL++S +  LQ TCP NG G   A LD  + D FDN YF NL  
Sbjct  207   FSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDPTTPDSFDNSYFSNLQN  266

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V +++++ + FF  F  SM+ MGNISPL GS+GEIR
Sbjct  267   NQGLLQSDQELFSTTGAATVS--IVNSFSSNQSAFFQSFAQSMINMGNISPLVGSNGEIR  324

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  325   LDCKKVN  331



>ref|XP_003553432.1| PREDICTED: peroxidase 15-like [Glycine max]
Length=331

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 226/307 (74%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL++ FY+++CPN+  VVR  VQ A++++ R+AASL RLHFHDCFVNGCDGS+LLD  GN
Sbjct  26    QLSSTFYSSTCPNVSSVVRSVVQQALQSDPRIAASLTRLHFHDCFVNGCDGSILLDVGGN  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK A PN NSARGF+V+D+IK++VE++C GVVSCADILA+AA  SV L GGP+W V
Sbjct  86    ITLSEKNAGPNNNSARGFDVVDNIKTSVENSCPGVVSCADILALAAEASVSLGGGPSWNV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRDG +AN + A+ S+ P P +SL  + AKF AVGLN+TD+VALSGAHT G A+C  
Sbjct  146   QLGRRDGLIANQSGANTSI-PNPTESLANVTAKFAAVGLNVTDLVALSGAHTFGRAQCRF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL N   TGSPDPTL+A+ +  LQ  CP NG GN    LD +S D FDN+YF+NLL 
Sbjct  205   FNQRLFNLSGTGSPDPTLNATYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLS  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQ+DQ LFS++ A   S  ++  +  +   FF  F  SM+ MGNISPLTGS GEIR
Sbjct  265   NQGLLQTDQELFSTNGAATIS--VINNFAANQTAFFQAFAQSMINMGNISPLTGSRGEIR  322

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  323   SDCKRVN  329



>emb|CDX98949.1| BnaC09g48860D [Brassica napus]
Length=338

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 220/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD + S
Sbjct  34    QLNATFYSGTCPNASAIVRTTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDNSGS  93

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+AC G VSC+DILA+A+  SV LSGGP+W VL
Sbjct  94    IQSEKNAGPNANSARGFNVVDNIKTALENACPGAVSCSDILALASEASVSLSGGPSWTVL  153

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A++S+ P PF+SL  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  154   LGRRDSLTANQAGANSSI-PSPFESLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  212

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  +G+PDPTL+ +L+  LQ  CP NG G+    LD ++ D FDN+YF NL   
Sbjct  213   SNRLFNFSGSGNPDPTLNTTLLSSLQQICPQNGTGSGITNLDLSTPDAFDNNYFTNLQSN  272

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++ + FF  F  SM+ MGNISPLTGS GEIR 
Sbjct  273   NGLLQSDQELFSTTGS--ATIAIVTSFASNQSLFFQAFAQSMINMGNISPLTGSSGEIRL  330

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  331   DCKKVN  336



>ref|XP_011039460.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=331

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 219/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL T FYAN+CPN+  +V   VQ A +++ R+ ASL+RLHFHDCFVNGCD S+LLD +S+
Sbjct  27    QLNTTFYANTCPNVSSIVSNVVQQAFQSDSRIGASLIRLHFHDCFVNGCDASILLDNSSS  86

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEKFA PN+NS RGF V+D+IK+AVE++C GVVSCADILA+AA  SV  SGGP+W VL
Sbjct  87    ILSEKFAAPNVNSTRGFGVVDNIKTAVENSCPGVVSCADILALAAESSVSQSGGPSWSVL  146

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S+ P PF+ L+ I AKF AVGLN  D+VALSGAHT G A+C  F
Sbjct  147   LGRRDSLTANQAGANTSI-PSPFEGLNNITAKFSAVGLNTNDLVALSGAHTFGRAQCRTF  205

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PD TL+ + +  LQ  CP NG G   A LD  ++D FDN+YF NL   
Sbjct  206   SNRLYNFSNTGNPDSTLNTTYLTTLQQICPQNGSGTALANLDPTTSDAFDNNYFTNLQNN  265

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLLQSDQ LFS+  +   +  LV  ++++   FF  FV SM+ MGNISPLTGS GEIR 
Sbjct  266   QGLLQSDQELFSTSGS--ATITLVNNFSSNQTAFFQSFVQSMINMGNISPLTGSSGEIRS  323

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  324   DCKKVN  329



>emb|CDX70074.1| BnaA10g24230D [Brassica napus]
Length=358

 Score =   345 bits (885),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 219/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY+ +CPN+  +VR  ++ A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD ++ 
Sbjct  32    QLNATFYSGTCPNVSAIVRSTIEQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDSAN  91

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK AVPN NS RGF V+D IK+A+E+AC G+VSC+DILA+A+  SV L+GGPTW VL
Sbjct  92    IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPTWAVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN + A+   LP PF+ +  I AKF AVGLN TD+V LSGAHT G A CA F
Sbjct  152   LGRRDGLTANLSGANTG-LPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFGRAACATF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TGSPDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGSASVVTNLDLSTPDAFDNNYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ L S   +   +  +V ++ ++  +FF  F  SM+KMGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELLSDTGSP--TIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKVVN  334



>ref|XP_009122284.1| PREDICTED: peroxidase A2 [Brassica rapa]
Length=358

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 219/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY+ +CPN+  +VR  ++ A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD ++ 
Sbjct  32    QLNATFYSGTCPNVSAIVRSTIEQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDSAN  91

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK AVPN NS RGF V+D IK+A+E+AC G+VSC+DILA+A+  SV L+GGPTW VL
Sbjct  92    IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPTWAVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN + A+   LP PF+ +  I AKF AVGLN TD+V LSGAHT G A CA F
Sbjct  152   LGRRDGLTANLSGANTG-LPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFGRAACATF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TGSPDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGSASVVTNLDLSTPDAFDNNYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ L S   +   +  +V ++ ++  +FF  F  SM+KMGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELLSDTGSP--TIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKVVN  334



>ref|XP_009375169.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=350

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/311 (57%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLT  FY  SCPN   +VR  +Q A++ + R+AASL RLHFHDCFVNGCDGS+LLD ++
Sbjct  29    AQLTPTFYDESCPNATSIVRGVIQEALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNST  88

Query  440   TT-----SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGP  604
             ++     SEK A PN NS RGF+V+DSIK+A+E+AC  VVSCADILAIAA +SV LSGGP
Sbjct  89    SSTSTIDSEKTAFPNNNSVRGFDVVDSIKTALENACPAVVSCADILAIAAEESVALSGGP  148

Query  605   TWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLA  784
             +W VLLGRRD   AN TAA+ ++ P P  +LD + A F+AVGLN TD+VALSGAHT G A
Sbjct  149   SWTVLLGRRDSTTANRTAANLAI-PAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRA  207

Query  785   KCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFK  964
             +C  F+NRL NF  TGSPDPTL+++ +  L   CP NG+ +    LD  + D FD  YF 
Sbjct  208   RCQSFTNRLYNFSGTGSPDPTLNSTYLETLSEICPQNGNSSVLTNLDPVTPDTFDAKYFS  267

Query  965   NLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSD  1144
             NL + +GLLQSDQ LFS+  A   +  +V  ++ + + FF  FV SM+KMGNISPLTG+D
Sbjct  268   NLQVQQGLLQSDQELFSTSGAD--TIGIVNNFSTNQSAFFESFVESMIKMGNISPLTGTD  325

Query  1145  GEIRKNCRTRN  1177
             GEIR NCR  N
Sbjct  326   GEIRLNCRRVN  336



>ref|XP_008787874.1| PREDICTED: peroxidase 15 [Phoenix dactylifera]
Length=336

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 223/306 (73%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL++ FY ++C N+  +VR  +Q A  +++R+ ASL RL FHDCFV+GCDGSVLLD +ST
Sbjct  33    QLSSSFYNSTCSNVSAIVRSVIQQAQSSDVRITASLTRLFFHDCFVDGCDGSVLLDSSST  92

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK AVPN NSARGF+V+D+IK+AVE+AC GVVSCADILA+AA  SV L+GGP+W  L
Sbjct  93    IVSEKGAVPNNNSARGFDVVDNIKTAVENACPGVVSCADILALAAEASVNLAGGPSWSAL  152

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN T A+   LP PFDSL  + +KF AVGL  TD+VALSGAHT G A+C  F
Sbjct  153   LGRRDGTTANITGANN--LPSPFDSLTTLQSKFSAVGLGDTDLVALSGAHTFGRAQCRFF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PDP+L++S +  LQ  CP  GDG     LD ++ + FD++YF NL   
Sbjct  211   SNRLYNFSGTGNPDPSLNSSYLTTLQQNCPQGGDGTTLNNLDPSTPNTFDSNYFTNLQNN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             RGLLQSDQ L S+  A  ++ ++V ++ +  + FF +FV SM+ MGNISPLTGS G+IR 
Sbjct  271   RGLLQSDQELLSTSGA--STASIVNSFASSQSTFFQNFVQSMINMGNISPLTGSSGQIRS  328

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  329   NCRKVN  334



>ref|XP_006363346.1| PREDICTED: peroxidase 15-like [Solanum tuberosum]
Length=326

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 223/309 (72%), Gaps = 8/309 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+ +CPN+  +V+  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD N+
Sbjct  23    AQLSANFYSTTCPNVSSIVQNVIQQALQSDARIGASLIRLHFHDCFVNGCDASLLLDNNA  82

Query  440   TT---SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
             TT   SEK A PN NS RGF+V+D+IK+A+E++C GVVSCADILA+AA  SV  +GGP+W
Sbjct  83    TTNIVSEKDAAPNTNSTRGFDVVDNIKTALETSCPGVVSCADILALAAESSVSQAGGPSW  142

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKC  790
              VLLGRRD   AN   A+ S+ P P + L  I AKF AVGLN+TD+VALSGAHT G A+C
Sbjct  143   NVLLGRRDSRTANQAGANTSI-PSPTEGLTNITAKFTAVGLNITDLVALSGAHTFGRAQC  201

Query  791   AVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNL  970
              VFS RL NF  TG+PDP+L+ + +  L+  CP NG     A LD  ++D FDN+Y+ NL
Sbjct  202   RVFSARLYNFNGTGNPDPSLNTTYLANLRQICPQNGSATALANLDPTTSDGFDNNYYANL  261

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                +GLLQSDQ LFSS     T+ ++V T++++ N FF  FV SM+ MGNISPLTG++GE
Sbjct  262   QNNQGLLQSDQELFSSG----TTLSIVNTFSSNQNTFFQSFVQSMINMGNISPLTGTNGE  317

Query  1151  IRKNCRTRN  1177
             I  +C+  N
Sbjct  318   IHSDCKRIN  326



>ref|XP_011078985.1| PREDICTED: peroxidase 15-like [Sesamum indicum]
Length=332

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 222/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-  436
              QL + FY+++CPN+  +V   +Q A++++ R+ ASL+RLHFHDCFV GCDGS+LLD N 
Sbjct  26    AQLNSTFYSSTCPNVSNIVTTVIQQALQSDPRIGASLIRLHFHDCFVQGCDGSILLDDNN  85

Query  437   -STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWR  613
              S  SEK A PN NS RGF+V+D+IK+AVE++C GVVSCADILA+AA+ +V L+GGP+W 
Sbjct  86    GSIQSEKDAAPNTNSTRGFDVVDNIKTAVENSCPGVVSCADILALAAQSAVSLAGGPSWN  145

Query  614   VLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCA  793
             VLLGRRD   AN   A+ S+ P PF+ L  + AKF AVGLN+TD+VALSGAHT G A+C 
Sbjct  146   VLLGRRDSRTANQAGANTSI-PAPFEPLTNLTAKFSAVGLNVTDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
             +F NRL NF  +G PDPTL+ + +  L+  CP NG G   A LD  + D FDN+Y+ NL 
Sbjct  205   LFINRLYNFSGSGGPDPTLNTTYLATLRQICPQNGSGFVVANLDLRTPDTFDNNYYSNLQ  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQSDQ LFSS  A   +  +V  ++++ + FF  FV SM+KMGNI+PLTGS+GEI
Sbjct  265   SNEGLLQSDQELFSSSGA--PTIPIVNLFSSNQSAFFESFVQSMIKMGNITPLTGSNGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RANCRRVN  330



>ref|XP_006373791.1| hypothetical protein POPTR_0016s05860g [Populus trichocarpa]
 ref|XP_006388578.1| This sequence shows homology with Cucumber peroxidase family 
protein [Populus trichocarpa]
 gb|ERP47492.1| This sequence shows homology with Cucumber peroxidase family 
protein [Populus trichocarpa]
 gb|ERP51588.1| hypothetical protein POPTR_0016s05860g [Populus trichocarpa]
 gb|AHL39185.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 218/306 (71%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FYAN+CPN+  +V   VQ A +++ R+ ASL+RLHFHDCFVNGCD S+LLD +S+
Sbjct  27    QLNATFYANTCPNVSSIVSNVVQQAFQSDSRIGASLIRLHFHDCFVNGCDASILLDNSSS  86

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEKFA PN+NS RGF V+D+IK+AVE++C GVVSCADILA+AA  SV  SGGP+W VL
Sbjct  87    ILSEKFAAPNVNSIRGFGVVDNIKTAVENSCPGVVSCADILALAAESSVSQSGGPSWSVL  146

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ ++ P PF+ L+ I AKF AVGLN  D+VALSGAHT G A+C  F
Sbjct  147   LGRRDSLTANQAGANTAI-PSPFEGLNNITAKFSAVGLNTNDLVALSGAHTFGRAQCRTF  205

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TG+PDPTL+ + +  LQ  CP NG G   A LD  ++D FDN+YF NL   
Sbjct  206   SNRLYNFSNTGNPDPTLNTTYLTTLQQICPQNGSGTALANLDPTTSDAFDNNYFTNLQNN  265

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLLQSDQ LFS+  A   +   V  ++++   FF  FV SM+ MGNISPLTGS GEIR 
Sbjct  266   QGLLQSDQELFSTPGAATIT--FVNNFSSNQTAFFQSFVQSMINMGNISPLTGSSGEIRS  323

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  324   DCKKVN  329



>ref|NP_196291.1| peroxidase 54 [Arabidopsis thaliana]
 sp|Q9FG34.1|PER54_ARATH RecName: Full=Peroxidase 54; Short=Atperox P54; AltName: Full=ATP29a; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09807.1| peroxidase [Arabidopsis thaliana]
 dbj|BAC43417.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAP40411.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED91056.1| peroxidase [Arabidopsis thaliana]
Length=358

 Score =   343 bits (880),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 220/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY+ +CPN   +VR  +Q A++++ R+  SL+RLHFHDCFVNGCDGS+LLD  S+
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHDCFVNGCDGSLLLDDTSS  91

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A  N NS RGF V+DSIK+A+E+AC G+VSC+DILA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN + A++S LP PF+ L+ I +KFVAVGL  TD+V+LSGAHT G  +C  F
Sbjct  152   LGRRDGLTANLSGANSS-LPSPFEGLNNITSKFVAVGLKTTDVVSLSGAHTFGRGQCVTF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG       LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSNTGITNLDLSTPDAFDNNYFTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   +  +V ++ ++   FF  FV SM+KMGNISPLTGS GEIR+
Sbjct  271   NGLLQSDQELFSNTGS--ATVPIVNSFASNQTLFFEAFVQSMIKMGNISPLTGSSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKVVN  334



>gb|AAM65211.1| peroxidase [Arabidopsis thaliana]
 gb|AAS17636.1| peroxidase ATPA2 [Arabidopsis thaliana]
Length=335

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  31    QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGS  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN+NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV L+GGP+W VL
Sbjct  91    IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A++S+ P P +SL  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  151   LGRRDSLTANLAGANSSI-PSPVESLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  210   NNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  269

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +  ++ A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  270   NGLLQSDQELFSTTGS--STIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRL  327

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  328   DCKKVN  333



>ref|XP_006399146.1| hypothetical protein EUTSA_v10014029mg [Eutrema salsugineum]
 gb|ESQ40599.1| hypothetical protein EUTSA_v10014029mg [Eutrema salsugineum]
Length=339

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 218/306 (71%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  35    QLNATFYSRTCPNASAIVRSTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDDSGS  94

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV L+GGP+W VL
Sbjct  95    IQSEKNAAPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVL  154

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A++S+ P P +SL  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  155   LGRRDSLTANQAGANSSI-PSPVESLANITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  213

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  +G+PDPTL+ +L+  LQ  CP NG G+    LD ++ D FDN+YF NL   
Sbjct  214   SNRLINFSGSGNPDPTLNTTLLNSLQQICPQNGSGSGITNLDLSTPDAFDNNYFSNLQSN  273

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++   FF  F  SM+ MGNISPLTGS GEIR 
Sbjct  274   NGLLQSDQELFSTTGS--ATIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSSGEIRL  331

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  332   DCKKVN  337



>ref|XP_006492672.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO40102.1| hypothetical protein CISIN_1g018847mg [Citrus sinensis]
Length=349

 Score =   342 bits (878),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 224/308 (73%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+++CPN+  ++R+ +QNA  +++R+ ASL+RLHFHDCFVNGCD S+LLD  +
Sbjct  26    AQLSPFFYSSTCPNVTNIIREVLQNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTT  85

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEKFA PN NSARGFEV+D +K+AVE AC GVVSCADIL IAA +SV LSGGP W  
Sbjct  86    TIDSEKFAAPNNNSARGFEVVDDMKAAVERACPGVVSCADILTIAAEESVALSGGPAWTN  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
             LLGRRD   AN T A+ + LPGP +SL+++  +F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   LLGRRDSRTANRTLANEN-LPGPNNSLERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL NF  TG+PDPTL+ +L+ +L+  CP  G+G+    LD  + DLFDN YF NL 
Sbjct  205   TFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQ  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQSDQ LFS+  A  T  A+V  ++++   FF  FV SM++MGN+ PLTG+ GEI
Sbjct  265   ISKGLLQSDQELFSTPGADTT--AIVNVFSSNQAAFFKSFVISMIRMGNLKPLTGNQGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RSNCRRVN  330



>ref|XP_009409636.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   342 bits (876),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 216/306 (71%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL++ FY +SC N+  VVR  VQ A  +++R+ ASLLRLHFHDCFVNGCDGS+LLD  +S
Sbjct  32    QLSSTFYDSSCSNVSAVVRNVVQQAQSSDVRIVASLLRLHFHDCFVNGCDGSILLDNSDS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NS RGF+V+D IK+AVE+ C GVVSCADILA+AA  SV L+GGPTW VL
Sbjct  92    IQSEKDAAPNKNSVRGFDVVDDIKTAVENVCPGVVSCADILALAAEASVDLAGGPTWGVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN TAA+   +P PFD LD +  KF  VGL+ TD+VALSGAHT G A+C  F
Sbjct  152   LGRRDGTTANPTAANN--MPSPFDDLDTLKQKFSDVGLDDTDLVALSGAHTFGRAQCRFF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S+RL NF  TGSPDP+LD++ +  LQ  CP  GD      LD  + + FDN YF NL   
Sbjct  210   SSRLYNFSGTGSPDPSLDSTYLATLQQNCPQGGDDTTLNNLDLTTPNTFDNKYFTNLQSN  269

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  A   S  +V ++  D + FF  F +SM+ MGNI+PLTGS+GEIR 
Sbjct  270   EGLLQSDQELFSTSGASTIS--IVNSFAGDESTFFQSFASSMINMGNINPLTGSNGEIRS  327

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  328   DCKKVN  333



>ref|XP_010491252.1| PREDICTED: peroxidase 53 [Camelina sativa]
Length=336

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 218/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD    
Sbjct  31    QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDVSG  90

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             S  SEK A PN NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV L+GGP+W V
Sbjct  91    SIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTV  150

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S +P P +SL  I +KF AVGLN  D+VALSGAHT G A+C V
Sbjct  151   LLGRRDSLTANLAGAN-STIPSPVESLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGV  209

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+NRL NF  TG+PDPTL+++L+  LQ  CP NG       LD ++ D FDN+YF NL  
Sbjct  210   FNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSATTITNLDLSTPDAFDNNYFTNLQS  269

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  +  ++ A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR
Sbjct  270   NNGLLQSDQELFSTTGS--STIAIVTSFASNQTLFFQTFAQSMINMGNISPLTGSNGEIR  327

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  328   LDCKKVN  334



>pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2
 pdb|1QO4|A Chain A, Arabidopsis Thaliana Peroxidase A2 At Room Temperature
Length=306

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 220/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  2     QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGS  61

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN+NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV L+GGP+W VL
Sbjct  62    IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVL  121

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A++S+ P P +SL  I  KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  122   LGRRDSLTANLAGANSSI-PSPIESLSNITFKFSAVGLNTNDLVALSGAHTFGRARCGVF  180

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  181   NNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  240

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +  ++ A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  241   DGLLQSDQELFSTTGS--STIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRL  298

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  299   DCKKVN  304



>ref|XP_008240914.1| PREDICTED: peroxidase A2-like [Prunus mume]
Length=333

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 219/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL T FY+++CPN+  +VR  VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD  G+
Sbjct  28    QLNTTFYSSTCPNVTTIVRSVVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKGGS  87

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NS RGF+V+D+IK+AVE++C  VVSCADILA+AA  SV LSGG +W V
Sbjct  88    IQLSEKDAAPNTNSTRGFDVVDNIKTAVENSCPAVVSCADILALAAEASVSLSGGISWNV  147

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P P + L  I +KF A+GLN  D+VALSGAHT G A+C  
Sbjct  148   LLGRRDSLTANQAGANTSI-PSPVEGLANITSKFSALGLNTNDLVALSGAHTFGRAQCRT  206

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF  TG+PDPTL++S +  LQ TCP NG G   A LD  + D FDN+YF NL  
Sbjct  207   FSNRLYNFTGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDPTTPDSFDNNYFSNLQN  266

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V +++++ + FF  F  SM+ MGNISPL GS+GEIR
Sbjct  267   NQGLLQSDQELFSTTGAATVS--IVNSFSSNQSAFFQSFAQSMINMGNISPLVGSNGEIR  324

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  325   LDCKKVN  331



>emb|CCJ34833.1| horseradish peroxidase isoenzyme HRP_4663 [Armoracia rusticana]
Length=358

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD   S
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDTGS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A  N NSARGF V+D IK+A+E+AC G+VSC+DILA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAPANANSARGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             +GRRDG  AN + A++S LP PF+ L+ I +KF+AVGLN TD+V LSGAHT G  +C  F
Sbjct  152   VGRRDGLTANLSGANSS-LPSPFEGLNNITSKFLAVGLNTTDVVVLSGAHTFGRGQCVTF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TGSPDPTL+++L+  LQ  CP NG G+    LD  + D FD++Y+ NL   
Sbjct  211   NNRLFNFNGTGSPDPTLNSTLLSSLQQICPQNGSGSAITNLDLTTPDAFDSNYYTNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++   FF  F  SM+KMGNISPLTG+ GEIR+
Sbjct  271   NGLLQSDQELFSNTGSP--TIAIVNSFASNQTLFFEAFAQSMIKMGNISPLTGTSGEIRQ  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKAVN  334



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/309 (59%), Positives = 224/309 (72%), Gaps = 14/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY+ SCP LF+ V+  VQ+AI  E RM ASLLRL FHDCFVNGCDGS+LLD  S
Sbjct  27    AQLSTNFYSKSCPKLFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  86

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             + T EK A PN+NS RGFEVID+IKSAVE AC GVVSCADILAI ARDSV++ GGP W V
Sbjct  87    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPNWNV  146

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA++S+ P P  +L+Q+I+ F AVGL+ TDMVALSGAHTIG A+C  
Sbjct  147   KLGRRDARTASQGAANSSI-PPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQARCTS  205

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+  + +T +    +D+S     Q  CP N G G NN APLD  +   FDN+YFKNL
Sbjct  206   FRARI--YNETNN----IDSSFATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNL  259

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  RGLL SDQ LF+  +A     ++V +Y+N+ + F +DFVT+M+KMG+  PLTGS+GE
Sbjct  260   VSKRGLLHSDQQLFNGGSAD----SIVTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGE  315

Query  1151  IRKNCRTRN  1177
             IRKNCRTRN
Sbjct  316   IRKNCRTRN  324



>ref|XP_010423310.1| PREDICTED: peroxidase 53-like [Camelina sativa]
Length=336

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 218/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD    
Sbjct  31    QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDVSG  90

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             S  SEK A PN NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV L+GGP+W V
Sbjct  91    SIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTV  150

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S +P P +SL  I +KF AVGLN  D+VALSGAHT G A+C V
Sbjct  151   LLGRRDSLTANLAGAN-SAIPSPVESLSNITSKFSAVGLNSNDLVALSGAHTFGRARCGV  209

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+NRL NF  TG+PDPTL+++L+  LQ  CP NG       LD ++ D FDN+YF NL  
Sbjct  210   FNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSATTITNLDLSTPDAFDNNYFANLQS  269

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  +  ++ A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR
Sbjct  270   NNGLLQSDQELFSTTGS--STIAIVTSFASNQTLFFQTFAQSMINMGNISPLTGSNGEIR  327

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  328   LDCKKVN  334



>ref|XP_009375132.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=350

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 223/311 (72%), Gaps = 8/311 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG--  433
              QLT  FY  SCPN   +VR  +Q A++ + R+ ASL RLHFHDCFVNGCDGS+LLD   
Sbjct  29    AQLTPTFYDESCPNATSIVRGVIQEALQTDPRITASLTRLHFHDCFVNGCDGSILLDNST  88

Query  434   --NSTT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGP  604
               NST  SEK A+ N NSARGF+V+D+IK+A+E+AC  VVSCADILAIAA +SV+LSGG 
Sbjct  89    NPNSTIDSEKTAIANNNSARGFDVVDNIKTALENACPAVVSCADILAIAAEESVVLSGGS  148

Query  605   TWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLA  784
             +W VLLGRRD   AN TAA+ + LPGP  +LD+++A F+AVGLN TD+VALSGAHT G A
Sbjct  149   SWTVLLGRRDSLTANRTAANEA-LPGPTFTLDELMANFLAVGLNTTDLVALSGAHTFGRA  207

Query  785   KCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFK  964
             +C  F++RL NF  TGSPDPTL+++ +  L   CP NG+G+    LD  + D FD+ YF 
Sbjct  208   RCLTFTDRLYNFTGTGSPDPTLNSTYLEILSEICPQNGNGSVLTNLDPVTPDTFDSKYFS  267

Query  965   NLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSD  1144
             NL +  GLLQSDQ LFS+  A      +V  ++ + + FF  F  SM+KMGNISPLTG++
Sbjct  268   NLQVEEGLLQSDQELFSTSGADTID--IVNNFSANQSAFFESFGESMIKMGNISPLTGTE  325

Query  1145  GEIRKNCRTRN  1177
             GEIR +CR  N
Sbjct  326   GEIRLSCRRVN  336



>gb|AAR15704.3| peroxidase [Brassica napus]
Length=306

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 217/306 (71%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   FY+ +CPN+  +VR  ++ A +++ R+ ASL+RLHFHDCFV GCDGS+LLD ++ 
Sbjct  1     QLNPTFYSGTCPNVSAIVRSTIEQAPQSDPRIGASLIRLHFHDCFVKGCDGSLLLDDSAN  60

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK AVPN NS RGF V+D IK+A+E+AC G+VSC+DILA+A+  SV L+GGPTW VL
Sbjct  61    IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPTWAVL  120

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN + A+   LP PF+ +  I AKF AVGLN TD+V LSGAHT G A CA F
Sbjct  121   LGRRDGLTANLSGANTG-LPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFGRAACATF  179

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TGSPDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  180   NNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGSASVVTNLDLSTPDAFDNNYFTNLQSN  239

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ L S   +   +  +V ++ ++  +FF  F  SM+KMGNISPLTGS GEIR+
Sbjct  240   NGLLQSDQELLSDTGSP--TIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGSSGEIRQ  297

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  298   DCKVVN  303



>gb|AFN41087.1| peroxidase precursor [Corylus avellana]
Length=330

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL   FY ++C N   +VR  VQ A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD  G+
Sbjct  25    QLNATFYGDTCSNASTIVRNAVQQALQSDSRIGASLIRLHFHDCFVNGCDGSILLDRGGS  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
              T SEK A PN NS RGF+V+D+IK+A+ES+C  VVSCADILA+AA  SV LSGGPTW V
Sbjct  85    ITQSEKDAAPNTNSTRGFDVVDNIKAALESSCPSVVSCADILALAAEASVSLSGGPTWNV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P P + L  I +KF AVGL+  D+VALSGAHT G A+C +
Sbjct  145   LLGRRDSLTANQAGANTSI-PSPVEGLSNITSKFSAVGLDTNDLVALSGAHTFGRAQCRL  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F  RL NF  TG+PDPT++++ +  LQ TCP NGDG   A LD  + D FDN YF NL  
Sbjct  204   FIGRLYNFNGTGNPDPTINSTYLTTLQQTCPQNGDGTVLANLDPTTPDSFDNGYFTNLQN  263

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V +++++   FF  F  SM+ MGNISPLTG++GEIR
Sbjct  264   NQGLLQSDQELFSTAGASTVS--IVNSFSSNQTAFFERFAQSMINMGNISPLTGTNGEIR  321

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  322   SDCKKVN  328



>ref|NP_196290.1| peroxidase 53 [Arabidopsis thaliana]
 sp|Q42578.1|PER53_ARATH RecName: Full=Peroxidase 53; Short=Atperox P53; AltName: Full=ATPA2; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA68212.1| peroxidase [Arabidopsis thaliana]
 dbj|BAB09806.1| peroxidase [Arabidopsis thaliana]
 gb|AAL07035.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM20347.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED91055.1| peroxidase 2 [Arabidopsis thaliana]
Length=335

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 220/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  31    QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGS  90

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN+NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV L+GGP+W VL
Sbjct  91    IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVL  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A++S+ P P +SL  I  KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  151   LGRRDSLTANLAGANSSI-PSPIESLSNITFKFSAVGLNTNDLVALSGAHTFGRARCGVF  209

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  210   NNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  269

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +  ++ A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  270   DGLLQSDQELFSTTGS--STIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRL  327

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  328   DCKKVN  333



>ref|XP_006362277.1| PREDICTED: peroxidase 15-like [Solanum tuberosum]
Length=335

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 218/309 (71%), Gaps = 5/309 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL + FY N+CPN+  +VR  +Q A++++ R+ ASLLRLHFHDCFVNGCD S+LLD N+
Sbjct  29    AQLNSNFYQNNCPNVSDIVRCVIQEALQSDARIGASLLRLHFHDCFVNGCDASILLDNNA  88

Query  440   TT---SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
              T   SEK A PN NS RGF V+D+IK AVE+ C GVVSCADILA+AA  SV L+GGP+W
Sbjct  89    KTNIVSEKDAAPNANSVRGFNVVDNIKVAVENCCPGVVSCADILALAAESSVSLAGGPSW  148

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKC  790
              VLLGRRD   AN   A+ S+ P PF+S+++I  KF AVGL++TD+VALSGAHT G A+C
Sbjct  149   NVLLGRRDSRRANQGGANISI-PSPFESINKITTKFSAVGLSITDLVALSGAHTFGRAQC  207

Query  791   AVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNL  970
              +F  RL NF  TG PDPTL+ + + +L   CP  G     A LD  + + FDN+YF NL
Sbjct  208   RLFRQRLYNFNGTGKPDPTLNTNYLAKLMKICPKKGSNTPLANLDLTTPNKFDNNYFANL  267

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                +GLL+SDQ LFS + A   +  ++ T++ D N FF  FV SM+ MGNISPLTG++GE
Sbjct  268   QNNKGLLESDQKLFSKNGASEITN-IINTFSRDQNVFFQSFVESMINMGNISPLTGTNGE  326

Query  1151  IRKNCRTRN  1177
             IR +C+  N
Sbjct  327   IRLDCKRVN  335



>ref|XP_006288143.1| hypothetical protein CARUB_v10001380mg [Capsella rubella]
 gb|EOA21041.1| hypothetical protein CARUB_v10001380mg [Capsella rubella]
Length=336

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 219/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCDGS+LLD   S
Sbjct  32    QLNATFYSATCPNASAIVRSTIQQALQSDARIGASLIRLHFHDCFVNGCDGSLLLDDTGS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NS RGF V+D+IK+A+E+AC G+VSC+D+LA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAAPNANSTRGFNVVDNIKTALENACPGIVSCSDVLALASEASVSLAGGPSWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S +P P +SL  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  152   LGRRDSLTANLAGAN-SAIPSPVESLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSASTITNLDLSTPDAFDNNYFNNLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +  ++ A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  271   NGLLQSDQELFSTTVS--STIAIVTSFASNQTLFFQVFAQSMINMGNISPLTGSNGEIRL  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKKVN  334



>ref|XP_006492671.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO62911.1| hypothetical protein CISIN_1g018796mg [Citrus sinensis]
Length=350

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 223/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY ++CPN+  ++R+ +QNA  +++R+ ASL+RLHFHDCFVNGCD S+LLD  +
Sbjct  26    AQLSPSFYNSTCPNVANIIREVLQNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTT  85

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEKFA PN NSARGFEV+D +K+AVE AC GVVSCADIL IAA  SV LSGGP+W  
Sbjct  86    TIVSEKFAAPNNNSARGFEVVDDMKAAVERACPGVVSCADILTIAAEQSVALSGGPSWTN  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
             LLGRRD   AN T A+ + LPGP +SL+++  +F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   LLGRRDSRTANRTLANEN-LPGPNNSLERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL NF  TG+PDPTL+ +L+ +L+  CP  G+G+    LD  + D+FDN YF NL 
Sbjct  205   TFSDRLFNFNSTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDVFDNKYFFNLQ  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQSDQ LFS+  A   + A+V  +  +   FF +FVTSM++MGN+ PLTG+ GEI
Sbjct  265   IHKGLLQSDQELFSTPGAD--TAAIVNNFGRNQTAFFENFVTSMIRMGNLKPLTGNQGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RLNCRRVN  330



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   339 bits (870),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 225/308 (73%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCP L++ V+  VQ+AIK E RM ASLLRL FHDCFVNGCDGS+LLD  S+
Sbjct  26    QLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSS  85

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN+NS RGFEVID+IKSAVE AC GVVSCADILA+ ARDSV++ GGP W V 
Sbjct  86    FTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGGPNWNVK  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA++S+ P P  +L+++I+ F AVGL+  DMVALSG+HTIG A+C  F
Sbjct  146   LGRRDARTASQGAANSSI-PAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIGQARCTTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+  + +T S    +D+S     Q +CP N G G NN APLD  +   FDN+YFKNL+
Sbjct  205   RARI--YNETNS----IDSSFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLV  258

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+  +A     ++V++Y N+ + F +DFVT+M+KMG+I PLTGS+GEI
Sbjct  259   NKKGLLHSDQQLFNGGSAD----SIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEI  314

Query  1154  RKNCRTRN  1177
             RKNCR RN
Sbjct  315   RKNCRRRN  322



>emb|CCJ34825.1| horseradish peroxidase isoenzyme HRP_A2A [Armoracia rusticana]
Length=336

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 216/306 (71%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A +++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHDCFVNGCDASILLDDSGS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+ C GVVSC+DILA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILALASEASVSLTGGPSWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S +P PF+ L  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  152   LGRRDSLTANLAGAN-SAIPSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  271   NGLLQSDQELFSTTGS--ATIAVVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRL  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKKVN  334



>ref|XP_009122283.1| PREDICTED: peroxidase A2 [Brassica rapa]
 emb|CDX70075.1| BnaA10g24240D [Brassica napus]
Length=338

 Score =   339 bits (870),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 219/306 (72%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  34    QLNATFYSGTCPNASAIVRTTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDDSGS  93

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+AC GVVSC+D+LA+A+  SV LSGGP+W VL
Sbjct  94    IQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLSGGPSWTVL  153

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A++S+ P P +SL  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  154   LGRRDSLTANQAGANSSI-PSPVESLTNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  212

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  +G+PDPTL+ +L+  LQ  CP NG G+    LD ++ D FDN+YF NL   
Sbjct  213   SNRLFNFSGSGNPDPTLNTTLLSSLQQICPQNGTGSGITNLDLSTPDAFDNNYFTNLQSN  272

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++ + FF  F  SM+ MGNI+PLTG+ GEIR 
Sbjct  273   NGLLQSDQELFSTTGS--ATIAIVTSFASNQSLFFQAFAQSMINMGNITPLTGNSGEIRL  330

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  331   DCKKVN  336



>ref|XP_010257485.1| PREDICTED: peroxidase A2-like [Nelumbo nucifera]
Length=328

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 216/306 (71%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL   FY+ SCPN+  +VR  +Q A++++ R  ASL+RLHFHDCFVNGCDGS+LLD + S
Sbjct  24    QLNATFYSISCPNVSSIVRGVIQQALQSDARNGASLIRLHFHDCFVNGCDGSILLDNSGS  83

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NS RGF+V+D IK+A+E++C GVVSCADILA+AA  SV L+GGP+W VL
Sbjct  84    IQSEKDAAPNANSTRGFDVVDDIKTALENSCPGVVSCADILALAAEASVSLAGGPSWNVL  143

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S+ P PF++L +I AKF AVGL+ TD+VALSGAHT G A+C  F
Sbjct  144   LGRRDSTTANQAGANTSI-PSPFENLTEITAKFSAVGLDTTDLVALSGAHTFGRAQCRTF  202

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S+RL NF  +G+PDPTL++S +  LQ TCP NG     A LD  + D FDN+YF NL   
Sbjct  203   SSRLYNFSGSGNPDPTLNSSYLATLQQTCPQNGSSTTLANLDPTTPDTFDNNYFSNLENN  262

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SDQ L S+  A   S  +V  ++ +   FF  F  SM+ MGNISPLTGS G+IR 
Sbjct  263   QGLLLSDQELLSTSGAATIS--IVNNFSANQTAFFQSFAQSMINMGNISPLTGSSGQIRS  320

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  321   DCKKVN  326



>emb|CCJ34826.1| horseradish peroxidase isoenzyme HRP_A2B [Armoracia rusticana]
Length=336

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 215/306 (70%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A +++ R+ ASL+RLHFHDCFVNGCD S+LLD   S
Sbjct  32    QLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHDCFVNGCDASILLDDSGS  91

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+ C GVVSC+DILA+A+  SV L+GGP+W VL
Sbjct  92    IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILALASEASVSLTGGPSWTVL  151

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S +P PF+ L  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  152   LGRRDSLTANLAGAN-SAIPSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  TG+PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  211   NNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  270

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   +  +V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  271   NGLLQSDQELFSTTGSATIT--VVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRL  328

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  329   DCKKVN  334



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/309 (58%), Positives = 217/309 (70%), Gaps = 14/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLTTGFY+ SCP L++ V+  V +A++ E RM ASLLRL FHDCFVNGCDGS+ LD  S
Sbjct  22    AQLTTGFYSKSCPKLYETVKSVVHSAVQKETRMGASLLRLFFHDCFVNGCDGSLFLDDIS  81

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A PN NSARGFEVID IKSAVE  C GVVSCADILA+ ARDSV++ GGP W V
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDV  141

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA++S+ P P  +L+++I+ F AVGL+  DMVALSGAHTIG A+C  
Sbjct  142   KLGRRDARTASQAAANSSI-PPPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTS  200

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+ N          LD+SL    Q  CP N G G NN APLD  +   FDNHYF NL
Sbjct  201   FRARIYNETN------NLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINL  254

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+  +A     ++V++Y+++ N F ADFVT+M+KMG+I PLTGS GE
Sbjct  255   VSKKGLLHSDQQLFNGGSAD----SIVKSYSDNPNSFAADFVTAMIKMGDIRPLTGSKGE  310

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  311   IRKNCRRIN  319



>ref|XP_010935535.1| PREDICTED: peroxidase 10 [Elaeis guineensis]
Length=327

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/309 (59%), Positives = 210/309 (68%), Gaps = 9/309 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GN  436
             GQL   FY  SCPNL ++VR  V +A+ NE RMAASLLR+HFHDCFV+GCD S+LLD  +
Sbjct  25    GQLDYRFYDTSCPNLTRIVRYGVWSAMLNETRMAASLLRMHFHDCFVDGCDASLLLDDSD  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NS RG+EVIDSIK+ VE AC   VSCADIL IAAR++V LSGGP W V
Sbjct  85    DIISEKSASPNKNSVRGYEVIDSIKADVEKACPSTVSCADILTIAAREAVFLSGGPFWYV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRDG  AN TAA+   LP PFDSL  I AKF A GL+  D+V LSGAHTIG A+C  
Sbjct  145   ALGRRDGTAANRTAANEQ-LPSPFDSLTTITAKFAAKGLDTKDVVVLSGAHTIGFAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F NRL NF  +G PDP LD SL+  LQ+ CP+N   N N APLD  +T  FDN Y+KNL+
Sbjct  204   FKNRLFNFNNSGEPDPALDTSLLRNLQSLCPNNVSSNSNLAPLDPVTTSRFDNVYYKNLM  263

Query  974   IGRGLLQSDQILF-SSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                GLLQSDQ L   SD A     ++V  Y+     FF DF  SMVKM +I  LTG +GE
Sbjct  264   NSSGLLQSDQALLDDSDTA-----SMVSDYSRYPYMFFRDFGASMVKMDSIGVLTGGNGE  318

Query  1151  IRKNCRTRN  1177
             IR NCR  N
Sbjct  319   IRTNCRVVN  327



>ref|XP_008390167.1| PREDICTED: peroxidase A2-like, partial [Malus domestica]
Length=315

 Score =   336 bits (862),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 218/304 (72%), Gaps = 8/304 (3%)
 Frame = +2

Query  281   YANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG----NSTT-  445
             Y  SCPN   +VR  ++ A++ + R+ ASL RLHFHDCFVNGCDGS+LLD     NST  
Sbjct  1     YDESCPNATSIVRGVIEEALQTDPRITASLTRLHFHDCFVNGCDGSILLDNSTNPNSTID  60

Query  446   SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLLG  625
             SEK AVPN NSARGF+V+D+IK+A+E+AC  VVSCADILAIAA +SV LSGGP+W VLLG
Sbjct  61    SEKTAVPNNNSARGFDVVDNIKTALENACPAVVSCADILAIAAEESVALSGGPSWTVLLG  120

Query  626   RRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSN  805
             RRD   AN TAA+ + LP P  +LD++ A F+AVGLN TD+VALSGAHT G A+C  F++
Sbjct  121   RRDSLTANRTAANEA-LPAPTFTLDZLEANFLAVGLNTTDLVALSGAHTFGRARCLTFTD  179

Query  806   RLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRG  985
             RL NF  TGSPDPTL+++ +  L   CP NG+G+    LD  + D FD  YF NL +  G
Sbjct  180   RLYNFSGTGSPDPTLNSTYLETLSEICPLNGNGSVLTNLDXVTPDTFDAKYFSNLQVEEG  239

Query  986   LLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNC  1165
             LLQSDQ LFS+  A      +V  ++ + + FF +F  SM+KMGNISPLTG++GEIR +C
Sbjct  240   LLQSDQELFSTSGADTID--IVNNFSANQSAFFENFGESMIKMGNISPLTGTEGEIRLSC  297

Query  1166  RTRN  1177
             R  N
Sbjct  298   RRVN  301



>gb|KDO62915.1| hypothetical protein CISIN_1g018873mg [Citrus sinensis]
Length=349

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 225/308 (73%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+++CPN+  ++R+ ++NA  +++R+ ASL+RLHFHDCFVNGCD S+LLD  +
Sbjct  26    AQLSPFFYSSTCPNVTNIIREVLKNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTT  85

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEKFA PN+NSARGFEV+D +K+AVE AC GVVSCADIL IAA +SV LSGGP+W  
Sbjct  86    TIVSEKFAGPNINSARGFEVVDDMKAAVERACPGVVSCADILTIAAEESVALSGGPSWTN  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
             LLGRRD   AN T A+ + LPGP ++L ++  +F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   LLGRRDSRTANRTLANEN-LPGPNNTLTRLKDRFRNVGLNDNFDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL NF  TG+PDPTL+ +L+ +L+  CP  G+G+    LD  + DLFDN YF NL 
Sbjct  205   TFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQ  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQSDQ LFS+  A   + A+V  ++++   FF  FV SM++MGN+ PLTG+ GEI
Sbjct  265   IRKGLLQSDQELFSTPGAD--TAAIVNVFSSNQAAFFQSFVISMIRMGNLRPLTGNQGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RLNCRRVN  330



>ref|XP_008228052.1| PREDICTED: peroxidase A2-like [Prunus mume]
Length=365

 Score =   338 bits (867),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY   CPN    VR  ++ A++ + R+AASL RLHFHDCFVNGCDGS+LLD +S
Sbjct  44    AQLSPTFYDEDCPNATSTVRAVIEEALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNSS  103

Query  440   TT-----SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGP  604
             +T     SEK A  N NSARGF+V+D+IK+A+E+AC GVVSCADILAIAA +SV LSGGP
Sbjct  104   STSSTIDSEKAAFANNNSARGFDVVDNIKTALETACPGVVSCADILAIAAEESVSLSGGP  163

Query  605   TWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLA  784
             +W VLLGRRD   AN TAA+ + LP P  +LDQ+ A F AVGL+ TD+VALSGAHT G A
Sbjct  164   SWTVLLGRRDSTTANRTAANEA-LPPPTFTLDQLKASFAAVGLDTTDLVALSGAHTFGRA  222

Query  785   KCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFK  964
             KC  FSNRL +F  TG PDPTL+++ +  L+  CP NG+ +  A  D ++ + FD  YF 
Sbjct  223   KCQSFSNRLYDFNSTGLPDPTLNSTYLETLRELCPQNGNASVLANFDPSTPNTFDGKYFS  282

Query  965   NLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSD  1144
             NL + +GLLQSDQ LFS+  A   +  +V  ++ + + FF  FV SM+KMGNISPLTG+D
Sbjct  283   NLQVRKGLLQSDQELFSTTGADTIN--IVNNFSVNQSAFFESFVKSMIKMGNISPLTGTD  340

Query  1145  GEIRKNCRTRN  1177
             GEIR NCR  N
Sbjct  341   GEIRLNCRKVN  351



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 222/308 (72%), Gaps = 15/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCPNLF  ++  VQ+AI  E RM ASL+RL FHDCFVNGCDGSVLLD  S+
Sbjct  30    QLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLDDTSS  89

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A+PN NSARGFEVIDSIKSAVE AC GVVSCADILA+AARDS ++ GGPTW V 
Sbjct  90    FTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPTWNVK  149

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+ +AA+  + P P  +L+Q+I++F A+GL+  D+VAL+G+HTIG A+C  F
Sbjct  150   LGRRDARTASLSAANNGI-PPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSF  208

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N       +  +D S     ++ CP +NG G NN APLD  +   FDN+YFKNLL
Sbjct  209   RARIYN-------ETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLL  261

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+      ++ ++V+TY+N  + FF+DFV  M+KMG+ISPLTGS GEI
Sbjct  262   NQKGLLHSDQQLFNG----GSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEI  317

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  318   RKNCRRMN  325



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   336 bits (862),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 221/304 (73%), Gaps = 14/304 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+TGFY+ SCP L++ V+  VQ+AIK E RM ASLLRL FHDCFVNGCDGS+LLD  S+
Sbjct  25    QLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSS  84

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN+NSARGFEVID+IKSAVE  C GVVSCADILA+ ARDSV++ GGP W V 
Sbjct  85    FTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNVK  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA+ S+ P P  +L+++I+ F AVGL+  DMVALSGAHTIG A+C  F
Sbjct  145   LGRRDARTASQAAANRSI-PPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDGNNT-APLDRNSTDLFDNHYFKNLL  973
               R+ N          LDAS     Q+ CP S+G G+N+ APLD  + + FDN+YFKNL+
Sbjct  204   RARIYNETN------NLDASFARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKNLV  257

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+  +A     ++V +Y+N+   F +DFVT+M+KMG+I PLTGS+GEI
Sbjct  258   NKKGLLHSDQQLFNGGSAD----SIVTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEI  313

Query  1154  RKNC  1165
             RKNC
Sbjct  314   RKNC  317



>ref|XP_009369457.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=338

 Score =   337 bits (864),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 222/307 (72%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL + FY+ +CPN+  +VR  VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD N T
Sbjct  33    QLNSTFYSTTCPNVTSIVRTTVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKNGT  92

Query  443   --TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NS RGF+V+D+IK+A+E++C GVVSCAD+LA+AA  SV LSGGP+W V
Sbjct  93    IQQSEKDAAPNTNSTRGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGGPSWNV  152

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PF+SL  I +KF AVGLN  D+VALSGAHT G A+C  
Sbjct  153   LLGRRDSLTANQAGANTSI-PSPFESLANITSKFSAVGLNTNDLVALSGAHTFGRAQCRT  211

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF  TG+PDPTL++S +  LQ TCP NG G   A LD ++ D FDN+YF NL  
Sbjct  212   FSNRLYNFNSTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDLSTPDAFDNNYFTNLQN  271

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V +++++ + FF  F  SM+ MGNISPL G+ GEIR
Sbjct  272   NQGLLQSDQELFSTAGAATVS--IVNSFSSNQSAFFESFARSMINMGNISPLVGTSGEIR  329

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  330   LDCKNVN  336



>ref|XP_009780492.1| PREDICTED: peroxidase 10-like [Nicotiana sylvestris]
Length=327

 Score =   336 bits (862),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 216/308 (70%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL   +Y  +CPNL K+VR  + +AI NE RMAASLLRLHFHDCFVNGCDGSVLLD  S
Sbjct  25    GQLDYKYYDATCPNLTKIVRYGIWSAISNETRMAASLLRLHFHDCFVNGCDGSVLLDDTS  84

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A  N NSARGFEVID+IK+ VE AC   VSCADIL +AAR+++ L+GGP W V
Sbjct  85    TFTGEKNAPANRNSARGFEVIDAIKANVEKACPSTVSCADILTLAAREAIYLTGGPYWSV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+ +AA+A + P PF+ L+ I AKFV+ GL++ D+V LSGAHTIG A+C  
Sbjct  145   SLGRRDSLTASQSAANAQI-PSPFEPLENITAKFVSKGLDIKDVVVLSGAHTIGFAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F  RL +F  +G+PDPTLD+SL+  L++ CP+  D + N APLD  + + FDN YFKNL+
Sbjct  204   FKQRLFDFDGSGNPDPTLDSSLLGNLRSVCPNQNDSDSNLAPLDAVTINKFDNVYFKNLM  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQSDQ L +     N + +LV TY+     F   F  SMVK+ N+  LTG DGEI
Sbjct  264   NNSGLLQSDQALMN----DNNTASLVSTYSKYPYLFSKAFAASMVKLTNLGVLTGQDGEI  319

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  320   RKNCRLVN  327



>ref|XP_006425837.1| hypothetical protein CICLE_v10026130mg [Citrus clementina]
 gb|ESR39077.1| hypothetical protein CICLE_v10026130mg [Citrus clementina]
 gb|KDO37975.1| hypothetical protein CISIN_1g021592mg [Citrus sinensis]
Length=310

 Score =   335 bits (860),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 209/307 (68%), Gaps = 8/307 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   +Y ++CP+L ++VR  V +AI NE RMAASLLRLHFHDCFV GCDGSVLLD  ST
Sbjct  10    QLDYKYYDDTCPSLTRIVRYGVWSAISNETRMAASLLRLHFHDCFVKGCDGSVLLDDTST  69

Query  443   TS-EKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T  EK A PN NSARGFEVID+IK+ +E AC   VSC DIL + AR++V L GGP W V 
Sbjct  70    TKGEKNAFPNRNSARGFEVIDAIKANLEKACPATVSCTDILTLVAREAVFLGGGPFWAVP  129

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  A  + ++A+ LP PF+ L  I AKF A GL+L D+V LSG HTIG A+C  F
Sbjct  130   LGRRDGLTA--SESEANNLPSPFEPLQNITAKFTARGLDLKDVVVLSGGHTIGFAQCLSF  187

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNT-APLDRNSTDLFDNHYFKNLLI  976
              NRL +F  +G PDPTLDASL+  LQ+TCPS  D +     LD  +T+ FDN YF+NL+ 
Sbjct  188   KNRLFDFSGSGKPDPTLDASLLQSLQSTCPSQADSDTKLVALDSVTTNKFDNIYFQNLVN  247

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ L       N + A+VQ Y+     F  DF  SMVKM NI  LTG DGEIR
Sbjct  248   KSGLLQSDQALM----GDNRTAAMVQYYSKYPYFFSKDFGASMVKMANIGVLTGQDGEIR  303

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  304   KNCRVVN  310



>ref|XP_006492677.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
Length=349

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 224/308 (73%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+++CPN+  ++R+ ++NA  +++R+ ASL+RLHFHDCFVNGCD S+LLD  +
Sbjct  26    AQLSPFFYSSTCPNVTNIIREVLKNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTT  85

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEKFA PN+NSARGFEV+D +K+AVE AC GVVSCADIL IAA +SV LSGGP W  
Sbjct  86    TIVSEKFAGPNINSARGFEVVDDMKAAVERACPGVVSCADILTIAAEESVALSGGPAWTN  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
             LLGRRD   AN T A+ + LPGP ++L ++  +F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   LLGRRDSRTANRTLANEN-LPGPNNTLTRLKDRFRNVGLNDNFDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL NF  TG+PDPTL+ +L+ +L+  CP  G+G+    LD  + DLFDN YF NL 
Sbjct  205   TFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQ  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQSDQ LFS+  A   + A+V  ++++   FF  FV SM++MGN+ PLTG+ GEI
Sbjct  265   IRKGLLQSDQELFSTPGAD--TAAIVNVFSSNQAAFFQSFVISMIRMGNLRPLTGNQGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RLNCRRVN  330



>ref|XP_007205439.1| hypothetical protein PRUPE_ppa007826mg [Prunus persica]
 gb|EMJ06638.1| hypothetical protein PRUPE_ppa007826mg [Prunus persica]
Length=354

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 221/307 (72%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY   CPN   +VR  ++ A++ ++R+AASL RL FHDCFVNGCDGS+LLD +S
Sbjct  37    AQLSPTFYDKDCPNATSIVRAVIEEALQTDLRIAASLTRLFFHDCFVNGCDGSILLDNSS  96

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A+PN NSARGF+V+D+IK+A+E+AC G+VSCADILAI+A +SV LSGGP+W V
Sbjct  97    TIDSEKGALPNNNSARGFDVVDNIKTALETACPGIVSCADILAISAEESVSLSGGPSWTV  156

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN TAA+ + LP P  +LD++ A F AVGL+ TD+VALSGAHT G A+C  
Sbjct  157   LLGRRDSTTANRTAANEA-LPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRAQCQF  215

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS+RL  F  TGSPDPTL+++ +  L   CP +G+G+  A LD ++ D FD  YF NL +
Sbjct  216   FSDRLYAFNSTGSPDPTLNSTYLETLSALCPQSGNGSVLADLDPSTPDGFDADYFSNLQV  275

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A      ++ +Y+ + + FF  FV SM KMGNIS LTG+DGEIR
Sbjct  276   HYGLLQSDQELFSTSGADTVD--IINSYSANQSAFFESFVISMNKMGNISLLTGTDGEIR  333

Query  1157  KNCRTRN  1177
              NC   N
Sbjct  334   LNCSKVN  340



>ref|XP_008387221.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=339

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 220/307 (72%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL + FY+ +CPN+  +VR  VQ A++++ R+ ASL+RLHFHDCFVNGCD S+LLD N T
Sbjct  34    QLNSTFYSTTCPNVTSIVRSAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKNGT  93

Query  443   --TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NSARGF+V+D+IK+A+E++C GVVSCAD+LA+AA  SV LSGGP+W  
Sbjct  94    IQQSEKDAAPNTNSARGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGGPSWNA  153

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PF+ L  I +KF AVGLN  D+VALSGAHT G A+C  
Sbjct  154   LLGRRDSLTANQAGANTSI-PSPFEGLANITSKFSAVGLNTNDLVALSGAHTFGRAQCRT  212

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF  TG+PDPTL++S +  LQ TCP NG G   A LD  + D FDN+YF NL  
Sbjct  213   FSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDLXTPDAFDNNYFTNLQN  272

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A   S  +V +++++ + FFA F  SM+ MGNISPL G+ GEIR
Sbjct  273   NEGLLQSDQELFSTAGAATVS--IVNSFSSNQSAFFASFAQSMINMGNISPLVGTSGEIR  330

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  331   LDCKNVN  337



>ref|XP_004294746.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 214/308 (69%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCP LF  V+  VQ+AI NE R+ ASLLRLHFHDCFVNGCDGSVLLD  S+
Sbjct  31    QLSTNFYSGSCPKLFTTVKSVVQSAISNENRIGASLLRLHFHDCFVNGCDGSVLLDDTSS  90

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN NS RGF+V+D IK+ VE AC GVVSCADI+ IAARDSV++ GGP+W V 
Sbjct  91    FTGEKTAGPNNNSLRGFDVVDKIKTKVEKACPGVVSCADIVTIAARDSVVILGGPSWSVK  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD       AA++ V+P P + L  +I KF A GL+ TDMVALSGAHTIG A+C VF
Sbjct  151   LGRRDAKTTTLAAANSGVIPAPTNDLSDLITKFQAQGLSTTDMVALSGAHTIGKARCTVF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPS-NGDG-NNTAPLDRNSTDLFDNHYFKNLL  973
              +R+ N       +  +DAS     Q  CPS +G G NN APLD  +T+ FD  YF+NL+
Sbjct  211   RDRIYN-------ETNIDASFAKTRQNNCPSTSGSGDNNLAPLDTQTTNAFDPKYFQNLI  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+      ++ +LV+ Y+  +  F ADF  +M+KMG+I PLTGS GEI
Sbjct  264   NKKGLLHSDQELFNG----GSTDSLVKKYSASAKNFNADFAKAMIKMGDIKPLTGSQGEI  319

Query  1154  RKNCRTRN  1177
             RKNCR RN
Sbjct  320   RKNCRKRN  327



>ref|XP_006466643.1| PREDICTED: peroxidase 10-like [Citrus sinensis]
Length=329

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 209/307 (68%), Gaps = 8/307 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL   +Y ++CP+L ++VR  V +AI NE RMAASLLRLHFHDCFV GCDGSVLLD  ST
Sbjct  29    QLDYKYYDDTCPSLTRIVRYGVWSAISNETRMAASLLRLHFHDCFVKGCDGSVLLDDTST  88

Query  443   TS-EKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
             T  EK A PN NSARGFEVID+IK+ +E AC   VSC DIL + AR++V L GGP W V 
Sbjct  89    TKGEKNAFPNRNSARGFEVIDAIKANLEKACPATVSCTDILTLVAREAVFLGGGPFWAVP  148

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  A  + ++A+ LP PF+ L  I AKF A GL+L D+V LSG HTIG A+C  F
Sbjct  149   LGRRDGLTA--SESEANNLPSPFEPLQNITAKFTARGLDLKDVVVLSGGHTIGFAQCLSF  206

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNT-APLDRNSTDLFDNHYFKNLLI  976
              NRL +F  +G PDPTLDASL+  LQ+TCPS  D +     LD  +T+ FDN YF+NL+ 
Sbjct  207   KNRLFDFSGSGKPDPTLDASLLQSLQSTCPSQADSDTKLVALDSVTTNKFDNIYFQNLVN  266

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ L       N + A+VQ Y+     F  DF  SMVKM NI  LTG DGEIR
Sbjct  267   KSGLLQSDQALM----GDNRTAAMVQYYSKYPYFFSKDFGASMVKMANIGVLTGQDGEIR  322

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  323   KNCRVVN  329



>dbj|BAF33316.1| peroxidase [Populus alba]
Length=329

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 215/306 (70%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FYAN+CPN+  +V   VQ A  ++ R+ ASL+RLHFHDCFV+GCD S+LLD +S+
Sbjct  25    QLSATFYANTCPNVSSIVSNVVQQAFLSDSRIGASLIRLHFHDCFVDGCDASILLDNSSS  84

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN+NS RGF V+DSIK+A+ES+C GVV+CADILA+AA  SV  SGGP+W VL
Sbjct  85    ILSEKLAAPNVNSIRGFGVVDSIKTALESSCPGVVTCADILALAAESSVSQSGGPSWSVL  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGR D   AN   A+ S+ P PF+ L  I AKF AVGLN  D+VAL GAHT G A+C  F
Sbjct  145   LGRGDSLTANQAGANTSI-PSPFEGLSNITAKFSAVGLNTNDLVALLGAHTFGRAQCRTF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             SNRL NF  TGSPDPTL+ + +  LQ  CP NG G   A LD  ++D FDN+YF NL   
Sbjct  204   SNRLYNFSNTGSPDPTLNTTYLTTLQQICPQNGSGTALANLDPTTSDTFDNNYFTNLQNN  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLLQSDQ LFS+  A   +  LV  ++++   FF  FV S++ MGNISPLTGS GEIR 
Sbjct  264   QGLLQSDQELFSTSGAATVT--LVNNFSSNQTAFFQSFVQSIINMGNISPLTGSSGEIRS  321

Query  1160  NCRTRN  1177
             +C+  N
Sbjct  322   DCKKVN  327



>ref|XP_004249178.1| PREDICTED: peroxidase A2 [Solanum lycopersicum]
Length=338

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 217/309 (70%), Gaps = 5/309 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL + FY N+CPN+  +VR  +Q A++++ R+ ASLLR+HFHDCFVNGCD S+LLD N+
Sbjct  32    AQLNSNFYENNCPNVSDIVRCVLQEALQSDARIGASLLRIHFHDCFVNGCDASILLDNNA  91

Query  440   TT---SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
              T   SEK A PN NS RGF V+D+IK AVE+ C GVVSCADILA+AA  SV L+GGP+W
Sbjct  92    KTKIVSEKNAAPNANSLRGFNVVDNIKVAVENCCPGVVSCADILALAAESSVSLAGGPSW  151

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKC  790
              VLLGRRD   AN   A+ S+ P P + +++I  KF AVGL +TD+VALSGAHT G A+C
Sbjct  152   NVLLGRRDSRRANQGGANISI-PSPLEDINKITTKFSAVGLTITDLVALSGAHTFGRAQC  210

Query  791   AVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNL  970
              +F  RL NF  TG PDPTL+ + + +L   CP  G     A LD  + + FDN+YF NL
Sbjct  211   RLFRERLYNFNGTGKPDPTLNTNYLAKLMKICPKKGSNTALANLDLTTPNKFDNNYFANL  270

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
                +GLL+SDQ LFS ++A   +  +++T++ D N FF  FV SM+ MGNISPLTG++GE
Sbjct  271   QNKKGLLESDQKLFSKNSASEITN-IIKTFSRDQNVFFQSFVESMINMGNISPLTGTNGE  329

Query  1151  IRKNCRTRN  1177
             IR +C+  N
Sbjct  330   IRLDCKRVN  338



>ref|XP_009586909.1| PREDICTED: peroxidase 10-like [Nicotiana tomentosiformis]
Length=327

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 216/308 (70%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL   +Y  +CPNL K+VR  + +AI NE RMAASLLRLHFHDCFVNGCDGSVLLD  S
Sbjct  25    GQLDYKYYDATCPNLTKIVRYGIWSAISNETRMAASLLRLHFHDCFVNGCDGSVLLDDTS  84

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A  N NSARGFEVID+IK+ VE AC   VSCADIL +AAR+++ L+GGP W V
Sbjct  85    TFTGEKNASANRNSARGFEVIDTIKANVEKACPSTVSCADILTLAAREAIYLTGGPYWSV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+ +AA+A + P PF+ L+ I AKFV+ GL++ D+V LSG+HTIG A+C  
Sbjct  145   SLGRRDSLTASQSAANAQI-PSPFEPLENITAKFVSKGLDVKDVVVLSGSHTIGFAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F  RL +F  +G+PDPTLD+SL+  L++ CP+  D + N APLD  + + FDN YFKNL+
Sbjct  204   FKQRLFDFDGSGNPDPTLDSSLLGNLRSVCPNQSDSDSNLAPLDAVTINKFDNVYFKNLM  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQSDQ L +     N + ++V TY+     F   F  SMVK+ N+  LTG DGEI
Sbjct  264   NNSGLLQSDQALMN----DNNTASMVSTYSKYPYLFSKAFAASMVKLTNLGVLTGQDGEI  319

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  320   RKNCRLVN  327



>ref|XP_010058152.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
Length=333

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 215/307 (70%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLT  FYA +CP++  +V+  +Q A++++ R+ ASLLRLHFHDCFV+GCDGS+LLD + 
Sbjct  28    AQLTANFYAKTCPSVSSIVQTVIQEALQSDPRITASLLRLHFHDCFVDGCDGSLLLDNSP  87

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A PN  SARGF+V+D IK+A+ESAC G VSCADILA+AA+ SV LS GP W V
Sbjct  88    TIKSEKDAAPNFKSARGFDVVDKIKAAIESACPGTVSCADILALAAQASVSLSEGPYWTV  147

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PFDS + +++KF AVGL++TD+  LSGAHT G A+C  
Sbjct  148   LLGRRDSLTANQAGANTSI-PSPFDSYNNLVSKFSAVGLDITDLATLSGAHTFGRAQCKS  206

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL NF   G PDPT++   +  L+  CP NGD +  A LD  + +LFDNHY+ NL  
Sbjct  207   FNPRLYNFTANGGPDPTINPWYLTNLRKLCPQNGDSSVLADLDPTTPNLFDNHYYSNLQK  266

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLL SDQ L+S+  A   S  +V +++ D + FF  F  S+V MGNISPLTGS+GEIR
Sbjct  267   NEGLLLSDQELYSTTGAATIS--IVNSFSFDQSAFFESFARSIVNMGNISPLTGSNGEIR  324

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  325   FNCRKVN  331



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 224/308 (73%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCP L++ ++  VQ+AI  E RM ASLLRL FHDCFVNGCDGS+LLD  S+
Sbjct  26    QLSTNFYSKSCPKLYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSS  85

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN+NS RGFEVID+IKSAVE AC G+VSCADILA+ ARDSV++ GGP W V 
Sbjct  86    FTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGPNWNVK  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA++S+ P P  +L+++I+ F AVGL+  DMVALSGAHTIG A+C  F
Sbjct  146   LGRRDARTASQGAANSSI-PAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTF  204

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+  + +T +    +D++     Q +CP N G G NN APLD  +   FDN+YFKNL+
Sbjct  205   RARI--YNETNN----IDSTFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLV  258

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+  +A     ++V++Y N+ + F +DFVT+M+KMG+I PLTGS+GEI
Sbjct  259   NKKGLLHSDQQLFNGGSAD----SIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEI  314

Query  1154  RKNCRTRN  1177
             RKNCR RN
Sbjct  315   RKNCRRRN  322



>gb|KDO62910.1| hypothetical protein CISIN_1g018796mg [Citrus sinensis]
Length=350

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 220/308 (71%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-N  436
              QL+  FY ++CPN+  ++R+ +QNA  +++R+ ASL+RLHFHDCFVNGCD S+LLD  N
Sbjct  26    AQLSPSFYNSTCPNVANIIREVLQNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDSTN  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             +  SEKFA PN NSARGFEVID++K+AVE AC  VVSCADIL IAA  SV LSGGP+W V
Sbjct  86    TIDSEKFAAPNNNSARGFEVIDNMKAAVEKACRRVVSCADILTIAAERSVALSGGPSWAV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
              LGRRD   AN   A+ + LPGP +SLD++ + F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   PLGRRDSRTANRALANQN-LPGPSNSLDELKSSFRNVGLNDKFDLVALSGAHTFGRAQCK  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL +F +TG PDPT+D +L+ +L+  CP  G+G   A  D  + D FDN YF NL 
Sbjct  205   FFSDRLYDFNKTGKPDPTVDRTLLKQLRELCPQGGNGAVLANFDVKTPDAFDNKYFSNLR  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             + +GLLQSDQ LFS+  A   + A+V+ +  +   FF +FV SM++MGN+ PLTG+ GEI
Sbjct  265   LRKGLLQSDQELFSTPGAD--TAAIVEDFGRNQTAFFKNFVISMIRMGNLKPLTGNQGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RLNCRRVN  330



>dbj|BAJ93823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   334 bits (857),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 213/307 (69%), Gaps = 4/307 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   +Y  SCP+++  VR+ VQ A   + R+ ASL+RL FHDCFVNGCDGS+LLD G +
Sbjct  28    QLNPAYYDESCPHVYDTVRRVVQEARTADPRILASLVRLQFHDCFVNGCDGSLLLDDGPA  87

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D IK+A+ESAC G VSCADI+A+AA  SV L+GGP WRVL
Sbjct  88    VNSEKKAAPNSNSARGFPVVDGIKAALESACPGTVSCADIVALAAEVSVELAGGPYWRVL  147

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  ANF AAD   LPGP D+L+ +  KF  +GL+ TD VAL GAHTIG ++C  F
Sbjct  148   LGRRDGMTANFDAADN--LPGPTDALNVLRQKFAGLGLDDTDFVALQGAHTIGRSQCRFF  205

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              +RL+NF  TG PDPTLD + +  LQ +CP+ G       LD  + D FDN Y+ NLL  
Sbjct  206   QDRLNNFAGTGQPDPTLDGAYLSALQQSCPAAGADMRLNNLDPATPDAFDNSYYHNLLRN  265

Query  980   RGLLQSDQILFSSDAAQNTSKA-LVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             RGLL+SDQ++ S+     TS A +V+ +      FF  F T+M+KMGNI+PLTG+ GE+R
Sbjct  266   RGLLRSDQVMLSAPEGAATSTAPIVERFAASQADFFRSFATAMIKMGNIAPLTGNMGEVR  325

Query  1157  KNCRTRN  1177
             +NCR  N
Sbjct  326   RNCRVVN  332



>ref|XP_007205419.1| hypothetical protein PRUPE_ppa007654mg [Prunus persica]
 gb|EMJ06618.1| hypothetical protein PRUPE_ppa007654mg [Prunus persica]
Length=360

 Score =   335 bits (859),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLTT FY   CP     VR  + +A++ + R+AASL RLHFHDCFVNGCDGS+LLD +S
Sbjct  39    AQLTTTFYDEVCPCAITTVRGVILDALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNSS  98

Query  440   TT-----SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGP  604
             +T     SEK A  N NSARGF+V+D+IK+A+E+AC GVVSCADILAIAA +SV LSGGP
Sbjct  99    STSSTIDSEKAAFANNNSARGFDVVDNIKTALETACPGVVSCADILAIAAEESVSLSGGP  158

Query  605   TWRVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLA  784
             +W VLLGRRD   AN TAA+ + LP P  +LD++ A F AVGL+ TD+VALSGAHT G A
Sbjct  159   SWTVLLGRRDSTTANRTAANEA-LPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRA  217

Query  785   KCAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFK  964
             KC  FSNRL +F  TG PDPTL+++ +  L+  CP NG+ +  A  D ++ + FD  YF 
Sbjct  218   KCQSFSNRLYDFNSTGLPDPTLNSTYLETLRELCPQNGNASVLANFDPSTPNTFDGKYFS  277

Query  965   NLLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSD  1144
             NL + +GLLQSDQ LFS+  A   +  +V  ++ + + FF  FV SM+KMGNISPLTG+D
Sbjct  278   NLQVRKGLLQSDQELFSTSGADTIN--IVNNFSVNQSAFFESFVKSMIKMGNISPLTGTD  335

Query  1145  GEIRKNCRTRN  1177
             GEIR NCR  N
Sbjct  336   GEIRLNCRRVN  346



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   333 bits (855),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 222/308 (72%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+TGFY+ SCP L++ V+  VQ+AI  E RM ASLLRL FHDCFVNGCDGS+LLD  S+
Sbjct  25    QLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSS  84

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN+NSARGFEVID+IKSAVE  C GVVSCADILA+ ARDSV++ GGP W V 
Sbjct  85    FTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNVK  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+ +AA++ + P    +L+++I+ F AVGL+  DMVALSGAHTIG A+C  F
Sbjct  145   LGRRDSRTASQSAANSGIPPAT-SNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N          LDAS     Q+ CP S+G G NN APLD  + + FDN+YFKNL+
Sbjct  204   RARIYNETN------NLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLV  257

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+  +A     ++V +Y+N+ + F +DFVT+M+KMG+I PLTGS+GEI
Sbjct  258   DKKGLLHSDQQLFNGGSAD----SIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEI  313

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  314   RKNCRRLN  321



>ref|XP_006494804.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
Length=350

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 223/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+++CPN+  ++R+ +QNA  +++R+ ASL+RLHFHDCFVNGCD S+LLD  +
Sbjct  26    AQLSPSFYSSTCPNVTNIIREVLQNAFLSDIRIGASLVRLHFHDCFVNGCDASILLDNTT  85

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEKFA PN NSARGFEV+D +K+AVE AC GVVSCADIL IAA  SV LSGGP+W  
Sbjct  86    TIESEKFAGPNNNSARGFEVVDDMKAAVERACPGVVSCADILTIAAEQSVALSGGPSWTN  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
             LLGRRD   AN T A+ + LP P +S++++  +F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   LLGRRDSRTANRTLANEN-LPVPNNSVERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL NF  TG+PDPTL+ +L+ +L+  CP  G+G+    LD  + D+FDN YF NL 
Sbjct  205   TFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDVFDNKYFFNLQ  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             I +GLLQSDQ LFS+  A   + A+V  +  +   FF +FVTSM++MGN+ PLTG+ GEI
Sbjct  265   IHKGLLQSDQELFSTPGAD--TAAIVNNFGRNQTVFFVNFVTSMIRMGNLKPLTGNQGEI  322

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  323   RLNCRRVN  330



>ref|XP_002263033.2| PREDICTED: peroxidase 10-like [Vitis vinifera]
Length=327

 Score =   333 bits (855),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 207/308 (67%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL   FY +SCPNL  +VR  V +A+  E RMAASLLRLHFHDCFVNGCD S+LLD +S
Sbjct  25    GQLDYNFYDHSCPNLTGIVRNGVASAVAKETRMAASLLRLHFHDCFVNGCDASILLDESS  84

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                 EK A+PN NS RGFEVID+IK+ VE AC   VSCADIL +A R+++ L GGP W V
Sbjct  85    AFKGEKNALPNRNSVRGFEVIDAIKADVERACPSTVSCADILTLAVREAIYLVGGPFWLV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              +GRRDG  AN TAA+   LP P + L+ I AKF + GL L D+V LSGAHTIG A+C  
Sbjct  145   AMGRRDGLTANETAANEQ-LPSPIEPLENITAKFTSKGLTLKDVVVLSGAHTIGFAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F +RL NF  TG+PDPTLDASL+  LQ  CP+  D N N APLD  +T+ FDN Y++NL+
Sbjct  204   FKSRLFNFDNTGNPDPTLDASLLQSLQQICPNQADSNTNLAPLDSVTTNKFDNVYYRNLV  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQSDQ L       N +  +V  Y      F + F TSMVKM  I  LTG DGEI
Sbjct  264   NNSGLLQSDQALM----GDNRTAPMVMLYNRLPYLFASAFKTSMVKMSYIGVLTGHDGEI  319

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  320   RKNCRVVN  327



>ref|XP_006492673.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
Length=350

 Score =   334 bits (857),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 221/317 (70%), Gaps = 5/317 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY+++CPN+  ++R  +Q A  +++R+ ASL+RLHFHDCFVNGCD SVLLD  +
Sbjct  26    AQLSPFFYSSTCPNVTNIIRGVLQKAFLSDIRIGASLIRLHFHDCFVNGCDASVLLDNTT  85

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEKFA PN NSARGFEVID +K+AVE AC  VVSCADIL IAA  SV LSGGP+W  
Sbjct  86    TIDSEKFAAPNNNSARGFEVIDQMKAAVEKACPRVVSCADILTIAAEQSVALSGGPSWTN  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
             LLGRRD   AN T A+ + LP PFD+LD++ A F  VGLN   D+VALSGAHT G A+C 
Sbjct  146   LLGRRDSRTANRTLANQN-LPSPFDTLDRLKASFRNVGLNDNFDLVALSGAHTFGRAQCR  204

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  TG+PDPTLDA+ + +L+  CP  G+G+    LD  + ++FDN YF NL 
Sbjct  205   FFSVRLFNFNNTGNPDPTLDATFLQQLRQLCPQGGNGSVLTNLDVTTPNVFDNKYFSNLR  264

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLLQSDQ LFS+  A      +V  +  +   FF  FVTSM++MGN+ PLTG++GEI
Sbjct  265   NRKGLLQSDQELFSTPGADTID--IVNVFRKNQAAFFKSFVTSMIRMGNLKPLTGNEGEI  322

Query  1154  RKNCRTRN*IINPLTHS  1204
             R NCR  N   N +T S
Sbjct  323   RLNCRRVNGNSNIVTRS  339



>ref|XP_006492674.1| PREDICTED: peroxidase C3-like isoform X1 [Citrus sinensis]
Length=349

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-NS  439
             QL+  FY+++CPN+   +   ++ A  +++R+ ASL+RLHFHDCFV+GCD S+LLD  N+
Sbjct  26    QLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDSTNT  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEKFA PN NSARGFEVID++K+AVE AC  VVSCADIL IAA  SV LSGGP+W V 
Sbjct  86    IDSEKFAAPNNNSARGFEVIDNMKAAVEKACPRVVSCADILTIAAERSVALSGGPSWAVP  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLN-LTDMVALSGAHTIGLAKCAV  796
             LGRRD   AN   A+ + LPGPFD+LD++ + F  VGLN   D+VALSGAHT G A+C  
Sbjct  146   LGRRDSRTANRALANQN-LPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGRAQCQF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F  RL +F  TG PDPTLDA+ + +L+  CP  G+G   A  D  + D+FDN YF NL  
Sbjct  205   FRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYFSNLRG  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   + A+V+ +  + N FF +FVTSM++MGN+ PLTG+ GEIR
Sbjct  265   RKGLLQSDQELFSTPGAD--TAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQGEIR  322

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  323   LNCRRVN  329



>gb|ABG46370.1| rubber peroxidase 1 [Hevea brasiliensis]
Length=346

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 220/308 (71%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY  SCPN+  ++R  +Q +++++ R+ ASL+RLHFHDCFVNGCD S+LLD   
Sbjct  27    AQLSPTFYDQSCPNVSNIIRGVIQESLQSDSRIGASLIRLHFHDCFVNGCDASILLDNTD  86

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A  N NSARGF+V+D++K+ +ESAC G+VSCADIL ++A+ SV L+GGPTW  
Sbjct  87    TIESEKQAAANNNSARGFDVVDTMKARLESACPGIVSCADILTVSAQQSVDLAGGPTWTN  146

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNL-TDMVALSGAHTIGLAKCA  793
             LLGRRD   A+ + A+ S+ PGPF++LDQ+ +KF AVGLN  TD+VALSGAHT G A+C 
Sbjct  147   LLGRRDSLTASRSQANLSI-PGPFETLDQLKSKFTAVGLNNNTDLVALSGAHTFGRAQCR  205

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS RL NF  T SPDPTL+ + +  LQ  CP  G+G+    LD  ++D FDN YF NLL
Sbjct  206   TFSPRLYNFNNTNSPDPTLNTTYLQTLQQICPQGGNGSVITNLDLTTSDTFDNEYFSNLL  265

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             +G GLLQSDQ LF++  A   + A+VQ ++ +   FF  FV SM++MGN+S LTG+ GEI
Sbjct  266   VGEGLLQSDQELFNTTGAD--TVAIVQNFSANQTAFFESFVESMLRMGNLSVLTGTIGEI  323

Query  1154  RKNCRTRN  1177
             R NC   N
Sbjct  324   RLNCSKVN  331



>gb|KDO62916.1| hypothetical protein CISIN_1g018871mg [Citrus sinensis]
Length=349

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-NS  439
             QL+  FY+++CPN+   +   ++ A  +++R+ ASL+RLHFHDCFV+GCD S+LLD  N+
Sbjct  26    QLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDSTNT  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEKFA PN NSARGFEVID++K+AVE AC  VVSCADIL IAA  SV LSGGP+W V 
Sbjct  86    IDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGGPSWAVP  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLN-LTDMVALSGAHTIGLAKCAV  796
             LGRRD   AN   A+ + LPGPFD+LD++ + F  VGLN   D+VALSGAHT G A+C  
Sbjct  146   LGRRDSRTANRALANQN-LPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGRAQCQF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F  RL +F  TG PDPTLDA+ + +L+  CP  G+G   A  D  + D+FDN YF NL  
Sbjct  205   FRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYFSNLRG  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   + A+V+ +  + N FF +FVTSM++MGN+ PLTG+ GEIR
Sbjct  265   RKGLLQSDQELFSTPGAD--TAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQGEIR  322

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  323   LNCRRVN  329



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 216/309 (70%), Gaps = 14/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLTTGFY+ SCP L++ V+  V +AI+ E RM ASLLRL FHDCFVNGCDGS+ LD  S
Sbjct  22    AQLTTGFYSKSCPKLYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTS  81

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A PN NSARGFEVID IKSAVE  C GVVSCADILA+ ARDSV++ GGP W V
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDV  141

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA++S+ P P  +L+++I+ F AVGL+  DMVALSGAHTIG A+C  
Sbjct  142   KLGRRDARTASQAAANSSI-PPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTS  200

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+ N          LD+SL    Q  CP N G G NN APLD  +   FDNHYF NL
Sbjct  201   FRARIYNETN------NLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINL  254

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+  +A     ++V++Y+++ + F  DFVT+M+KMG+I PLTGS GE
Sbjct  255   VSKKGLLHSDQQLFNGGSAD----SIVKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGE  310

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  311   IRKNCRRIN  319



>gb|AGF25268.1| peroxidase 1 [Pyrus communis]
Length=338

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 221/307 (72%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL + FY+ +CPN+  +VR   Q A++++ R+ ASL+RLHFHDCFVNGCD S+LLD N T
Sbjct  33    QLNSTFYSTTCPNVTSIVRSADQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKNGT  92

Query  443   --TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                SEK A PN NS RGF+V+D+IK+A+E++C GVVSCAD+LA+AA  SV LSGGP+W V
Sbjct  93    IQQSEKDAAPNTNSTRGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGGPSWNV  152

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P PF+SL  I +KF AVGLN  D+VALSGAHT G A+C  
Sbjct  153   LLGRRDSLTANQAGANTSI-PSPFESLANITSKFSAVGLNTNDLVALSGAHTFGRAQCRT  211

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF  TG+PDPTL++S +  LQ TCP NG G   A LD ++ D FDN+YF NL  
Sbjct  212   FSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDLSTPDAFDNNYFTNLQN  271

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   S  +V +++++ + FF  F  SM+ MGNISPL G+ GEIR
Sbjct  272   NQGLLQSDQELFSTAGAATVS--IVNSFSSNQSAFFESFAQSMINMGNISPLVGTSGEIR  329

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  330   LDCKNVN  336



>ref|XP_002980452.1| hypothetical protein SELMODRAFT_444510 [Selaginella moellendorffii]
 gb|EFJ18712.1| hypothetical protein SELMODRAFT_444510 [Selaginella moellendorffii]
Length=343

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 210/301 (70%), Gaps = 4/301 (1%)
 Frame = +2

Query  278   FYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST-TSEK  454
             FYA SCPNL  +VR  +  A++ E RMAASLLRLHFHDCFV GCDGSVLLD     T EK
Sbjct  45    FYAYSCPNLLSIVRGVLSRAVEREPRMAASLLRLHFHDCFVMGCDGSVLLDDQPGFTGEK  104

Query  455   FAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRD  634
              + PN NSARGFEV+D +K+AVESAC GVVSCAD+LAI A  SV L+ GP+W VLLGRRD
Sbjct  105   TSNPNRNSARGFEVVDDVKAAVESACPGVVSCADVLAIIAEQSVELTYGPSWTVLLGRRD  164

Query  635   GFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLS  814
                A+ + ++  + P P  +L Q+IA F   GL++ D+VALSG+HTIG A+C  F +RL 
Sbjct  165   STTASLSGSNNDI-PPPTSTLAQLIASFQRKGLSVQDLVALSGSHTIGNARCTSFRDRLY  223

Query  815   NFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQ  994
             NF  TG PDP+LD   + ELQ  CP +G  NN   LD ++   FD  YF NL   +GLL 
Sbjct  224   NFSNTGRPDPSLDQGYLRELQARCPPSGGDNNIFNLDLHTPTEFDTSYFTNLKFSKGLLN  283

Query  995   SDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTR  1174
             SDQ+LFS+  A  ++K LV TY    + FF DF  SMVKMGN++PLTG++GEIRKNCR  
Sbjct  284   SDQVLFSTPGA--STKNLVSTYDFAQDSFFNDFAVSMVKMGNLNPLTGTNGEIRKNCRVV  341

Query  1175  N  1177
             N
Sbjct  342   N  342



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 219/308 (71%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTTGFY+ SCP L++ V+  V +AI+ E RM ASLLRL FHDCFVNGCDGS+ LD  ST
Sbjct  23    QLTTGFYSKSCPKLYQTVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTST  82

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN NSARGFEVID+IKSAVE  C GVVSCADILA+ ARDSV++ GGP W V 
Sbjct  83    FTGEKRAQPNFNSARGFEVIDNIKSAVEKVCLGVVSCADILAVTARDSVVILGGPNWDVK  142

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA+ S+ P P  +L+++I+ F AVGL+  DMVALSGAHTIG A+C  F
Sbjct  143   LGRRDARTASQGAANNSI-PTPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N  +       +DASL    Q  CP ++G G NN APLD  +   FDNHYF NL+
Sbjct  202   RGRIYNETK------NMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFINLV  255

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+  +      ++V++Y+N+ + F +DFVT+M+KMG+I PLTGS+GEI
Sbjct  256   NKKGLLHSDQQLFNGGSVD----SIVKSYSNNPSSFISDFVTAMIKMGDIRPLTGSNGEI  311

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  312   RKNCRRIN  319



>ref|XP_002962639.1| hypothetical protein SELMODRAFT_230146 [Selaginella moellendorffii]
 gb|EFJ36102.1| hypothetical protein SELMODRAFT_230146 [Selaginella moellendorffii]
Length=341

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 210/301 (70%), Gaps = 4/301 (1%)
 Frame = +2

Query  278   FYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST-TSEK  454
             FYA SCPNL  +VR  +  A++ E RMAASLLRLHFHDCFV GCDGSVLLD     T EK
Sbjct  43    FYAYSCPNLLSIVRGVLSRAVEREPRMAASLLRLHFHDCFVMGCDGSVLLDDQPGFTGEK  102

Query  455   FAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLLGRRD  634
              + PN NSARGFEV+D +K+AVESAC GVVSCAD+LAI A  SV L+ GP+W VLLGRRD
Sbjct  103   TSNPNRNSARGFEVVDDVKAAVESACPGVVSCADVLAIIAEQSVELTYGPSWTVLLGRRD  162

Query  635   GFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFSNRLS  814
                A+ + ++  + P P  +L Q+IA F   GL++ D+VALSG+HTIG A+C  F +RL 
Sbjct  163   STTASLSGSNNDI-PPPTSTLAQLIASFQRKGLSVQDLVALSGSHTIGNARCTSFRDRLY  221

Query  815   NFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGRGLLQ  994
             NF  TG PDP+LD   + ELQ  CP +G  NN   LD ++   FD  YF NL   +GLL 
Sbjct  222   NFSNTGRPDPSLDQGYLRELQARCPPSGGDNNIFNLDLHTPTEFDTSYFTNLKFSKGLLN  281

Query  995   SDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRKNCRTR  1174
             SDQ+LFS+  A  ++K LV TY    + FF DF  SMVKMGN++PLTG++GEIRKNCR  
Sbjct  282   SDQVLFSTPGA--STKNLVSTYDFAQDNFFNDFAVSMVKMGNLNPLTGTNGEIRKNCRVV  339

Query  1175  N  1177
             N
Sbjct  340   N  340



>emb|CAD92857.1| peroxidase [Picea abies]
Length=340

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 215/307 (70%), Gaps = 8/307 (3%)
 Frame = +2

Query  266   LTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST-  442
             L+  FY  SCP    +++  V++A+K E R+AASLLRLHFHDCFV GCD S+LLD N++ 
Sbjct  39    LSHHFYYKSCPKAQAIIKSMVEDAVKKEARIAASLLRLHFHDCFVKGCDASLLLDDNASF  98

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             T EK A+PN NS RGFEV+D IKS +E AC GVVSCADILA+AARDSV +SGGP W+VLL
Sbjct  99    TGEKTAIPNKNSLRGFEVVDKIKSNLEKACPGVVSCADILAVAARDSVAISGGPFWKVLL  158

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRD   A+ + A+   LP P  +   +  KF   GLN+ D+VALSGAHTIGLA+CA F 
Sbjct  159   GRRDSRSASKSGANED-LPAPNSTHQTLETKFKLQGLNVVDLVALSGAHTIGLARCASFK  217

Query  803   NRLSNFQQTG-SPDPTLDASLIPELQTTCPSNG-DGNNTAPLDRNSTDLFDNHYFKNLLI  976
              RL N  QTG  PD TLD + + +L+T CP  G D N T P D  S   FD +Y+KN++ 
Sbjct  218   QRLYN--QTGNKPDQTLDTTYLKQLRTVCPQTGTDNNQTRPFDPVSPTKFDVNYYKNVVA  275

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             G+GLL SD+IL+S+  ++  +   V+ YT +++ FF  F  SM+KMGNISPLTG  GEIR
Sbjct  276   GKGLLNSDEILYSTKGSR--TAGFVKYYTTNTHAFFKQFAASMIKMGNISPLTGFHGEIR  333

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  334   KNCRRIN  340



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 212/308 (69%), Gaps = 15/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTT FY+ SCPNL   V   VQ+AI  E RM ASLLRL FHDCFVNGCDGS+LLD  S+
Sbjct  27    QLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLDDTSS  86

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A+PN  S RGFEVID IKSAVE AC GVVSCADIL I ARDSV++ GGPTW V 
Sbjct  87    FTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPTWNVK  146

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+ TAA+ ++ P P  SL Q+++ F   GL+ TDMVAL+G HTIG A+C  F
Sbjct  147   LGRRDARTASRTAANNNI-PQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSF  205

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP--SNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N       +  +DAS     Q  CP  SN   NN APLD  + + FDN Y+KNL+
Sbjct  206   RTRIYN-------ESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLV  258

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LFS      ++ +LVQTY ++ +RF ADF+ +M+KMG+I PLTGS+GE+
Sbjct  259   SQKGLLHSDQQLFSG----GSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEV  314

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  315   RKNCRKTN  322



>sp|P80679.1|PERA2_ARMRU RecName: Full=Peroxidase A2 [Armoracia rusticana]
Length=305

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 213/303 (70%), Gaps = 4/303 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GNS  439
             QL   FY+ +CPN   +VR  +Q A +++ R+ ASL+RLHFHDCFV+GCD S+LLD   S
Sbjct  1     QLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHDCFVDGCDASILLDDSGS  60

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF V+D+IK+A+E+ C GVVSC+DILA+A+  SV L+GGP+W VL
Sbjct  61    IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILALASEASVSLTGGPSWTVL  120

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S +P PF+ L  I +KF AVGLN  D+VALSGAHT G A+C VF
Sbjct  121   LGRRDSLTANLAGAN-SAIPSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  179

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             +NRL NF  T  PDPTL+++L+  LQ  CP NG  +    LD ++ D FDN+YF NL   
Sbjct  180   NNRLFNFSGTNGPDPTLNSTLLSSLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  239

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLLQSDQ LFS+  +   + A+V ++ ++   FF  F  SM+ MGNISPLTGS+GEIR 
Sbjct  240   NGLLQSDQELFSTLGS--ATIAVVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRL  297

Query  1160  NCR  1168
             +C+
Sbjct  298   DCK  300



>dbj|BAF33314.1| peroxidase [Populus alba]
Length=321

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 219/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  +CPN+  ++R  +  A++ + R+ ASL RLHFHDCFV+GCDGS+LLD   T
Sbjct  5     QLTPTFYDGTCPNVSTIIRGVLVQALQTDPRIGASLTRLHFHDCFVDGCDGSILLDNTDT  64

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF+V+D++K+AVE+AC G+VSCADILAIAA +SV L+GGP+W V 
Sbjct  65    IESEKEAAPNNNSARGFDVVDNMKAAVENACPGIVSCADILAIAAEESVRLAGGPSWTVP  124

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNL-TDMVALSGAHTIGLAKCAV  796
             LGRRD  +AN + A++S+ P PF+SL  + +KF AVGLN  +D+VALSGAHT G A+C  
Sbjct  125   LGRRDSLIANRSGANSSI-PAPFESLAVLKSKFAAVGLNTSSDLVALSGAHTFGRAQCLN  183

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F +RL NF  +G+PDPTL+ + +  LQ  CP  G+ +    LDR + D FD +YF NL  
Sbjct  184   FISRLYNFSGSGNPDPTLNTTYLAALQQLCPQAGNRSVLTNLDRTTADTFDGNYFSNLQT  243

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A   + A+V  ++ +   FF  FV SM++MGNISPLTG+DGEIR
Sbjct  244   NEGLLQSDQELFSTTGAD--TIAIVNNFSGNQTAFFESFVVSMIRMGNISPLTGTDGEIR  301

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  302   LNCRIVN  308



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 227/309 (73%), Gaps = 15/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY++SCP +F  VR  VQ+AI+NE R+ ASLLRLHFHDCFVNGCDGS+LLD  S
Sbjct  23    AQLSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             + T EK AVPN NSARGF+V+D+IKSAVE+ C GVVSCADILAIAARDSV + GGP+W V
Sbjct  83    SFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGPSWNV  142

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA+ ++ P P  +L+Q+I++F A+GL+  D+VALSG+HTIG ++C  
Sbjct  143   KLGRRDARTASQAAANNNI-PPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQ  201

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+ N       +  LD+S     ++ CP ++G G NN APLD  +   FDN+YFKNL
Sbjct  202   FRPRIYN-------ETNLDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNL  254

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+      ++ ++V+TY+N  N F +DFV++++KMG+I PLTGS+GE
Sbjct  255   IQKKGLLHSDQQLFNG----GSTDSIVRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGE  310

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  311   IRKNCRKPN  319



>ref|XP_002279920.1| PREDICTED: peroxidase A2 [Vitis vinifera]
 emb|CBI30006.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 214/310 (69%), Gaps = 8/310 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGN-S  439
             QL + FY+ +CPN + +VR  V  A+ ++ R+ ASL+RLHFHDCF NGCD S+LLD + S
Sbjct  27    QLNSSFYSCTCPNAYTIVRSIVHQAMASDTRIGASLVRLHFHDCFANGCDASILLDDSPS  86

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN  SARGFEV+D IK+A+E +C GVVSCADILA+A+  SV LSGGP+W VL
Sbjct  87    IQSEKHAAPNFKSARGFEVVDRIKAALECSCRGVVSCADILALASEASVSLSGGPSWTVL  146

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN   A+ S+ P P + L  I  KF AVGL +TD+VALSGAHT G A+C  F
Sbjct  147   LGRRDSTTANQAGANTSI-PSPSEGLANISNKFSAVGLEITDLVALSGAHTFGKAQCRTF  205

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN----NTAPLDRNSTDLFDNHYFKN  967
             S RL NF+ TG PDPTL+A+ +  LQ  CP +G+G     N  P + +    FDN+YF N
Sbjct  206   SERLYNFKGTGGPDPTLNATYLAVLQQICPEDGNGGFGLANLDPTNTSDGHDFDNNYFSN  265

Query  968   LLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDG  1147
             L   +GLLQSDQ LFS+  A+    A+V +++ D + FF  F  SMVKMGNISPLTG DG
Sbjct  266   LQSLQGLLQSDQELFSTPNAKII--AIVNSFSGDQSAFFQSFAQSMVKMGNISPLTGKDG  323

Query  1148  EIRKNCRTRN  1177
             EIR NCR  N
Sbjct  324   EIRLNCRKVN  333



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   332 bits (850),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 220/309 (71%), Gaps = 15/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY++SCP LF  V+  V +AI+ E RM ASLLRLHFHDCFVNGCDGS+LLD  S
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             + T EK AVPN NSARGF V+D IKSAVE+AC GVVSCADILAIAAR+SV + GGP+W V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENACPGVVSCADILAIAARESVTVLGGPSWDV  142

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA+ S+ P P  +L+Q+++ F A+GL+  D+VALSG+HTIG A+C  
Sbjct  143   KLGRRDTRTASQAAANNSI-PPPTRNLNQLVSTFNALGLSTRDLVALSGSHTIGQARCTT  201

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+ N       +  LD+SL    Q+ CP ++G G NN APLD  S   FDN YFKNL
Sbjct  202   FRPRIYN-------ETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFKNL  254

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+      ++ ++V+ Y+N  N F +DF  +M+KMG+I PLTGS+GE
Sbjct  255   IQNKGLLHSDQQLFNG----GSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGE  310

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  311   IRKNCRKPN  319



>ref|XP_006409192.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
 gb|ESQ50645.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
Length=336

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 210/307 (68%), Gaps = 5/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD-GN  436
             G L+ GFY++SCP   ++V+  V  A+  E RMAASL+RLHFHDCFV GCDGS+LLD   
Sbjct  33    GNLSPGFYSSSCPKAEEIVKSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTSG  92

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             S  +EK + PN  SARGFEV+D IK+A+E+ C G VSCAD+L +AARDS +L+GGP+W V
Sbjct  93    SIVTEKSSNPNSRSARGFEVVDQIKAALENECPGTVSCADVLTLAARDSSVLTGGPSWMV  152

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+ + ++ ++ P P ++ + I+++F   GL+LTD+VALSG+HTIG ++C  
Sbjct  153   PLGRRDSTTASLSGSNNNI-PAPNNTFNTILSRFTNQGLDLTDLVALSGSHTIGFSRCTS  211

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F  RL N    GSPD TL+ S    L+  CP +G   N + LD NS   FDN YFKNL+ 
Sbjct  212   FRQRLYNQSGNGSPDSTLEQSYAANLRQMCPRSGGDQNLSELDINSAGRFDNSYFKNLIE  271

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLL SDQ+LFSS+     S  LV+ Y  D   FF  F  SMVKMGNISPLTGS GEIR
Sbjct  272   NMGLLNSDQVLFSSN---EESSELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSSGEIR  328

Query  1157  KNCRTRN  1177
             KNCR  N
Sbjct  329   KNCRKVN  335



>ref|XP_010268504.1| PREDICTED: peroxidase 10 [Nelumbo nucifera]
Length=330

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 213/306 (70%), Gaps = 6/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +L    Y N CP+LF++V+  V  A++NE R+AASLLRLHFHDC VNGCDGSVLLD  + 
Sbjct  30    ELDYYIYNNKCPDLFRIVKYGVWAAVQNETRIAASLLRLHFHDCLVNGCDGSVLLDATAK  89

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              TSEK A+PN NSARGFEVI+ IK+ VE+AC  +VSCADILAIAARD+V+++GGP W V 
Sbjct  90    FTSEKNALPNRNSARGFEVIEKIKADVEAACPSIVSCADILAIAARDAVVVAGGPFWLVP  149

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  A+   A+   LP PF+SL+ I AKF + GL L D+V LSGAHTIG A+C  F
Sbjct  150   LGRRDGTTASEETANQQ-LPSPFESLNNITAKFTSKGLELKDVVVLSGAHTIGYAQCFTF  208

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
               RL +F  +G PD +LD++L+  LQ+TCP  G  +N APLD  S   FDN Y+ NL   
Sbjct  209   KRRLFDFNGSGKPDKSLDSTLLQNLQSTCPKGGSDSNLAPLDSASASKFDNGYYSNLAKS  268

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              GLL+SDQ L +      T+ ++V +YT     F+ DF  SMVKMGN+  LTG+ G+IRK
Sbjct  269   SGLLESDQALMNDP----TTASIVNSYTQYPYLFYKDFAESMVKMGNLGVLTGNKGQIRK  324

Query  1160  NCRTRN  1177
              C + N
Sbjct  325   KCGSVN  330



>pdb|4CUO|A Chain A, Banyan Peroxidase With Glycosylation
Length=306

 Score =   331 bits (849),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 218/306 (71%), Gaps = 4/306 (1%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY ++CPN+  +VR  +Q+A++ ++R+ ASL+RLHFHDCFVNGCDGS+LLD + T
Sbjct  1     QLTPTFYRSTCPNVTSIVRGVIQDALQTDLRIPASLIRLHFHDCFVNGCDGSLLLDNSDT  60

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF+V+D+IK+AVE+AC GVVSCADIL IAA  SV LSGGP+W V 
Sbjct  61    IESEKQAAPNNNSARGFDVVDNIKTAVENACPGVVSCADILTIAAEQSVWLSGGPSWPVP  120

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   AN T A+ + LP PF +LDQ+   F   GLN TD+VALSGAHT G A+C  F
Sbjct  121   LGRRDSLTANRTLANQT-LPSPFLTLDQLKTDFSDQGLNTTDLVALSGAHTFGRAQCQFF  179

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
             S RL NF  TGSPDPTL+ +L+  L+  CP  G+G+    LD+ + D FDN YF NL   
Sbjct  180   SQRLYNFSATGSPDPTLNTTLLETLRNICPQGGNGSTITNLDQTTPDAFDNKYFSNLQTQ  239

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
              G+LQ+DQ LFS+  A  T  A+V  ++ + + FF  FV SM+KMGNI  LT  +GEIR 
Sbjct  240   YGILQTDQELFSTKGANTT--AIVTKFSANQSAFFNSFVASMIKMGNIGVLTXDEGEIRS  297

Query  1160  NCRTRN  1177
             NCR+ N
Sbjct  298   NCRSVN  303



>gb|AHL39106.1| class III peroxidase [Populus trichocarpa]
Length=343

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 216/308 (70%), Gaps = 4/308 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQLT  FY  +CPN+  ++R  +   + ++ R+AASL+RLHFHDCFVNGCDGS+LLD   
Sbjct  24    GQLTPTFYDQTCPNVSSIIRNVITETLVSDPRIAASLIRLHFHDCFVNGCDGSLLLDNTD  83

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A  N NSARGFEV+D +K+ +ESAC   VSCADIL IAA +SV+L+GGP W V
Sbjct  84    TIESEKEAAGNNNSARGFEVVDRMKALLESACPATVSCADILTIAAEESVVLAGGPNWTV  143

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNL-TDMVALSGAHTIGLAKCA  793
              LGRRD   A+  AA+AS LP PF +LDQ+   F  VGLN  TD+VALSGAHT G AKC+
Sbjct  144   PLGRRDSTTASRAAANAS-LPAPFLTLDQLRESFTNVGLNNNTDLVALSGAHTFGRAKCS  202

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              F  RL +F +TG+PDP++D +L+  LQ  CP NG+G+    LD  + D FD+ Y+ NL 
Sbjct  203   TFDFRLFDFNRTGAPDPSMDTTLLAALQKLCPENGNGSVITDLDVTTADAFDSKYYSNLQ  262

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               RGLLQ+DQ LFS+  A +   ALV  ++ +   FF  FV SM++MGNISPLTG++GEI
Sbjct  263   CNRGLLQTDQELFSTPGADDV-IALVNAFSANQTAFFESFVESMIRMGNISPLTGTEGEI  321

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  322   RLNCRVVN  329



>ref|XP_003563125.1| PREDICTED: peroxidase N-like [Brachypodium distachyon]
Length=329

 Score =   332 bits (850),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 215/307 (70%), Gaps = 12/307 (4%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             +LT  FY  +CP L+ +V++ V  A+++EMRM ASLLRLHFHDCFVNGCD S+LL G   
Sbjct  32    ELTGDFYDYTCPGLYTIVQQHVFAAMRDEMRMGASLLRLHFHDCFVNGCDASILLVGE--  89

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             T E+FA PN NS RG+EVID++K+ +ES C GVVSCADI+A+AA   VL SGGP + VLL
Sbjct  90    TGEQFARPNQNSVRGYEVIDAMKADIESVCPGVVSCADIVALAAAYGVLFSGGPYYEVLL  149

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GR+DG +AN T A+   LP PF+ +  I+ KF  VGL+  D+V LSGAHTIG A+C +F+
Sbjct  150   GRKDGLVANKTGAENG-LPAPFEPVSSIVQKFGDVGLDTKDVVVLSGAHTIGRARCGLFN  208

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIGR  982
             NRL     T S DPTLD+ +   LQ+ C + GD N T  LD  S D+FD  Y++NLL  +
Sbjct  209   NRL-----TSSGDPTLDSKMAANLQSLCTTGGD-NQTTALDVESADVFDKQYYQNLLSKK  262

Query  983   GLLQSDQILFS--SDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
             GLL SDQ LFS   D  + T+KALVQTY++D  +FF DF  SMVKMG+I   TG  GEIR
Sbjct  263   GLLSSDQNLFSGAEDVVKATTKALVQTYSDDGEQFFMDFGASMVKMGSIKK-TGVPGEIR  321

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  322   TNCRVPN  328



>ref|XP_010058168.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
 gb|KCW90315.1| hypothetical protein EUGRSUZ_A02458 [Eucalyptus grandis]
Length=333

 Score =   332 bits (850),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 214/307 (70%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QLT  FYA +CP++  +V+  +Q A++++ R+ ASLLRLHFHDCFV+GCDGS+LLD + 
Sbjct  28    AQLTANFYAKTCPSVSSIVQTVIQEALQSDPRITASLLRLHFHDCFVDGCDGSLLLDNSP  87

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A PN  SARGF+V+D IK+A+ESAC G VSCADILA+AA+ SV LS GP W V
Sbjct  88    TIKSEKDAAPNFKSARGFDVVDKIKAAIESACPGTVSCADILALAAQASVSLSEGPYWTV  147

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN   A+ S+ P P DS + +++KF AVGL++TD+  LSGAHT G A+C  
Sbjct  148   LLGRRDSLTANQAGANTSI-PSPSDSYNNLVSKFSAVGLDITDLATLSGAHTFGRAQCKS  206

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F+ RL NF   G PDPT++   +  L+  CP NGD +  A LD  + +LFDNHY+ NL  
Sbjct  207   FNPRLYNFTANGGPDPTINPWYLTNLRKLCPQNGDSSVLADLDPTTPNLFDNHYYSNLQK  266

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLL SDQ L+S+  A   S  +V +++ D + FF  F  S+V MGNISPLTGS+GEIR
Sbjct  267   NEGLLLSDQELYSTTGAATIS--IVNSFSFDQSAFFESFARSIVNMGNISPLTGSNGEIR  324

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  325   FNCRKVN  331



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   331 bits (848),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 222/309 (72%), Gaps = 15/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY++SCP LF  V+  VQ+AI+ E RM ASLLRLHFHDCFVNGCDGS+LLD  S
Sbjct  23    AQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             + T EK A PN NSARGF+V+D+IKSAVE+ C GVVSCADILAIAARDSV+  GGP+W V
Sbjct  83    SFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPSWNV  142

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA+ ++ P P  +L+Q+I+ F AVGL+  D+VALSG+HTIG A+C  
Sbjct  143   KLGRRDARTASQAAANNNI-PPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTS  201

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+ N       +  LD+SL    ++ CP ++G G NN APLD  +   FDN+YFKNL
Sbjct  202   FRPRIYN-------ETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNL  254

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+      ++ ++V+ Y+N  N F +DF ++M+KMG+I PLTGS GE
Sbjct  255   IQNKGLLHSDQQLFNG----GSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGE  310

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  311   IRKNCRKTN  319



>ref|XP_008227949.1| PREDICTED: peroxidase A2-like isoform X2 [Prunus mume]
Length=405

 Score =   334 bits (856),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 219/307 (71%), Gaps = 4/307 (1%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY   CPN   +VR  +  A++ ++R+AASL RL FHDCFVNGCDGSVLLD +S
Sbjct  88    AQLSPTFYEEDCPNATSIVRAVIGEALQTDLRIAASLTRLFFHDCFVNGCDGSVLLDNSS  147

Query  440   TT-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A PN NSARGF+V+D+IK+A+E+AC G+VSCADILAI+A  SV LSGGP+W V
Sbjct  148   TIDSEKGAFPNNNSARGFDVVDNIKTALETACPGIVSCADILAISAEASVSLSGGPSWTV  207

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN TAA+ + LP P  +LD++ A F AVGL+ TD+VALSGAHT G A+C  
Sbjct  208   LLGRRDSTTANRTAANEA-LPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRAQCQF  266

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FS+RL +F  TGSPDPTL+++ +  L   CP +G+G+  A LD ++ D FD  YF NL +
Sbjct  267   FSDRLYDFNSTGSPDPTLNSTYLETLSALCPESGNGSVLADLDPSTPDGFDADYFSNLQV  326

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A      +V +++ + + FF  FV SM KMGNIS LTG+DGEIR
Sbjct  327   HYGLLQSDQELFSTSGADTVD--IVNSFSANQSAFFESFVISMNKMGNISLLTGTDGEIR  384

Query  1157  KNCRTRN  1177
              NC   N
Sbjct  385   LNCSKVN  391



>ref|XP_006849541.1| hypothetical protein AMTR_s00024p00166170 [Amborella trichopoda]
 gb|ERN11122.1| hypothetical protein AMTR_s00024p00166170 [Amborella trichopoda]
Length=328

 Score =   331 bits (849),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 218/306 (71%), Gaps = 5/306 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+  FY  +CPN+  +VR  VQ A +++ R+ ASL+RLHFHDCFV+GCDGS+LLD +S+
Sbjct  25    QLSATFYDTTCPNVISIVRNVVQQAAQSDARIGASLIRLHFHDCFVDGCDGSLLLDNSSS  84

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK AVPN  S RGF V+D+IK+ +ES C G+VSCADILAIA+  SV+L+GGP+W VL
Sbjct  85    IVSEKDAVPNSGSVRGFPVVDNIKADLESQCPGIVSCADILAIASEVSVVLAGGPSWSVL  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRDG  AN  AA+ + LP PF+ +  I  KF  VGL+ TD+VALSGAHT G A+C  F
Sbjct  145   LGRRDGTTANKDAANNN-LPSPFEGISNISTKFSNVGLDTTDVVALSGAHTFGRAQCQFF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              +RL NF  +G+ DPT+++S +  LQ +CP +G     + LD  + D FDN YF NL   
Sbjct  204   RDRLYNFSGSGAADPTMNSSYVTTLQGSCPQSGGDTTLSDLDPTTPDGFDNAYFTNLESN  263

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             RGLLQSDQ LFS+  A   + ++VQ Y ++ + FF  FV SM+KMGNISPLTG++G+IR 
Sbjct  264   RGLLQSDQELFSTSGA---TVSIVQNYASNQSAFFESFVKSMIKMGNISPLTGTNGQIRT  320

Query  1160  NCRTRN  1177
             NC   N
Sbjct  321   NCSRVN  326



>ref|XP_011025201.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=368

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 221/308 (72%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-N  436
              QLT  FY  +CPN+  ++R  +  A++ + R+ ASL RLHFHDCFV+GCDGS+LLD  +
Sbjct  51    AQLTPTFYDGTCPNVSTIIRGVLVQAMQTDPRIGASLTRLHFHDCFVDGCDGSILLDNTD  110

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             S  SEK A PN NSARGF+V+D++K+AVE+AC+G+VSCADILAIAA +SV L+GGP+W V
Sbjct  111   SIESEKEAAPNNNSARGFDVVDNMKAAVENACTGIVSCADILAIAAEESVRLAGGPSWTV  170

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNL-TDMVALSGAHTIGLAKCA  793
             LLGRRD   AN + A++S+ P P +SL  + +KF AVGLN  +D+VALSGAHT G A+C 
Sbjct  171   LLGRRDSLTANRSGANSSI-PAPSESLAVLKSKFAAVGLNTSSDLVALSGAHTFGRAQCL  229

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              F +RL NF  +G+PDPTL+ + +  LQ  CP  G+ +  A LDR + D FD +YF NL 
Sbjct  230   NFISRLYNFSGSGNPDPTLNTTYLAALQQLCPQGGNQSVLANLDRTTPDTFDGNYFSNLQ  289

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQSDQ LFS+  A   S  +V  ++++   FF  FV SM++MGNISPLTG+DGEI
Sbjct  290   TNEGLLQSDQELFSTTGADTIS--IVNNFSSNQTAFFESFVVSMIRMGNISPLTGTDGEI  347

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  348   RLNCRIVN  355



>ref|XP_010683551.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/326 (53%), Positives = 225/326 (69%), Gaps = 12/326 (4%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+  FY++SCPN    ++  VQ+A+ NE RM ASLLRLHFHDCFVNGCDGS+LLD  +
Sbjct  26    AQLSPNFYSSSCPNALSTIQSAVQSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDTA  85

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
               T EK A+PNLNS RGFEVID+IKS VE+ C+GVVSCADILA+AARDSV+  GGP+W V
Sbjct  86    NFTGEKTAIPNLNSVRGFEVIDTIKSQVENVCAGVVSCADILAVAARDSVVALGGPSWTV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRD   AN +AA+A +LP P  ++ Q+I  F  +G    D+VALSGAHTIG A+C  
Sbjct  146   LLGRRDSTTANISAANA-ILPAPTLNITQLITLFSGLGFTNQDLVALSGAHTIGQARCTT  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F +R+ N       +  ++++    LQ  CPS+G  NNT+PLD+  T  FDN YF +LL 
Sbjct  205   FRSRIYN-------ETNINSTFATSLQANCPSSGGDNNTSPLDKTPTT-FDNTYFNDLLT  256

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +G+L SDQ LF+ +    T+ + V +Y ++S  FFADF ++M+KMGN+S LTG+ GEIR
Sbjct  257   LQGVLHSDQELFTGN--NGTTDSQVSSYGSNSTTFFADFASAMLKMGNMSVLTGTSGEIR  314

Query  1157  KNCRTRN*IINPLTHSLYIFTSVSYL  1234
              NCR  N   + L  +  IF  V+ L
Sbjct  315   TNCRRPNTASSNLAENYNIFDIVTSL  340



>ref|XP_009761466.1| PREDICTED: peroxidase 10-like [Nicotiana sylvestris]
Length=327

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 216/308 (70%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-N  436
             GQL   FY  SCP+L ++VR  V +A +N+ R+AA+LLRLHFHDCFVNGCDGSVLLD  N
Sbjct  25    GQLDYSFYERSCPSLPRIVRWGVWSAYRNDSRIAAALLRLHFHDCFVNGCDGSVLLDDTN  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                 EK A+PN NSARG+E+IDSIK+ +E AC   VSC DIL +AAR+ V++SGGP W V
Sbjct  85    DFKGEKNALPNRNSARGYEIIDSIKADLERACPSTVSCVDILTLAAREVVVMSGGPYWPV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  A+  AA+   LP PF+ LD+I AKF A GL+L D+V LSGAHTIG A+C  
Sbjct  145   LLGRRDGLTASDKAANEQ-LPSPFEPLDKIAAKFTAKGLDLKDIVVLSGAHTIGYAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNT-APLDRNSTDLFDNHYFKNLL  973
             F  RL NFQ +G PDP LD+S++  LQ+TCP+  + N+  APLD  S   FDN Y++NL+
Sbjct  204   FKRRLFNFQNSGKPDPNLDSSMLSNLQSTCPNRDESNSKIAPLDFQSVSRFDNSYYRNLV  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLL+SDQ L S+    +    +V++Y++    F+ DF  SM+K+GN+  LTG  G+I
Sbjct  264   NNSGLLESDQALMSNSQTAD----MVKSYSSYPYLFYQDFAASMLKLGNVGVLTGQSGQI  319

Query  1154  RKNCRTRN  1177
             RK C + N
Sbjct  320   RKICGSVN  327



>ref|XP_007047175.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91332.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=327

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 213/308 (69%), Gaps = 9/308 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLD--GN  436
             QL   +Y ++CPNL ++VR  V +AI N+ RMAASL+RLHFHDCFVNGCDGS+LLD  G+
Sbjct  26    QLDYKYYDSTCPNLARIVRYGVWSAITNDTRMAASLVRLHFHDCFVNGCDGSILLDDIGS  85

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             +   EK A+ N NSARG+EVID+IK+ VE AC   VSC+DIL +AARD+V  +GG  W V
Sbjct  86    TFVGEKNALANQNSARGYEVIDNIKANVEKACPSTVSCSDILTLAARDAVYFAGGSYWMV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRDG  AN TAA+   LP PF+SLD IIAKF + GL++ D+V LSGAHTIG A+C  
Sbjct  146   PLGRRDGRTANKTAANE--LPSPFESLDSIIAKFNSKGLDIKDVVVLSGAHTIGFAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F +RL NF  +G PDP LDAS +  LQ+ CP   D + N  PLD  ++  FDN Y+KN++
Sbjct  204   FKSRLFNFGGSGKPDPELDASFLKGLQSVCPDQVDSDTNLVPLDSVTSTKFDNSYYKNIV  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLLQSDQ+L       N + ++V  Y+     F  DF  SMVKMGNI  LTG DGEI
Sbjct  264   NSSGLLQSDQLL----GTDNRTASMVLNYSKYPYLFLKDFGASMVKMGNIGVLTGQDGEI  319

Query  1154  RKNCRTRN  1177
             RKNC+  N
Sbjct  320   RKNCKVVN  327



>ref|XP_009381003.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=351

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 218/307 (71%), Gaps = 6/307 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL++ FY +SCPN+  +V  +VQ A K++ R+ ASL RL FHDCFVNGCDGS+LLD +S
Sbjct  30    AQLSSTFYDSSCPNVSSIVLDQVQQAQKSDTRILASLTRLFFHDCFVNGCDGSILLDNSS  89

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  +EK AVPN NSARGF+V+D+IK+AVE++CSG+VSCADILA+AA  SV LSGGP W V
Sbjct  90    TIVTEKDAVPNNNSARGFDVVDNIKAAVENSCSGIVSCADILALAAEVSVNLSGGPKWSV  149

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  AN TAA+   LPGP D+L  +  KF  VGLN TD+VALSG HT G A+C  
Sbjct  150   LLGRRDGTTANITAANN--LPGPRDNLTTLQQKFNDVGLNDTDLVALSGGHTFGRAQCRS  207

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             FSNRL NF    + DP+L+++ +  LQ  CP  G+G+    LD  + D FDN Y+ NL  
Sbjct  208   FSNRLYNFSDNSTADPSLNSTYLTTLQNNCPQGGNGSTLNNLDLTTPDTFDNKYYTNLQT  267

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ L+ + A   ++ ++V  +  +   FF +F+ +M+ MGNISPLTGS+GEIR
Sbjct  268   KEGLLQSDQELYGTGA---STASIVDQFAANQTVFFENFIAAMINMGNISPLTGSNGEIR  324

Query  1157  KNCRTRN  1177
              +C+  N
Sbjct  325   SDCKKVN  331



>ref|XP_006492676.1| PREDICTED: peroxidase C3-like isoform X3 [Citrus sinensis]
Length=349

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-NS  439
             QL+  FY+++CPN+  ++   ++ A  +++R+ ASL+RLHFHDCFV+GCD S+LLD  N+
Sbjct  26    QLSPSFYSSTCPNVLNIIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDSTNT  85

Query  440   TTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEKFA PN NSARGFEVID++K+AVE AC  VVSCADIL IAA  SV LSGGP+W V 
Sbjct  86    IDSEKFAAPNNNSARGFEVIDNMKAAVEKACRRVVSCADILTIAAERSVALSGGPSWAVP  145

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCAV  796
             LGRRD   AN   A+ + LPGP +SLD++ + F  VGLN   D+VALSGAHT G A+C  
Sbjct  146   LGRRDSRTANRALANQN-LPGPSNSLDELKSSFRNVGLNDKFDLVALSGAHTFGRAQCQF  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F  RL +F  TG PDPTLDA+ + +L+  CP  G+G   A  D  + D+FDN YF NL  
Sbjct  205   FRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYFSNLRG  264

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
              +GLLQSDQ LFS+  A   + A+V+ +  + N FF +FVTSM++MGN+ PLTG+ GEIR
Sbjct  265   RKGLLQSDQELFSTPGAD--TAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQGEIR  322

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  323   LNCRRVN  329



>ref|XP_002285652.2| PREDICTED: peroxidase A2 [Vitis vinifera]
Length=343

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 217/308 (70%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL+  +Y ++CPN   +VR  +Q A  +++R+ ASL+RLHFHDCFVNGCDGS+LLD   
Sbjct  25    GQLSPTYYDDTCPNASSIVRGVIQEAFISDVRIGASLIRLHFHDCFVNGCDGSLLLDNTE  84

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T  SEK A+PN NS RGFEV+DSIK+A+ES+C G+VSCADILAIAA  SV +SGGP+W V
Sbjct  85    TIVSEKDAIPNANSTRGFEVVDSIKTALESSCQGIVSCADILAIAAEASVNMSGGPSWTV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLN-LTDMVALSGAHTIGLAKCA  793
             LLGRRD  +AN + A+ + LP P  ++  + A F AVGLN  TD+VALSGAHT G A C 
Sbjct  145   LLGRRDSRIANQSGAN-TALPNPRQNITTLKAVFEAVGLNTTTDLVALSGAHTFGRAACR  203

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+R+ NF  T SPDP+L++S +  L   CP +GDG   A LD  + D FD +YF NL 
Sbjct  204   FFSDRIYNFSGTESPDPSLNSSYLETLSALCPQDGDGTVLADLDPTTPDGFDKNYFSNLQ  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               RGLLQSDQ LFS+  +      +V  + ++   FF  FV SM++MGNISPLTG++GEI
Sbjct  264   ENRGLLQSDQELFSTTGSDTID--IVNLFASNETAFFESFVESMIRMGNISPLTGTEGEI  321

Query  1154  RKNCRTRN  1177
             R +CR  N
Sbjct  322   RLDCRKVN  329



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 214/308 (69%), Gaps = 13/308 (4%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCP +F  V+  VQ+A+  E RM ASLLRLHFHDCFVNGCDGS+LLD  S+
Sbjct  28    QLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSS  87

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN NS RGFEV+D+IKS VE  C GVVSCADILAIAARDSV + GGP+W V 
Sbjct  88    FTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGPSWNVK  147

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA++ V+P P  +L Q+  +F AVGLN  D+VALSGAHTIG A+C  F
Sbjct  148   LGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQARCTSF  207

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N       +  +DAS     Q+ CPS  G G NN APLD  + + FD  YFKNL+
Sbjct  208   RARIYN-------ETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKNLI  260

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQIL+++  + ++   LV+TY+  +N F +DF  +M+KMG+  PLTGS+GEI
Sbjct  261   NQKGLLHSDQILYNNGGSTDS---LVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEI  317

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  318   RLNCRRPN  325



>emb|CAA66037.1| peroxidase [Populus trichocarpa]
Length=345

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 220/307 (72%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  +CPN+  ++R  +  A++ + R+ ASL+RLHFHDCFV+GCDGS+LLD   T
Sbjct  29    QLTPTFYDGTCPNVSTIIRGVLAQALQTDPRIGASLIRLHFHDCFVDGCDGSILLDNTDT  88

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF+V+D++K+AVE+AC G+VSCADILAIAA +SV L+GGP+W V 
Sbjct  89    IESEKEAAPNNNSARGFDVVDNMKAAVENACPGIVSCADILAIAAEESVRLAGGPSWTVP  148

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNL-TDMVALSGAHTIGLAKCAV  796
             LGRRD  +AN + A++S+ P P +SL  + +KF AVGLN  +D+VALSGAHT G A+C  
Sbjct  149   LGRRDSLIANRSGANSSI-PAPSESLAVLKSKFAAVGLNTSSDLVALSGAHTFGRAQCLN  207

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F +RL NF  +G+PDPTL+ + +  LQ  CP  G+ +    LDR + D FD +YF NL  
Sbjct  208   FISRLYNFSGSGNPDPTLNTTYLAALQQLCPQGGNRSVLTNLDRTTPDTFDGNYFSNLQT  267

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A   + A+V  ++++   FF  FV SM++MGNISPLTG+DGEIR
Sbjct  268   NEGLLQSDQELFSTTGAD--TIAIVNNFSSNQTAFFESFVVSMIRMGNISPLTGTDGEIR  325

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  326   LNCRIVN  332



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 224/309 (72%), Gaps = 15/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL+TGFY++SCPNL   V+  V++A+ +E RM AS+LRL FHDCFVNGCDGS+LLD  S
Sbjct  26    GQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             + T EK A PN NSARGF+VID+IK+AVE AC GVVSCADILAIAARDSV+L GGP+W V
Sbjct  86    SFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNV  145

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+ + A+  + PGP  SL Q+ ++F A+GL+ TD+VALSG HTIG A+C  
Sbjct  146   KLGRRDSTTASQSQANNDI-PGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTT  204

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F +R+       S    +++S     Q+ CP ++G G NN APLD   T  FDN+Y+KNL
Sbjct  205   FRSRIY------SNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDFTPTS-FDNNYYKNL  257

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLLQSDQ+LF+      ++ ++VQ Y N   RF +DF  +MVKMG+I+PLTGS+G+
Sbjct  258   VQNKGLLQSDQVLFNG----GSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQ  313

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  314   IRKNCRMVN  322



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 213/308 (69%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ +CP L   V+  VQ+A+  E RM ASLLRLHFHDCFVNGCDGS+LLD  S+
Sbjct  27    QLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDTSS  86

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK + PN+NSARGFEV+D IKS VE  C GVVSCADILAIAAR SV + GGP+W V 
Sbjct  87    FTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSWNVK  146

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA++ V+P P  +L  +I +F A GL+  DMVALSGAHTIG A+C  F
Sbjct  147   LGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCVAF  206

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNLL  973
              NR+ N       +  +++S     +  CP + G G NN APLD  S + FDN Y+K+LL
Sbjct  207   RNRIYN-------ESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLL  259

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQILF+      ++ +LV TY ++S  F +DF  +M+KMG+ISPLTGS GEI
Sbjct  260   NQKGLLHSDQILFNG----GSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEI  315

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  316   RKNCRRPN  323



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   329 bits (843),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 219/309 (71%), Gaps = 15/309 (5%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
              QL+T FY++SCP LF  V+  V++AI+ E RM ASLLRLHFHDCFVNGCDGS+LLD  S
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             + T EK AVPN NSARGF V+D IK AVE+ C GVVSCADILAIAARDSV + GGP+W V
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKFAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+  AA+ S+ P P  +L+Q+I+ F A+GL+  D+VALSG+HTIG A+C  
Sbjct  143   KLGRRDTRTASQAAANNSI-PPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTT  201

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNL  970
             F  R+ N       +  LD+SL    Q+ CP ++G G NN APLD  S   FDN YFKNL
Sbjct  202   FRPRVYN-------ETNLDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNL  254

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+    + ++ ++V+ Y+N  N F +DF  +M+KMG+I PLTGS GE
Sbjct  255   IQKKGLLHSDQQLFN----RGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSKGE  310

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  311   IRKNCRKPN  319



>ref|XP_006386069.1| hypothetical protein POPTR_0003s21640g [Populus trichocarpa]
 gb|ABK94318.1| unknown [Populus trichocarpa]
 gb|ACN97185.1| peroxidase [Populus trichocarpa]
 gb|ERP63866.1| hypothetical protein POPTR_0003s21640g [Populus trichocarpa]
 gb|AHL39127.1| class III peroxidase [Populus trichocarpa]
Length=354

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 220/307 (72%), Gaps = 5/307 (2%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLT  FY  +CPN+  ++R  +  A++ + R+ ASL+RLHFHDCFV+GCDGS+LLD   T
Sbjct  38    QLTPTFYDGTCPNVSTIIRGVLAQALQTDPRIGASLIRLHFHDCFVDGCDGSILLDNTDT  97

Query  443   T-SEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
               SEK A PN NSARGF+V+D++K+AVE+AC G+VSCADILAIAA +SV L+GGP+W V 
Sbjct  98    IESEKEAAPNNNSARGFDVVDNMKAAVENACPGIVSCADILAIAAEESVRLAGGPSWTVP  157

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNL-TDMVALSGAHTIGLAKCAV  796
             LGRRD  +AN + A++S+ P P +SL  + +KF AVGLN  +D+VALSGAHT G A+C  
Sbjct  158   LGRRDSLIANRSGANSSI-PAPSESLAVLKSKFAAVGLNTSSDLVALSGAHTFGRAQCLN  216

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLLI  976
             F +RL NF  +G+PDPTL+ + +  LQ  CP  G+ +    LDR + D FD +YF NL  
Sbjct  217   FISRLYNFSGSGNPDPTLNTTYLAALQQLCPQGGNRSVLTNLDRTTPDTFDGNYFSNLQT  276

Query  977   GRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIR  1156
               GLLQSDQ LFS+  A   + A+V  ++++   FF  FV SM++MGNISPLTG+DGEIR
Sbjct  277   NEGLLQSDQELFSTTGAD--TIAIVNNFSSNQTAFFESFVVSMIRMGNISPLTGTDGEIR  334

Query  1157  KNCRTRN  1177
              NCR  N
Sbjct  335   LNCRIVN  341



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 218/309 (71%), Gaps = 17/309 (6%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ +CPNLF  V+  +Q+AI +E RM AS+LRL FHDCFVNGCDGS+LLD  S+
Sbjct  25    QLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDTSS  84

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN NSARGF+VID IK+AVE AC GVVSCADILAI+ARDSV+L GGP W V 
Sbjct  85    FTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPNWNVK  144

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+ + A+ ++ P P  SL  +I+KF A GL+  +MVALSGAHTIG A+C  F
Sbjct  145   LGRRDARTASLSGANNNI-PPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARCTSF  203

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPS---NGDGNNTAPLDRNSTDLFDNHYFKNL  970
               R+ N       D  +D S     ++ CPS   NGD NN APLD  +   FDN YFKNL
Sbjct  204   RARIYN-------DTNIDGSFAKTRRSNCPSTSGNGD-NNLAPLDLQTPTSFDNDYFKNL  255

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +  +GLL SDQ LF+    + ++ +LV TY+ + ++F +DFV +M+KMG+ISPLTGS GE
Sbjct  256   VNQKGLLHSDQQLFN----KGSTDSLVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGE  311

Query  1151  IRKNCRTRN  1177
             IRKNCR  N
Sbjct  312   IRKNCRKIN  320



>ref|XP_009625722.1| PREDICTED: peroxidase 10-like [Nicotiana tomentosiformis]
Length=327

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 216/309 (70%), Gaps = 9/309 (3%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-N  436
             GQL   FY  SCP+  ++VR  V +A +N+ R+AA+LLRLHFHDCFVNGCDGSVLLD  N
Sbjct  25    GQLDYSFYERSCPSFPRIVRWGVWSAYRNDSRIAAALLRLHFHDCFVNGCDGSVLLDDTN  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
                 EK A+PN NSARG+E+IDSIK+ +E AC   VSC DIL + AR+ V++SGGP W V
Sbjct  85    DFKGEKNALPNRNSARGYEIIDSIKADLERACPSTVSCVDILTLVAREVVVMSGGPYWPV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
             LLGRRDG  A+  AA+   LP PF+ LD+I AKF A GL+L D+V LSGAHTIG A+C  
Sbjct  145   LLGRRDGLTASDKAANEQ-LPSPFEPLDKIAAKFTAKGLDLKDVVVLSGAHTIGYAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNT--APLDRNSTDLFDNHYFKNL  970
             F  RL NFQ +G PDP LD+S++  LQ+TCP N DG+N+  APLD  S   FDN Y++NL
Sbjct  204   FKRRLFNFQNSGKPDPNLDSSMLSNLQSTCP-NTDGSNSKIAPLDFQSVTRFDNSYYRNL  262

Query  971   LIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGE  1150
             +   GLL+SDQ L S+    +    +V++Y++   RF+ DF  SM+K+GN+  LT   G+
Sbjct  263   VNNSGLLESDQALMSNSQTAD----MVKSYSSYPYRFYQDFAASMMKLGNVGILTEQSGQ  318

Query  1151  IRKNCRTRN  1177
             IRK C + N
Sbjct  319   IRKICGSVN  327



>ref|XP_006492675.1| PREDICTED: peroxidase C3-like isoform X2 [Citrus sinensis]
 gb|KDO62913.1| hypothetical protein CISIN_1g018796mg [Citrus sinensis]
Length=349

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/308 (54%), Positives = 218/308 (71%), Gaps = 5/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG-N  436
              QL+  FY+++CPN+  ++   ++ A  +++R+ ASL+RLHFHDCFV+GCD S+LLD  N
Sbjct  25    AQLSPSFYSSTCPNVLNIIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDSTN  84

Query  437   STTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             +  SEKFA PN NSARGFEVID++K+AVE AC  VVSCADIL IAA  SV LSGGP+W V
Sbjct  85    TIDSEKFAAPNNNSARGFEVIDNMKAAVEKACRRVVSCADILTIAAERSVALSGGPSWAV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLT-DMVALSGAHTIGLAKCA  793
              LGRRD   AN   A+ + LPGP +SLD++ + F  VGLN   D+VALSGAHT G A+C 
Sbjct  145   PLGRRDSRTANRALANQN-LPGPSNSLDELKSSFRNVGLNDKFDLVALSGAHTFGRAQCK  203

Query  794   VFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKNLL  973
              FS+RL +F +TG PDPT+D +L+ +L+  CP  G+G   A  D  + D FDN YF NL 
Sbjct  204   FFSDRLYDFNKTGKPDPTVDRTLLKQLRELCPQGGNGAVLANFDVKTPDAFDNKYFSNLR  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
             + +GLLQSDQ LFS+  A   + A+V+ +  +   FF +FV SM++MGN+ PLTG+ GEI
Sbjct  264   LRKGLLQSDQELFSTPGAD--TAAIVEDFGRNQTAFFKNFVISMIRMGNLKPLTGNQGEI  321

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  322   RLNCRRVN  329



>ref|XP_006338218.1| PREDICTED: peroxidase 10-like [Solanum tuberosum]
Length=327

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 215/308 (70%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL   +Y  +CPNL K+VR  V +AI N+ RM ASLLRLHFHDCFVNGCDGS+LLD  S
Sbjct  25    GQLDYKYYDTTCPNLTKIVRNGVWSAISNDTRMPASLLRLHFHDCFVNGCDGSILLDDTS  84

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A PN NSARG+EVID+IK+ VE AC   VSC DIL +AAR+++ L+ GP W V
Sbjct  85    TFTGEKNAFPNRNSARGYEVIDAIKANVEKACPSTVSCTDILTLAAREAIYLTRGPFWSV  144

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+ +AA+   LP PF+ L  I AKFV+ GL++ D+V LSGAHTIG A+C  
Sbjct  145   CLGRRDSLTASQSAANDQ-LPSPFEPLVNITAKFVSKGLDVKDVVVLSGAHTIGFAQCFT  203

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F  RL +F  +G+PDPTLD+SL+  L++ CP+  D + N APLD  + + FDN YFKNL+
Sbjct  204   FKRRLFDFDGSGNPDPTLDSSLLGSLRSVCPNQSDSDSNLAPLDAVTINRFDNVYFKNLM  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLL+SDQ L +     NT+ ALV  Y+ + + F  +F  SMVK+ NI  LTG +GEI
Sbjct  264   NNSGLLESDQALMN----DNTTAALVSNYSRNPSLFSKEFAASMVKLINIGVLTGQNGEI  319

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  320   RKNCRVVN  327



>gb|ABG49115.1| peroxidase [Citrus maxima]
Length=350

 Score =   330 bits (845),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 218/310 (70%), Gaps = 8/310 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG---  433
             QLT  FY  +CPN   ++   +QNA  +++R+ ASL+RLHFHDCFVNGCDGS+LLD    
Sbjct  26    QLTPDFYNTTCPNASNIILGVLQNAFNSDIRITASLIRLHFHDCFVNGCDGSILLDNVAN  85

Query  434   -NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
               S  SEKF++ N NSARGFEV+D++K+A+ESAC G+VSCADILAIA+  SV LSGGP+W
Sbjct  86    DTSIDSEKFSMANNNSARGFEVVDAMKTALESACPGIVSCADILAIASEQSVNLSGGPSW  145

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLN-LTDMVALSGAHTIGLAK  787
              V LGRRDG  AN + AD + LP PF +LD +  +F  VGLN  TD+VALSGAHT G A+
Sbjct  146   TVPLGRRDGRTANRSLADQN-LPTPFQTLDLLKGRFRNVGLNDNTDLVALSGAHTFGRAQ  204

Query  788   CAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKN  967
             C  FS RL NF  TG+PDPTL+A+L+ +LQ  CP  G+G+    LD ++ D FDN YF N
Sbjct  205   CQFFSQRLFNFNGTGNPDPTLNATLLAQLQQLCPQGGNGSVLTNLDLSTPDGFDNDYFSN  264

Query  968   LLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDG  1147
             L    GLLQSDQ LFS+  A   +  +V  ++++   FF  F  SM++MGN+S LTG+ G
Sbjct  265   LQANNGLLQSDQELFSTSGAD--TIPIVNNFSSNETAFFESFAVSMIRMGNLSLLTGTQG  322

Query  1148  EIRKNCRTRN  1177
             EIR NCR  N
Sbjct  323   EIRSNCRRVN  332



>ref|XP_006492678.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO62918.1| hypothetical protein CISIN_1g018811mg [Citrus sinensis]
Length=350

 Score =   329 bits (844),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 218/310 (70%), Gaps = 8/310 (3%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDG---  433
             QLT  FY  +CPN   ++   +QNA  +++R+ ASL+RLHFHDCFVNGCDGS+LLD    
Sbjct  26    QLTPDFYNTTCPNASNIILGVLQNAFNSDIRITASLIRLHFHDCFVNGCDGSILLDNVAN  85

Query  434   -NSTTSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTW  610
               S  SEKF++ N NSARGFEV+D++K+A+ESAC G+VSCADILAIA+  SV LSGGP+W
Sbjct  86    DTSIDSEKFSMANNNSARGFEVVDAMKAALESACPGIVSCADILAIASEQSVNLSGGPSW  145

Query  611   RVLLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLN-LTDMVALSGAHTIGLAK  787
              V LGRRDG  AN + AD + LP PF +LD +  +F  VGLN  TD+VALSGAHT G A+
Sbjct  146   TVPLGRRDGRTANRSLADQN-LPTPFQTLDLLKGRFTNVGLNDNTDLVALSGAHTFGRAQ  204

Query  788   CAVFSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGNNTAPLDRNSTDLFDNHYFKN  967
             C  FS RL NF  TG+PDPTL+A+L+ +LQ  CP  G+G+    LD ++ D FDN YF N
Sbjct  205   CQFFSQRLFNFNGTGNPDPTLNATLLAQLQQLCPQGGNGSVLTNLDLSTPDGFDNDYFSN  264

Query  968   LLIGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDG  1147
             L    GLLQSDQ LFS+  A   +  +V  ++++   FF  F  SM++MGN+S LTG+ G
Sbjct  265   LQANNGLLQSDQELFSTPGAD--TIPIVNNFSSNETAFFESFAVSMIRMGNLSLLTGTQG  322

Query  1148  EIRKNCRTRN  1177
             EIR NCR  N
Sbjct  323   EIRSNCRRVN  332



>gb|ABK21983.1| unknown [Picea sitchensis]
Length=341

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 210/306 (69%), Gaps = 5/306 (2%)
 Frame = +2

Query  266   LTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST-  442
             L+  FY  SCP    +++  V++A++ E RMAASLLRLHFHDCFV GCDGS+LLD  S+ 
Sbjct  39    LSHHFYYKSCPKAQAIIKSVVEDAVRKEARMAASLLRLHFHDCFVKGCDGSILLDDTSSF  98

Query  443   TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVLL  622
             T EK A PN NS RGF V+D IK  +E AC GVVSCADILA+AARDSV  SGGP W+VLL
Sbjct  99    TGEKTANPNKNSVRGFGVVDQIKCELEKACPGVVSCADILAVAARDSVGFSGGPFWKVLL  158

Query  623   GRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVFS  802
             GRRD   A+ + A+  + PGP  +   +  KF   GLN+ D+VALSGAHTIGLA+C+ F 
Sbjct  159   GRRDSRSASKSGANNDI-PGPNSTHQTLETKFKRQGLNVVDLVALSGAHTIGLARCSSFK  217

Query  803   NRLSNFQQTGSPDPTLDASLIPELQTTCPSNG-DGNNTAPLDRNSTDLFDNHYFKNLLIG  979
              RL N    G PDPTLD + + +L+  CP  G D N T PLD  +   FD  Y+ N++ G
Sbjct  218   ARLYNQTVNGKPDPTLDTTYLKQLRAVCPQTGTDDNQTTPLDPVTPIKFDIDYYDNVVAG  277

Query  980   RGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEIRK  1159
             +GLL SD+IL+S+  ++     LV++Y+  ++ FF  F  SM+KMGNI+PLTGS GEIRK
Sbjct  278   KGLLASDEILYSTKGSRTV--GLVESYSTSTHAFFKQFAASMIKMGNINPLTGSHGEIRK  335

Query  1160  NCRTRN  1177
             NCR  N
Sbjct  336   NCRRMN  341



>ref|XP_004233638.1| PREDICTED: peroxidase 10-like [Solanum lycopersicum]
Length=334

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 215/308 (70%), Gaps = 7/308 (2%)
 Frame = +2

Query  260   GQLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNS  439
             GQL   +Y  +CPNL K+VR  V +AI N+ RM ASLLRLHFHDCFVNGCDGS+LLD  S
Sbjct  32    GQLDYKYYDTTCPNLTKIVRNGVWSAISNDTRMPASLLRLHFHDCFVNGCDGSILLDDTS  91

Query  440   T-TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRV  616
             T T EK A PN NSARG+EVID+IK+ VE AC   VSC DIL +AAR+++ L+ GP W V
Sbjct  92    TFTGEKNAFPNRNSARGYEVIDAIKANVEKACPSTVSCTDILTLAAREAIYLTRGPFWSV  151

Query  617   LLGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAV  796
              LGRRD   A+ +AA+   LP PF+ L  I AKFV+ GL++ D+V LSGAHTIG A+C +
Sbjct  152   CLGRRDSLTASQSAANDQ-LPSPFEPLVNITAKFVSKGLDVKDVVVLSGAHTIGFAQCFM  210

Query  797   FSNRLSNFQQTGSPDPTLDASLIPELQTTCPSNGDGN-NTAPLDRNSTDLFDNHYFKNLL  973
             F  RL +F  +G+PDPTLD SL+  L++ CP+  D + N APLD  + + FDN YFKNL+
Sbjct  211   FKRRLFDFDGSGNPDPTLDLSLLGSLRSVCPNQSDSDSNLAPLDAVTINRFDNVYFKNLM  270

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
                GLL+SDQ L +     NT+ ALV  Y+ + + F  +F  SMVK+ NI  LTG +GEI
Sbjct  271   NNSGLLESDQALMN----DNTTAALVSNYSRNPSLFSKEFAASMVKLINIGVLTGQNGEI  326

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  327   RKNCRVVN  334



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 217/308 (70%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QLTTGFY+ SCP L++ V+  V +AI+ E RM ASLLRL FHDCFVNGCDGS+ LD  ST
Sbjct  23    QLTTGFYSKSCPKLYETVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTST  82

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN NSARGFEVID+IKSAVE  C GVVSCADILA+ ARDSV++ GGP W V 
Sbjct  83    FTGEKRAQPNFNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDVK  142

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+  AA+ S+ P P  +L+++I+ F AVGL+  DMVALSGAHTIG A+C  F
Sbjct  143   LGRRDARTASQGAANNSI-PTPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCP-SNGDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N  +       +DASL    Q  CP ++G G NN APLD  +   FDNHYF NL+
Sbjct  202   RGRIYNETK------NMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFINLV  255

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQ LF+  +      ++V++Y+N+ + F +DFVT+M+KMG+  PLTGS GEI
Sbjct  256   NKKGLLHSDQQLFNGGSVD----SIVKSYSNNPSSFTSDFVTAMIKMGDNRPLTGSKGEI  311

Query  1154  RKNCRTRN  1177
             RKNCR  N
Sbjct  312   RKNCRRIN  319



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 216/308 (70%), Gaps = 14/308 (5%)
 Frame = +2

Query  263   QLTTGFYANSCPNLFKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSVLLDGNST  442
             QL+T FY+ SCP +F  V+  V++A+  E RM ASLLRLHFHDCFVNGCDGS+LLD  S+
Sbjct  31    QLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTSS  90

Query  443   -TSEKFAVPNLNSARGFEVIDSIKSAVESACSGVVSCADILAIAARDSVLLSGGPTWRVL  619
              T EK A PN NSARGFEV+D IKS VE AC GVVSCADILAIA+RDSV + GGP+W V 
Sbjct  91    FTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEVK  150

Query  620   LGRRDGFLANFTAADASVLPGPFDSLDQIIAKFVAVGLNLTDMVALSGAHTIGLAKCAVF  799
             LGRRD   A+ +AA++ V+P P  +L++++ +F AVGL+  D+VALSGAHTIG A+C  F
Sbjct  151   LGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTTF  210

Query  800   SNRLSNFQQTGSPDPTLDASLIPELQTTCPSN-GDG-NNTAPLDRNSTDLFDNHYFKNLL  973
               R+ N       +  +DAS     Q TCP   G G NN APLD  + + FD  YFKNL+
Sbjct  211   RARIYN-------ETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLV  263

Query  974   IGRGLLQSDQILFSSDAAQNTSKALVQTYTNDSNRFFADFVTSMVKMGNISPLTGSDGEI  1153
               +GLL SDQILF+S A    + +LV++Y+ ++  F +DF  +M+KMG+  PLTGS GEI
Sbjct  264   NQKGLLHSDQILFNSGA----TNSLVKSYSGNAETFNSDFAKAMIKMGDNKPLTGSKGEI  319

Query  1154  RKNCRTRN  1177
             R NCR  N
Sbjct  320   RLNCRKPN  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3392847999056