BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30545_g1_i1 len=493 path=[511:0-492]

Length=493
                                                                      Score     E

ref|XP_009150833.1|  PREDICTED: putative ribonuclease H protein A...    106   2e-25   
gb|AAD22368.1|  putative non-LTR retroelement reverse transcriptase     105   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AID60103.1|  hypothetical protein                                    107   7e-24   
ref|XP_009121276.1|  PREDICTED: putative ribonuclease H protein A...    102   1e-23   
ref|XP_009124321.1|  PREDICTED: putative ribonuclease H protein A...    102   2e-23   
ref|XP_009147282.1|  PREDICTED: putative ribonuclease H protein A...    103   3e-23   
ref|XP_009120305.1|  PREDICTED: putative ribonuclease H protein A...    102   5e-23   
ref|XP_010451770.1|  PREDICTED: uncharacterized protein LOC104733943    104   7e-23   
gb|ABW81036.1|  unknown                                               99.4    1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_009124780.1|  PREDICTED: putative ribonuclease H protein A...    101   1e-22   
ref|XP_009107495.1|  PREDICTED: putative ribonuclease H protein A...    101   1e-22   
dbj|BAB09815.1|  non-LTR retroelement reverse transcriptase-like        103   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...    103   5e-22   
ref|XP_009123770.1|  PREDICTED: putative ribonuclease H protein A...    102   5e-22   
gb|AAF19536.1|AC007190_4  F23N19.5                                    97.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115103.1|  PREDICTED: putative ribonuclease H protein A...  98.6    1e-21   
sp|P0C2F6.1|RNHX1_ARATH  RecName: Full=Putative ribonuclease H pr...    100   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAF23831.1|AC007234_3  F1E22.12                                      100   3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79490.1|AC022492_34  F1L3.4                                     96.7    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...    100   4e-21   
gb|AAF97302.1|AC007843_5  Hypothetical protein                        96.7    5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31801.1|  hypothetical protein AALP_AA6G160600                  96.3    1e-20   
gb|AAG28895.1|AC008113_11  F12A21.24                                  98.6    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...  97.1    7e-20   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431  97.1    8e-20   
gb|AAD21515.1|  putative reverse transcriptase                        93.2    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28199.1|  unknown                                               93.2    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144970.1|  PREDICTED: putative ribonuclease H protein A...  94.4    1e-19   
ref|XP_009107896.1|  PREDICTED: putative ribonuclease H protein A...  93.6    2e-19   
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...  95.5    2e-19   
gb|AAD14501.1|  Hypothetical protein                                  90.1    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65396.1|  hypothetical protein At1g26950                        89.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28138.1|  unknown                                               89.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089  94.7    5e-19   
ref|XP_010501912.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  94.4    5e-19   
dbj|BAB09192.1|  non-LTR retroelement reverse transcriptase-like ...  91.3    6e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65462.1|  hypothetical protein At2g27870                        90.9    9e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase   89.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002514383.1|  nuclease, putative                               82.4    1e-16   Ricinus communis
gb|ABW81175.1|  non-LTR retrotransposon transposase                   86.7    2e-16   Arabidopsis cebennensis
gb|AAG12669.1|AC027033_4  hypothetical protein; 81517-79153           82.4    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042183.1|  Ribonuclease H protein                           84.0    1e-15   
ref|XP_008226028.1|  PREDICTED: putative ribonuclease H protein A...  80.5    3e-15   
gb|AAF69156.1|AC007915_8  F27F5.12                                    79.7    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227731.1|  PREDICTED: putative ribonuclease H protein A...  80.1    5e-15   
ref|YP_006666138.1|  RnaseH                                           77.8    7e-15   
ref|XP_007212728.1|  hypothetical protein PRUPE_ppa019009mg           78.2    1e-14   
ref|XP_008344356.1|  PREDICTED: putative ribonuclease H protein A...  79.3    1e-14   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764  81.3    2e-14   
ref|XP_006492639.1|  PREDICTED: putative ribonuclease H protein A...  80.5    2e-14   
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803  81.3    2e-14   
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase   80.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006490009.1|  PREDICTED: putative ribonuclease H protein A...  76.6    3e-14   
ref|XP_007208821.1|  hypothetical protein PRUPE_ppa025050mg           76.3    8e-14   
ref|XP_008221720.1|  PREDICTED: putative ribonuclease H protein A...  75.9    8e-14   
ref|XP_007020729.1|  Non-LTR retroelement reverse transcriptase-l...  75.1    1e-13   
ref|XP_004306073.1|  PREDICTED: putative ribonuclease H protein A...  74.7    2e-13   
ref|XP_006582499.1|  PREDICTED: putative ribonuclease H protein A...  74.7    2e-13   
ref|XP_002530315.1|  nuclease, putative                               74.7    2e-13   Ricinus communis
ref|XP_007221764.1|  hypothetical protein PRUPE_ppb024359mg           74.7    2e-13   
ref|NP_680382.1|  polynucleotidyl transferase, ribonuclease H-lik...  75.1    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293144.1|  PREDICTED: putative ribonuclease H protein A...  75.1    3e-13   
ref|XP_010474216.1|  PREDICTED: serine/threonine-protein kinase S...  77.0    4e-13   
ref|XP_004305448.1|  PREDICTED: putative ribonuclease H protein A...  72.4    8e-13   
dbj|BAE79382.1|  unnamed protein product                              76.3    8e-13   Ipomoea batatas [batate]
ref|XP_006605148.1|  PREDICTED: putative ribonuclease H protein A...  71.2    1e-12   
ref|XP_004299997.1|  PREDICTED: putative ribonuclease H protein A...  74.7    1e-12   
ref|XP_009148725.1|  PREDICTED: uncharacterized protein LOC103872128  75.1    1e-12   
ref|XP_004292485.1|  PREDICTED: putative ribonuclease H protein A...  72.0    2e-12   
ref|XP_008244240.1|  PREDICTED: putative ribonuclease H protein A...  71.2    2e-12   
gb|KHN06921.1|  Heat shock 70 kDa protein                             74.7    3e-12   
ref|XP_007031938.1|  Ribonuclease H protein                           74.3    3e-12   
ref|XP_007031579.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...  72.8    3e-12   
ref|XP_007048772.1|  Ribonuclease H protein                           70.5    3e-12   
dbj|BAE79384.1|  unnamed protein product                              74.7    4e-12   Ipomoea batatas [batate]
ref|XP_008237302.1|  PREDICTED: putative ribonuclease H protein A...  72.8    4e-12   
dbj|BAE79385.1|  unnamed protein product                              73.6    6e-12   Ipomoea batatas [batate]
ref|XP_004289446.1|  PREDICTED: putative ribonuclease H protein A...  69.7    8e-12   
gb|KHN47376.1|  Heat shock 70 kDa protein                             72.8    9e-12   
ref|XP_008224410.1|  PREDICTED: putative ribonuclease H protein A...  69.7    1e-11   
gb|AFK45241.1|  unknown                                               69.3    1e-11   
ref|XP_008357106.1|  PREDICTED: putative ribonuclease H protein A...  70.1    1e-11   
ref|XP_007216426.1|  hypothetical protein PRUPE_ppa022108mg           68.6    1e-11   
ref|XP_008344200.1|  PREDICTED: putative ribonuclease H protein A...  68.6    2e-11   
gb|KHN12872.1|  Putative ribonuclease H protein                       68.6    2e-11   
ref|XP_007039529.1|  Ribonuclease H protein                           68.2    2e-11   
gb|AAF79665.1|AC022314_6  F9C16.13                                    71.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007039838.1|  RNA-directed DNA polymerase (Reverse transcr...  71.2    3e-11   
ref|XP_002518868.1|  conserved hypothetical protein                   68.2    3e-11   Ricinus communis
ref|XP_007147977.1|  hypothetical protein PHAVU_006G170300g           71.2    3e-11   
gb|KHN28455.1|  Putative ribonuclease H protein                       67.4    4e-11   
ref|XP_004301145.1|  PREDICTED: putative ribonuclease H protein A...  70.1    4e-11   
ref|WP_028307571.1|  hypothetical protein                             67.0    5e-11   
ref|XP_007037560.1|  Uncharacterized protein TCM_014255               70.9    5e-11   
ref|XP_008224632.1|  PREDICTED: putative ribonuclease H protein A...  67.8    5e-11   
ref|XP_008222990.1|  PREDICTED: putative ribonuclease H protein A...  69.3    5e-11   
ref|XP_007224782.1|  hypothetical protein PRUPE_ppa023938mg           67.4    5e-11   
emb|CAB78008.1|  putative protein                                     70.5    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007221027.1|  hypothetical protein PRUPE_ppa014857mg           67.0    7e-11   
ref|XP_008227119.1|  PREDICTED: putative ribonuclease H protein A...  66.6    8e-11   
ref|XP_004298044.1|  PREDICTED: putative ribonuclease H protein A...  66.6    8e-11   
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323  69.3    2e-10   
ref|XP_007031450.1|  LINE-type retrotransposon LIb DNA, Insertion...  68.9    2e-10   
gb|AGN12869.1|  putative transposable element protein                 65.9    2e-10   
ref|XP_007037316.1|  Ribonuclease H-like protein                      67.4    2e-10   
ref|XP_007224107.1|  hypothetical protein PRUPE_ppa015647mg           65.1    2e-10   
ref|XP_004305757.1|  PREDICTED: putative ribonuclease H protein A...  67.4    3e-10   
gb|AGV40503.1|  hypothetical protein                                  65.9    3e-10   
ref|XP_007226572.1|  hypothetical protein PRUPE_ppa024162mg           66.6    3e-10   
gb|KHN04118.1|  Putative ribonuclease H protein                       64.7    3e-10   
ref|NP_001236017.1|  uncharacterized protein LOC100526921             65.9    3e-10   
ref|XP_006605069.1|  PREDICTED: putative ribonuclease H protein A...  64.7    3e-10   
ref|XP_006468253.1|  PREDICTED: uncharacterized protein LOC102614777  66.6    4e-10   
gb|ABD32321.2|  Ribonuclease H                                        65.1    4e-10   Medicago truncatula
dbj|BAF46298.1|  hypothetical protein                                 65.1    4e-10   Ipomoea nil [qian niu]
ref|XP_008226553.1|  PREDICTED: putative ribonuclease H protein A...  64.3    5e-10   
ref|XP_009805051.1|  PREDICTED: uncharacterized protein LOC104250178  64.3    7e-10   
gb|KHN25063.1|  Putative ribonuclease H protein                       63.5    8e-10   
ref|XP_008221996.1|  PREDICTED: putative ribonuclease H protein A...  66.6    9e-10   
ref|XP_007219162.1|  hypothetical protein PRUPE_ppa016360mg           63.9    1e-09   
ref|XP_008221992.1|  PREDICTED: uncharacterized protein LOC103321917  66.6    1e-09   
ref|XP_006475107.1|  PREDICTED: putative ribonuclease H protein A...  64.3    1e-09   
ref|XP_006584399.1|  PREDICTED: putative ribonuclease H protein A...  65.9    1e-09   
gb|AAF79682.1|AC022314_23  F9C16.18                                   63.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226620.1|  hypothetical protein PRUPE_ppa022893mg           63.5    1e-09   
ref|XP_004292270.1|  PREDICTED: putative ribonuclease H protein A...  63.9    1e-09   
ref|XP_003543094.1|  PREDICTED: putative ribonuclease H protein A...  63.5    1e-09   
ref|XP_010527295.1|  PREDICTED: uncharacterized protein LOC104804652  63.5    1e-09   
ref|XP_008223341.1|  PREDICTED: putative ribonuclease H protein A...  63.2    1e-09   
ref|XP_002530566.1|  nuclease, putative                               63.2    2e-09   Ricinus communis
ref|XP_004306184.1|  PREDICTED: putative ribonuclease H protein A...  62.8    2e-09   
gb|ABV21218.1|  At4g21420                                             63.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217555.1|  hypothetical protein PRUPE_ppa022357mg           62.4    2e-09   
ref|XP_007033353.1|  Non-LTR retroelement reverse transcriptase-like  65.1    2e-09   
ref|XP_002521266.1|  conserved hypothetical protein                   62.4    2e-09   Ricinus communis
ref|XP_002512046.1|  nucleic acid binding protein, putative           63.2    3e-09   Ricinus communis
ref|XP_004146631.1|  PREDICTED: putative ribonuclease H protein A...  62.8    3e-09   
gb|KHN08856.1|  Putative ribonuclease H protein                       62.0    3e-09   
ref|XP_008229469.1|  PREDICTED: putative ribonuclease H protein A...  63.9    3e-09   
emb|CAB10336.1|  splicing factor like protein                         64.7    4e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18706.1|  hypothetical protein                                 62.4    4e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ABD33209.1|  Ribonuclease H                                        63.5    4e-09   Medicago truncatula
ref|XP_008220870.1|  PREDICTED: putative ribonuclease H protein A...  62.8    5e-09   
emb|CAN67514.1|  hypothetical protein VITISV_012081                   64.7    5e-09   Vitis vinifera
ref|XP_002530597.1|  nuclease, putative                               60.8    5e-09   Ricinus communis
ref|XP_006485141.1|  PREDICTED: protein argonaute MEL1-like           64.7    6e-09   
ref|XP_007039706.1|  Non-LTR retroelement reverse transcriptase       63.5    6e-09   
emb|CCI61487.1|  unnamed protein product                              61.2    7e-09   
ref|XP_007030929.1|  Uncharacterized protein TCM_026608               61.2    8e-09   
gb|AID21636.1|  At4g21420p-like protein                               61.2    8e-09   
gb|KHN15930.1|  Putative ribonuclease H protein                       60.8    8e-09   
ref|XP_007225017.1|  hypothetical protein PRUPE_ppa020094mg           60.5    8e-09   
gb|AID21644.1|  At4g21420p-like protein                               61.2    9e-09   
ref|XP_009588021.1|  PREDICTED: uncharacterized protein LOC104085633  60.8    9e-09   
ref|XP_008343842.1|  PREDICTED: putative ribonuclease H protein A...  60.8    9e-09   
ref|XP_007019573.1|  Uncharacterized protein TCM_035679               60.8    1e-08   
gb|KCW83711.1|  hypothetical protein EUGRSUZ_B00585                   62.4    1e-08   
ref|XP_002869889.1|  At4g21420                                        60.8    1e-08   
emb|CDY63479.1|  BnaC01g41220D                                        60.8    1e-08   
ref|XP_010045599.1|  PREDICTED: uncharacterized protein LOC104434358  63.2    2e-08   
ref|XP_004308354.1|  PREDICTED: putative ribonuclease H protein A...  60.8    2e-08   
ref|WP_013275740.1|  ribonuclease H                                   59.7    2e-08   
ref|XP_002535256.1|  conserved hypothetical protein                   59.3    2e-08   Ricinus communis
gb|AID21608.1|  At4g21420p-like protein                               60.1    2e-08   
ref|XP_008245516.1|  PREDICTED: putative ribonuclease H protein A...  60.1    2e-08   
ref|XP_008371252.1|  PREDICTED: putative ribonuclease H protein A...  60.1    2e-08   
ref|XP_007019605.1|  Uncharacterized protein TCM_035716               59.7    2e-08   
ref|XP_006469101.1|  PREDICTED: putative ribonuclease H protein A...  62.4    2e-08   
ref|WP_026476332.1|  hypothetical protein                             59.3    2e-08   
ref|XP_009134753.1|  PREDICTED: uncharacterized protein LOC103859019  59.7    2e-08   
ref|XP_008383873.1|  PREDICTED: putative ribonuclease H protein A...  61.6    2e-08   
gb|ABN09101.1|  Ribonuclease H                                        59.3    3e-08   Medicago truncatula
ref|XP_008383853.1|  PREDICTED: putative ribonuclease H protein A...  59.7    3e-08   
ref|XP_007025838.1|  Polynucleotidyl transferase                      60.8    3e-08   
ref|XP_006599770.1|  PREDICTED: putative ribonuclease H protein A...  60.8    3e-08   
ref|XP_004305144.1|  PREDICTED: putative ribonuclease H protein A...  59.3    3e-08   
ref|WP_038506228.1|  hypothetical protein                             58.5    4e-08   
ref|XP_008382509.1|  PREDICTED: putative ribonuclease H protein A...  60.8    4e-08   
ref|XP_007203348.1|  hypothetical protein PRUPE_ppa020364mg           60.5    4e-08   
ref|WP_014961913.1|  ribonuclease H                                   58.5    4e-08   
ref|XP_007017129.1|  Uncharacterized protein TCM_042328               62.0    4e-08   
ref|XP_007019466.1|  Polynucleotidyl transferase, putative            60.8    5e-08   
ref|XP_007010351.1|  Polynucleotidyl transferase, putative            60.8    5e-08   
emb|CCA65997.1|  hypothetical protein                                 61.6    5e-08   
emb|CDP11300.1|  unnamed protein product                              61.2    5e-08   
ref|XP_002520194.1|  conserved hypothetical protein                   60.1    6e-08   Ricinus communis
ref|XP_007017131.1|  Uncharacterized protein TCM_033752               61.6    6e-08   
ref|XP_007031181.1|  Uncharacterized protein TCM_026784               61.2    7e-08   
gb|EYU27884.1|  hypothetical protein MIMGU_mgv1a013877mg              58.5    7e-08   
ref|WP_015327493.1|  ribonuclease HI                                  57.8    7e-08   
gb|EAR82875.2|  RNase H family protein                                60.5    7e-08   Tetrahymena thermophila SB210
ref|XP_007162147.1|  hypothetical protein PHAVU_001G128200g           61.2    8e-08   
ref|XP_002517245.1|  conserved hypothetical protein                   57.8    8e-08   Ricinus communis
ref|XP_008803873.1|  PREDICTED: putative ribonuclease H protein A...  58.5    8e-08   
ref|XP_004289281.1|  PREDICTED: putative ribonuclease H protein A...  58.5    9e-08   
ref|XP_008390978.1|  PREDICTED: putative ribonuclease H protein A...  58.2    9e-08   
ref|XP_007210921.1|  hypothetical protein PRUPE_ppb019242mg           57.8    9e-08   
ref|WP_017873228.1|  hypothetical protein                             57.4    1e-07   
ref|XP_007219947.1|  hypothetical protein PRUPE_ppb019489mg           60.5    1e-07   
ref|XP_008340288.1|  PREDICTED: putative ribonuclease H protein A...  59.7    1e-07   
ref|XP_007023230.1|  Non-LTR retroelement reverse transcriptase       60.8    1e-07   
ref|XP_008349924.1|  PREDICTED: putative ribonuclease H protein A...  57.4    1e-07   
ref|XP_002524702.1|  nuclease, putative                               57.8    1e-07   Ricinus communis
ref|XP_006601510.1|  PREDICTED: putative ribonuclease H protein A...  57.8    1e-07   
ref|XP_007043335.1|  Uncharacterized protein TCM_007760               57.8    1e-07   
ref|WP_022914789.1|  bifunctional RNase H/acid phosphatase            59.7    1e-07   
gb|ABN08768.1|  Polynucleotidyl transferase, Ribonuclease H fold      58.9    1e-07   Medicago truncatula
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966  60.5    1e-07   
ref|XP_008231862.1|  PREDICTED: putative ribonuclease H protein A...  57.4    1e-07   
ref|XP_010666966.1|  PREDICTED: uncharacterized protein LOC104884068  59.3    1e-07   
ref|XP_009793852.1|  PREDICTED: uncharacterized protein LOC104240675  58.2    1e-07   
ref|XP_008218223.1|  PREDICTED: putative ribonuclease H protein A...  57.8    1e-07   
ref|XP_008228893.1|  PREDICTED: probable CCR4-associated factor 1...  59.3    2e-07   
ref|XP_008245401.1|  PREDICTED: putative ribonuclease H protein A...  57.0    2e-07   
ref|XP_002523578.1|  conserved hypothetical protein                   57.0    2e-07   Ricinus communis
ref|WP_013496454.1|  ribonuclease H                                   56.6    2e-07   
ref|WP_014450173.1|  ribonuclease H                                   56.6    2e-07   
ref|XP_007021515.1|  Non-LTR retroelement reverse transcriptase-like  57.4    2e-07   
ref|XP_009619020.1|  PREDICTED: uncharacterized protein LOC104111114  57.0    2e-07   
ref|XP_007212490.1|  hypothetical protein PRUPE_ppa019260mg           57.0    2e-07   
ref|XP_009799760.1|  PREDICTED: uncharacterized protein LOC104245789  58.9    2e-07   
ref|XP_004308642.1|  PREDICTED: putative ribonuclease H protein A...  57.4    2e-07   
ref|XP_010229762.1|  PREDICTED: uncharacterized protein LOC104582121  57.4    2e-07   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               59.7    2e-07   
ref|XP_008225019.1|  PREDICTED: putative ribonuclease H protein A...  57.0    2e-07   
ref|XP_004301685.1|  PREDICTED: putative ribonuclease H protein A...  56.2    3e-07   
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...  59.3    3e-07   
gb|EKD30269.1|  ribonuclease H                                        55.8    3e-07   
gb|KFE63543.1|  ribonuclease H                                        57.0    3e-07   
ref|XP_010229775.1|  PREDICTED: uncharacterized protein LOC104582129  57.0    3e-07   
ref|XP_008233465.1|  PREDICTED: putative ribonuclease H protein A...  58.9    3e-07   
ref|WP_033430344.1|  acid phosphatase                                 58.5    3e-07   
ref|WP_023524696.1|  Putative ribonuclease H                          55.8    3e-07   
gb|EMS61533.1|  putative disease resistance RPP8-like protein 4       59.3    3e-07   
ref|XP_006576371.1|  PREDICTED: putative ribonuclease H protein A...  57.0    3e-07   
ref|XP_008220882.1|  PREDICTED: uncharacterized protein LOC103320918  58.9    3e-07   
ref|XP_008441930.1|  PREDICTED: putative ribonuclease H protein A...  56.6    4e-07   
ref|XP_002523020.1|  conserved hypothetical protein                   55.8    4e-07   Ricinus communis
gb|EKD84584.1|  ribonuclease H                                        55.5    4e-07   
ref|WP_017889809.1|  hypothetical protein                             55.8    4e-07   
ref|XP_007022832.1|  Uncharacterized protein TCM_026877               58.9    4e-07   
ref|WP_013682242.1|  ribonuclease H                                   56.2    4e-07   
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...  58.5    4e-07   Medicago truncatula
ref|WP_026939604.1|  hypothetical protein                             55.5    4e-07   
gb|KHN27033.1|  Putative ribonuclease H protein                       55.8    5e-07   
ref|XP_008385839.1|  PREDICTED: uncharacterized protein LOC103448363  57.8    5e-07   
ref|XP_009772061.1|  PREDICTED: uncharacterized protein LOC104222525  55.1    5e-07   
ref|XP_009334162.1|  PREDICTED: uncharacterized protein LOC103926995  57.8    5e-07   
dbj|BAE71259.1|  hypothetical protein                                 58.2    5e-07   Trifolium pratense [peavine clover]
ref|XP_008344853.1|  PREDICTED: putative ribonuclease H protein A...  57.8    5e-07   
ref|XP_007036030.1|  Uncharacterized protein TCM_021518               58.5    5e-07   
ref|XP_008337185.1|  PREDICTED: putative ribonuclease H protein A...  55.8    5e-07   
ref|XP_006338209.1|  PREDICTED: putative ribonuclease H protein A...  56.2    5e-07   
ref|XP_004292858.1|  PREDICTED: putative ribonuclease H protein A...  55.5    5e-07   
gb|KHN06694.1|  Putative ribonuclease H protein                       55.1    5e-07   
ref|WP_038595437.1|  acid phosphatase                                 57.8    5e-07   
ref|WP_034651982.1|  acid phosphatase                                 57.8    6e-07   
ref|XP_007017128.1|  Uncharacterized protein TCM_042327               58.5    6e-07   
ref|XP_004305206.1|  PREDICTED: putative ribonuclease H protein A...  55.5    6e-07   
ref|XP_008359251.1|  PREDICTED: uncharacterized protein LOC103422...  57.8    6e-07   
ref|XP_008354602.1|  PREDICTED: uncharacterized protein LOC103418244  58.5    6e-07   
ref|XP_010096800.1|  Putative ribonuclease H protein                  56.2    6e-07   
ref|XP_008359250.1|  PREDICTED: uncharacterized protein LOC103422...  57.8    6e-07   
ref|XP_007206968.1|  hypothetical protein PRUPE_ppb019197mg           57.4    6e-07   
ref|XP_008377870.1|  PREDICTED: putative ribonuclease H protein A...  57.8    7e-07   
ref|XP_006651286.1|  PREDICTED: uncharacterized protein LOC102718534  55.5    7e-07   
ref|XP_007214110.1|  hypothetical protein PRUPE_ppa017108mg           55.8    7e-07   
ref|XP_007207019.1|  hypothetical protein PRUPE_ppb022940mg           54.7    7e-07   
ref|XP_008346965.1|  PREDICTED: putative ribonuclease H protein A...  57.8    7e-07   
ref|XP_004486259.1|  PREDICTED: uncharacterized protein LOC101508262  55.5    8e-07   
ref|XP_004305091.1|  PREDICTED: ribonuclease HI-like                  55.5    8e-07   
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319  57.8    9e-07   
gb|ABD33309.1|  Ribonuclease H                                        57.8    9e-07   Medicago truncatula
ref|XP_003625075.1|  TMV resistance protein N                         57.8    9e-07   
ref|XP_002523031.1|  nucleic acid binding protein, putative           55.5    1e-06   Ricinus communis
ref|WP_006903068.1|  putative SAM-dependent methyltransferase         57.0    1e-06   
gb|KDP31341.1|  hypothetical protein JCGZ_11717                       57.0    1e-06   
ref|XP_007211152.1|  hypothetical protein PRUPE_ppa027042mg           55.1    1e-06   
ref|XP_004304923.1|  PREDICTED: putative ribonuclease H protein A...  55.5    1e-06   
ref|XP_007023195.1|  Non-LTR retroelement reverse transcriptase       57.4    1e-06   
ref|XP_007032969.1|  Uncharacterized protein TCM_019113               54.7    1e-06   
ref|XP_004305696.1|  PREDICTED: putative ribonuclease H protein A...  53.9    1e-06   
ref|XP_010253540.1|  PREDICTED: uncharacterized protein LOC104594...  56.2    1e-06   
ref|XP_010673863.1|  PREDICTED: uncharacterized protein LOC104890171  55.1    1e-06   
ref|XP_006477729.1|  PREDICTED: uncharacterized protein LOC102617084  57.0    1e-06   
ref|XP_010680493.1|  PREDICTED: uncharacterized protein LOC104895631  54.7    2e-06   
ref|XP_007202982.1|  hypothetical protein PRUPE_ppa018691mg           53.9    2e-06   
ref|XP_008373258.1|  PREDICTED: putative ribonuclease H protein A...  55.1    2e-06   
ref|XP_009763453.1|  PREDICTED: uncharacterized protein LOC104215364  55.1    2e-06   
ref|XP_008385092.1|  PREDICTED: putative ribonuclease H protein A...  57.0    2e-06   
gb|KHM99756.1|  TMV resistance protein N                              57.0    2e-06   
ref|XP_006598649.1|  PREDICTED: putative ribonuclease H protein A...  53.5    2e-06   
ref|XP_007023907.1|  Ribonuclease H-like protein                      56.6    2e-06   
ref|XP_002304990.2|  hypothetical protein POPTR_0004s03265g           54.7    2e-06   
ref|WP_005395430.1|  RNase H                                          56.2    2e-06   
ref|XP_009590365.1|  PREDICTED: uncharacterized protein LOC104087561  54.3    2e-06   
ref|XP_006599978.1|  PREDICTED: putative ribonuclease H protein A...  55.5    2e-06   
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...  56.6    2e-06   
emb|CDP20728.1|  unnamed protein product                              56.2    2e-06   
emb|CDP21148.1|  unnamed protein product                              56.2    2e-06   
ref|XP_009586778.1|  PREDICTED: putative ribonuclease H protein A...  54.7    2e-06   
ref|WP_005389340.1|  RNase H                                          56.2    2e-06   
ref|XP_009773024.1|  PREDICTED: uncharacterized protein LOC104223309  55.8    2e-06   
ref|XP_007013604.1|  Uncharacterized protein TCM_038187               55.5    2e-06   
ref|XP_007028667.1|  Uncharacterized protein TCM_024569               52.8    2e-06   
gb|KHN09144.1|  Putative ribonuclease H protein                       52.8    2e-06   
ref|XP_006587415.1|  PREDICTED: putative ribonuclease H protein A...  56.2    2e-06   
ref|WP_037583176.1|  hypothetical protein                             53.1    2e-06   
gb|KDO65745.1|  hypothetical protein CISIN_1g039495mg                 55.5    2e-06   
ref|XP_007040950.1|  Uncharacterized protein TCM_016759               56.2    3e-06   
ref|XP_009762739.1|  PREDICTED: uncharacterized protein LOC104214726  56.2    3e-06   
ref|XP_006440743.1|  hypothetical protein CICLE_v10021474mg           55.5    3e-06   
ref|XP_007031312.1|  Uncharacterized protein TCM_016762               56.2    3e-06   
ref|XP_008357937.1|  PREDICTED: putative ribonuclease H protein A...  56.2    3e-06   
ref|XP_008227007.1|  PREDICTED: uncharacterized protein LOC103326548  55.5    3e-06   
gb|KHF99723.1|  HVA22-like protein a                                  55.5    3e-06   
ref|WP_038616309.1|  acid phosphatase                                 55.5    3e-06   
emb|CDO99650.1|  unnamed protein product                              53.9    3e-06   
ref|XP_009600729.1|  PREDICTED: uncharacterized protein LOC104096123  53.1    3e-06   
ref|XP_007046404.1|  Uncharacterized protein TCM_011923               56.2    3e-06   
ref|XP_010695753.1|  PREDICTED: uncharacterized protein LOC104908345  55.8    3e-06   
ref|XP_010675683.1|  PREDICTED: uncharacterized protein LOC104891658  56.2    3e-06   
ref|XP_009596499.1|  PREDICTED: uncharacterized protein LOC104092577  53.1    3e-06   
gb|EAU68178.1|  RNase H                                               53.5    3e-06   
gb|EKD46245.1|  ribonuclease HI                                       53.1    3e-06   
ref|XP_001030538.1|  RNase H family protein                           55.8    3e-06   
ref|WP_011419781.1|  ribonuclease H                                   53.1    4e-06   
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230  55.8    4e-06   
ref|XP_007026458.1|  Uncharacterized protein TCM_021522               55.8    4e-06   
ref|WP_012524826.1|  MULTISPECIES: ribonuclease H                     54.3    4e-06   
ref|XP_009594976.1|  PREDICTED: uncharacterized protein LOC104091358  52.8    4e-06   
gb|ACV72190.1|  ribonuclease H                                        53.1    4e-06   
ref|XP_007044236.1|  Ribonuclease H protein, putative                 52.0    4e-06   
pdb|4H8K|A  Chain A, Crystal Structure Of Lc11-rnase H1 In Comple...  52.8    4e-06   
ref|WP_007467158.1|  phosphoglycerate mutase                          55.1    4e-06   
ref|XP_008356537.1|  PREDICTED: uncharacterized protein LOC103420255  55.5    4e-06   
ref|XP_008346905.1|  PREDICTED: uncharacterized protein LOC103409892  55.5    4e-06   
ref|XP_002524970.1|  conserved hypothetical protein                   52.4    5e-06   
ref|XP_009597642.1|  PREDICTED: uncharacterized protein LOC104093583  53.1    5e-06   
ref|WP_013911944.1|  RNase H                                          55.1    5e-06   
ref|WP_014526056.1|  RNase H                                          55.1    5e-06   
ref|XP_008349226.1|  PREDICTED: uncharacterized protein LOC103412449  53.5    5e-06   
ref|WP_038622116.1|  acid phosphatase                                 54.7    5e-06   
ref|WP_038618993.1|  acid phosphatase                                 54.7    5e-06   
ref|XP_007008705.1|  Uncharacterized protein TCM_042331               55.5    5e-06   
gb|EEE66235.1|  hypothetical protein OsJ_22399                        53.1    5e-06   
ref|XP_004292534.1|  PREDICTED: uncharacterized protein LOC101291992  52.4    5e-06   
ref|WP_014558760.1|  RNase H                                          54.7    5e-06   
ref|WP_013242351.1|  RNase H                                          54.7    5e-06   
ref|XP_010692627.1|  PREDICTED: uncharacterized protein LOC104905716  52.8    5e-06   
ref|WP_014367383.1|  RNase H                                          54.7    5e-06   
emb|CAJ38373.1|  putative reverse transcriptase                       53.9    5e-06   
pdb|3U3G|D  Chain D, Structure Of Lc11-Rnase H1 Isolated From Com...  52.4    6e-06   
ref|WP_036016524.1|  acid phosphatase                                 54.7    6e-06   
ref|WP_013377286.1|  RNase H                                          53.5    6e-06   
gb|KHN42473.1|  Putative ribonuclease H protein                       52.8    6e-06   
gb|AFK41923.1|  unknown                                               53.5    6e-06   
ref|XP_009616365.1|  PREDICTED: uncharacterized protein LOC104108915  54.7    6e-06   
ref|WP_028585917.1|  hypothetical protein                             52.4    6e-06   
ref|XP_008345768.1|  PREDICTED: putative ribonuclease H protein A...  54.7    6e-06   
ref|XP_010666658.1|  PREDICTED: uncharacterized protein LOC104883793  52.4    6e-06   
ref|XP_009770934.1|  PREDICTED: uncharacterized protein LOC104221568  54.3    6e-06   
gb|KFK31628.1|  hypothetical protein AALP_AA6G137400                  54.7    6e-06   
ref|WP_013258228.1|  ribonuclease H                                   53.1    6e-06   
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737  55.1    7e-06   
ref|WP_006063991.1|  ribonuclease HI                                  54.3    7e-06   
ref|XP_004301565.1|  PREDICTED: putative ribonuclease H protein A...  53.5    8e-06   
gb|EEC81198.1|  hypothetical protein OsI_24213                        53.1    8e-06   
ref|XP_008220350.1|  PREDICTED: putative ribonuclease H protein A...  52.0    8e-06   
ref|XP_010694338.1|  PREDICTED: uncharacterized protein LOC104907148  52.8    8e-06   
ref|XP_008384440.1|  PREDICTED: putative ribonuclease H protein A...  54.3    8e-06   
ref|XP_004289414.1|  PREDICTED: uncharacterized protein LOC101292643  51.6    9e-06   
ref|XP_009784797.1|  PREDICTED: uncharacterized protein LOC104233157  51.6    9e-06   
ref|XP_008229048.1|  PREDICTED: putative ribonuclease H protein A...  52.0    9e-06   
ref|XP_008385950.1|  PREDICTED: putative ribonuclease H protein A...  53.9    1e-05   
ref|XP_004305553.1|  PREDICTED: uncharacterized protein LOC101315367  52.8    1e-05   
gb|ABE80133.2|  Polynucleotidyl transferase, Ribonuclease H fold      53.5    1e-05   
ref|WP_026165872.1|  acid phosphatase                                 53.9    1e-05   
ref|XP_009804158.1|  PREDICTED: uncharacterized protein LOC104249428  53.5    1e-05   
ref|XP_007031882.1|  Uncharacterized protein TCM_017202               53.9    1e-05   
ref|XP_002526241.1|  conserved hypothetical protein                   53.5    1e-05   
ref|XP_008370907.1|  PREDICTED: putative ribonuclease H protein A...  54.3    1e-05   
ref|XP_009800955.1|  PREDICTED: uncharacterized protein LOC104246773  51.6    1e-05   
ref|WP_023636041.1|  RNase H                                          53.5    1e-05   
gb|KHN04604.1|  Putative ribonuclease H protein                       51.6    1e-05   
ref|XP_006379569.1|  hypothetical protein POPTR_0008s04925g           52.4    1e-05   
ref|XP_009765799.1|  PREDICTED: uncharacterized protein LOC104217298  51.6    1e-05   
ref|XP_009629929.1|  PREDICTED: uncharacterized protein LOC104119987  53.9    1e-05   
ref|XP_010693676.1|  PREDICTED: uncharacterized protein LOC104906600  53.5    1e-05   
gb|AAT68735.1|  hypothetical protein At2g15045                        50.8    1e-05   
gb|KHN24479.1|  TMV resistance protein N                              53.9    1e-05   
ref|XP_008358855.1|  PREDICTED: uncharacterized protein LOC103422573  53.9    1e-05   
ref|WP_015098408.1|  hypothetical protein                             53.5    1e-05   
ref|NP_001174960.1|  Os06g0683500                                     52.8    1e-05   
ref|XP_010668107.1|  PREDICTED: uncharacterized protein LOC104885102  52.0    2e-05   
ref|XP_010666059.1|  PREDICTED: uncharacterized protein LOC104883268  53.1    2e-05   
gb|AJE33682.1|  bifunctional RNase H/acid phosphatase                 53.1    2e-05   
ref|XP_007227404.1|  hypothetical protein PRUPE_ppb019814mg           50.4    2e-05   
ref|WP_034665960.1|  acid phosphatase                                 53.1    2e-05   
ref|XP_008364754.1|  PREDICTED: putative ribonuclease H protein A...  51.6    2e-05   
ref|XP_008225764.1|  PREDICTED: putative ribonuclease H protein A...  53.1    2e-05   
ref|XP_007207745.1|  hypothetical protein PRUPE_ppb024611mg           51.6    2e-05   
ref|WP_014307124.1|  RNase H                                          53.1    2e-05   
ref|XP_006285450.1|  hypothetical protein CARUB_v10006875mg           53.1    2e-05   
ref|XP_004295896.1|  PREDICTED: putative ribonuclease H protein A...  52.8    2e-05   
emb|CEL18879.1|  FIG006762: Phosphoglycerate mutase family            52.8    2e-05   
ref|XP_008780607.1|  PREDICTED: uncharacterized protein LOC103700442  52.4    2e-05   
ref|WP_018297148.1|  hypothetical protein                             52.8    2e-05   
dbj|BAD23746.1|  hypothetical protein                                 52.0    2e-05   
ref|XP_007040952.1|  Uncharacterized protein TCM_005954               53.1    2e-05   
ref|XP_004966272.1|  PREDICTED: putative ribonuclease H protein A...  51.6    2e-05   
gb|EEC73643.1|  hypothetical protein OsI_08164                        51.6    2e-05   
ref|XP_007015180.1|  Uncharacterized protein TCM_040819               52.8    3e-05   
gb|AFK34055.1|  unknown                                               51.6    3e-05   
ref|XP_006605154.1|  PREDICTED: putative ribonuclease H protein A...  50.4    3e-05   
ref|XP_009794683.1|  PREDICTED: uncharacterized protein LOC104241433  52.0    3e-05   
ref|WP_019854957.1|  hypothetical protein                             52.8    3e-05   
ref|WP_016457809.1|  hypothetical protein                             52.8    3e-05   
ref|XP_010695481.1|  PREDICTED: uncharacterized protein LOC104908104  52.0    3e-05   
ref|XP_010675545.1|  PREDICTED: uncharacterized protein LOC104891535  51.2    3e-05   
ref|XP_006421903.1|  hypothetical protein CICLE_v10007098mg           50.4    3e-05   
gb|ABN08136.1|  Ribonuclease H                                        49.7    3e-05   
ref|XP_009802861.1|  PREDICTED: uncharacterized protein LOC104248321  51.2    3e-05   
ref|XP_004514910.1|  PREDICTED: putative ribonuclease H protein A...  51.2    3e-05   
emb|CCA65995.1|  hypothetical protein                                 52.8    4e-05   
ref|XP_009775981.1|  PREDICTED: uncharacterized protein LOC104225816  49.7    4e-05   
ref|XP_008390124.1|  PREDICTED: uncharacterized protein LOC103452415  50.4    4e-05   
ref|XP_007210030.1|  hypothetical protein PRUPE_ppa018992mg           49.3    4e-05   
ref|WP_035556906.1|  hypothetical protein                             50.1    4e-05   
emb|CDP20084.1|  unnamed protein product                              52.0    4e-05   
ref|WP_033229873.1|  MULTISPECIES: acid phosphatase                   52.0    4e-05   
ref|WP_016468719.1|  hypothetical protein                             52.0    4e-05   
ref|XP_010669417.1|  PREDICTED: uncharacterized protein LOC104886646  50.1    4e-05   
ref|XP_007201602.1|  hypothetical protein PRUPE_ppa019457mg           50.1    4e-05   
ref|XP_007046402.1|  Uncharacterized protein TCM_011921               52.4    4e-05   
ref|XP_008913838.1|  hypothetical protein PPTG_17648                  50.4    4e-05   
ref|XP_007014629.1|  Uncharacterized protein TCM_039895               50.8    4e-05   
ref|XP_007048818.1|  Uncharacterized protein TCM_001832               50.4    4e-05   
gb|ETL27263.1|  hypothetical protein L916_19146                       50.4    4e-05   
ref|WP_015619868.1|  phosphoglycerate mutase                          52.0    4e-05   
ref|XP_010670392.1|  PREDICTED: uncharacterized protein LOC104887460  50.8    5e-05   
ref|XP_002520926.1|  conserved hypothetical protein                   49.7    5e-05   
gb|ETI33490.1|  hypothetical protein F443_19802                       50.4    5e-05   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737               52.4    5e-05   
ref|XP_004234299.1|  PREDICTED: uncharacterized protein LOC101243674  50.8    5e-05   
ref|XP_004293164.1|  PREDICTED: putative ribonuclease H protein A...  50.8    5e-05   
ref|XP_010693635.1|  PREDICTED: uncharacterized protein LOC104906563  52.4    5e-05   
ref|XP_008354555.1|  PREDICTED: putative ribonuclease H protein A...  52.0    5e-05   
ref|XP_004232279.1|  PREDICTED: uncharacterized protein LOC101245...  51.6    5e-05   
ref|WP_038591689.1|  acid phosphatase                                 51.6    5e-05   
ref|WP_029720604.1|  acid phosphatase                                 51.6    5e-05   
ref|XP_004232278.1|  PREDICTED: uncharacterized protein LOC101245...  51.6    5e-05   
ref|WP_014316931.1|  RNase H                                          51.6    5e-05   
emb|CAD41337.2|  OJ991113_30.21                                       52.0    5e-05   
ref|WP_007692980.1|  ribonuclease H                                   50.4    5e-05   
ref|WP_033362456.1|  acid phosphatase                                 51.6    6e-05   
ref|XP_010689379.1|  PREDICTED: uncharacterized protein LOC104903088  51.2    6e-05   
ref|XP_006584183.1|  PREDICTED: putative ribonuclease H protein A...  51.2    6e-05   
ref|XP_007220772.1|  hypothetical protein PRUPE_ppa026532mg           51.6    6e-05   
ref|XP_006356603.1|  PREDICTED: putative ribonuclease H protein A...  52.0    6e-05   
ref|WP_011985082.1|  ribonuclease H                                   51.2    6e-05   
ref|XP_004287420.1|  PREDICTED: uncharacterized protein LOC101302388  51.6    6e-05   
ref|XP_006338531.1|  PREDICTED: uncharacterized protein LOC102582...  51.2    6e-05   
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein       52.0    6e-05   
ref|XP_006338530.1|  PREDICTED: uncharacterized protein LOC102582...  51.2    6e-05   
gb|KHN36121.1|  Putative ribonuclease H protein                       48.9    6e-05   
ref|WP_016829530.1|  RNase H                                          51.6    7e-05   
ref|WP_014310660.1|  RNase H                                          51.6    7e-05   
ref|XP_010314146.1|  PREDICTED: uncharacterized protein LOC104644962  51.2    7e-05   
ref|XP_002513210.1|  conserved hypothetical protein                   50.1    7e-05   
ref|XP_009588376.1|  PREDICTED: uncharacterized protein LOC104085...  51.2    7e-05   
ref|XP_004496386.1|  PREDICTED: uncharacterized protein LOC101497185  50.4    7e-05   
ref|WP_013874247.1|  RNase H                                          51.2    7e-05   
ref|XP_009599431.1|  PREDICTED: uncharacterized protein LOC104095089  50.4    7e-05   
ref|WP_010935245.1|  RNase H                                          51.2    7e-05   
ref|WP_014302159.1|  RNase H                                          51.2    7e-05   
ref|XP_010675636.1|  PREDICTED: uncharacterized protein LOC104891623  51.2    7e-05   
ref|XP_007050978.1|  Uncharacterized protein TCM_004691               50.8    7e-05   
ref|XP_007028292.1|  Uncharacterized protein TCM_023960               51.2    7e-05   
ref|XP_009786080.1|  PREDICTED: uncharacterized protein LOC104234...  51.2    7e-05   
ref|WP_014303675.1|  RNase H                                          51.2    7e-05   
ref|XP_003602156.1|  hypothetical protein MTR_3g090420                50.8    7e-05   
ref|XP_006358679.1|  PREDICTED: uncharacterized protein LOC102578253  50.8    8e-05   
gb|KHN12821.1|  Putative ribonuclease H protein                       49.3    8e-05   
ref|XP_009786084.1|  PREDICTED: uncharacterized protein LOC104234...  50.8    8e-05   
ref|WP_020936123.1|  ribonuclease H                                   50.1    8e-05   
ref|WP_003852273.1|  RNase H                                          51.2    8e-05   
ref|WP_013277683.1|  ribonuclease H                                   50.1    8e-05   
gb|KHN24167.1|  Putative ribonuclease H protein                       49.3    8e-05   
gb|KHN31950.1|  Putative ribonuclease H protein                       50.1    8e-05   
ref|XP_004513875.1|  PREDICTED: putative ribonuclease H protein A...  50.4    8e-05   
emb|CAN72157.1|  hypothetical protein VITISV_019020                   51.2    8e-05   
ref|XP_009588373.1|  PREDICTED: uncharacterized protein LOC104085...  50.8    8e-05   
ref|XP_002524943.1|  conserved hypothetical protein                   48.9    8e-05   
ref|WP_006884989.1|  ribonuclease H                                   50.1    8e-05   
ref|XP_003614783.1|  hypothetical protein MTR_5g059160                49.3    8e-05   
ref|WP_014308537.1|  RNase H                                          51.2    8e-05   
ref|XP_008391104.1|  PREDICTED: putative ribonuclease H protein A...  51.2    9e-05   
ref|WP_006839884.1|  RNase H                                          51.2    9e-05   
ref|XP_009786072.1|  PREDICTED: uncharacterized protein LOC104234226  51.2    9e-05   



>ref|XP_009150833.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=188

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G AT GGVLRD NG+WL GFG  IGRC+  +AE WGV  GL +    GVR + +E
Sbjct  36   SRGNPGLATAGGVLRDENGSWLCGFGLNIGRCSAPLAELWGVYYGLLIAWQKGVRCVEVE  95

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  +V   + G  + H L+ + RLC         +RF H+YRE N LAD LA  AFS
Sbjct  96   VDSAVVVGFFQTGIAETHPLSFLVRLCYGFISRDWIVRFKHVYREANGLADGLATYAFS  154



>gb|AAD22368.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=321

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G AT GGVLRD NG W+ GF   IG C+  +AE WGV  GL +    G R + L
Sbjct  168  ASRGNPGFATAGGVLRDHNGAWIGGFAVNIGVCSAPLAELWGVYYGLFIAWGRGARRVEL  227

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DSK +V  L  G  D H L+ + RLC         +R  H+YRE NRLAD LA+ AFS
Sbjct  228  EVDSKMVVGFLTTGIADSHPLSFLLRLCYDFLSKGWIVRISHVYREANRLADGLANYAFS  287



>gb|AID60103.1| hypothetical protein [Brassica napus]
Length=620

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G AT GG LRD  G W+ GF   IG C+  +AE WGV  GL +  D G+R L +
Sbjct  467  ASRGNPGLATAGGALRDEEGKWIGGFSLNIGICSAPLAELWGVYYGLCIAWDKGIRKLEV  526

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DSK +V  L+ G  D H L+ + RLC         + F H+YRE NRLAD LA+ AFS
Sbjct  527  EVDSKSVVGFLKTGIHDSHPLSFLVRLCYGFVSRDWIVNFSHVYRETNRLADGLANYAFS  586

Query  364  QQ  369
             Q
Sbjct  587  LQ  588



>ref|XP_009121276.1| PREDICTED: putative ribonuclease H protein At1g65750, partial 
[Brassica rapa]
Length=216

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G AT GG LRD  G W+ GF   IG C+  +AE WGV  G+ +  D G+R L +
Sbjct  63   ASRGNPGLATAGGALRDGQGRWIGGFALNIGICSAPLAELWGVYYGMCIAWDKGIRKLEV  122

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DSK +V  L+ G  D H L+ + RLC         +   H+YRE NRLAD LA+  FS
Sbjct  123  EVDSKSVVGFLKTGIHDSHPLSFLVRLCYGFVSRDWIVNISHVYREANRLADGLANYVFS  182

Query  364  QQ  369
             Q
Sbjct  183  LQ  184



>ref|XP_009124321.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=262

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 70/119 (59%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  N G A  GG LR+  G W  GF   IG CT  +AE WGV  GL +  + GVR L +E
Sbjct  108  SHGNPGPAAAGGALRNGEGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEVE  167

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  ++E L  G GD H L+ + RLC         +RFVH+YRE NRLAD LA++AF+
Sbjct  168  VDSMMVMEFLTIGIGDTHPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANLAFT  226



>ref|XP_009147282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 69/119 (58%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G AT GGVLRD  G W  GF   IG C+  +AE WGV  GL +  D G+R L +E
Sbjct  156  SRGNPGLATAGGVLRDEYGEWKGGFAVNIGICSASLAELWGVYYGLCIAWDRGIRRLEVE  215

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  +V+ LR G  D H L+ + RLC         ++F H+YRE N LAD LA  AFS
Sbjct  216  VDSASVVDFLRTGIHDSHPLSFLVRLCYGFISRDWLVKFSHVYREANHLADGLATYAFS  274



>ref|XP_009120305.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G A+ GGVLRD  G W  GF   IGRC+  +AE WGV  GL +  + G+R L +
Sbjct  155  ASHGNPGLASAGGVLRDGEGEWCGGFALNIGRCSAPLAELWGVYYGLVIAWEKGIRRLEV  214

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DSK +V  L  G  D H L+ + RLC         +R VH+YRE NRLAD LA++AFS
Sbjct  215  EVDSKMVVGFLTTGIEDTHPLSFLVRLCHGFLTRDWLVRIVHVYREANRLADGLANLAFS  274



>ref|XP_010451770.1| PREDICTED: uncharacterized protein LOC104733943 [Camelina sativa]
Length=589

 Score =   104 bits (260),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 68/152 (45%), Positives = 85/152 (56%), Gaps = 0/152 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G AT GGVL DS+G W+ GF  +IG C+  +AE WGV  GL M  +     L LE
Sbjct  437  SRGNPGMATAGGVLHDSSGAWIGGFALQIGICSAPLAELWGVYYGLVMAWEKQATRLELE  496

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
             DSK +V  L+ G  + HLL+ +  LC         +R  H+YRE NRLAD LA+ AFS 
Sbjct  497  IDSKVVVGFLKTGVSEAHLLSFLICLCHGFISRDWCVRISHVYRETNRLADGLANYAFSL  556

Query  367  QEDHIlletppleteellALDRVGAASTRRVC  462
            +     L+      E LL+ D  G AS RRVC
Sbjct  557  ELVFHALDVVSSCIEFLLSSDTQGMASLRRVC  588



>gb|ABW81036.1| unknown [Arabidopsis lyrata subsp. lyrata]
Length=172

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 68/119 (57%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S+ N G AT  GVLR+S+G W  GF   IGRC+  +AE WGV  GL    ++ V  LVLE
Sbjct  20   SQGNPGLATASGVLRNSDGKWCGGFALNIGRCSAPLAELWGVYYGLYTAWEHRVTRLVLE  79

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  +V  L  G GD H L+ + RLC         +R  H+YR+ NR AD LA+  FS
Sbjct  80   VDSSLVVGFLTTGIGDSHPLSILVRLCYGFIARDWIVRVTHVYRKANRFADGLANYVFS  138



>ref|XP_009124780.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=332

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 69/119 (58%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  N G A  GG LR+  G W  GF   IG CT  +AE WGV  GL +  + GVR L +E
Sbjct  178  SHGNPGPAAAGGALRNGEGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEVE  237

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  ++E L  G GD H L+ + RLC         +RFVH+YRE NRLAD LA+ AF+
Sbjct  238  VDSMMVMEFLTIGIGDTHPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANFAFT  296



>ref|XP_009107495.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=305

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 69/119 (58%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G AT GGVLRD NG+WL GFG  IGRC+  +AE WGV  GL +     VR + +E
Sbjct  184  SRGNPGLATAGGVLRDENGSWLCGFGLNIGRCSAPLAELWGVYYGLLIAWQKRVRCVEVE  243

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  +V   + G  + H L+ + RLC         +RF H+YRE N LAD LA   FS
Sbjct  244  VDSAVVVGFFQTGIAETHPLSFLVRLCYGFISRDWIVRFKHVYREANGLADGLATYGFS  302



>dbj|BAB09815.1| non-LTR retroelement reverse transcriptase-like [Arabidopsis 
thaliana]
Length=676

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N GQAT GGV+RD +G+WL GF   IG C+  +AE WGV  GL +  + G R + L
Sbjct  523  ASHGNPGQATAGGVIRDEHGSWLVGFALNIGVCSAPLAELWGVYYGLVVAWERGWRRVRL  582

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS  +V  L+ G GD H L  + RLC         +R  H+YRE NRLAD LA+ AF+
Sbjct  583  EVDSALVVGFLQSGIGDSHPLAFLVRLCHGFISKDWIVRITHVYREANRLADGLANYAFT  642



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G AT GGVLR+  G W  GF   IGRC   +AE WGV  GL    + G+R L L
Sbjct  858  SSHGNPGAATAGGVLRNGEGEWCGGFALNIGRCGALLAELWGVYYGLVAAWEKGIRRLEL  917

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS+ +VE L  G GD H L+ + R+C    +    +  VH+YRE NRLAD LA++AFS
Sbjct  918  EVDSQVVVEFLTIGIGDTHSLSFLVRMCHGLLKKDWLVHIVHVYREANRLADGLANLAFS  977



>ref|XP_009123770.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=532

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 70/119 (59%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  N G A  GG LR+  G W  GF   IG CT  +AE WGV  GL +  + GVR L +E
Sbjct  378  SHGNPGPAAAGGALRNGEGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEVE  437

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  ++E L  G GD H L+ + RLC         +RFVH+YRE NRLAD LA++AF+
Sbjct  438  VDSMMVMEFLTIGIGDTHPLSFLVRLCHGFLTRDWLVRFVHVYREANRLADGLANLAFT  496



>gb|AAF19536.1|AC007190_4 F23N19.5 [Arabidopsis thaliana]
Length=233

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 66/118 (56%), Gaps = 0/118 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  N G AT GG LR+  G W  GF   IGRC   +AE WGV  GL M  D G+  L LE
Sbjct  81   SHGNPGLATAGGALRNEYGEWCFGFALNIGRCLAPLAELWGVYYGLFMAWDRGITRLELE  140

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             DS+ +V  LR G G  H L+ + R+C         +R  H+YRE NRLAD LA+ AF
Sbjct  141  VDSEMVVGFLRTGIGSSHPLSFLVRMCHGFLSRDWIVRIGHVYREANRLADGLANYAF  198



>ref|XP_009115103.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=308

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G AT GGVLR+ +G W  GF   IGRC+  +AE WGV  GL +  + G+  L +
Sbjct  155  ASHGNPGLATAGGVLRNGDGEWCGGFVLNIGRCSAPLAELWGVYYGLVIAWEKGISRLEV  214

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DSK +VE L  G G+ H L+ + RLC         +R +H+YRE N LAD L  +AFS
Sbjct  215  EVDSKMVVEFLTMGIGETHPLSFLVRLCHGFLTRDWLVRILHVYREANHLADGLTHLAFS  274



>sp|P0C2F6.1|RNHX1_ARATH RecName: Full=Putative ribonuclease H protein At1g65750 [Arabidopsis 
thaliana]
Length=620

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G A+ GGVLRD  G W  GF   IGRC+   AE WGV  GL    +  V  + L
Sbjct  467  ASRGNPGLASAGGVLRDCTGAWCGGFSLNIGRCSAPQAELWGVYYGLYFAWEKKVPRVEL  526

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS+ +V  L+ G  D H L+ + RLC    +    +R VH+YRE NRLAD LA+ AFS
Sbjct  527  EVDSEVIVGFLKTGISDSHPLSFLVRLCHGFLQKDWLVRIVHVYREANRLADGLANYAFS  586



>gb|AAF23831.1|AC007234_3 F1E22.12 [Arabidopsis thaliana]
Length=1055

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 69/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G A+ GGVLRD  G W  GF   IGRC+   AE WGV  GL    +  V  + L
Sbjct  576  ASRGNPGLASAGGVLRDCTGAWCGGFSLNIGRCSAPQAELWGVYYGLYFAWEKKVPRVEL  635

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS+ +V  L+ G  D H L+ + RLC    +    +R VH+YRE NRLAD LA+ AFS
Sbjct  636  EVDSEVIVGFLKTGISDSHPLSFLVRLCHGFLQKDWLVRIVHVYREANRLADGLANYAFS  695



>gb|AAF79490.1|AC022492_34 F1L3.4 [Arabidopsis thaliana]
Length=253

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 67/119 (56%), Gaps = 0/119 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N   AT GGV+RD +G W  GF   IG C+  +AE WG   GL +  + GV  L +
Sbjct  100  ASRGNPRLATAGGVVRDGDGNWCYGFSLNIGICSAPLAELWGAYYGLNIAWERGVTQLEM  159

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
            E DS+ +V  LR G  D H L+ + RLC         +R  H+YRE NRLAD LA+ AF
Sbjct  160  EIDSEMVVGFLRTGIDDSHPLSFLVRLCHGLLSKDWSVRISHVYREANRLADGLANYAF  218



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  4     CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
              S  N G A+ GGVLRD  G W  GF   IGRC+  +AE WGV  GL +  + G+R L +
Sbjct  1051  ASHGNPGLASAGGVLRDGEGEWCGGFALNIGRCSAPLAELWGVYYGLVIAWEKGIRRLEV  1110

Query  184   ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             E DSK +V  L  G  D H L+ + RLC         +R VH+YRE NRLAD LA++A S
Sbjct  1111  EVDSKMVVGFLTTGIEDTHPLSFLVRLCHGFLTRDWLVRIVHVYREANRLADGLANLAIS  1170



>gb|AAF97302.1|AC007843_5 Hypothetical protein [Arabidopsis thaliana]
 gb|AAV68820.1| hypothetical protein AT1G17390 [Arabidopsis thaliana]
Length=272

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 67/119 (56%), Gaps = 0/119 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N   AT GGV+RD +G W  GF   IG C+  +AE WG   GL +  + GV  L +
Sbjct  119  ASRGNPRLATAGGVVRDGDGNWCYGFSLNIGICSAPLAELWGAYYGLNIAWERGVTQLEM  178

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
            E DS+ +V  LR G  D H L+ + RLC         +R  H+YRE NRLAD LA+ AF
Sbjct  179  EIDSEMVVGFLRTGIDDSHPLSFLVRLCHGLLSKDWSVRISHVYREANRLADGLANYAF  237



>gb|KFK31801.1| hypothetical protein AALP_AA6G160600 [Arabis alpina]
Length=373

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 81/152 (53%), Gaps = 0/152 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G A  GGVLRD +G W  GF   IG C   +AE WGV  GL +  +  +  L +
Sbjct  220  ASRGNPGLAAAGGVLRDGDGNWCGGFVLNIGICFAPLAELWGVYYGLYIAWERRITRLEI  279

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS  +VE L+ G  + H L+ + RLC         +R VH+YRE NRLAD LA+ AFS
Sbjct  280  EVDSAIVVEFLKTGISEYHPLSFLVRLCHGFISRDWIVRIVHVYREANRLADGLANYAFS  339

Query  364  QQEDHIlletppleteellALDRVGAASTRRV  459
                 + LE+ P     + A D  G A  R++
Sbjct  340  LPLGFLFLESIPDSVRLIFAEDASGTAIPRQI  371



>gb|AAG28895.1|AC008113_11 F12A21.24 [Arabidopsis thaliana]
Length=803

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G AT GGV+RD  G W  GF   IGRC+  +AE WGV  G  +     +  + L
Sbjct  650  ASRGNPGLATAGGVIRDGAGNWCGGFALNIGRCSAPLAELWGVYYGFYLAWTKALTRVEL  709

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS+ +V  L+ G GD H L+ + RLC         +R  H+YRE NRLAD LA+ AFS
Sbjct  710  EVDSELVVGFLKTGIGDQHPLSFLVRLCHGLLSKDWIVRITHVYREANRLADGLANYAFS  769



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = +1

Query  4     CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
              +R N G AT GGV+RD  GTW  GF   IG C+  +AE WGV  GL +  D G R + +
Sbjct  1082  AARGNPGLATAGGVVRDEYGTWRGGFAINIGICSAPLAELWGVYYGLCIAWDRGFRRVEV  1141

Query  184   ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             E DS+ +V  L+ G  D H L+ + RLC         ++F H+YRE N LAD LA+ AFS
Sbjct  1142  EVDSECVVGFLQTGIQDSHPLSFLVRLCYGFISRDWLVKFSHVYREANHLADGLANYAFS  1201



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +1

Query  4     CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
              SR N G AT GGV+RD NG W  GF   IG C+  +AE WGV  G  +  + G+R L +
Sbjct  1681  ASRGNPGLATAGGVMRDENGEWQGGFAVNIGICSATLAELWGVYYGFVIAWENGIRRLEV  1740

Query  184   ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             E DS  +V  L+ G  D H L+ + RLC         ++  H+YRE N LAD LA+ AFS
Sbjct  1741  EVDSATVVGFLKTGIHDAHPLSFLVRLCYGFISRDWLVKISHVYREANCLADGLANYAFS  1800



>gb|AAD21515.1| putative reverse transcriptase [Arabidopsis thaliana]
 gb|AAM15081.1| putative reverse transcriptase [Arabidopsis thaliana]
Length=314

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 70/123 (57%), Gaps = 8/123 (7%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GGVLRD  G W  GF   IG C+  +AE WGV  GL +  +  V  L +E
Sbjct  162  SRGNPGLASAGGVLRDEEGAWRGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIE  221

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPD----LRFVHIYREQNRLADKLADM  354
             DS+ +V  L+ G  + H L+ + RLC     DF      +R  H+YRE NRLAD LA+ 
Sbjct  222  VDSEIVVGFLKIGINEVHPLSFLVRLC----HDFISRDWRVRISHVYREANRLADGLANY  277

Query  355  AFS  363
            AFS
Sbjct  278  AFS  280



>gb|ABK28199.1| unknown [Arabidopsis thaliana]
Length=315

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 70/123 (57%), Gaps = 8/123 (7%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GGVLRD  G W  GF   IG C+  +AE WGV  GL +  +  V  L +E
Sbjct  162  SRGNPGLASAGGVLRDEEGAWRGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIE  221

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPD----LRFVHIYREQNRLADKLADM  354
             DS+ +V  L+ G  + H L+ + RLC     DF      +R  H+YRE NRLAD LA+ 
Sbjct  222  VDSEIVVGFLKIGINEVHPLSFLVRLC----HDFISRDWRVRISHVYREANRLADGLANY  277

Query  355  AFS  363
            AFS
Sbjct  278  AFS  280



>ref|XP_009144970.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=448

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 67/119 (56%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G AT GGVLRD  G W  GF   IG C+  +AE WGV  G+ +  + G R + LE
Sbjct  296  AKGNPGLATAGGVLRDEYGMWHGGFALNIGICSARMAELWGVYYGMCIAWERGFRRVELE  355

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS+ +V  LR G  D H L+ + RLC         ++  H+YRE N LAD LA  AFS
Sbjct  356  VDSESVVGFLRTGINDSHPLSFLVRLCYGFISRDWIVKISHVYREANHLADGLATYAFS  414



>ref|XP_009107896.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=416

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G A+ GGVLRD NG W  GF   IGRC+  +A+ WGV  GL +  +  +  L +
Sbjct  263  ASHGNPGLASVGGVLRDGNGEWYGGFALNIGRCSAPLADLWGVYYGLVIAWENNISRLEV  322

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DSK +V  L  G  D H L+ +  LC         +R VH+YRE NRLAD LA++A S
Sbjct  323  EVDSKMVVGFLSAGIEDTHPLSFLVCLCHGFLTRDWLVRIVHVYREANRLADGLANLAIS  382



>ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=782

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 68/119 (57%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  N G  T GGVLR+  G W  GF   I RC   +AE W V  G  +  + G+R L LE
Sbjct  630  SHGNPGPETAGGVLRNGEGEWCGGFALNIERCGALLAELWRVYYGFVVAWEKGIRRLELE  689

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS+ +VE L  G GD H L+ + R+C    +    +  VH+YRE NRLAD LA++AFS
Sbjct  690  VDSQVVVEFLTTGIGDTHSLSFLVRMCHGLLKKDWLVHIVHVYREANRLADCLANLAFS  748



>gb|AAD14501.1| Hypothetical protein [Arabidopsis thaliana]
Length=158

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +1

Query  40   GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALR  219
            G LRD  G W   F   +GRCT  +AE WGV  GL +  + G+  L LE DSK +   L 
Sbjct  17   GALRDEYGDWRGSFALNLGRCTAPLAELWGVYYGLVIAWEKGITRLELEVDSKLVAGFLT  76

Query  220  QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             G  D HLL+ + RLC   +     +R  H+YRE NR AD+LA+ AFS
Sbjct  77   TGIEDSHLLSFLVRLCYGFSSKDWIVRVSHVYREANRFADELANYAFS  124



>gb|ABE65396.1| hypothetical protein At1g26950 [Arabidopsis thaliana]
Length=162

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +1

Query  40   GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALR  219
            G LRD  G W   F   +GRCT  +AE WGV  GL +  + G+  L LE DSK +   L 
Sbjct  21   GALRDEYGDWRGSFALNLGRCTAPLAELWGVYYGLVIAWEKGITRLELEVDSKLVAGFLT  80

Query  220  QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             G  D HLL+ + RLC   +     +R  H+YRE NR AD+LA+ AFS
Sbjct  81   TGIEDSHLLSFLVRLCYGFSSKDWIVRVSHVYREANRFADELANYAFS  128



>gb|ABK28138.1| unknown [Arabidopsis thaliana]
Length=163

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +1

Query  40   GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALR  219
            G LRD  G W   F   +GRCT  +AE WGV  GL +  + G+  L LE DSK +   L 
Sbjct  21   GALRDEYGDWRGSFALNLGRCTAPLAELWGVYYGLVIAWEKGITRLELEVDSKLVAGFLT  80

Query  220  QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             G  D HLL+ + RLC   +     +R  H+YRE NR AD+LA+ AFS
Sbjct  81   TGIEDSHLLSFLVRLCYGFSSKDWIVRVSHVYREANRFADELANYAFS  128



>ref|XP_010484806.1| PREDICTED: uncharacterized protein LOC104763089 [Camelina sativa]
Length=1130

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 67/119 (56%), Gaps = 0/119 (0%)
 Frame = +1

Query  4     CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
              S  N G AT GGVLRDS+G W+ GF + IG CT  +AE WGV  GL    + G+  + L
Sbjct  977   ASHGNPGLATAGGVLRDSDGAWIGGFAFNIGICTAPLAELWGVYYGLYTAWEKGITRVEL  1036

Query  184   ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             E DS+ +V  L     D H L+ + RLC         +R  H+YRE NRLAD LA+ A 
Sbjct  1037  EVDSELVVGFLTTVIEDSHPLSFLVRLCYDFISRDWIVRIGHMYREANRLADGLANYAL  1095



>ref|XP_010501912.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104779243 
[Camelina sativa]
Length=1023

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 71/124 (57%), Gaps = 8/124 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N   AT GGVLRD+ G+W+ G+   IG CT  +AE WGV   LR+  +  VR L L
Sbjct  648  ASRGNPRLATAGGVLRDNIGSWVCGYALHIGICTAALAELWGVYYCLRIAWERRVRRLEL  707

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPD----LRFVHIYREQNRLADKLAD  351
            E DSK +V+ L  G  + H L+ + RLC     DF      +R  H YR+ NRLAD L +
Sbjct  708  EVDSKEVVDFLVTGISEAHPLSFLVRLC----HDFISRDWIVRVTHTYRKANRLADGLTN  763

Query  352  MAFS  363
             AFS
Sbjct  764  YAFS  767



>dbj|BAB09192.1| non-LTR retroelement reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=308

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 65/117 (56%), Gaps = 0/117 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GGVLRD  G W  GF   IGRC+   AE WGV  GL    +  V  + LE
Sbjct  156  SRGNPGLASAGGVLRDCEGAWCGGFSLNIGRCSAQHAELWGVYYGLYFAWEKKVPRVELE  215

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
             DS+ +V  L+ G  D H L+ + RLC    +    +R V++YRE N LAD LA+  
Sbjct  216  VDSEAIVGFLKTGISDSHPLSFLVRLCHNFLQKDWLVRIVYVYREANCLADGLANYT  272



>gb|ABE65462.1| hypothetical protein At2g27870 [Arabidopsis thaliana]
Length=314

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 69/123 (56%), Gaps = 8/123 (7%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GGVLRD  G W  GF   IG C+  +AE WGV  GL +  +  V  L +E
Sbjct  162  SRGNPGLASAGGVLRDEEGAWRGGFALNIGVCSAPLAELWGVYYGLYIAWERRVTRLEIE  221

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPD----LRFVHIYREQNRLADKLADM  354
             DS+ +V  L+    + H L+ + RLC     DF      +R  H+YRE NRLAD LA+ 
Sbjct  222  VDSEIVVGFLKIXINEVHPLSFLVRLC----HDFISRDWRVRISHVYREANRLADGLANY  277

Query  355  AFS  363
            AFS
Sbjct  278  AFS  280



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 64/120 (53%), Gaps = 0/120 (0%)
 Frame = +1

Query  4     CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
              SR N G A  GG +R+  G WL GF   IG C   +AE WG   GL +  D G R + L
Sbjct  1078  ASRGNHGLAAAGGAIRNGQGEWLGGFALNIGSCAAPLAELWGAYYGLLIAWDKGFRRVEL  1137

Query  184   ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             + D K +V  L  G  + H L+ + RLC         +R  H+YRE NRLAD LA+ AF+
Sbjct  1138  DLDCKLVVGFLSTGVSNAHPLSFLVRLCQGFFTRDWLVRVSHVYREANRLADGLANYAFT  1197



>ref|XP_002514383.1| nuclease, putative [Ricinus communis]
 gb|EEF47979.1| nuclease, putative [Ricinus communis]
Length=145

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 67/119 (56%), Gaps = 0/119 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S+    +A  GG++RDSNG W+ GF   IG C    AE W  LQG+ +    G+  L++E
Sbjct  12   SKDYGAKARGGGIIRDSNGCWVGGFVIHIGACDPVGAELWAFLQGISLAWSKGIHNLIVE  71

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             DS  + + + +      +  N+   C+   +++ D++  H++RE N++AD LA++ F+
Sbjct  72   VDSSLVADWMNKKSVCKSIHANLVSACLDLLQNWWDVKIKHVFREMNQVADSLANIVFA  130



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+ N G AT GG+LR  +G+W+ GF   IG C+  +AE W V  GL +  +  +  L +
Sbjct  641  ASKGNPGLATAGGILRQQDGSWIGGFAVNIGICSAPLAELWRVYYGLYIAWERKITRLEV  700

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS+ +V  L     D H L+ + RLC         +R  H+YRE NRLAD LA+ A S
Sbjct  701  EVDSELVVGFLTTWISDSHPLSFLVRLCYGFISRDWIVRISHVYREANRLADGLANYASS  760



>gb|AAG12669.1|AC027033_4 hypothetical protein; 81517-79153 [Arabidopsis thaliana]
Length=256

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = +1

Query  49   RDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGD  228
            R+  G W  GF   IG C+   AE WGV  GL +  +  V  + LE DS+ +V  L+ G 
Sbjct  37   REHQGNWCGGFSVSIGICSAPQAELWGVYYGLYIAWEKWVTRVELEVDSEIVVGFLKTGI  96

Query  229  GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            GD H L+ +ARLC         +R  H+YRE NRLAD LA+ AF+
Sbjct  97   GDSHPLSFLARLCYGFISKDWIVRISHVYREANRLADGLANYAFT  141



>ref|XP_007042183.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX98014.1| Ribonuclease H protein [Theobroma cacao]
Length=528

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/164 (34%), Positives = 90/164 (55%), Gaps = 8/164 (5%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            +R+  +A+ GGV R++ G W  GF  K+G+C+   AE WG+L GLR+  D G + + ++ 
Sbjct  266  KRSIEEASAGGVKRNAEGDWQAGFVAKLGKCSAYRAELWGILHGLRLAWDSGFKKVQVQV  325

Query  190  DSKPLVEALRQGD----GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            D+K +V+A+         +  L++ I  +  +E E    + F+H YRE N +AD LA  A
Sbjct  326  DNKMVVQAISTDKLIPGANTDLISAIKNVLQKEWE----VSFMHTYREGNMVADYLASYA  381

Query  358  FSQQEDHIlletppleteellALDRVGAASTRRVCRQ*AAALSC  489
            F  +E +++LE  P    +LL  D +G  +     R  AA+  C
Sbjct  382  FVLEESYVVLEQAPTGARKLLIYDMLGTMTNASQLRPAAASPPC  425



>ref|XP_008226028.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=294

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 8/121 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            C +  DG+   GGVLRDS+G W+RGF   +G      AE WG+  GL++  D G   +VL
Sbjct  142  CRKGEDGRIAVGGVLRDSSGQWMRGFAVNLGVGQVLEAELWGIYPGLKLAWDIGCSAVVL  201

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFV----HIYREQNRLADKLAD  351
            E DS   V  L +   D H L  +   C    +D+ +  +V    H+YRE N +ADKL +
Sbjct  202  ESDSATAVHLLNKNVEDLHPLATMLWGC----KDYINKNWVCSIHHVYRECNMVADKLVE  257

Query  352  M  354
            +
Sbjct  258  L  258



>gb|AAF69156.1|AC007915_8 F27F5.12 [Arabidopsis thaliana]
Length=205

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 12/118 (10%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
             +N    T GG++RD+ G+W  GF   IG C+  +AE WGV  GL +  +  +  L +E 
Sbjct  67   HKNPVLTTAGGLIRDATGSWCGGFALNIGVCSAPLAELWGVYYGLYLTWERHITRLEVEV  126

Query  190  DSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            DS+ +V  L +G  D H L+            F  +   H+YRE NRLAD+L + AF+
Sbjct  127  DSELVVGFLSKGISDSHPLS------------FVIVWTSHVYREANRLADELENYAFT  172



>ref|XP_008227731.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=322

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 65/121 (54%), Gaps = 8/121 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            C +  DG+   GGVLRDS   W+RGF   +G      AE WG+  GL++  D G  P+VL
Sbjct  170  CRKGEDGRIAAGGVLRDSYRQWMRGFVVNLGVKQVLEAELWGIYLGLKIAWDIGCSPVVL  229

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFV----HIYREQNRLADKLAD  351
            E DS   V  L +   D H L  +   C    +D+ +  +V    H+YRE N +ADKLA+
Sbjct  230  ESDSATAVHLLNKNVEDFHPLATMLWGC----QDYINKNWVCSIHHVYRECNMVADKLAE  285

Query  352  M  354
            +
Sbjct  286  L  286



>ref|YP_006666138.1| RnaseH (mitochondrion) [Malus domestica]
 emb|CBX33402.1| rnaseH (mitochondrion) [Malus domestica]
Length=153

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 72/149 (48%), Gaps = 0/149 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
             G    GG+LRD+NG W+ GF   +G+     AE WG+  GLR+    G R + +E DS 
Sbjct  5    SGSIGAGGLLRDNNGNWISGFTANLGKGKIIAAELWGLFFGLRLAWMRGFRSVEVEVDSA  64

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDH  378
             +V  + Q D   H L+ + R C    +     +  HIYRE+N  AD LA +  +    +
Sbjct  65   TVVTLVNQQDNSLHPLHTLIRGCQAYLKMDWHCKLSHIYREKNFSADYLASIGLTYDLGY  124

Query  379  IlletppleteellALDRVGAASTRRVCR  465
               ++PP      L  D +G A  R V R
Sbjct  125  FESQSPPPGCIPFLFEDSLGYARPREVIR  153



>ref|XP_007212728.1| hypothetical protein PRUPE_ppa019009mg, partial [Prunus persica]
 gb|EMJ13927.1| hypothetical protein PRUPE_ppa019009mg, partial [Prunus persica]
Length=259

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 64/121 (53%), Gaps = 8/121 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            C +  DG+   G VLRDS+G W+RGF   +G      AE WG+  GL++  D G   +VL
Sbjct  48   CRKGEDGRNAAGSVLRDSSGQWMRGFAVNLGVGQVLEAELWGIYLGLKIAWDIGCSAVVL  107

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFV----HIYREQNRLADKLAD  351
            E DS   V  L +   D H L  +   C    +D+ +  +V    H+YRE N L DKLA+
Sbjct  108  ESDSTTAVHLLHKNVEDLHPLVAMLWGC----QDYINKNWVCSIHHVYRECNMLVDKLAE  163

Query  352  M  354
            +
Sbjct  164  L  164



>ref|XP_008344356.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=348

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
               + GG++R+S G W+ GF   +GR T   AE WGVL GL +  D G R ++LECDS  
Sbjct  201  SHISAGGLIRNSEGDWIXGFAANLGRGTXMEAELWGVLMGLTIAWDEGCRDVILECDSWD  260

Query  202  LVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             V ++++     H L N+   C    E        HIYRE+N  AD +AD+
Sbjct  261  AVISIQKPMLVSHPLYNLILDCKEAIERNWRCEVTHIYREKNASADHMADL  311



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/109 (39%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = +1

Query  31    TCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVE  210
             + GG++R+S G W++GF   +GR T   AE WGV  GL +  D G R ++LECDS   V 
Sbjct  1221  SAGGLIRNSEGDWIKGFAANLGRGTIMEAELWGVFMGLSIAWDEGCRDVILECDSWDAVT  1280

Query  211   ALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
              +++   D H L N+   C             HIYRE N  AD +AD+ 
Sbjct  1281  LIQKPILDSHPLYNLIIDCKEAIGKNWRCEVTHIYREMNASADHMADLG  1329



>ref|XP_006492639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=569

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 8/125 (6%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D +    G +T  G++RD  G WL GFG  IG C+  VAE WG+ QGL++  + G+R L 
Sbjct  350  DGAHNRGGTSTAWGLIRDHMGRWLSGFGMMIGSCSITVAELWGLYQGLQLAWNSGIRKLQ  409

Query  181  LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRF----VHIYREQNRLADKLA  348
            +E DS  +++ + +   +   +N+ A L I+  +D+  + +     HIYRE N  AD +A
Sbjct  410  VEIDSLCVLQLVTKPSLE---INHYAPL-IQAIKDYLKMDWQVSISHIYREANFAADYMA  465

Query  349  DMAFS  363
            ++AFS
Sbjct  466  NLAFS  470



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = +1

Query  31    TCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVE  210
             + GG++R+S G W+ GF   +GR T   AE WGVL GL +  D G R ++LECDS   V 
Sbjct  1289  SAGGLIRNSEGDWIXGFAANLGRGTXMEAELWGVLMGLTIAWDEGXRDVILECDSWDAVI  1348

Query  211   ALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
             ++++     H L N+   C    E        HIYRE+N  AD +AD+ 
Sbjct  1349  SIQKPMLVSHPLYNLILDCKEAIERNWRCEVTHIYREKNASADHMADLG  1397



>gb|AAC26674.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=970

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 47/118 (40%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR + G A   G + +  G WL GF   IG C   +AE WG   GL +  D G R + L 
Sbjct  818  SRGHQGLAAASGAILNLQGEWLGGFALNIGSCDAPLAELWGAYYGLLIAWDKGFRRVELN  877

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             DS+ +V  L  G    H L+ + RLC         +R  H+YRE NRLAD LA+ AF
Sbjct  878  LDSELVVGFLSTGISKAHPLSFLVRLCQGFFTRDWLVRVSHVYREANRLADGLANYAF  935



>ref|XP_006490009.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=171

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D + +  G A  GG+LRD NG WL GF   +G C+   AE WG+L GL++  DYG R L 
Sbjct  17   DGAMKRFGYAGAGGLLRDYNGNWLMGFTVNLGMCSVLSAELWGLLHGLKVAWDYGFRHLQ  76

Query  181  LECDSKPLVEALRQGDGDGHLLNNIARLCIRE--AEDFPDLRFVHIYREQNRLADKLADM  354
            +  D+K +V  L +     +  N I    IRE  A D+  +   H+YR+ N  AD LA  
Sbjct  77   VGVDNKNVVLLLERAHPPAN-ENAILVKTIRELLARDW-IVHMEHVYRKANSAADFLASY  134

Query  355  AFSQQ  369
            + ++ 
Sbjct  135  SLTKP  139



>ref|XP_007208821.1| hypothetical protein PRUPE_ppa025050mg [Prunus persica]
 gb|EMJ10020.1| hypothetical protein PRUPE_ppa025050mg [Prunus persica]
Length=241

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            +    + T GG+LRDS+G+W+ GF   IG       E W +L+GL+M  + G+R L +EC
Sbjct  92   KTTSWKITTGGLLRDSHGSWICGFSVNIGIGNIAKGELWSLLKGLQMAWNRGIRSLDVEC  151

Query  190  DSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
            D   +V  + +     H L  +   C          +  H+YREQNR AD LA++ +
Sbjct  152  DFLYVVSLMAKVSDQSHPLLCLIEDCKSLLNRDWSCKISHVYREQNRTADHLANLGY  208



>ref|XP_008221720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=228

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = +1

Query  1    DCSRRND-GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR N  G    GG+LRDS G+W++GF   +G  +   AE WG+  GL M  D G R +
Sbjct  73   DGSRINSSGLIGAGGLLRDSCGSWIKGFSVNLGYGSIIEAELWGIFWGLNMAWDAGFRTV  132

Query  178  VLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
             +ECD+   V  L+      H L +I   C  +  +       HI+REQN   D LA
Sbjct  133  EIECDANSAVALLKSPIVSTHPLFSIINCCKMKIHEDWSCSVKHIFREQNCAVDALA  189



>ref|XP_007020729.1| Non-LTR retroelement reverse transcriptase-like, putative [Theobroma 
cacao]
 gb|EOY12254.1| Non-LTR retroelement reverse transcriptase-like, putative [Theobroma 
cacao]
Length=173

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 8/128 (6%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            RRN      GGV RD NG WL  F  K+G+C++   E W VL  LR+ K+ G   + L+ 
Sbjct  22   RRNTNMVATGGVFRDYNGYWLGRFAAKLGKCSSYRVELWIVLHSLRIAKEKGFSRIWLQV  81

Query  190  DSKPLVEALRQGD----GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
             +K +V+ +         +  LLN I  L   + E    ++  HIYR++N +AD + +++
Sbjct  82   YNKIVVQVITSSALHPCANSDLLNTIHGLLQLDWE----VKISHIYRKRNMVADGMVNIS  137

Query  358  FSQQEDHI  381
            F+     I
Sbjct  138  FNLDSSFI  145



>ref|XP_004306073.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=187

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL  216
            GGV+R+  G W+ GF   +G C    AEAW +  GL++     +  L +E DS  LV+ +
Sbjct  25   GGVIRNHAGAWIAGFQINLGVCAILDAEAWALFHGLKLASKLHISCLEIESDSAILVQLM  84

Query  217  RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQ  369
               +   H L ++   C     +  D++  HI+RE N  AD LA  + S +
Sbjct  85   NCSNLSSHPLGSLLGGCSSMMTEMDDVKLFHIFREANMTADSLAKCSISNE  135



>ref|XP_006582499.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=196

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 8/121 (7%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N  +A+CGGVLR+  G W+ GF   IG      AE WG+   L +    G R +++ECDS
Sbjct  42   NGSKASCGGVLRNCFGAWISGFLRNIGTTYVLSAELWGIFSTLDISWRVGHRRVLVECDS  101

Query  196  KPLVEALRQGDGDGH----LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            K   + + +G    H    L+++I R   R       LR  H+YR++N +AD LA +A S
Sbjct  102  KVTAKLMSKGCLSSHPYSPLIHSIQRFFSRSWV----LRVNHVYRKRNAVADSLAALAHS  157

Query  364  Q  366
            +
Sbjct  158  K  158



>ref|XP_002530315.1| nuclease, putative [Ricinus communis]
 gb|EEF32082.1| nuclease, putative [Ricinus communis]
Length=219

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 81/159 (51%), Gaps = 12/159 (8%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRC-TTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +++ G AT  G+ R+ NG W  GF  K+  C +  VAE +G+L GL +  + G R ++LE
Sbjct  63   KKSSGIATAAGLFRNCNGQWCGGFAIKLRDCYSAFVAELFGILNGLNIAWNAGFRNIILE  122

Query  187  CDSKPLVEAL-------RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKL  345
             D+K  V+ +       R GD +  L+ +I  +  +E     +++  H YRE NR+AD L
Sbjct  123  TDNKTSVDKIYGDSDTKRMGDLEDLLITSIKEMLTKEW----NIKLQHQYREGNRVADAL  178

Query  346  ADMAFSQQEDHIlletppleteellALDRVGAASTRRVC  462
            A+ A       I+    P E+   L ++ +      R+C
Sbjct  179  ANFAVDFSPGQIVALHYPPESTISLLMEDIWGMKFPRIC  217



>ref|XP_007221764.1| hypothetical protein PRUPE_ppb024359mg [Prunus persica]
 gb|EMJ22963.1| hypothetical protein PRUPE_ppb024359mg [Prunus persica]
Length=222

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
            DG+   GGVLRDS G W+RGF   +G      A+ WG+  GL++  D G   +VLE DS 
Sbjct  75   DGRIAAGGVLRDSYGQWMRGFAVNLGVGQVLEAKLWGIYLGLKITWDIGCSAVVLEYDSA  134

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
              V  L +   D H L  +   C             H+YRE N +A+KLA+++
Sbjct  135  TAVHLLNKNVEDFHPLATMLWGCQAYINKNWVCSIHHVYRECNMVANKLAELS  187



>ref|NP_680382.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AED94885.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=258

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GGVLRD  G W  GF   IGRC+   AE WGV  GL    +  V  + LE
Sbjct  156  SRGNPGLASAGGVLRDCEGAWCGGFSLNIGRCSAQHAELWGVYYGLYFAWEKKVPRVELE  215

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLC  267
             DS+ +V  L+ G  D H L+ + RLC
Sbjct  216  VDSEAIVGFLKTGISDSHPLSFLVRLC  242



>ref|XP_004293144.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=321

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR   G    GG++RDS+G W  GF   IG      AEAWG+  G+++     +  L 
Sbjct  163  DGSRTRAGDIGAGGIIRDSSGCWCGGFMVNIGAGEVLQAEAWGLFYGIQLAFSMKIPKLE  222

Query  181  LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            +E DS  LV  L+  D D H L  I   C    + F  ++  HI++E+N +AD LA
Sbjct  223  IESDSVVLVNLLQNSDMDVHPLGTIVLNCRAMMQHFDFVQIKHIHKERNMVADLLA  278



>ref|XP_010474216.1| PREDICTED: serine/threonine-protein kinase STN7, chloroplastic-like 
[Camelina sativa]
Length=795

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 57/119 (48%), Gaps = 23/119 (19%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GGV+R + G W RGF   IG C+  +AE WGV  GL +            
Sbjct  120  SRGNSGLASAGGVMRSNTGDWCRGFALNIGICSAPLAELWGVYYGLVLT-----------  168

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
                        G  D H L+ + RLC         +R  H++RE NRLAD+LA+ A S
Sbjct  169  ------------GISDSHPLSFLMRLCYSFLAKNWIIRIFHVHREANRLADELANYALS  215



>ref|XP_004305448.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=171

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
             G+   GGV+R+  GTW+ GF   +G      AEAWG+  GL++V    +  L +E DS 
Sbjct  19   SGKIGAGGVIRNHAGTWIIGFQINLGVGEILTAEAWGLFYGLKLVVKLQISNLEVESDSA  78

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
             LV  ++  +   H L ++   C +      + +  HI+RE N  AD LA  + S 
Sbjct  79   ILVNLMQSSNLALHPLGSLLDGCCKLMSRMENAKLSHIFRESNMTADALAKSSISH  134



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = +1

Query  28    ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
             A+ GG+LR+ NG W+ G+   IG   + +AE WG+ +GL + K+ G   L+ E DS+ +V
Sbjct  1223  ASAGGLLRNENGLWVAGYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVV  1282

Query  208   EALRQGDG----DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQED  375
             + LR+ DG    D  +L    +L +   + F +++  HI RE N+ AD LA++  S    
Sbjct  1283  QVLRK-DGPVTPDASILVKDCKLLL---DHFQEIKVTHILREGNQCADFLANLGQSSSWG  1338

Query  376   HIlletppleteellALDRVGAASTRR  456
               +LE PP +    L  D +G AS+RR
Sbjct  1339  TTILERPPDDLRIFLQRDAIGLASSRR  1365



>ref|XP_006605148.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
 gb|KHN22754.1| Putative ribonuclease H protein [Glycine soja]
Length=121

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = +1

Query  43   VLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALR-  219
            ++ D +G W+ GF   IGR +T VAE WGV QGL++    G   ++L+ DSK ++ A+R 
Sbjct  8    LIWDHDGRWIYGFQKYIGRSSTFVAELWGVFQGLKLAILKGFTRILLQVDSKAVILAIRS  67

Query  220  --QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
              +G   G  L    +  IR    F   +  H+Y+E NR  DKLA+
Sbjct  68   GNEGSASGWRLIQAIQKFIRMVNQF---QINHMYKETNRCVDKLAN  110



>ref|XP_004299997.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (53%), Gaps = 0/117 (0%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            + G+   GGVLRD  G W+ G    +G      AEAWG+L GL++V  +    L +E DS
Sbjct  295  SSGKIGAGGVLRDHAGNWIFGCQINLGVGEVLYAEAWGLLFGLKLVAKFYCSDLEVESDS  354

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
              LV+ +++   + H L ++   C       P+++  HI+RE N +AD LA  + + 
Sbjct  355  AVLVQLMQKRSFELHPLGSLLSACSSFMSKMPNVKLSHIFRECNMVADSLAKCSITH  411



>ref|XP_009148725.1| PREDICTED: uncharacterized protein LOC103872128 [Brassica rapa]
Length=760

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G A  GG LR+  G W  GF   IG CT  +AE WGV  GL +  + GVR L +
Sbjct  151  ASHGNPGPAAAGGALRNGEGEWCGGFAINIGSCTAPLAELWGVYYGLVVAWEKGVRRLEV  210

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLC  267
            E DS  ++E L  G GD H L+ + RLC
Sbjct  211  EVDSMMVMEFLTIGIGDTHPLSFLVRLC  238



>ref|XP_004292485.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=207

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 58/117 (50%), Gaps = 1/117 (1%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            + G    GGV+R+ +  W+ GF   +G    D AEAWG+  GL++  +  +  L +E DS
Sbjct  55   SSGMIGAGGVIRNHSDAWITGFQINLGVGAID-AEAWGLFHGLKLASNLHISKLEIESDS  113

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
              LV  ++  +   H L ++   C        D++  H++RE N  AD LA  + S 
Sbjct  114  AILVHLMKSANLSLHPLGSLLNGCKSMMSQMDDVKLSHVFRESNMTADVLAKCSISN  170



>ref|XP_008244240.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=172

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 57/117 (49%), Gaps = 21/117 (18%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            C +  DG+   GGVL DS+G W+RGF   +G      AE WG+  GL++  D G   +VL
Sbjct  41   CIKGEDGRIAAGGVLWDSSGQWMRGFAVNLGVGQVLEAELWGIYLGLKLAWDIGCSAVVL  100

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            E DS   V          HLLN      I            H+YRE N +ADKLA++
Sbjct  101  ESDSATAV----------HLLNKNWVCSIH-----------HVYRECNMVADKLAEL  136



>gb|KHN06921.1| Heat shock 70 kDa protein [Glycine soja]
Length=778

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 8/126 (6%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            R     + CGG++RDS+G +L GF   IG     +AE WGV+ GL++  D G + + ++ 
Sbjct  626  RNGSTGSACGGLVRDSSGCFLGGFTVNIGITAVTLAELWGVVHGLKLAWDLGCKKVKVDI  685

Query  190  DSKPLVEALRQG----DGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            DS   +  +R G    D    L++ I  L  +E      + F H++RE NR ADKLA + 
Sbjct  686  DSGHALGLIRHGPVAKDPAFALVSEINELVRKEWL----VEFSHVFRESNRAADKLAHLG  741

Query  358  FSQQED  375
             S   +
Sbjct  742  HSHSSE  747



>ref|XP_007031938.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOY02864.1| Ribonuclease H protein [Theobroma cacao]
Length=660

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 84/160 (53%), Gaps = 8/160 (5%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            +  +R+  +A+ GGV+R++ G W   F  K+G+C+   AE WGVL GLR+  D G + + 
Sbjct  505  EAYKRSIEEASTGGVIRNAEGDWQAEFLAKLGKCSAYRAELWGVLHGLRLAWDSGFKKVQ  564

Query  181  LECDSKPLVEALRQGD----GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            ++ D+K +V A+         +  L+  I  +  +E E    + F+H Y E N + D LA
Sbjct  565  VQVDNKMVVPAVSTNKLIPGANTDLIRAIKDVLQKEWE----VSFMHTYCEGNMVTDYLA  620

Query  349  DMAFSQQEDHIlletppleteellALDRVGAASTRRVCRQ  468
              AF  ++ +I+LE  P    +LL  D +G    R +  Q
Sbjct  621  SYAFVLEKSYIVLEQAPTGARKLLMYDMLGVCLPRMIPIQ  660



>ref|XP_007031579.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007031580.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02505.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02506.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
Length=344

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (54%), Gaps = 0/125 (0%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  + G+A  GG++R+  G W  G+  K+G+ T+  AE WG+  GL++    G+  ++++
Sbjct  79   SAADPGKAGAGGIIRNDQGEWNVGYSRKLGQATSTCAEHWGLRDGLQLAVKRGLFDVIIK  138

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
             D + +++ + +   D H L  I + C    E  P+ RF  I R+ N  AD LA M  + 
Sbjct  139  VDLQVVLDLICKEAVDSHTLGPIIKECRSLLEQIPNHRFCQINRDSNCCADHLARMGATM  198

Query  367  QEDHI  381
             +D +
Sbjct  199  TKDFV  203



>ref|XP_007048772.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX92929.1| Ribonuclease H protein [Theobroma cacao]
Length=148

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            RRN      GGVLRD NG WL GF  K+G+C++  AE WGVL  LR+ K+ G   + L  
Sbjct  56   RRNTNMVAAGGVLRDYNGYWLGGFAVKLGKCSSHRAELWGVLHSLRIAKEKGFCRIWLHV  115

Query  190  DSKPLVEAL  216
            D+K +V+A+
Sbjct  116  DNKIVVQAI  124



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 6/146 (4%)
 Frame = +1

Query  28    ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
             A+ GG+LR+ NG W+ G+   IG   + +AE WG+ +GL + K+ G   L+ E DS+ +V
Sbjct  1755  ASAGGLLRNENGLWVAGYTCNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVV  1814

Query  208   EALRQGDGDGHLLNNIARL---CIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDH  378
             + LR+   DG +  + + L   C    + F +++  HI RE N+ AD LA++  S     
Sbjct  1815  QVLRK---DGPVTPDASILVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGT  1871

Query  379   IlletppleteellALDRVGAASTRR  456
              +LE PP +    L  D +G AS+RR
Sbjct  1872  TILERPPDDLRIFLQRDAIGLASSRR  1897



>ref|XP_008237302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=394

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    DCSRR-NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR+   G    GGVLRD +G W  GF   +G+     AE WG+  GLRM    G   L
Sbjct  237  DGSRKVASGHIGAGGVLRDVSGDWCSGFAINLGKGQILEAELWGLFFGLRMAIAKGFNNL  296

Query  178  VLECDSKPLVEALRQGDG-DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            ++E DS   ++ ++Q D    H L ++   C +  +        HI+RE+N +AD+LA  
Sbjct  297  IVEMDSAVAIQLVQQHDSLTVHPLASLVSSCWQLMQQLEKCSMRHIFREKNSVADRLAAW  356

Query  355  AFS  363
            +++
Sbjct  357  SYN  359



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 6/146 (4%)
 Frame = +1

Query  28    ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
             A+ GG+LR+ NG W+ G+   IG   + +AE WG+ +GL + K+ G   L+ E DS+ +V
Sbjct  1223  ASAGGLLRNENGLWVAGYICNIGTANSFLAELWGLREGLLLAKNRGFTKLIAETDSEAVV  1282

Query  208   EALRQGDGDGHLLNNIARL---CIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDH  378
             + LR+   DG +  + + L   C    + F +++  HI RE N+ AD LA++  S     
Sbjct  1283  QVLRK---DGPVTPDASILVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGT  1339

Query  379   IlletppleteellALDRVGAASTRR  456
              +LE PP +    L  D +G AS+RR
Sbjct  1340  TILERPPDDLRIFLQRDAIGLASSRR  1365



>ref|XP_004289446.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=176

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL  216
            GGVLRD  G W+ GF   +G      AEAWG+  GLRMV  + +  L +E +   LV+ +
Sbjct  30   GGVLRDHLGIWIDGFQVNLGTSEVLDAEAWGLFFGLRMVAMHNIVNLEIESNYAVLVQLM  89

Query  217  RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
             + D   H L ++   C        ++   HI+RE N +AD LA
Sbjct  90   LKSDTGVHPLGSLLDSCSVMMSKLLNVNIKHIFRECNMVADALA  133



>gb|KHN47376.1| Heat shock 70 kDa protein [Glycine soja]
Length=793

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = +1

Query  28   ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
            + CGG++RDS+G +L GF   +G  +  +AE WGV+ GL++  D G + + ++ DS   +
Sbjct  647  SACGGLVRDSSGCYLGGFTVNLGNTSVTLAELWGVVHGLKLAWDLGCKKVKVDIDSGNAL  706

Query  208  EALRQG----DGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQ  369
              +R G    D    L++ I  L  +E      + F H++RE NR ADKLA +  S  
Sbjct  707  GLVRHGPVANDPAFALVSEINELVRKEWL----VEFSHVFRESNRAADKLAHLGHSHS  760



>ref|XP_008224410.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=232

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 1/150 (1%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            ++G    GGV+R+S G W+ GF   +G+      E WG+  GL++  + G+  LV+E DS
Sbjct  79   SNGAIGAGGVIRNSLGDWVTGFTVNLGKGQILDVEIWGLFFGLKLAAERGISNLVVEMDS  138

Query  196  KPLVEALRQGDGDG-HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQE  372
               V  L++ +    H L  +   C +  E   +    H+YR+QN +AD LA  +++   
Sbjct  139  ATAVHLLQRSETPSFHPLAGVLSDCRKFVEQLGNCGVNHVYRDQNCVADSLAQASYNGDL  198

Query  373  DHIlletppleteellALDRVGAASTRRVC  462
                L++ P     LLA D +G + TR +C
Sbjct  199  GVWPLDSAPAWIGTLLADDVMGVSKTRWIC  228



>gb|AFK45241.1| unknown [Lotus japonicus]
Length=165

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 0/107 (0%)
 Frame = +1

Query  28   ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
            A CGGV RD +G +L GF  K+G C+   AE WG++ GLR V   G   +++E DS   +
Sbjct  52   AACGGVPRDHHGNFLLGFTMKVGVCSILHAELWGLVHGLRFVLGRGFSKILIEADSAGTI  111

Query  208  EALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            E L +G    H    + R           + + H+YRE N +AD  A
Sbjct  112  EFLNKGCPVVHPCFPLVREFHHLVGQNCYIHWKHVYREVNFVADSFA  158



>ref|XP_008357106.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=246

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 70/140 (50%), Gaps = 0/140 (0%)
 Frame = +1

Query  40   GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALR  219
            G++R+S G  ++GF   +GR T   AE WGV  GL +  D G + ++L+CDS   V  ++
Sbjct  105  GLIRNSEGDGIKGFAANLGRGTIMEAELWGVFMGLSIAWDEGCKDVILKCDSWDAVILIQ  164

Query  220  QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDHIlletpp  399
            +     H L N+   C +  E        HIYRE N  AD +AD+ +       +  +PP
Sbjct  165  KRILVSHPLYNLIIDCKKAIEKNWKCEVTHIYRENNASADHMADLGYGLSLGLHVFVSPP  224

Query  400  leteellALDRVGAASTRRV  459
              +   LA D +G A  R V
Sbjct  225  TTSTNFLASDSIGRALPRAV  244



>ref|XP_007216426.1| hypothetical protein PRUPE_ppa022108mg [Prunus persica]
 gb|EMJ17625.1| hypothetical protein PRUPE_ppa022108mg [Prunus persica]
Length=154

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +1

Query  46   LRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQG  225
            +RD+ G WL+G+   +G  +   AE WG+  GL +  ++G R + +E DSK  V  L   
Sbjct  15   IRDATGAWLKGYSVNLGIGSVLEAELWGIFWGLSLAWNFGFRTVEVESDSKVAVILLDSL  74

Query  226  DGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
                HLL NI   C  +  D  +    HI+R+QN   D LA  +F
Sbjct  75   TISTHLLFNIINCCKLKMGDDWNCSVRHIFRQQNCATDALAANSF  119



>ref|XP_008344200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=153

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 67/141 (48%), Gaps = 0/141 (0%)
 Frame = +1

Query  43   VLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQ  222
            +LRD+NG W+ GF   +G+     AE WG    LR+    G R + +E DS  +V  + Q
Sbjct  13   LLRDNNGNWIXGFXANLGKGKIIAAELWGXFFXLRLAWMRGFRSVEVEVDSATVVTLVNQ  72

Query  223  GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDHIlletppl  402
             D   H L+ + R C    +     +  HIYRE+N  AD LA +  +    +   ++PP 
Sbjct  73   QDNSLHPLHTLIRGCQAYLKMDWHCKLSHIYREKNFSADYLASIGLTYDLGYFESQSPPP  132

Query  403  eteellALDRVGAASTRRVCR  465
                 L  D +G A  R V R
Sbjct  133  GCIPFLFEDSLGYARPREVIR  153



>gb|KHN12872.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=151

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N G A  GG++RDS G W  GF    G  T+  AE   +L GL +  D G R +  E DS
Sbjct  12   NPGNAGFGGIIRDSFGDWHAGFYGSCGTATSLQAELLAILHGLNLSWDKGFRNIQCESDS  71

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFP----DLRFVHIYREQNRLADKLADMAFS  363
            K  ++ + +G    H   +I    I++ +DF     DL F H +RE N  AD+LA    S
Sbjct  72   KLALQLISEGRNSLHPYASI----IQKIQDFKLLHWDLHFNHTFREGNMCADELAKTGSS  127

Query  364  QQ  369
             Q
Sbjct  128  LQ  129



>ref|XP_007039529.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOY24030.1| Ribonuclease H protein [Theobroma cacao]
Length=148

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            R N  +A  GGVLRD NG WL G   K+G+C++  AE WGVL  LR+ KD G   + L+ 
Sbjct  56   RCNTNKAAAGGVLRDYNGYWLGGSAAKLGKCSSYRAELWGVLHSLRIAKDKGFHRIWLQV  115

Query  190  DSKPLVEAL  216
            D+K +V+A+
Sbjct  116  DNKIVVQAI  124



>gb|AAF79665.1|AC022314_6 F9C16.13 [Arabidopsis thaliana]
Length=1172

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 55/118 (47%), Gaps = 23/118 (19%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N   +T GGVLRD  G WL GF   IGR T  VAE W ++ G               
Sbjct  222  SRGNPALSTAGGVLRDREGEWLGGFSLNIGRRTAPVAELWALVVGF--------------  267

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
                     L+ G  + H L+ + RLC         +R  H+YRE NRLAD LA+ AF
Sbjct  268  ---------LKTGVSERHPLSFLVRLCHGFLSKDWIVRISHVYREANRLADGLANYAF  316



>ref|XP_007039838.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
 gb|EOY24339.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
Length=616

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            RRN   A  GGV RD N  WL GF  K+G+C +  AE WGVL  LR+VK+ G   + L+ 
Sbjct  524  RRNTNMAAAGGVFRDCNEYWLGGFAAKLGKCYSYRAELWGVLHSLRIVKEKGFSKIWLQV  583

Query  190  DSKPLVEAL  216
            D+K +V+A+
Sbjct  584  DNKIVVKAI  592



>ref|XP_002518868.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43401.1| conserved hypothetical protein [Ricinus communis]
Length=186

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 52/116 (45%), Gaps = 22/116 (19%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
             ++ G    GG++RD+NG W+ GF   I  C+   AE WGV QGL +    G+  L++E 
Sbjct  54   HQSSGHGYVGGLIRDTNGRWVAGFSINISLCSITCAELWGVYQGLMLANRLGIVNLMVEV  113

Query  190  DSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            DS                      + +    +       HIYRE NR AD+LA  A
Sbjct  114  DS----------------------MAVTTFAERMSTTVKHIYRETNRAADRLAAFA  147



>ref|XP_007147977.1| hypothetical protein PHAVU_006G170300g [Phaseolus vulgaris]
 gb|ESW19971.1| hypothetical protein PHAVU_006G170300g [Phaseolus vulgaris]
Length=793

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 13/128 (10%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            CSR      +CGG++RDS G +L GFG  +G  +  +AE WGV+ GLR+  D G + + +
Sbjct  644  CSR-----GSCGGLVRDSEGCFLGGFGVNLGSTSVTLAELWGVVHGLRLAWDLGCKKVKV  698

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPD----LRFVHIYREQNRLADKLAD  351
            + DS   +  +R       + ++ A   +RE  +       + F H++RE NR AD+LA 
Sbjct  699  DIDSGHALGLVRHCP----VGSDPAFAVVREINELVRKDWLVEFSHVFRESNRAADRLAH  754

Query  352  MAFSQQED  375
            +  S   D
Sbjct  755  LGHSHSLD  762



>gb|KHN28455.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=152

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
            +G A  GGVLRD+NG  +  F +KIGRC+   AE W ++ G+++ K  G    ++E DSK
Sbjct  16   NGNAGTGGVLRDNNGNVVVTFVFKIGRCSVTQAELWAIVLGIQVAKSRGFSESLVESDSK  75

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
              +  ++      H+   +  +  +   D     ++  Y E N++A+ L+    S 
Sbjct  76   LAISLIQHRCSPSHVCFQLVEMIRKFESDGGRFTWIPAYPEANQVAEILSKFGLSS  131



>ref|XP_004301145.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=411

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL  216
            GGVLRD  G W+ GF   +G      AEAWG+  GLRMV  + +  L +E DS  LV+ +
Sbjct  265  GGVLRDHLGIWIDGFQVNLGTGEVLDAEAWGLFFGLRMVAMHNIVNLEIESDSALLVQLM  324

Query  217  RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
             + D   H   ++   C        ++   HI+RE N +AD LA
Sbjct  325  LKSDTGVHPFGSLLDSCSVMMSKLLNVNIKHIFRECNMVADALA  368



>ref|WP_028307571.1| hypothetical protein [Desulfitibacter alkalitolerans]
Length=132

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G+A  G ++ D +G  L+     IG  T +VAE   V++GL +    G   + L
Sbjct  10   ASRGNPGKAAVGVIIYDLDGQILKKDNEYIGVTTNNVAEYKAVIRGLELAVGLGASGVKL  69

Query  184  ECDSKPLVEALR-----QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
              DS+ LV+ L      + +G   L  N+  L      +F +   +HI REQN+ ADKLA
Sbjct  70   YADSQLLVKQLSGEYRVKNEGLKPLYENVKALT----RNFKNFAAIHIPREQNKEADKLA  125

Query  349  DMAFSQQ  369
            +MA   Q
Sbjct  126  NMALDSQ  132



>ref|XP_007037560.1| Uncharacterized protein TCM_014255 [Theobroma cacao]
 gb|EOY22061.1| Uncharacterized protein TCM_014255 [Theobroma cacao]
Length=956

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 44/119 (37%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A+ GG++RD  G W+ G+   +GRC++   + W + QG++   D G R +++E
Sbjct  794  SRGNTGAASAGGLIRDKLGKWIVGYNLNLGRCSSLSTDLWALFQGIKFTWDRGYRKVLVE  853

Query  187  CDSKPLVEALRQGDGDGHLLN-NIARLCIREAEDFPDLRF---VH-IYREQNRLADKLA  348
             D    VE LR+      LLN NIA   I+   D  + ++   VH I RE+N  A+ LA
Sbjct  854  SDCVAAVECLRKAPS---LLNSNIA--LIKSCRDLLNRKWDCKVHPIRREENLCANWLA  907



>ref|XP_008224632.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=204

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 62/119 (52%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    DCSRRND-GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR +D G    GG++R+S+G W+ GF   +G     VAEAW +  GL +    G+R +
Sbjct  49   DGSRMSDSGYIAAGGIIRNSDGNWIAGFSANLGHGEVFVAEAWALYYGLNLAWQLGLRQI  108

Query  178  VLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            ++  DS  +V+ +     D H +  +   C    ++  +   +H+YRE N  AD LA +
Sbjct  109  MVNSDSALVVDMINGDWVDSHPMAVLLTKCKELLKNQWNCCVLHVYRETNFAADFLAKL  167



>ref|XP_008222990.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 1/115 (1%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G    GG+LRD +  W  GF   +G+     AE WG+  GLRM    G   L+ E DS  
Sbjct  197  GHIGAGGMLRDVSSDWCSGFAVNLGKGQILEAELWGLFFGLRMAVAKGFNNLIFEMDSVV  256

Query  202  LVEALRQGDG-DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
             ++ ++Q D    H L ++   C +  +   +    HI+RE+N +AD+LA  +++
Sbjct  257  AIQLVQQHDSLTLHPLASLVSSCWQLMQQLENCSLHHIFREKNSVADRLAAWSYN  311



>ref|XP_007224782.1| hypothetical protein PRUPE_ppa023938mg, partial [Prunus persica]
 gb|EMJ25981.1| hypothetical protein PRUPE_ppa023938mg, partial [Prunus persica]
Length=189

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G     GVLRD+ G WL+G+   +G  +   AE WG+   L +  D+G R + +E DSK 
Sbjct  42   GHIGAAGVLRDATGAWLKGYSVNLGIGSVLEAELWGIFWRLSLAWDFGFRTVEVESDSKV  101

Query  202  LVEALRQGDGDGHLLNNIARLC-IREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             V  L       H L +I   C ++ + D+ +    HI  EQN  AD LA ++F
Sbjct  102  AVTLLNSLTISTHPLFSIINCCKVKMSVDW-NCSVRHILLEQNCAADALAAISF  154



>emb|CAB78008.1| putative protein [Arabidopsis thaliana]
 emb|CAB82119.1| putative protein [Arabidopsis thaliana]
Length=947

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G AT GGVLRD  G W  GF   IG C+  +AE WGV  GL M  +     + L
Sbjct  856  ASRGNLGLATTGGVLRDGIGHWCGGFALDIGVCSAPLAELWGVYYGLYMAWERRFTRVEL  915

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLC  267
            E DS+ +V  L  G  D H L+ + RLC
Sbjct  916  EVDSELVVGFLTTGISDTHSLSFLVRLC  943



>ref|XP_007221027.1| hypothetical protein PRUPE_ppa014857mg, partial [Prunus persica]
 gb|EMJ22226.1| hypothetical protein PRUPE_ppa014857mg, partial [Prunus persica]
Length=183

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 72/156 (46%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DCSRRN-DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR++  G    GGV+RDS G W+ GF   +G+     AE WG+  GL++  + G+  L
Sbjct  23   DGSRKHVTGCIGAGGVIRDSFGDWVSGFAVNLGKGQVLEAEIWGLFFGLKLAIEKGISNL  82

Query  178  VLECDSKPLVEALRQGDGDG-HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             +E DS   V   +       H L  + R C    +  P     H++RE N +AD LA+ 
Sbjct  83   TIEMDSAIAVNLCQNPSMLAMHPLAALVRNCCDLMQQVPRCALQHVFREMNIVADCLANW  142

Query  355  AFSQQEDHIlletppleteellALDRVGAASTRRVC  462
            ++       +L   P      L  D +G   +R VC
Sbjct  143  SYQVDLGLCVLVHAPSWLSAYLVDDLLGVVHSRLVC  178



>ref|XP_008227119.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=147

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G    GG+LRD+ G W++GF   +G  +   AE WG L GL +  D G R + +E DS  
Sbjct  22   GSIGAGGLLRDATGEWIKGFSVNLGNGSVLEAELWGFLWGLTLAWDSGYRNVEVESDSGD  81

Query  202  LVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            +V  L       H L +I   C  +          HIYREQN  AD   
Sbjct  82   VVSLLNSPTIPTHPLLSIICCCKSKINKDWRCSISHIYREQNVDADTFV  130



>ref|XP_004298044.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=168

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 0/111 (0%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL  216
            GGVLRDSNG W+ GF   +G  +   A+AWG+   L+M        L++E DS  +V+ L
Sbjct  24   GGVLRDSNGNWISGFAASLGNGSVLDAKAWGLPLDLKMAYTSQCTSLLIESDSNVIVQML  83

Query  217  RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQ  369
            ++G  D H L ++   C    +        H++RE N +A+ L+    S +
Sbjct  84   KKGVDDLHPLYSVLGRCKFLMDKLFMCDVSHVHREINMVANILSKSRLSSE  134



>ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430323 [Malus domestica]
Length=1380

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/123 (36%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = +1

Query  7     SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
             S+ N G A CGGV R+ +G +L GF  +IG C +  AE   ++ G+      G   L LE
Sbjct  1230  SKGNPGPAACGGVFRNCHGXFLGGFCQRIGHCNSFFAELSAIIIGIEFAYQRGWHCLWLE  1289

Query  187   CDSKPLVEALRQGDGDG----HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
              DS  ++ AL+  D D     H   +I    IR+   +      HIYRE N +AD  A+M
Sbjct  1290  SDSSSVISALQSSDFDPPWPLHTQWSICLDRIRKMTFYAS----HIYREXNLVADNFANM  1345

Query  355   AFS  363
               S
Sbjct  1346  GLS  1348



>ref|XP_007031450.1| LINE-type retrotransposon LIb DNA, Insertion at the S11 site-like 
protein [Theobroma cacao]
 gb|EOY02376.1| LINE-type retrotransposon LIb DNA, Insertion at the S11 site-like 
protein [Theobroma cacao]
Length=620

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            +   G A+ GGVLR SNG+W+ G+G K G  T   AE WGV QGL++  D+G R + ++ 
Sbjct  528  KSGKGVASVGGVLRHSNGSWIIGYGCKSGTSTAYRAELWGVFQGLKLAWDHGYRRIQVQV  587

Query  190  DSKPLVEAL  216
            D+K +V AL
Sbjct  588  DNKIVVNAL  596



>gb|AGN12869.1| putative transposable element protein [Leavenworthia alabamica]
Length=195

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 11/133 (8%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SRR DGQA+ GG+ R+    +L G+   IG  T+ +AE   + +GL +V ++G   L 
Sbjct  42   DGSRRRDGQASIGGIFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELVLEHGWMNLW  101

Query  181  LECDSKPLVEA------LRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADK  342
            LE D+K +V+       LR  +   H+  N   + +       +    H+YRE NR ADK
Sbjct  102  LEGDAKIIVDIIAKRGRLRCEETTKHV--NYINVVM---PGLSNCVLSHVYREGNRAADK  156

Query  343  LADMAFSQQEDHI  381
            LA +    Q+  +
Sbjct  157  LAKLGHQFQDPKV  169



>ref|XP_007037316.1| Ribonuclease H-like protein [Theobroma cacao]
 gb|EOY21817.1| Ribonuclease H-like protein [Theobroma cacao]
Length=326

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            +++  +A  GGV+R+S G W  GF  K+G+C    AE WGVL  LR+  D   + ++++ 
Sbjct  201  KKSIDEAFAGGVIRNSEGDWRTGFVAKLGKCLAYRAELWGVLHDLRLAWDSRFKKVMVQV  260

Query  190  DSKPLVEALRQGD----GDGHLLNNIARLCIREAEDFPDLRFVHIYREQN  327
            D+K +V+A+         +  L+  I  +  +E E    + FVHIYRE N
Sbjct  261  DNKMVVQAILMDKLLPCANTDLIRAIKDILQKEWE----VHFVHIYREDN  306



>ref|XP_007224107.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
 gb|EMJ25306.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
Length=140

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = +1

Query  58   NGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGDGDG  237
            +G W++GF  K+G  +   AE WGV +GL +  + G+R + +ECDS   V  +    G  
Sbjct  5    DGVWVKGFVTKLGCGSILEAELWGVFRGLLLTWNEGIRRIQMECDSLTAVSLINGETGTN  64

Query  238  HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            H L++I   C        +    HIYREQN  AD +A +
Sbjct  65   HPLSSIIHCCKDLLLRDWECTIYHIYREQNSAADHMAHL  103



>ref|XP_004305757.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=395

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 58/118 (49%), Gaps = 2/118 (2%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G+   GGV+R+  G W+ GF   +G      AEAWG+ QGL++     +  L++E DS  
Sbjct  261  GKIGAGGVIRNHYGDWISGFQINLGVGEILDAEAWGLFQGLKLAVSLNINNLIIESDSAI  320

Query  202  LVEALRQGDGDGHLLNNIARLC--IREAEDFPDLRFVHIYREQNRLADKLADMAFSQQ  369
            LV+ +   +   H L ++ + C  +    +       HI+RE N   D LA  + S +
Sbjct  321  LVQLMNNSEFGNHPLGSLLQGCSSLMNKMEMKSATLSHIFRECNSTTDALAKCSISHE  378



>gb|AGV40503.1| hypothetical protein [Phaseolus vulgaris]
Length=234

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 58/123 (47%), Gaps = 1/123 (1%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +R   G ATCGG+ R S G ++  F   +   T  VAE +GV+  +   +  G+  + LE
Sbjct  85   ARGYPGLATCGGIFRGSMGEFIGAFSAFLEVQTALVAEFYGVIHAMEEAQKMGLTNVWLE  144

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
            CDS  +  A         +L N    C+         R  HI+RE N  ADKLA++ F  
Sbjct  145  CDSALVCAAFTARTNVPWMLQNRWNTCLNFCGTI-RFRVTHIFREGNACADKLANLGFIH  203

Query  367  QED  375
            +E 
Sbjct  204  RES  206



>ref|XP_007226572.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
 gb|EMJ27771.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
Length=297

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 2/118 (2%)
 Frame = +1

Query  1    DCSRR-NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR+   G    GGVLRD  G    GF   +G+     AE WG+  GLRM  + G   L
Sbjct  179  DGSRKVASGHIGAGGVLRDVFGDCCCGFAINLGKGQILEAELWGLFFGLRMAVEKGFNNL  238

Query  178  VLECDSKPLVEALRQ-GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            ++E DS   +  ++Q G    H L ++A  C +  +   +    HI+RE+N +AD+LA
Sbjct  239  IVEMDSAVAIHLVQQHGSLTLHPLASLASSCWQLMQKLENCSLHHIFREKNSVADQLA  296



>gb|KHN04118.1| Putative ribonuclease H protein [Glycine soja]
Length=128

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 0/109 (0%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G+A  G V+R+ +   +  F   IG C    AE WG+L+GL + +D G   +V+E DSK 
Sbjct  12   GRAAYGVVVRNDSDAMIFAFSSNIGNCNFLRAELWGILKGLTIARDRGFNYIVVESDSKI  71

Query  202  LVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
             ++ +  G    H   N+ +      +   ++ F HI+RE N+  D LA
Sbjct  72   AIKLITYGCPTIHSNYNLVQQIKEIVDSRLEVTFSHIFREANQTTDALA  120



>ref|NP_001236017.1| uncharacterized protein LOC100526921 [Glycine max]
 ref|XP_006574355.1| PREDICTED: uncharacterized protein LOC100526921 isoform X1 [Glycine 
max]
 gb|ACU15942.1| unknown [Glycine max]
Length=247

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +1

Query  25   QATCGGVLRDSNGTWLRGFGYKIGRC-TTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
             A CGGVLRD++  WLRGF  K+         E   +L GL++  +  V+ L++E DS  
Sbjct  102  SAGCGGVLRDASAKWLRGFAKKLNPTYAVHQTELEAILTGLKVASEMNVKKLIVESDSDS  161

Query  202  LVEALRQGDGDGHLLNNIARLCIREAEDFP-DLRFVHIYREQNRLADKLADMA  357
            +V  +  G    H    +  L   +   F  ++RFV +  + NR+AD+LA+ A
Sbjct  162  VVSMVENGVKPNHPDYGVVELIRTKRRRFDWEVRFVSVSNKANRVADRLANDA  214



>ref|XP_006605069.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=148

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
            +G A  GGVLRD+NG  +  F +KIGRC+   AE W ++ G+++ K  G    ++E DSK
Sbjct  2    NGNAGTGGVLRDNNGNVVVTFVFKIGRCSVTQAELWAIVLGIQVAKSRGFSESLVESDSK  61

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
              +  ++      ++   +  +  +   D     ++  Y E N++A+ L+    S 
Sbjct  62   LAISLIQHRCSPSYVCFQLVEMIRKFESDGGRFTWIPAYPEANQVAEILSKFGLSS  117



>ref|XP_006468253.1| PREDICTED: uncharacterized protein LOC102614777 [Citrus sinensis]
Length=320

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 8/125 (6%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D ++++ G A  GG++RD  G W  G+   +G C+    E WG+  GL +   YG R + 
Sbjct  166  DGAKKSSGIAGAGGLIRDFRGVWQVGYSANLGVCSVTSTELWGLFHGLSIAWQYGFRRVY  225

Query  181  LECDSKPLVEALRQGDGDGH----LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            +E DS  ++  +   +   +    L+  I  L  R+       +  HIYRE N +AD LA
Sbjct  226  VEVDSMCVMRLISNPNPPINEHFTLIQEIQALLRRDWLT----KVEHIYREANEVADFLA  281

Query  349  DMAFS  363
               FS
Sbjct  282  SYNFS  286



>gb|ABD32321.2| Ribonuclease H [Medicago truncatula]
Length=220

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 8/116 (7%)
 Frame = +1

Query  28   ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
            A CGG+ RD +G W++G+  KIG C    AE WG+  GL M        L++E DSK L+
Sbjct  75   AGCGGLFRDLDGRWIKGYTKKIGACDALHAEMWGLYLGLDMAWREHYSHLIVESDSKILI  134

Query  208  EALRQGDGDGHLLN-NIARLCIREAEDFP---DLRFVHIYREQNRLADKLADMAFS  363
            + +     D    N NI  L  R  +      +++  H +RE NR AD LA+++ S
Sbjct  135  DMI----SDNFKFNGNIPVLVYRIRKLLKTSWNVQLNHTWREGNRSADWLANLSIS  186



>dbj|BAF46298.1| hypothetical protein [Ipomoea nil]
Length=212

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 62/110 (56%), Gaps = 6/110 (5%)
 Frame = +1

Query  28   ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
            A  GG LR+  GTWL GF YKI   T +  EA  ++ G++ + + GVR   ++ D++ +V
Sbjct  62   AGIGGALREDKGTWLGGFAYKIPLETPEAIEAKAIVLGMQWLWERGVREAEIQSDARKVV  121

Query  208  EALRQGDGDGHLLNNI---ARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            E ++  D     +  I   ARL +   +D+  +    +YREQNR+AD LA
Sbjct  122  EWIQASDNLRGPIQGIIEEARLWL--TKDW-KISIRAVYREQNRVADALA  168



>ref|XP_008226553.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=180

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    DCSRRN-DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SRR   G    GGV+R  NG W+ GF   +G+      E WG+  GL +V D G   L
Sbjct  23   DGSRRAASGCIDAGGVIRGVNGNWICGFAVNLGKGQLLEVELWGLYFGLYLVWDKGFSNL  82

Query  178  VLECDSKPLVEALRQ-GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            ++E D   +V  ++Q G    H L  + + C        +    H+YRE N +A+++ + 
Sbjct  83   LIEMDVAIVVSLVQQVGTLSCHPLVALIQSCCVLMRRISNCHLTHVYREVNVVANRMTNW  142

Query  355  AFS  363
            +F+
Sbjct  143  SFN  145



>ref|XP_009805051.1| PREDICTED: uncharacterized protein LOC104250178 [Nicotiana sylvestris]
Length=222

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 60/114 (53%), Gaps = 3/114 (3%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S  N+ ++  G ++R++N  W+ GF   I   +   AE + ++QGL++  D  + PL +E
Sbjct  62   SAHNNSKSGIGDLIRNANAEWVIGFATSITAESPTTAETYALMQGLQLALDRNLLPLEVE  121

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
             DS+   ++LR       + NN+   C    +       +H YREQN +ADKLA
Sbjct  122  VDSR---DSLRLLTSTKDIPNNLISDCRYLLDRLGKPIVMHAYREQNGVADKLA  172



>gb|KHN25063.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=145

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 58/112 (52%), Gaps = 4/112 (4%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK-PLVEA  213
            GG++RDSNG+W++GF    G  T   AE   +L+ L+M  DY  + L+ E +S+  L   
Sbjct  5    GGIIRDSNGSWVQGFAGLCGVKTNLYAELLAILKVLQMAWDYNGQALIYESNSRTALSLT  64

Query  214  LRQGDGDGHLLNNIARLCIREAEDFP-DLRFVHIYREQNRLADKLADMAFSQ  366
            L   D   H    I+R  IR     P +L F H +RE N  AD LA +  S 
Sbjct  65   LHGADHTHHYFPLISR--IRSFLHHPWELSFQHEFREANYCADWLAKLGASS  114



>ref|XP_008221996.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=545

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +1

Query  43   VLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQ  222
            V+R+S G W+ GF    G  +T  AE WGV  GL +  + G R + +ECD+  +V  L  
Sbjct  405  VIRNSAGVWITGFAVNQGVGSTLEAELWGVFWGLHLAWEIGCRHIEVECDANSVVSLLTG  464

Query  223  GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
                 H L ++   C  + +        H++REQN +AD LA M+
Sbjct  465  SIASTHPLFSLLSCCKLKLQQDWVCSLTHVFREQNCVADGLAHMS  509



>ref|XP_007219162.1| hypothetical protein PRUPE_ppa016360mg, partial [Prunus persica]
 gb|EMJ20361.1| hypothetical protein PRUPE_ppa016360mg, partial [Prunus persica]
Length=217

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query  1    DCSRRND-GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR N  G    GG+LRDS G W++GF   +G  +   AE WG+  GL M  D G R +
Sbjct  121  DGSRINSSGFIGAGGLLRDSCGNWIKGFSVNLGFGSVIEAELWGIFWGLSMAWDAGFRTV  180

Query  178  VLECDSKPLVEALRQGDGDGHLLNNIARLC  267
             +ECDS   V  L+      H L +I   C
Sbjct  181  EIECDSTSAVALLKSPIVSTHPLFSIINCC  210



>ref|XP_008221992.1| PREDICTED: uncharacterized protein LOC103321917 [Prunus mume]
Length=658

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  52   DSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGDG  231
            DSN  W+ GF   IG      AE W + +GL M  D G+R L +ECDS  +V  + +   
Sbjct  521  DSNRAWIYGFSANIGIGNIYEAELWSLFRGLHMAWDKGIRSLDIECDSLSVVSLIAKACN  580

Query  232  DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
              H L  +   C    +        HIYR+QNR+AD LA++ +
Sbjct  581  HSHPLFCLIEDCKLLLKRNWRCNVSHIYRKQNRVADHLANLGY  623



>ref|XP_006475107.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=246

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (50%), Gaps = 8/125 (6%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D + +    A  GG++RD  G W  G+   +G C+   AE WG+  GL +   YG R ++
Sbjct  92   DGAMKPSDHAGAGGLIRDYRGVWQIGYCANLGFCSVTSAELWGLFHGLSIAWLYGYRRVI  151

Query  181  LECDSKPLVEALRQGDGDGH----LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            +E DSK +++ +   +   +    L+  I  L  R+      ++  HIYRE N  AD LA
Sbjct  152  VEVDSKCILQLVSSSNPTINEHLSLIKAIQELIGRKWL----IQMNHIYREANAAADFLA  207

Query  349  DMAFS  363
              + S
Sbjct  208  TYSLS  212



>ref|XP_006584399.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=470

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +1

Query  43   VLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQ  222
            ++RD NG W+ GF   +G  +  VA++WGVL+G+ + +  G+  L +  DSK +V+ L+ 
Sbjct  330  LIRDENGRWVVGFVRNLGIASAYVAKSWGVLEGVTLARQRGIDFLEINVDSKVVVDGLK-  388

Query  223  GDGDGHLLNNIARLCIRE-AEDFPDLRFVHIYREQNRLADKLADMAFSQQED  375
            GD  G L        IR+       ++  HIYRE N+ AD   + A +Q+ED
Sbjct  389  GDKQGCLEGWTIVGAIRKMVSGLEQVKISHIYREANQCADLHVNHARTQEED  440



>gb|AAF79682.1|AC022314_23 F9C16.18 [Arabidopsis thaliana]
Length=196

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 51/119 (43%), Gaps = 32/119 (27%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N   +T GGVLRD  G WL GF   IGR T  VAE WGV                 
Sbjct  73   ASRGNPTLSTAGGVLRDREGEWLGGFSLNIGRRTAPVAELWGV-----------------  115

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
                            + H L+ + RLC         +R  H+YRE NRLAD LA+ AF
Sbjct  116  ---------------SERHPLSFLVRLCHGFLLKDWIVRISHVYREANRLADGLANYAF  159



>ref|XP_007226620.1| hypothetical protein PRUPE_ppa022893mg, partial [Prunus persica]
 gb|EMJ27819.1| hypothetical protein PRUPE_ppa022893mg, partial [Prunus persica]
Length=177

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = +1

Query  1    DCSRRNDG-QATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR N   Q    GVLRD+ G WL+G+  K+G  +   AE WG+  GL +  DYG R +
Sbjct  87   DGSRNNTADQIGAAGVLRDATGAWLKGYSVKLGTGSVLEAELWGIFWGLSLAWDYGFRTV  146

Query  178  VLECDSKPLVEALRQGDGDGHLLNNI  255
             +E DSK  V+ L       H L +I
Sbjct  147  EVESDSKVAVDLLNSLTISTHPLFSI  172



>ref|XP_004292270.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=224

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (48%), Gaps = 0/115 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
             +N G     GVLR+  G WL GF  K+G      AE WG+L+G+ M   +G   L +E 
Sbjct  73   HKNTGIICARGVLRNDRGEWLNGFSAKLGIGQVLEAELWGLLKGMEMAWQHGCNSLEVEV  132

Query  190  DSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            DS   V+ +       H L ++   C        ++  +H YRE N +AD LA +
Sbjct  133  DSLVAVKLVLSVIDHLHPLYSLITNCQESLSRNWNVSLIHDYRESNSVADLLASI  187



>ref|XP_003543094.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
 gb|KHN19096.1| Putative ribonuclease H protein [Glycine soja]
Length=201

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 11/118 (9%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
             G+A+ GGV+R+ N  +L G+   IG+  + +AE   + +GL +V + G   + LE D+K
Sbjct  54   SGKASIGGVVRNHNAEFLLGYAESIGQANSTIAELTALRKGLELVLENGWNDIWLEGDAK  113

Query  199  PLVEAL------RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             LVE +      R  +   H +N+I  +      +F +    HIYRE NR ADK A M
Sbjct  114  TLVEIIVKRRKVRCTEVQRH-INHINTIL----PEFNNFFVSHIYREGNRAADKFAQM  166



>ref|XP_010527295.1| PREDICTED: uncharacterized protein LOC104804652 [Tarenaya hassleriana]
Length=225

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N   A  GG++RD  G WL GF   +G C+   AEAWGVL GLR+  + G R + +E D+
Sbjct  140  NPDSAASGGLIRDQMGNWLVGFKANLGTCSIFRAEAWGVLLGLRLAWNRGWRKVRVEVDN  199

Query  196  KPLVEALRQGD----GDGHLLNNI  255
            + LV  +++ D     DG +L  I
Sbjct  200  QALVSTIQRSDYEYTVDGTILREI  223



>ref|XP_008223341.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=161

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            + G    GG++R+S G W+ GF   +G     VAE W + +GL++ +   V  L++E DS
Sbjct  12   SSGAIAAGGLIRNSAGEWVAGFSANLGHGEILVAELWALYRGLKLAQRLQVTKLIVETDS  71

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQ  369
              ++  L       H L  +  +C    +   D    H++++ N  AD LA M    +
Sbjct  72   TIVLHLLNAKLEPNHPLLTLLNMCRVCWKSSWDCSIFHVFKKVNFAADSLAKMGHEME  129



>ref|XP_002530566.1| nuclease, putative [Ricinus communis]
 gb|EEF31796.1| nuclease, putative [Ricinus communis]
Length=177

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 6/121 (5%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRC-TTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +++ G AT  G+ R+S+G W   F  K+  C +  VAE   +L GL++  D G + ++LE
Sbjct  21   KKSFGIATAAGLFRNSDGQWCGAFAIKLTDCYSAFVAELCSILNGLKIAWDAGFKNIILE  80

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFP----DLRFVHIYREQNRLADKLADM  354
             D+K  V+ +  GD D   + ++  L I   ++      +++  H YRE N++A+ LA+ 
Sbjct  81   TDNKISVDTIY-GDFDTKCIGDLEDLLITSIKEMLAMAWNVKLQHQYREGNQVAEALANF  139

Query  355  A  357
            A
Sbjct  140  A  140



>ref|XP_004306184.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=149

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 57/118 (48%), Gaps = 1/118 (1%)
 Frame = +1

Query  1    DCSRR-NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR  + G+    GV+RD  G+W+ GF   +G      AEAWG+   +++     +  L
Sbjct  12   DGSRSTSSGKIGASGVIRDHRGSWISGFQINLGVGEILDAEAWGLFYDMKLASQLQINNL  71

Query  178  VLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
             +E DS  LV+  +  + + H L ++ + C          +  HI+RE N  AD L +
Sbjct  72   SIESDSAVLVQLFQCANLEMHPLGSLLKGCKNFMSALRATQINHIFRESNMTADALVE  129



>gb|ABV21218.1| At4g21420 [Arabidopsis thaliana]
Length=197

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GGV R+    +L G+   IG  T+ +AE   + +GL +  + G+  L 
Sbjct  48   DGSRGREGQASIGGVFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELALENGLTDLW  107

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + R+G       N           +  +    H+YRE NR+ADKLA + 
Sbjct  108  LEGDAKIIMDIISRRGRLRCEKTNKHVNYIKVVMPELNNCVLSHVYREGNRVADKLAKLG  167

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  168  HQFQDPKV  175



>ref|XP_007217555.1| hypothetical protein PRUPE_ppa022357mg, partial [Prunus persica]
 gb|EMJ18754.1| hypothetical protein PRUPE_ppa022357mg, partial [Prunus persica]
Length=140

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 4/105 (4%)
 Frame = +1

Query  40   GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALR  219
            G+LRDS G+W++GF   +G  +   A  WG+  GL MV D     + +ECD+   V  L+
Sbjct  21   GLLRDSCGSWIKGFFVNLGYGSIIEAGLWGLFWGLNMVWDASFCMVEIECDATSAVALLK  80

Query  220  QGDGDGHLLNNIARLC-IREAEDFPDLRFV-HIYREQNRLADKLA  348
                  H   +I   C ++  ED+    FV HI+ EQN +AD LA
Sbjct  81   SPIVSTHPFFSIINCCKMKIYEDW--CCFVKHIFCEQNCVADALA  123



>ref|XP_007033353.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
 gb|EOY04279.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
Length=438

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 58/114 (51%), Gaps = 10/114 (9%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G A  GGV+R   G WL GF YKIG   +  AE W +  GL +  D G R + +E DS  
Sbjct  293  GMAAAGGVIRYEVGNWLLGFNYKIGISCSLQAELWALYWGLTLCWDKGFRKVQVESDSLL  352

Query  202  LVEALR----QGDGDGHLLNNIARLCIREA-EDFPDLRFVHIYREQNRLADKLA  348
             V+ +     Q + +  LL      CI+E  + F +    HI+RE N+ AD +A
Sbjct  353  AVQKISNQSLQPEQNAGLLK-----CIKELFQRFWNCTLTHIHREANQCADWMA  401



>ref|XP_002521266.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41122.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            CS+ N G A  GGV RD  G  + GF   IG C+   AE W    GL +  + G+R LVL
Sbjct  36   CSKGNPGSAAGGGVFRDYRGRCVVGFMCNIGYCSAIGAELWAAFHGLTIAWNKGLRKLVL  95

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQ  324
              DS   +  L +       L+N+   C        D + VH++RE+
Sbjct  96   AMDSTLALYWLSKRSICNSHLSNLVHSCSAILSYELDAKLVHVHREK  142



>ref|XP_002512046.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50715.1| nucleic acid binding protein, putative [Ricinus communis]
Length=244

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 70/128 (55%), Gaps = 11/128 (9%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDV-AEAWGVLQGLRMVKDYGVRPLVLE  186
            R  DG A  GG++RDS G W+RGF   +G  +T V AE  G+++GL++ +  G   L++E
Sbjct  94   RGEDGPAAAGGLIRDSRGRWIRGFKCYMGLGSTSVKAELLGLIEGLKLARKIGCEKLIVE  153

Query  187  CDSKPLVEALR---QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
             D++ +V+ ++       D ++L +  +  +++          H   +QNR AD+LA+  
Sbjct  154  TDNEGVVQMIKIKTNRQNDNYILASEIQQLLQKG-----WEVQHCKNKQNRCADRLANYG  208

Query  358  FSQQEDHI  381
               +E H+
Sbjct  209  L--EEPHV  214



>ref|XP_004146631.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis 
sativus]
 ref|XP_004158057.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis 
sativus]
 gb|KGN64619.1| hypothetical protein Csa_1G071820 [Cucumis sativus]
Length=205

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G A+ GGVLRD    +L G+   IGR  + +AE   + +GL +V + G + + +E D+K 
Sbjct  59   GVASIGGVLRDHKAQFLLGYAESIGRAYSSMAELKALTKGLELVLENGWKDVWVEGDAKG  118

Query  202  LVEALRQGDGDG-----HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            LVE L +            L +I  L +    DF + +  HIYRE N++AD+ A +
Sbjct  119  LVEILAENREVKCMEARSYLRHIKSLLL----DFDNCKVSHIYREGNKVADRFASI  170



>gb|KHN08856.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=147

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = +1

Query  34   CGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEA  213
            C G +R S G +L  F  K  R    +AE WGV +GL++ ++ G + ++++ DS+ +V  
Sbjct  3    CRGHIRGSAGNYLCDFSKKASRANAFIAELWGVYEGLKLAQNRGFKVVIVQVDSQVIVNI  62

Query  214  LR-QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            L+ + DG     + + ++ +  + D+    F H+YRE N  A  LA MA +
Sbjct  63   LKGKKDGSAQGWSLVRKIRLLFSADWRTKVF-HVYREANIWAHMLAKMAIN  112



>ref|XP_008229469.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=333

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 68/151 (45%), Gaps = 1/151 (1%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
             G+   GGV+RD  G W  GF   +G+     AE WG+  GLR+    G   +++E DS+
Sbjct  183  SGKIGAGGVIRDCVGEWCGGFAVNLGKWRILDAEIWGLFFGLRLAVAKGFTKILIEMDSQ  242

Query  199  PLVEALRQGDGDG-HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQED  375
              V   +Q D    H L  +   C +    F      HI+RE+N LAD LA  + +   D
Sbjct  243  IAVNLFQQRDSLCFHPLTALLSNCGKILRHFESWDIQHIFREKNGLADCLAKWSHNLDLD  302

Query  376  HIlletppleteellALDRVGAASTRRVCRQ  468
                 + P+     LA D +G      +C +
Sbjct  303  IQFFASAPIWASSALADDLLGVTRGHLICTE  333



>emb|CAB10336.1| splicing factor like protein [Arabidopsis thaliana]
 emb|CAB78600.1| splicing factor like protein [Arabidopsis thaliana]
Length=559

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (48%), Gaps = 14/122 (11%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G A  GGV+RD +G W+ GF  ++           G ++              L
Sbjct  43   ASRGNPGPAAAGGVIRDEDGLWVGGFALQLAFVRLRWQSCGGRVE--------------L  88

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            E DS+ +V  L+ G  + H L  + RLC         +R  H+YRE NRLAD LA+ AFS
Sbjct  89   EVDSELVVGFLQSGISEAHPLAFLVRLCHGLLSKDWLVRVSHVYREANRLADGLANYAFS  148

Query  364  QQ  369
             Q
Sbjct  149  LQ  150



>emb|CAA18706.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAA20207.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB81249.1| hypothetical protein [Arabidopsis thaliana]
Length=229

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GGV R+    +L G+   IG  T+ +AE   + +GL +  + G+  L 
Sbjct  76   DGSRGREGQASIGGVFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELALENGLTDLW  135

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + R+G       N           +  +    H+YRE NR+ADKLA + 
Sbjct  136  LEGDAKIIMDIISRRGRLRCEKTNKHVNYIKVVMPELNNCVLSHVYREGNRVADKLAKLG  195

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  196  HQFQDPKV  203



>gb|ABD33209.1| Ribonuclease H [Medicago truncatula]
Length=302

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N   A CGG+LR S+GTW++GF  KIG C    AE WG+  GL M    G+  L++E DS
Sbjct  221  NGELAGCGGLLRQSDGTWIKGFSRKIGACDALHAEMWGLYLGLDMAWREGISHLIVESDS  280

Query  196  KPLVEAL  216
            K L++ +
Sbjct  281  KVLIDMV  287



>ref|XP_008220870.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=264

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 63/123 (51%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    DCSRRN-DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SRR   G    GG++RDS G W  GF   +G+     AE WG+  GL++    GV+ L
Sbjct  107  DGSRRGMSGAIGAGGLIRDSVGNWHGGFVVNLGQGQILEAELWGLFFGLKLAIGKGVKKL  166

Query  178  VLECDSKPLVEALRQGDG-DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            ++E DS   +  ++  +  + H L  +   C         +   HI+RE+N  AD LA++
Sbjct  167  LVEMDSATTIRLIQCKESLEAHPLAGLLDCCREMLSQLDCVEVHHIFREKNFAADCLANL  226

Query  355  AFS  363
            +++
Sbjct  227  SYN  229



>emb|CAN67514.1| hypothetical protein VITISV_012081 [Vitis vinifera]
Length=697

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 7/118 (6%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            + G+A+ GGV+RD N  +L G+   IG   + +AE   + +GL +V + G   + LE D 
Sbjct  492  SSGRASIGGVIRDHNAAFLLGYAESIGHAXSTIAEMAALRRGLELVVENGWSQVWLEGDL  551

Query  196  KPLVEALRQG----DGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            + LVE + QG      +     +  +L I E ++F      HIYRE NR+A   A M 
Sbjct  552  QSLVEIIMQGRRVRSAEAQKQVSHIKLLIPELDNF---LITHIYREGNRVAHTFAQMG  606



>ref|XP_002530597.1| nuclease, putative [Ricinus communis]
 gb|EEF31777.1| nuclease, putative [Ricinus communis]
Length=113

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 6/110 (5%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            R   G A  GG+ R+  G W+ G+   IG CT   AE W  LQGL + +  G + LVLE 
Sbjct  5    RAIPGSAGGGGLFRNEFGDWIGGYVVHIGYCTAIEAELWAALQGLLIARRRGYQRLVLEV  64

Query  190  DSKPLV---EALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNR  330
            DS+ LV    +L   +G      N+ + C     +F   +  H+++E NR
Sbjct  65   DSQLLVAWPTSLSVLEGK---CANLVQTCRGLEHEFSSFQVQHVFQEGNR  111



>ref|XP_006485141.1| PREDICTED: protein argonaute MEL1-like [Citrus sinensis]
Length=907

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D +R+ +G+A+ GG+LRD +G ++ GF   +G C+   AE WGVL GLRM  D G R + 
Sbjct  46   DGARKGNGEASAGGLLRDCHGNFIHGFSAHLGVCSVLKAELWGVLHGLRMAWDLGYRHIQ  105

Query  181  LECD--SKPLVE  210
            +  D  S P+ E
Sbjct  106  VGVDNFSTPVEE  117



>ref|XP_007039706.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY24207.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=391

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 8/115 (7%)
 Frame = +1

Query  28   ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
            A  GGVLRD++GTW+ G+  K+   +    E WG  +GL++  + G R + L+ D+K +V
Sbjct  277  AAAGGVLRDAHGTWIVGYACKLETSSGLRVELWGFYKGLQLAWERGFRKVKLQSDNKAMV  336

Query  208  EALRQGD----GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
            +A+         +  L+  I  +  R  E    +   HIYRE N  AD ++++ F
Sbjct  337  QAISFSSVHPCSNLDLIRAIKGMLGRHWE----VNISHIYREANTTADFMSNLGF  387



>emb|CCI61487.1| unnamed protein product [Arabidopsis halleri]
 gb|AID21591.1| At4g21420p-like protein [Arabidopsis halleri]
 gb|AID21595.1| At4g21420p-like protein [Arabidopsis halleri]
Length=195

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GG+ R+    +L G+   IG  T+ +AE   + +GL +V + G   L 
Sbjct  42   DGSRGREGQASIGGIFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELVLENGWTDLW  101

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + ++G       N              +    H+YRE NR+ADKLA + 
Sbjct  102  LEGDAKIIMDIISKRGKLRCEKTNKHVNYINVVMPGLSNCVLSHVYREGNRVADKLAKLG  161

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  162  HQFQDPKV  169



>ref|XP_007030929.1| Uncharacterized protein TCM_026608 [Theobroma cacao]
 gb|EOY11431.1| Uncharacterized protein TCM_026608 [Theobroma cacao]
Length=212

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            +++  QA  GGVLRDS G W  G+  ++ RCT   AE WG  +GL+   D G R +VL+ 
Sbjct  142  QKSTKQAAAGGVLRDSLGQWRGGYTMRLRRCTAYWAELWGECRGLKHAWDLGFRRIVLQV  201

Query  190  DSKPLVEA  213
            DSK +V+A
Sbjct  202  DSKIVVQA  209



>gb|AID21636.1| At4g21420p-like protein [Arabidopsis lyrata]
Length=195

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GG+ R+    +L G+   IG  T+ +AE   + +GL +V + G   + 
Sbjct  42   DGSRGREGQASIGGIFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELVLENGWTDIW  101

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + ++G       N           +  +    H+YRE NR+ADKLA + 
Sbjct  102  LEGDAKIIMDIISKRGRLRCERTNKHVNYINVVMPELSNCVLSHVYREGNRVADKLAKLG  161

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  162  HQFQDPKV  169



>gb|KHN15930.1| Putative ribonuclease H protein [Glycine soja]
Length=159

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 68/148 (46%), Gaps = 0/148 (0%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N GQA  GG++RD+ G W  GF    G  T+  AE   +  GL++ +D G+  L+ E D 
Sbjct  12   NLGQAGFGGIIRDNLGNWHTGFMGSCGFTTSVHAELLSIYHGLKIARDIGIGRLICESDL  71

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQED  375
            K  ++ +       H       L         ++ FVH+YRE N+ AD  A    S Q+ 
Sbjct  72   KVALDLITGEINMFHQYFPTIMLIHSLKHMDWEVTFVHVYREGNKCADWFAKTGNSSQQG  131

Query  376  HIlletppleteellALDRVGAASTRRV  459
             I+L+  P    +    D +G  + R +
Sbjct  132  MIILDHRPSPIYQAYLGDAMGVTTQRMI  159



>ref|XP_007225017.1| hypothetical protein PRUPE_ppa020094mg, partial [Prunus persica]
 gb|EMJ26216.1| hypothetical protein PRUPE_ppa020094mg, partial [Prunus persica]
Length=140

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (49%), Gaps = 3/109 (3%)
 Frame = +1

Query  52   DSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGDG  231
            D  G W+ GF   +G+     AE WG+  GL++    G+  +V+E DS   V  +   D 
Sbjct  1    DHLGNWIGGFAVNLGKGQILEAELWGLFFGLKLATTRGIMDIVVEMDSVNAVNLILSNDL  60

Query  232  DG-HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQED  375
            +  H +  +   C R     P     HIYRE+N +AD+LA  A+S   D
Sbjct  61   NFCHPMAGLVHSCKRLMSQIPKCFLHHIYREKNAVADRLA--AWSHDID  107



>gb|AID21644.1| At4g21420p-like protein [Arabidopsis lyrata]
 gb|AID21663.1| At4g21420p-like protein [Arabidopsis lyrata]
Length=195

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GG+ R+    +L G+   IG  T+ +AE   + +GL +V + G   + 
Sbjct  42   DGSRGREGQASIGGIFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELVLENGWTDIW  101

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + ++G       N           +  +    H+YRE NR+ADKLA + 
Sbjct  102  LEGDAKIIMDIISKRGRLRCERTNKHVNYINVVMPELSNCVLSHVYREGNRVADKLAKLG  161

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  162  HQFQDPKV  169



>ref|XP_009588021.1| PREDICTED: uncharacterized protein LOC104085633 [Nicotiana tomentosiformis]
Length=183

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (51%), Gaps = 3/112 (3%)
 Frame = +1

Query  13   RNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECD  192
            RN  +   GGV RDS+G W+ GF   +   T   AE   VLQ L++ +  G+  + LE +
Sbjct  13   RNPEKGGVGGVFRDSSGNWVVGFMENLPHTTNTQAELLAVLQELQIAEQRGI--ISLEIN  70

Query  193  SKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            + P  E +R  + D H+ ++I   C+       ++   H YRE N++ D + 
Sbjct  71   TDP-TEVIRMLNLDNHVFDSIIFQCMSIILRLGNIVVKHGYREMNKVVDLMT  121



>ref|XP_008343842.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=157

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +1

Query  31   TCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVE  210
            + GG++R+S G W++GF   +GR T   AE WGVL GL +  D G R ++LECDS   V 
Sbjct  72   SAGGLIRNSEGDWIKGFAANLGRGTIMEAELWGVLMGLSIAWDEGCRDVILECDSWDAVI  131

Query  211  ALRQGDGDGHLLNNIARLCIREAE  282
            ++++     + L N+   C    E
Sbjct  132  SIQKPILALYPLYNLILDCKEAIE  155



>ref|XP_007019573.1| Uncharacterized protein TCM_035679 [Theobroma cacao]
 gb|EOY16798.1| Uncharacterized protein TCM_035679 [Theobroma cacao]
Length=203

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 57/119 (48%), Gaps = 10/119 (8%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +R     AT GGV+ D  G WL GF YKIG   +   E W +  GL +  D G R + +E
Sbjct  62   ARGQPEMATVGGVITDEVGNWLLGFNYKIGISCSLQVELWALYWGLTLCWDKGFRKVQVE  121

Query  187  CDSKPLVEALR----QGDGDGHLLNNIARLCIREA-EDFPDLRFVHIYREQNRLADKLA  348
             DS   V+ +     Q   +  LL      CIRE  +   D    HI+RE N+ A+ +A
Sbjct  122  SDSLLAVQKISNQSLQPKQNAGLLK-----CIRELFQRSWDCTLTHIHREANQCANWMA  175



>gb|KCW83711.1| hypothetical protein EUGRSUZ_B00585 [Eucalyptus grandis]
Length=322

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 62/121 (51%), Gaps = 8/121 (7%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +R + G A  GG +  S+G W+ G+ +++G+ ++  A+ W + QGL +V D   R +++ 
Sbjct  174  TRGSTGSAGVGGTVHTSSGKWVLGYSFQLGKWSSLAADLWAIFQGLNLVWDRNYRKVLVL  233

Query  187  CDSKPLVEALRQG----DGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             DS P + +L+      D +  L+     L +R  E        HI RE+N  A  LAD 
Sbjct  234  SDSYPALNSLKTAPQASDPNKDLIQCCRELILRNWE----CNVSHISREKNAAAAWLADH  289

Query  355  A  357
            +
Sbjct  290  S  290



>ref|XP_002869889.1| At4g21420 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46148.1| At4g21420 [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GG+ R+    +L G+   IG  T+ +AE   + +GL +V + G   + 
Sbjct  48   DGSRGREGQASIGGIFRNHKAEFLLGYSESIGEATSTMAEFAALKRGLELVLENGWTDIW  107

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + ++G       N           +  +    H+YRE NR+ADKLA + 
Sbjct  108  LEGDAKIIMDIISKRGRLRCERTNKHVNYINVVMPELSNCVLSHVYREGNRVADKLAKLG  167

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  168  HQFQDPKV  175



>emb|CDY63479.1| BnaC01g41220D [Brassica napus]
Length=200

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 21/134 (16%)
 Frame = +1

Query  13   RNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECD  192
            R  GQA+ GG+ R+  G +L G+   IG  T+ VAE   + +GL +V + G   L LE D
Sbjct  51   RKHGQASIGGIFRNHKGEFLLGYSEPIGAATSTVAEFAALKRGLELVLENGWTDLWLEGD  110

Query  193  SKPLVEALRQGDGDGHLLNNIARLCIREAED--------FPDLR---FVHIYREQNRLAD  339
            +K +++          +++   RL  +EA+          P L      H+YRE NR AD
Sbjct  111  AKIIMD----------IISKRGRLRCQEAKKHVNYINVVMPGLSNCVLSHVYREGNRAAD  160

Query  340  KLADMAFSQQEDHI  381
            KLA +    Q+  +
Sbjct  161  KLAKLGHQFQDPKV  174



>ref|XP_010045599.1| PREDICTED: uncharacterized protein LOC104434358 [Eucalyptus grandis]
Length=854

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 8/119 (7%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +R + G A  GG +  S+G W+ G+ +++G+ ++  A+ W + QGL +V D   R +++ 
Sbjct  706  TRGSTGSAGVGGTVHTSSGKWVLGYSFQLGKWSSLAADLWAIFQGLNLVWDRNYRKVLVL  765

Query  187  CDSKPLVEALRQG----DGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
             DS P + +L+      D +  L+     L +R  E        HI RE+N  A  LAD
Sbjct  766  SDSYPALNSLKTAPQASDPNKDLIQCCRELILRNWE----CNVSHISREKNAAAAWLAD  820



>ref|XP_004308354.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=235

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 10/125 (8%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G A CGGV RD++G +L  F + +G  T+  +E + V+  + +  D G   L LE
Sbjct  86   AKGNPGPAACGGVFRDASGGFLGSFCHSLGWKTSFYSELYVVILAIEIAHDKGWVYLWLE  145

Query  187  CDSKPLVEAL--RQGDGDGHL---LNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
             DS  +V     R      +L    NN   L IR+     + R+ HI+RE N +ADK+A+
Sbjct  146  SDSVSVVACFSSRSFSPTWNLRVRWNN-CLLIIRQM----NFRYSHIFREGNIVADKMAN  200

Query  352  MAFSQ  366
            +  S 
Sbjct  201  LGLSN  205



>ref|WP_013275740.1| ribonuclease H [Thermosediminibacter oceani]
 ref|YP_003825321.1| ribonuclease H [Thermosediminibacter oceani DSM 16646]
 gb|ADL07698.1| ribonuclease H [Thermosediminibacter oceani DSM 16646]
Length=142

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G A  G V+ D NG  L+     IG+ T ++AE   ++  L+   + G   + +
Sbjct  11   ASRGNPGDAGIGIVILDENGNTLKEISDYIGQTTNNIAEYTALVTALKEALEMGCEEIGI  70

Query  184  ECDSKPLVEALRQGDGDGHLLNN-IARLCIREAE---DFPDLRFVHIYREQNRLADKLA-  348
              DS+ +V   +Q +G+  + N  I RL  +  E   +F      HI REQN+ AD+LA 
Sbjct  71   FSDSELMV---KQINGEYQIKNEGIKRLYAQAMELLKEFKRFSISHIRREQNKRADELAN  127

Query  349  ---DMAFSQQE  372
               D+A S++E
Sbjct  128  EGIDLAVSEEE  138



>ref|XP_002535256.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27126.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 8/115 (7%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G+A+ GG++RD NG W+RGF   +G  +   AE  G+  GL +    G++ +VLE  +  
Sbjct  10   GRASLGGLIRDHNGDWIRGFMANLGVYSVMFAELQGIYHGLCLAWSKGIKKVVLEAYNLS  69

Query  202  LVEAL-RQGDG---DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            +   L R  DG   +  L+  I ++  RE +    ++  HI +E N+ A+ LA+M
Sbjct  70   IKMVLNRAKDGCIQNIALVKEIRKMITREWQ----IQVTHINQEGNKCANLLANM  120



>gb|AID21608.1| At4g21420p-like protein [Arabidopsis halleri]
Length=195

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D SR  +GQA+ GG+ R+    ++ G+   IG  T+ +AE   + +GL +  + G+  L 
Sbjct  42   DGSRGREGQASIGGIFRNHKAGFVLGYSESIGEATSTMAEFAALKRGLELALENGLTDLW  101

Query  181  LECDSKPLVEAL-RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            LE D+K +++ + ++G       N           +  +    H+YRE NR+ADKLA + 
Sbjct  102  LEGDAKIIMDIISKRGRLRCERTNKHVNYINVVMPELSNCVLSHVYREGNRVADKLAKLG  161

Query  358  FSQQEDHI  381
               Q+  +
Sbjct  162  HQFQDPKV  169



>ref|XP_008245516.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=203

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  49   RDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGD  228
            RDS G W+ GF   +G   T  AE WG+  GL++    GV  L +E DS   V+ ++Q  
Sbjct  63   RDSFGDWMGGFAVNLGIGQTLDAELWGLFFGLKLAVAKGVARLSIEMDSMTAVQLIKQHV  122

Query  229  GD-GHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQ  366
                H    +   C+     F  +   H+YRE+N  AD LA+ + + 
Sbjct  123  PSCHHPCAGVIASCVALMRKFESVELTHVYRERNVAADCLANWSLNM  169



>ref|XP_008371252.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=212

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    DCSRRN-DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR++  G ++ GG+LR +   W+ GF   IG  +   AE WG+  GL +    G R +
Sbjct  57   DGSRKSGKGCSSAGGILRAAADVWIAGFTINIGVGSVLNAELWGLYHGLTLAWRLGYRKV  116

Query  178  VLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            ++E DS   V  +   +   H L ++   C             H+YRE+NR+ D +A +
Sbjct  117  LVELDSVMAVTLIMDFNSSMHPLAHLITACRELLRKDWICSVSHVYREKNRVVDGMAAL  175



>ref|XP_007019605.1| Uncharacterized protein TCM_035716 [Theobroma cacao]
 gb|EOY16830.1| Uncharacterized protein TCM_035716 [Theobroma cacao]
Length=165

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+ N   AT GG+LRD  G+ + GF    G   +  AE   + +GL + +DYG+  L +
Sbjct  19   SSKCNFQNATSGGILRDYTGSLVFGFYENFGVKNSIQAELLALYKGLILCRDYGISHLWI  78

Query  184  ECDSKPLVEALR---QGDGDG-HLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
            E D+  +++ L    +G  D  +LL NI  L      ++   +  HI++E N+ AD L +
Sbjct  79   EMDALVVIQMLTGRYRGSHDSRYLLANIQNL-----HNYFSYKLSHIFQEGNQAADLLVN  133

Query  352  MAF  360
            + +
Sbjct  134  LGY  136



>ref|XP_006469101.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=684

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D S R    A  GG+LRDS G W+ GF   IG  +  +AE WG+ QGLR+  D G++ L+
Sbjct  558  DGSCRKSEGAGAGGILRDSVGHWISGFCLNIGESSVLMAELWGLYQGLRIAWDTGIKCLL  617

Query  181  LECDS  195
            +E DS
Sbjct  618  VEVDS  622



>ref|WP_026476332.1| hypothetical protein [Alkaliphilus transvaalensis]
Length=133

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 7/126 (6%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G+A  G +L D  G  ++     IG+ T +VAE   + +GL    D GV  +   
Sbjct  11   SRGNPGEAGIGILLEDEQGEVIKEISQYIGKQTNNVAEYQALYKGLETALDLGVNDITCY  70

Query  187  CDSKPLVEALRQGDGDGHLLNN----IARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             DS+ +V+ ++   G+  + N     I ++ +     F   +  H+ RE N+ AD LA++
Sbjct  71   LDSELVVKQIK---GEYKVKNEGLIPIYQMVLPLTRKFQSFKIQHVRREHNKRADALANL  127

Query  355  AFSQQE  372
            A  ++E
Sbjct  128  AMDRKE  133



>ref|XP_009134753.1| PREDICTED: uncharacterized protein LOC103859019 [Brassica rapa]
 emb|CDX79059.1| BnaA01g11260D [Brassica napus]
Length=200

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 21/134 (16%)
 Frame = +1

Query  13   RNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECD  192
            R  GQA+ GG+ R+  G ++ G+   IG  T+ VAE   + +GL +V + G   L LE D
Sbjct  51   RKHGQASIGGIFRNHKGEFILGYSEPIGAATSTVAEFAALKRGLELVLENGWTDLWLEGD  110

Query  193  SKPLVEALRQGDGDGHLLNNIARLCIREAED--------FPDLR---FVHIYREQNRLAD  339
            +K +++          +++   RL  +EA+          P L      H+YRE NR AD
Sbjct  111  AKIIMD----------IISKRGRLRCQEAKKHVNYINVVMPGLSNCVLSHVYREGNRAAD  160

Query  340  KLADMAFSQQEDHI  381
            KLA +    Q+  +
Sbjct  161  KLAKLGHQFQDPKV  174



>ref|XP_008383873.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=389

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 2/117 (2%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G A CGGV RDS G +L GF   +G  T+  AE   V+  + +    G + L LE
Sbjct  237  AKGNPGPAACGGVFRDSTGYFLGGFSLSLGHRTSFYAELHAVILAIELAHARGWKNLWLE  296

Query  187  CDSKPLVEALRQGDGDGHL-LNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             DS  ++     G       L      C    ++    R  HI+RE N +ADKLA++
Sbjct  297  SDSSSVISCFASGSFSPPWSLQTRWNNCTLHLQNM-VFRCSHIFREGNVVADKLANL  352



>gb|ABN09101.1| Ribonuclease H [Medicago truncatula]
Length=170

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 56/115 (49%), Gaps = 8/115 (7%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N G+A  GG++R+  G W+ GF    GR +  + E + +L GL++  D G R + LE D 
Sbjct  23   NPGRAGFGGLIRNDVGGWIHGFSESCGRVSNLLVELYAILNGLQLAWDLGFRIITLEPDY  82

Query  196  KPLVEALRQGDGDGH----LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            K  ++ +   D   H    +L  I  L  R+      L F H  RE N  AD LA
Sbjct  83   KSALDLILDNDTTYHPHAIVLGRIRTLMSRDWS----LLFNHTLREGNECADWLA  133



>ref|XP_008383853.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=204

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 4/129 (3%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+   G+A+ GGV R+    +L GF   IG   + +AE   + +GL +V + G R + L
Sbjct  51   SSKGKTGKASIGGVFRNHKAEFLLGFAESIGEANSTIAELXALKRGLELVLENGFRDVWL  110

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLR---FVHIYREQNRLADKLADM  354
            E D+K L++ + +   D      + R         P L      H+YRE NR ADK A +
Sbjct  111  EGDAKALLDIIVKRKKDFKCA-EVQRQVNDVNSILPKLNGCIVSHVYREGNRAADKFAQI  169

Query  355  AFSQQEDHI  381
                +E  I
Sbjct  170  GHQLEEPRI  178



>ref|XP_007025838.1| Polynucleotidyl transferase [Theobroma cacao]
 gb|EOY28460.1| Polynucleotidyl transferase [Theobroma cacao]
Length=285

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G+A+ GGV R+    +L G+   IGR T+ +AE   + +GL +V + G   + LE D+K 
Sbjct  56   GKASIGGVFRNHKAEFLLGYAESIGRSTSTIAELAALRRGLELVLENGWTDVWLEGDAKT  115

Query  202  LVEAL--RQGDGDGHLLNNIARLCIREAEDFPDLR---FVHIYREQNRLADKLADMAFSQ  366
            LV+ +  R+      L  +++ + +      P+L      HIYRE NR ADKLA +    
Sbjct  116  LVDVIVQRRQVKCAELQRHVSHINL----IIPELNNCIVTHIYREGNRAADKLAQIGHQL  171

Query  367  QEDHI  381
            ++  I
Sbjct  172  KKPQI  176



>ref|XP_006599770.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=289

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N GQA  GG++RD+ G W  GF    G  T+  AE   +  GL++ +D G+  L+ E D 
Sbjct  142  NLGQAGFGGIIRDNLGNWHTGFMGSCGFTTSVHAELLAIYHGLKIARDIGIGRLICESDL  201

Query  196  KPLVEALRQGDGDGH-LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQE  372
            K  ++ +       H     I  +   +  D+ ++ FVH+YRE N+ AD  A    S Q+
Sbjct  202  KVALDLITGEINMFHQYFPTIMLIHSLKHMDW-EVTFVHVYREGNKCADWFAKTGNSSQQ  260

Query  373  DHIlletppleteellALDRVGAASTRRV  459
              I+L+  P    +    D +G  + R +
Sbjct  261  GMIILDHRPSPIYQAYLGDAMGVTTQRMI  289



>ref|XP_004305144.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=183

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 57/126 (45%), Gaps = 8/126 (6%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G A CGGV RD  G ++ GF   IG      +E   V+ G+ +    G + + LE
Sbjct  34   AKGNSGPAACGGVFRDYQGHFIGGFSTPIGHHNAFFSELLAVIIGIELTFQLGWQHVWLE  93

Query  187  CDSKPLVEALRQGDG-DGHLLNNIARLC---IREAEDFPDLRFVHIYREQNRLADKLADM  354
            CDS  +VE   +        L  +   C   IR    F      H+ RE N +AD+LA++
Sbjct  94   CDSTSVVECFSKSSFVPPWQLRTLWYNCAARIRSMSFFCS----HVLREGNTVADRLANL  149

Query  355  AFSQQE  372
              S   
Sbjct  150  GMSSSS  155



>ref|WP_038506228.1| hypothetical protein [Leptospirillum ferriphilum]
 gb|AIA31129.1| ribonuclease H [Leptospirillum ferriphilum YSK]
Length=134

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 7/123 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G ++ G +L+D +G  +   G  +   T + AE   ++ GL+  +D GVR L++
Sbjct  8    ASRGNPGPSSIGYLLKDEDGRVIFSEGRILPPGTNNQAEYQALIAGLQAARDRGVRNLLV  67

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAED----FPDLRFVHIYREQNRLADKLAD  351
              DS+ ++   RQ  G   + N     C  +A +    F  ++F HI REQN  AD+LA+
Sbjct  68   RADSELMI---RQMTGKYRVRNPGLLACYEQATNLSRSFDTIQFEHIPREQNAQADRLAN  124

Query  352  MAF  360
             A 
Sbjct  125  EAL  127



>ref|XP_008382509.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=350

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
               + GG++R+S G W++GF   +GR T   AE WGVL GL +  D G R ++LECDS  
Sbjct  262  SHISAGGLIRNSEGDWIKGFAANLGRGTIMEAELWGVLMGLSIAWDEGCRDVILECDSWD  321

Query  202  LVEALRQGDGDGHLLNNIARLCIREAE  282
             V ++++     + L N+   C    E
Sbjct  322  AVISIQKPILALYPLYNLILDCKEAIE  348



>ref|XP_007203348.1| hypothetical protein PRUPE_ppa020364mg, partial [Prunus persica]
 gb|EMJ04547.1| hypothetical protein PRUPE_ppa020364mg, partial [Prunus persica]
Length=295

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 57/117 (49%), Gaps = 1/117 (1%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            R + G    GGVLRD  G W+ GF   +G+     AE WG+  GL +  +  +  +V+E 
Sbjct  144  RGSTGAIDAGGVLRDHLGQWIAGFAVNLGQGEVLDAELWGLFFGLNLAVEKNLDDIVIEM  203

Query  190  DSKPLVEALRQGD-GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
            DS  ++  +      D H    +   C R    F  ++  HIYRE+N +AD LA  +
Sbjct  204  DSDTVMLLIESKVLNDCHPNAGLVSSCKRLMNLFRRIKLQHIYRERNDVADGLATWS  260



>ref|WP_014961913.1| ribonuclease H [Leptospirillum ferriphilum]
 ref|YP_006767369.1| ribonuclease H [Leptospirillum ferriphilum ML-04]
 gb|EAY56702.1| putative ribonuclease H [Leptospirillum rubarum]
 gb|AFS54409.1| putative ribonuclease H [Leptospirillum ferriphilum ML-04]
Length=134

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 7/123 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G ++ G +L+D +G  +   G  +   T + AE   ++ GL+  +D GVR L++
Sbjct  8    ASRGNPGPSSIGYLLKDEDGRVIFSEGRILPPGTNNQAEYQALIAGLQAARDRGVRNLLV  67

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAED----FPDLRFVHIYREQNRLADKLAD  351
              DS+ ++   RQ  G   + N     C  +A +    F  ++F HI REQN  AD+LA+
Sbjct  68   RADSELMI---RQMTGKYRVRNPGLLACYEQATNLSRSFDTIQFEHIPREQNAQADRLAN  124

Query  352  MAF  360
             A 
Sbjct  125  EAL  127



>ref|XP_007017129.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
 gb|EOY34748.1| Uncharacterized protein TCM_042328 [Theobroma cacao]
Length=910

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D S ++   A  GG+LRD  G  + GF   +G   +  AE   + +GL + +DY +R L 
Sbjct  760  DGSAKHSHNAAGGGILRDHAGVMVFGFSENLGIQNSLQAELLALYRGLILCRDYNIRRLW  819

Query  181  LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
            +E D+  ++  L QG+  G        + +R+       RF HI+RE N+ AD LA+   
Sbjct  820  IEMDAISVIRLL-QGNHRGPHAIRYLMVSLRQLLSHFSFRFSHIFREGNQAADFLANRGH  878

Query  361  SQQ  369
              Q
Sbjct  879  EHQ  881



>ref|XP_007019466.1| Polynucleotidyl transferase, putative [Theobroma cacao]
 gb|EOY16691.1| Polynucleotidyl transferase, putative [Theobroma cacao]
Length=389

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             +R   G A  GG++RD  G W+ GF +KIG   +  AE W +LQGL +    G R + +
Sbjct  278  SARGQPGGAATGGIIRDDKGEWMLGFIHKIGITFSLNAELWALLQGLNLCWRRGFRKVQV  337

Query  184  ECDSKPLVEAL----RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLAD  339
            E DS   ++ L       + + HLL NI  L + +     D R  +I  E N+  D
Sbjct  338  ESDSFLAIQKLLMESNTLEPNVHLLRNIKELLLWDW----DYRIFYIPHEANQCVD  389



>ref|XP_007010351.1| Polynucleotidyl transferase, putative [Theobroma cacao]
 gb|EOY19161.1| Polynucleotidyl transferase, putative [Theobroma cacao]
Length=419

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++   G A  GGV+RD  G W+ GF  KIG   +  AE WG+ QGL +  + G+R   +E
Sbjct  269  AKGQPGLAASGGVIRDEYGNWIAGFCQKIGITFSLTAEPWGIYQGLTLCWNRGLRKFCVE  328

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFP---DLRFVHIYREQNRLADKLA  348
             DS   + AL++      +L+  A+L  R  E      D+   H++RE ++  D + 
Sbjct  329  IDS---MLALQKIYSQSSMLDPNAQLLRRIKELLQQSWDVTISHVHREADQCTDWMT  382



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 3/120 (3%)
 Frame = +1

Query  28    ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLV  207
             A  GGV RD+ G W  GF  ++   + + AE   + +GL++  D     L +ECD+K +V
Sbjct  1221  AGIGGVFRDAVGNWELGFAKRVDAGSPEAAELMAIREGLQVAWDCNYHKLEVECDAKGVV  1280

Query  208   EALRQG-DGDGHLLNNIAR-LCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDHI  381
             + L +  + + H L  I   +CI     +  + F+HI RE N++A  LA  A +Q E+ +
Sbjct  1281  QLLAKPLEAENHPLGVIVMDICILLTRHW-SVEFLHIKREGNKVAHCLAAEAVNQVEERV  1339



>emb|CDP11300.1| unnamed protein product [Coffea canephora]
Length=751

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 7/118 (6%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N G +  G VLRDS G+ LRGF   +G  T   AEA  +L+G+ +  D+    L +E DS
Sbjct  606  NPGSSGAGEVLRDSGGSVLRGFSSFLGSRTNMEAEALALLEGMLLSTDFPF--LQVEMDS  663

Query  196  KPLVEALRQGDG--DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            + L+ A+  G+G     L   I+R  I+       + F H+YRE N +AD LA++A S
Sbjct  664  QVLL-AMVNGNGRIPWTLWKTISR--IQTLARGRQVTFTHVYREANGVADALANLANS  718



>ref|XP_002520194.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42249.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
            + +A+ GGV+RD    WL GFGY IG+C+   A+ W  L GL M    G R ++LE DS 
Sbjct  179  ESRASAGGVIRDCRAGWLSGFGYNIGKCSPLDAKLWEALAGLDMASRQGYRKIILEMDSS  238

Query  199  PLVE  210
              +E
Sbjct  239  LALE  242



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 1/123 (1%)
 Frame = +1

Query  1     DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
             D S +    A  GG+LRD  G  + GF   +G   +  AE   + +GL + +DY +R L 
Sbjct  2101  DGSAKQSHNAAGGGILRDHAGEMVFGFSENLGTQNSLQAELLALYRGLILCRDYNIRRLW  2160

Query  181   LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             +E D+  ++  L QG+  G        + +R+       RF HI+RE N+ AD LA+   
Sbjct  2161  IEMDAISVIRLL-QGNHRGPHAIRYLMVSLRQLLSHFSFRFSHIFREGNQAADFLANRGH  2219

Query  361   SQQ  369
               Q
Sbjct  2220  EHQ  2222



>ref|XP_007031181.1| Uncharacterized protein TCM_026784 [Theobroma cacao]
 gb|EOY11683.1| Uncharacterized protein TCM_026784 [Theobroma cacao]
Length=702

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            R +   A   GVL D N  WL GF  K+GRC++  AE  GVL  LR+ +D G R + L+ 
Sbjct  610  RHSTSLAATSGVLCDYNDFWLGGFAAKLGRCSSYRAELRGVLHSLRIARDKGFRKIWLQV  669

Query  190  DSKPLVEAL  216
            D+K +V+A+
Sbjct  670  DNKIMVQAI  678



>gb|EYU27884.1| hypothetical protein MIMGU_mgv1a013877mg [Erythranthe guttata]
Length=208

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (55%), Gaps = 3/111 (3%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G+ + GG+ RD N  +L G+   IG+  + +AE   +L+GL +V++ G   + LE DSK 
Sbjct  62   GKCSIGGIFRDHNADFLLGYAESIGQSNSTIAELAALLRGLEIVRENGWSDVWLEGDSKS  121

Query  202  LVEAL--RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            LV+ +  ++      +  ++ R+ +   E   +    HIYRE NR ADK A
Sbjct  122  LVDIIAGKREVKCTQVQMHVDRINLIVPE-IKNCIITHIYREGNRAADKFA  171



>ref|WP_015327493.1| ribonuclease HI [Halobacteroides halobius]
 ref|YP_007315870.1| ribonuclease HI [Halobacteroides halobius DSM 5150]
 gb|AGB41777.1| ribonuclease HI [Halobacteroides halobius DSM 5150]
Length=134

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 61/124 (49%), Gaps = 11/124 (9%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKD-YGVRPLVL  183
            SR N G A  G V+ + NG  +      IGR T +VAE   V+ GL+++ D Y    + +
Sbjct  12   SRGNPGPAGVGAVIYN-NGQKVEELFEYIGRATNNVAEYKAVILGLKLLADNYSQAKIEI  70

Query  184  ECDSKPLVEALR-----QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            + DS+ LV+ L      + D    L   I  L      +F  + F HI RE+N+ AD LA
Sbjct  71   KADSQLLVKQLTGEYKVKSDNLKPLYQQIKELIT----NFSKVEFTHIPREENKEADALA  126

Query  349  DMAF  360
            + A 
Sbjct  127  NQAM  130



>gb|EAR82875.2| RNase H family protein [Tetrahymena thermophila SB210]
Length=419

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLR--DSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            CS+ N G A  G +++  ++N   L  F   +G  T + +E   ++ GL +    G++ L
Sbjct  292  CSKGNPGLAGVGFLIKQHENNSQVLESFAVNVGTKTNNQSEYLALIYGLYVSLKIGIQKL  351

Query  178  VLECDSKPLVEALRQGDGDGHLLN-NIAR---LCIREAEDFPDLRFVHIYREQNRLADKL  345
             ++ DS+ ++    Q  G  +  N NI +   LC      F    F H+YREQN+ AD L
Sbjct  352  FIQGDSQLII---YQMTGKYNCSNDNIKKYYELCKMLQSKFQQTSFNHVYREQNKEADHL  408

Query  346  ADMAFSQQ  369
            +++A S+Q
Sbjct  409  SNVAISKQ  416



>ref|XP_007162147.1| hypothetical protein PHAVU_001G128200g [Phaseolus vulgaris]
 gb|ESW34141.1| hypothetical protein PHAVU_001G128200g [Phaseolus vulgaris]
Length=1453

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 8/127 (6%)
 Frame = +1

Query  4     CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             C   N G A  GG+ RD  G WL GF   +G  T   A+ + + QGL    D G R +++
Sbjct  1303  CCNDNPGNAGYGGLFRDVEGKWLGGFYGSLGLATNVKADLFAICQGLITAWDLGYRTVLV  1362

Query  184   ECDSKPLVEALRQGDGD----GHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
             E DS   +  +++ + +    G LL +I  L  R       L  +H  R+ N  AD L+ 
Sbjct  1363  ETDSLEAINLIKEANIEDCAYGDLLADIRSLMQRNWS----LDLIHSLRQDNACADILSK  1418

Query  352   MAFSQQE  372
             +   Q E
Sbjct  1419  LGAEQHE  1425



>ref|XP_002517245.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45145.1| conserved hypothetical protein [Ricinus communis]
Length=153

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            R  +G A+ G ++R + G+WL GF +K+G C+   A+ WGVL GLR+  D G + + L  
Sbjct  51   RLQNGLASAGSLIRSAEGSWLSGFTHKLGSCSPFKAKLWGVLDGLRLAWDKGFKHVDLVI  110

Query  190  DSKPLVEALRQGDGDGHLLN  249
            D     EA++    D H++ 
Sbjct  111  DPS---EAIKVNIEDVHVIK  127



>ref|XP_008803873.1| PREDICTED: putative ribonuclease H protein At1g65750 [Phoenix 
dactylifera]
Length=205

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 66/139 (47%), Gaps = 25/139 (18%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+   G A+ GGV R+  G +L G+  +IG+ T+ VAE     +GL +    G   + +
Sbjct  50   ASKYGTGDASIGGVYRNHEGVFLFGYAERIGKATSSVAELVAAKRGLELAIKNGWFNIWI  109

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDF----------PDLRFV---HIYREQ  324
            E D+K +V+          L+ N  R+  +  ED           P L++    HIYRE 
Sbjct  110  EGDAKGVVD----------LITN--RMRSKSKEDLRHFREISVLIPQLKYFKASHIYREG  157

Query  325  NRLADKLADMAFSQQEDHI  381
            N++A +LA + +   +  I
Sbjct  158  NKVAHRLAKLGYKMHKPQI  176



>ref|XP_004289281.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=215

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 55/123 (45%), Gaps = 2/123 (2%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G ATCGGV RD  G ++ GF   IG      +E   V+ G+ +    G + + LE
Sbjct  66   AKGNPGPATCGGVFRDYQGHFIGGFSTPIGHHNDFFSELLAVIIGIELAFQLGWQHVWLE  125

Query  187  CDSKPLVEALRQGDG-DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            CDS  +VE   +        L  +   C+            H+ RE N +AD+L ++  S
Sbjct  126  CDSTSVVECFSKSSFVPPWQLRTLWYNCVARTRSM-SFFCSHVLREGNIVADRLVNLGMS  184

Query  364  QQE  372
               
Sbjct  185  SSS  187



>ref|XP_008390978.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=200

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 56/121 (46%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D S+ N        VLRD+ G WL  F   +G+      E WG+  GL++  D  +  L 
Sbjct  43   DGSQINTTGNISARVLRDNIGDWL--FSVNLGKGQVVDTEIWGLYFGLKLTVDKSISRLC  100

Query  181  LECDSKPLVEALRQ-GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA  357
             E DS  +V  +    D   H L NI  LC +      +   VH+YRE+N + D + + +
Sbjct  101  EEMDSAFMVNLINNMTDTSFHPLANIIDLCRQLMTRIAECELVHVYREKNMVVDDIPNWS  160

Query  358  F  360
            +
Sbjct  161  Y  161



>ref|XP_007210921.1| hypothetical protein PRUPE_ppb019242mg, partial [Prunus persica]
 gb|EMJ12120.1| hypothetical protein PRUPE_ppb019242mg, partial [Prunus persica]
Length=174

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  34   CGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEA  213
             GG++R+S G W+ GF   +G      AE   +  GL + +   V  L++E DSKP++  
Sbjct  35   AGGLIRNSAGDWIAGFSANLGYGDILKAELSALCHGLELAQRMQVTKLIVETDSKPVLRL  94

Query  214  LRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            L     D H L  +   C    +   D +  H YR+ N  AD LA M
Sbjct  95   LNANLEDHHPLLILRNKCRSYWKSSWDCKINHEYRQVNSAADSLAKM  141



>ref|WP_017873228.1| hypothetical protein [Candidatus Caldatribacterium saccharofermentans]
Length=144

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 7/120 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+ N G++    V+ D +G  L     +IG  T + AE W +L  L  ++ + V+ L +
Sbjct  19   ASKGNPGESAAAFVVCDGDGNVLFEMASRIGIATNNEAEYWALLLALDFLRQWKVKRLSV  78

Query  184  ECDSKPLVEALRQGDGDGHL----LNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
              DS+ LV   RQ  G   +    L+++ +L     + FP     HI RE+NR AD LA 
Sbjct  79   FSDSELLV---RQLQGTYRVRSPRLSSLHQLVKERIQGFPSFTITHIPREKNRRADSLAS  135



>ref|XP_007219947.1| hypothetical protein PRUPE_ppb019489mg [Prunus persica]
 gb|EMJ21146.1| hypothetical protein PRUPE_ppb019489mg [Prunus persica]
Length=516

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 7/122 (6%)
 Frame = +1

Query  4    CSRRNDGQATC-------GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDY  162
            C    DG   C       GG+LRD+ G W++GF   +G  +   AE W +  GL +  + 
Sbjct  356  CKINTDGSRNCVSGFISAGGLLRDNYGAWIKGFFVNLGVGSVLEAELWSIFGGLHLAWES  415

Query  163  GVRPLVLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADK  342
              R + +E D    V  L       H L ++ R C  + +        HI+REQN  AD 
Sbjct  416  SFRVVEVESDFSVAVALLSSSTISTHPLFSLIRCCKLKVQAGWRCSVKHIFREQNVAADV  475

Query  343  LA  348
            LA
Sbjct  476  LA  477



>ref|XP_008340288.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=364

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 2/117 (2%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G A CGGV RDS G +L GF   +G  T+  AE   V+  + +    G + L LE
Sbjct  212  AKGNPGPAACGGVFRDSTGYFLGGFSLSLGHRTSFYAELHAVILAVELAHARGWQNLWLE  271

Query  187  CDSKPLVEALRQGDGDGHL-LNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             DS  ++     G       L      C    ++    R  HI+RE N +ADKLA++
Sbjct  272  SDSSSVISCFASGSFSPPWSLQTRWNNCTLLLQNM-VFRCSHIFREGNVVADKLANL  327



>ref|XP_007023230.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25852.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=1011

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G A  GGVLRDS+GTW+ G+  K+   +   AE WGV +GL++  + G R + L+ D+K 
Sbjct  901  GIAAAGGVLRDSHGTWIVGYACKLETSSVFRAELWGVYKGLQLAWERGFRKVKLQSDNKA  960

Query  202  LVEAL  216
            +V+A+
Sbjct  961  VVQAI  965



>ref|XP_008349924.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=153

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (44%), Gaps = 17/126 (13%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDV-AEAWGVLQGLRMVKDYGVRPLVLECDS------  195
            GGV+R+ +G WL GF   +G     + AE W + +GL +  +YG  P+ +E DS      
Sbjct  4    GGVIRNQDGEWLSGFAENLGTGKKPIEAEVWALYRGLELAWNYGWYPIEVETDSAMAVTL  63

Query  196  ----------KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKL  345
                       P    + +         N+ R C+       +    H+YR++N +AD L
Sbjct  64   VFSPVQLYPKHPQFNLIHKSLNQIRNSENLIRNCLNLLNQIQNYSLQHVYRQKNSVADFL  123

Query  346  ADMAFS  363
            A+   +
Sbjct  124  ANFGLT  129



>ref|XP_002524702.1| nuclease, putative [Ricinus communis]
 gb|EEF37721.1| nuclease, putative [Ricinus communis]
Length=201

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
            +G+ + GGV R+    +L G+   IGR T+ +AE   + +GL +V + G   + LE D+K
Sbjct  54   EGKGSIGGVFRNHKAEFLLGYAESIGRSTSTIAELAALRRGLELVLENGWSNVWLEGDAK  113

Query  199  PLVEAL--RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQE  372
             L+E +  R+      +  +++ + +   E   +    H+YRE NR ADKLA +    Q+
Sbjct  114  TLLEIIVKRRKVRCAQMQRHVSDINLIIPE-LDNCIVSHVYREGNRAADKLAQIGHQLQK  172

Query  373  DHI  381
              I
Sbjct  173  PKI  175



>ref|XP_006601510.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=191

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 69/142 (49%), Gaps = 6/142 (4%)
 Frame = +1

Query  25   QATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPL  204
            +A CGGV+R  NG +L GF   +G  +    E WG+  G++     G   +V+E +S+ +
Sbjct  49   EAACGGVIRYHNGKFLVGFSVGLGSVSVVAVELWGIFYGIQTTLKKGFLYIVVESNSEEV  108

Query  205  VEALRQGDGDGHLLNNIARL-CIREAEDFPDLRFV--HIYREQNRLADKLADMAFSQQED  375
            V  +       H   N++ +  I +    P  RFV  H+  EQN++ D +   A      
Sbjct  109  VNLIENSGLITH--PNVSLVEEIHKMSKLPS-RFVVKHVLWEQNKVVDVMTKGALGAVSL  165

Query  376  HIlletppleteellALDRVGA  441
             +L E+PP+     + LD VG+
Sbjct  166  LVLFESPPMFVASSIVLDVVGS  187



>ref|XP_007043335.1| Uncharacterized protein TCM_007760 [Theobroma cacao]
 gb|EOX99166.1| Uncharacterized protein TCM_007760 [Theobroma cacao]
Length=190

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = +1

Query  43   VLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQ  222
            VL  S+GTW+ G+  K+G C+T  AE WGV QGL++  + G R   L+ D+K +V+    
Sbjct  51   VLGSSDGTWVMGYARKLGTCSTYRAELWGVFQGLQLDWEQGFRKFKLQIDNKAVVQF--P  108

Query  223  GDGDGHLLNNIARLCIREAEDFP----DLRFVHIYREQNRLADKLADMAF  360
                 H  +N+    IR  +D      ++    + +E+N++ D + ++ F
Sbjct  109  NTLSVHPCSNLD--VIRAIKDLLSRHWEVNISQVCKEENKVVDFMTNLGF  156



>ref|WP_022914789.1| bifunctional RNase H/acid phosphatase [Frankia sp. Iso899]
Length=394

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 8/123 (7%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDS-NGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            SR N G A  G V+ D+  G  L      IG  T +VAE  G+L GL   K+ G R + +
Sbjct  20   SRGNPGPAGYGAVVIDAATGEVLAERKQSIGVETNNVAEYQGLLAGLTAAKELGARSVAV  79

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAED----FPDLRFVHIYREQNRLADKLAD  351
              DSK +VE   Q  G   + +   R   R+A D    F ++ F  I REQN+ AD+LA+
Sbjct  80   RMDSKLVVE---QMSGRWQVKHPAMRPLARQAADLKRAFDEVTFTWIPREQNKYADRLAN  136

Query  352  MAF  360
             A 
Sbjct  137  EAM  139



>gb|ABN08768.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=275

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 55/118 (47%), Gaps = 17/118 (14%)
 Frame = +1

Query  1    DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
            D + + D     GG+ R++ G W+ GF + + RC   ++E  GV  GL++ ++ G   + 
Sbjct  138  DVASKRDIPTGSGGLFRNAEGKWISGFSHNLSRCNAYLSELCGVFDGLQIARERGFSKVE  197

Query  181  LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            L  DS  +V  L Q   DG                  +++  H YRE N  AD LA+M
Sbjct  198  LHVDSSVVVWTL-QTTKDGSW----------------EVKICHSYREVNSCADTLANM  238



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 53/123 (43%), Gaps = 2/123 (2%)
 Frame = +1

Query  19    DGQATCG--GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECD  192
             D   TCG  G+ R S G W+ GF           AE  G+  GL++   YG + L L  D
Sbjct  1273  DQTRTCGLGGIFRTSEGLWVLGFTKTAYARDALGAELQGIQLGLQLALHYGFKKLALLSD  1332

Query  193   SKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQE  372
              K  VE L Q     ++  N+   C      F D +  H  R+ N LAD+LA      ++
Sbjct  1333  CKKAVELLDQEVTQTNIYTNVLCKCRELGRSFEDFKIRHCRRQDNSLADRLAKYCMETED  1392

Query  373   DHI  381
               I
Sbjct  1393  PEI  1395



>ref|XP_008231862.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=187

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 52/117 (44%), Gaps = 1/117 (1%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            C      +    GVLR S+G W++GF   IG         WG+  GL    D G   +VL
Sbjct  36   CRNGETSRIAASGVLRSSSGMWVKGFAANIGYGQVLDIVLWGIYYGLNFAWDMGCNDVVL  95

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
              DS   V  L +     H L  +   C ++ + +      H+Y E N +AD+LA++
Sbjct  96   VSDSSIAVHLLNKAVDALHPLTTLLWGC-QDIKKYRGCSIYHVYCECNMVADRLANL  151



>ref|XP_010666966.1| PREDICTED: uncharacterized protein LOC104884068 [Beta vulgaris 
subsp. vulgaris]
Length=336

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 73/144 (51%), Gaps = 3/144 (2%)
 Frame = +1

Query  25   QATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPL  204
            +A  GGV R++ G W  GF  K+     + AE   + +GL++  D     L +ECD+K +
Sbjct  175  KAGAGGVFRNATGDWEFGFSKKVDAGLAEAAELMAIREGLQIAWDRNFHNLEVECDAKGV  234

Query  205  VEALRQG-DGDGHLLNNIAR-LCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDH  378
            ++ L    + + H L  I   +CI    D+  + F+HI R+ NR+A +LA  A  Q ++ 
Sbjct  235  IKLLSSPLEAENHPLGVIIMDICILLIMDW-KVDFLHIKRDGNRVAHRLAAEAVDQVDER  293

Query  379  IlletppleteellALDRVGAAST  450
            ++  T     EE    D+   AST
Sbjct  294  VVYITALNSVEEAYFKDKEFVAST  317



>ref|XP_009793852.1| PREDICTED: uncharacterized protein LOC104240675 [Nicotiana sylvestris]
Length=237

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 63/128 (49%), Gaps = 8/128 (6%)
 Frame = +1

Query  1    DCS--RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRP  174
             CS  R N G    GGV R+  G W+ GF   +   T+   E   +L+GL++V    ++P
Sbjct  23   SCSPIRNNYG---IGGVFRNHQGNWIIGFAGSVKEGTSVQIELLALLKGLQIVVQKYLKP  79

Query  175  LVLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            +++E D+  ++   +        + N  RL +++  D P L+   IYREQN + D LA  
Sbjct  80   IIIETDAHAIIGMFKAPTMHFTNIINDCRLLLQQL-DSPPLQV--IYREQNCVPDSLARY  136

Query  355  AFSQQEDH  378
                 ++H
Sbjct  137  GVMHAQEH  144



>ref|XP_008218223.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=204

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    DCSRRNDGQAT-CGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D SR +D +    GG++R+S+G  + GF   +G     V EAW +  GL++    G+  +
Sbjct  49   DGSRVSDSRCIDAGGIIRNSDGILIAGFFANLGHGKVLVVEAWALYYGLKLAWQLGLHQI  108

Query  178  VLECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            ++  D   +V+ +     D H ++ +        E   +   +H+YRE N +AD LA M
Sbjct  109  IVNSDYALVVDMINGEWVDSHPMSVLLTKYREFLESQWNCSILHVYRETNFVADFLAKM  167



>ref|XP_008228893.1| PREDICTED: probable CCR4-associated factor 1 homolog 9 [Prunus 
mume]
Length=405

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 66/124 (53%), Gaps = 12/124 (10%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
            C RR  G    GGV+RDS G W  GF   +G+     AE  G+  GL++V   G+  +++
Sbjct  252  CHRR--GLIGAGGVIRDSEGKWFAGFAVNLGKGGVLEAELQGLYHGLKLVVQKGISHVLV  309

Query  184  ECDSKPLVEALRQGDGDGHLL-----NNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            E DS+  V+ L+    + H L      ++   C+   ++   +   H+YRE+N +AD LA
Sbjct  310  ESDSEIAVKFLQ----NPHRLASCPYRDLMSDCLELMQEIGCVP-THVYREKNSVADYLA  364

Query  349  DMAF  360
            ++++
Sbjct  365  NLSY  368



>ref|XP_008245401.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=161

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            + G    GG++ +S G W+ GF   +G     V E W +  GL++ +   V   ++E DS
Sbjct  12   SSGAIAAGGLICNSAGEWVAGFSANLGHGEILVVELWVLYHGLKLAQRLQVTKFIVETDS  71

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQ  369
               +  L       H L  +  +C    +   D    H++RE N  AD LA M    +
Sbjct  72   TIGLHLLNAKLEPNHPLLTLLNMCKVCWKSSWDYSIFHVFREVNFAADSLAKMGHEME  129



>ref|XP_002523578.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38773.1| conserved hypothetical protein [Ricinus communis]
Length=159

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
            +G A+ GG++R++ G+WL GF +K+G C+   AE WGVL GLR+  D G +  +    S 
Sbjct  44   NGLASAGGLIRNTEGSWLFGFTHKLGSCSPLGAEFWGVLDGLRLAWDKGTKAPIARHWSI  103

Query  199  PLVEALRQGD  228
                A R+ +
Sbjct  104  TCTHACREAN  113



>ref|WP_013496454.1| ribonuclease H [Thermaerobacter marianensis]
 ref|YP_004102881.1| ribonuclease H [Thermaerobacter marianensis DSM 12885]
 gb|ADU52154.1| ribonuclease H [Thermaerobacter marianensis DSM 12885]
Length=140

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 7/123 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             +R N G A  G VL D  G         IG  T +VAE   ++ GL+   ++G R L +
Sbjct  15   AARGNPGPAGIGVVLIDPRGQVAERVARFIGTATNNVAEYTALITGLQRALEHGARRLEV  74

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAED----FPDLRFVHIYREQNRLADKLAD  351
              DS+ +V   RQ +G   + N+  +   R+  D    F  +RFVH+ RE+N+ AD+LA+
Sbjct  75   YSDSELMV---RQLNGQYRVKNDGLKPLYRQVLDLVARFDAVRFVHVPRERNKDADRLAN  131

Query  352  MAF  360
               
Sbjct  132  QGI  134



>ref|WP_014450173.1| ribonuclease H [Leptospirillum ferrooxidans]
 ref|YP_005469819.1| ribonuclease H [Leptospirillum ferrooxidans C2-3]
 dbj|BAM07689.1| putative ribonuclease H [Leptospirillum ferrooxidans C2-3]
Length=134

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 9/127 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G ++ G  L D +G  +R  G ++   T +VAE   ++ GL    + G+R +V+
Sbjct  8    ASRGNPGPSSYGWTLVDESGKCVREAGKRLPEGTNNVAEYEAMVAGLTAACELGIRQVVV  67

Query  184  ECDSKPLVEALR-----QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
              DS+ ++  +      +  G   L   +  L  R    F  + F H+ REQN+ AD LA
Sbjct  68   RADSELVIRQVTGRYKVKSPGLFPLYQKVMELSGR----FDRISFEHVPREQNKRADALA  123

Query  349  DMAFSQQ  369
            +MA  Q 
Sbjct  124  NMALDQS  130



>ref|XP_007021515.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
 gb|EOY13040.1| Non-LTR retroelement reverse transcriptase-like [Theobroma cacao]
Length=208

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 65/126 (52%), Gaps = 8/126 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR +  +A   GVLR ++G W+ GF  +   C+   AE W VL+GL +  D G R + L
Sbjct  58   ASRSSLNRAAARGVLRHAHGNWITGFCLRPKPCSAYRAELWRVLKGLTVAWDSGHRRIDL  117

Query  184  ECDSKPLVEALRQGDG----DGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
            + D+  +V+ +         +  L+  I RL +++      +    ++ E N +AD++A+
Sbjct  118  QIDNSIVVKVINLASTVTSHNYDLIQAIRRLLLKQWV----IEIRRVFHEGNIVADRVAN  173

Query  352  MAFSQQ  369
            M  +Q+
Sbjct  174  MGMTQE  179



>ref|XP_009619020.1| PREDICTED: uncharacterized protein LOC104111114 [Nicotiana tomentosiformis]
Length=187

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 57/111 (51%), Gaps = 3/111 (3%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            N G+    GV R++ G W+ GF   +    +  AE   +  G ++  D G+ P+V++ DS
Sbjct  50   NTGKGGYWGVFRNNRGDWVLGFMGGLTNTDSLRAELQALWMGRKIALDQGLSPIVIDTDS  109

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            + +++ L+ G+      N I   C    E   +L   H YREQN++AD LA
Sbjct  110  EVMLKMLKHGNLTH---NPIISECRYVIEQLVNLVIGHSYREQNQVADLLA  157



>ref|XP_007212490.1| hypothetical protein PRUPE_ppa019260mg, partial [Prunus persica]
 gb|EMJ13689.1| hypothetical protein PRUPE_ppa019260mg, partial [Prunus persica]
Length=169

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 11/123 (9%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+   G+A+ GG+ R+    +L G+   IGR  + +AE   + +GL +V + G   + L
Sbjct  17   SSKGKAGKASIGGLFRNHKADFLLGYAEPIGRANSIIAELAALRRGLELVLENGWSDVWL  76

Query  184  ECDSKPLVEALRQ------GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKL  345
            E D+K L++ + Q       +   H+ +    L I E     +    HIYRE NR ADK 
Sbjct  77   EGDAKTLLQIIAQRRQIRCAEAQRHISH--INLIIPEIN---NCILTHIYREGNRAADKF  131

Query  346  ADM  354
            A M
Sbjct  132  AQM  134



>ref|XP_009799760.1| PREDICTED: uncharacterized protein LOC104245789, partial [Nicotiana 
sylvestris]
Length=353

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 25/114 (22%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL  216
            GG++R+SN  W+  F   + + T+  AE   +L GL++V +Y ++P  LE D+K +V+ L
Sbjct  169  GGIIRNSNVEWILSFSRTVPKGTSVSAELHVLLTGLKLVHEYNLQP--LEVDAKEIVKIL  226

Query  217  RQGDGDGHLLNNIARLCIREAEDFPDLRFV----------HIYREQNRLADKLA  348
            +        +NNI+      A    D R++          H Y+EQNR+A++LA
Sbjct  227  Q--------INNISF-----ANMLKDCRYLLNQLGNPVVQHAYKEQNRVANQLA  267



>ref|XP_004308642.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=214

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDS  195
            +   A  G ++RDS G  +      +G  +  VAEA  +   L  VK+ G   +V+E DS
Sbjct  93   SSNSAASGAIIRDSKGNPILASTRNLGSTSVPVAEATALRDSLLSVKEKGFIDVVVEGDS  152

Query  196  KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKL  345
            K +++ + Q       ++ I     + AE F  + F H+YRE N  AD +
Sbjct  153  KLVIDVMTQKINPPWRIHQIVDDIRKIAESFSSISFHHVYREANFAADAV  202



>ref|XP_010229762.1| PREDICTED: uncharacterized protein LOC104582121 [Brachypodium 
distachyon]
Length=210

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 54/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
             G+A+ GG +RD NG  L  F  +       V E   +++GL++  D G R L++E D  
Sbjct  62   SGRASIGGAIRDGNGRVLLAFAERTAHAPVGVVEGRALIRGLQLALDLGCRRLLVEGDDL  121

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDH  378
             LV  LR       +   +    I   + F      H+YRE N +AD L   A+   E  
Sbjct  122  TLVRLLRCESAQTRISPEMLDRIIWLLDSFDVCEVQHVYREGNAVADALCHEAYKTAEGR  181

Query  379  I  381
            +
Sbjct  182  V  182



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = +1

Query  1     DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
             D S +    A  GGVLRD  G  + GF   +G   +  AE   + +GL + +DY +R L 
Sbjct  2099  DGSAKLSQNAAGGGVLRDHAGVMVFGFSENLGIQNSLQAELLALYRGLILCRDYNIRRLW  2158

Query  181   LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             +E D+  ++  L QG+  G        + IR+       R  HI+RE N+ AD LA+   
Sbjct  2159  IEMDAASVIRLL-QGNQRGPHAIRYLLVSIRQLLSHFSFRLSHIFREGNQAADFLANRGH  2217

Query  361   SQQ  369
               Q
Sbjct  2218  EHQ  2220



>ref|XP_008225019.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=200

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 11/122 (9%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            S+   G+A+ GG+ R+    +L G+   IGR  + +AE   + +GL +V + G   + LE
Sbjct  49   SKGKAGKASIGGLFRNHKADFLLGYAEPIGRANSIIAELAALRRGLELVLENGWSDVWLE  108

Query  187  CDSKPLVEALRQ------GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
             D+K L++ + Q       +   H+ +    L I E     +    HIYRE NR ADK A
Sbjct  109  GDAKTLLQIIAQRRQIRCAEAQRHISH--INLIIPEIN---NCILTHIYREGNRAADKFA  163

Query  349  DM  354
             M
Sbjct  164  QM  165



>ref|XP_004301685.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=149

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 0/98 (0%)
 Frame = +1

Query  61   GTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGDGDGH  240
            G WL GF  K+G      AE WG+L+G+ M   +G   L +E DS   V+ +       H
Sbjct  13   GEWLNGFSAKLGIGQVLEAELWGLLKGMEMAWQHGCNSLEVEVDSLVAVKLVLSVIDHLH  72

Query  241  LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             L ++   C        ++  +H+YRE N +AD LA +
Sbjct  73   PLYSLIANCQEFLSRNWNVSLIHVYRESNSVADLLASI  110



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 41/142 (29%), Positives = 63/142 (44%), Gaps = 0/142 (0%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL  216
            GG+LRD+ G W++GF   +G  +   A+ WG+  GL +  +   R +  E DS   V  L
Sbjct  735  GGLLRDNYGAWIKGFSVNLGVGSVLEAKLWGIFLGLHLAWESSFRFVEAESDSSVAVALL  794

Query  217  RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDHIlletp  396
                   H L ++   C  + +        HI+REQN  AD LA  +             
Sbjct  795  SSSTISTHPLFSLMSCCKLKVQAGWRFSIKHIFREQNVAADVLASKSSEFGPGVRYFTEV  854

Query  397  pleteellALDRVGAASTRRVC  462
            P      LA+D +G + +R +C
Sbjct  855  PAFLVNCLAVDAIGVSRSRVIC  876



>gb|EKD30269.1| ribonuclease H [uncultured bacterium (gcode 4)]
Length=135

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 8/125 (6%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            +R N G A  G  + D NG  L      +G  T + AE  G L G+R   + G   + L 
Sbjct  11   ARNNPGPAGIGVFITDENGKPLERRHKYLGIATNNQAEYQGALHGIRRGIELGATEIELR  70

Query  187  CDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPD-----LRFVHIYREQNRLADKLAD  351
             DSK +VE L    G+  + N   ++  RE +D  +     ++ +HI RE N  AD+L++
Sbjct  71   MDSKLVVEQL---SGNFKIKNPELKIIFREIQDLLEAWCGRIQHIHIRREHNGEADRLSN  127

Query  352  MAFSQ  366
            +A  +
Sbjct  128  VAMDE  132



>gb|KFE63543.1| ribonuclease H [Hyalangium minutum]
Length=208

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 7/126 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             +R N G +  G VL +  GT +   G  +G  T + AE  G+L GL+  K  G + + +
Sbjct  85   AARGNPGPSGAGAVLIEPGGTVVAKVGKYLGTQTNNYAEYMGLLLGLKHAKSLGAKEIEV  144

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREA----EDFPDLRFVHIYREQNRLADKLAD  351
              DS+ L+   RQ  G   + +   R    EA     DF  ++ VH+ RE N  AD++++
Sbjct  145  FADSELLI---RQLGGRYQVKSPTLRPLYEEAVKLLNDFSRVKLVHVPREMNAAADEMSN  201

Query  352  MAFSQQ  369
             A  ++
Sbjct  202  RAIDER  207



>ref|XP_010229775.1| PREDICTED: uncharacterized protein LOC104582129 [Brachypodium 
distachyon]
Length=211

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 54/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  19   DGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSK  198
             G+A+ GG +RD NG  L  F  +       V E   +++GL++  D G R L++E D  
Sbjct  63   SGRASIGGAIRDGNGRVLLAFAEQTAHAPVGVVEGRALIRGLQLALDLGCRRLLVEGDDL  122

Query  199  PLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFSQQEDH  378
             LV  LR       +   +    I   + F      H+YRE N +AD L   A+   E  
Sbjct  123  TLVRLLRCESAQTRISPEMLDRIIWLLDSFDVCEVQHVYREGNAVADALCHEAYKTAEGR  182

Query  379  I  381
            +
Sbjct  183  V  183



>ref|XP_008233465.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=547

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/107 (31%), Positives = 55/107 (51%), Gaps = 1/107 (1%)
 Frame = +1

Query  46   LRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEAL-RQ  222
            +R+S+G W+ GF   +GR     AE WG+  GL++  D  +  LV+E DS  +V+ + +Q
Sbjct  403  IRNSSGDWISGFAVNLGRGQILEAEIWGLFFGLKLAVDKEINNLVVEMDSALVVQLIQKQ  462

Query  223  GDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            G  D H    +   C             H+Y E+N +A+ LA  +++
Sbjct  463  GLTDVHPFAALVASCWELMHKINCCSVCHVYIERNSIANCLATWSYN  509



>ref|WP_033430344.1| acid phosphatase [Saccharothrix syringae]
Length=376

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 7/125 (6%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            SR N G A  G V+ D++G  L      IG  T +VAE  G+L GLR   + G   +V+ 
Sbjct  11   SRGNPGPAGYGAVVLDADGAVLAERSAGIGVATNNVAEYQGLLAGLRAAAELGASEVVVR  70

Query  187  CDSKPLVEAL----RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
             DSK +VE +    +        LN  AR   RE   F  + +  + RE+N+ AD+LA+ 
Sbjct  71   MDSKLVVEQMSGRWKVKHPAMQPLNAQARELARE---FARVGYEWVPRERNKRADRLANE  127

Query  355  AFSQQ  369
            A  +Q
Sbjct  128  AMDEQ  132



>ref|WP_023524696.1| Putative ribonuclease H [Leptospirillum ferriphilum]
 gb|EDZ40159.1| Putative ribonuclease H [Leptospirillum sp. Group II '5-way CG']
 gb|EIJ76144.1| Putative ribonuclease H [Leptospirillum sp. Group II 'C75']
 gb|KGA94527.1| Phosphoglycerate mutase family [Leptospirillum ferriphilum]
Length=134

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 63/123 (51%), Gaps = 7/123 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             SR N G ++ G +L+D  G  +   G  +   T + AE   ++ GL+  +D GVR L++
Sbjct  8    ASRGNPGPSSIGYLLQDEEGRVIFSEGRVLPPGTNNQAEYQALIAGLQAARDRGVRNLLV  67

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAED----FPDLRFVHIYREQNRLADKLAD  351
              DS+ ++   RQ  G   + +     C  +A +    F  ++F HI REQN  AD+LA+
Sbjct  68   RADSELMI---RQMTGKYRVRHPGLLACYEQATNLSRSFDTIQFEHIPREQNAQADRLAN  124

Query  352  MAF  360
             A 
Sbjct  125  EAL  127



>gb|EMS61533.1| putative disease resistance RPP8-like protein 4 [Triticum urartu]
Length=1043

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 59/122 (48%), Gaps = 2/122 (2%)
 Frame = +1

Query  16    NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVA-EAWGVLQGLRMVKDYGVRPLVLECD  192
             N  + T G VLRD  G ++ G   KI  C   +A EA  +  GL + +  G   LV+  D
Sbjct  899   NTLRGTVGAVLRDDRGKFIAGANEKIDWCADILAAEALALRYGLSLAQRIGCNRLVINSD  958

Query  193   SKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMA-FSQQ  369
             +  ++E +  G G       I   C   A DFP  RF H  RE N++A +LA +A FS  
Sbjct  959   NLEVIETMNNGGGHAIAAAVIFDDCYYLACDFPISRFEHCNREANKVAHELARLARFSAT  1018

Query  370   ED  375
              D
Sbjct  1019  YD  1020



>ref|XP_006576371.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
 ref|XP_006576373.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Glycine max]
 ref|XP_006576374.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Glycine max]
 ref|XP_006576375.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X3 [Glycine max]
 ref|XP_006576376.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X4 [Glycine max]
 ref|XP_006576378.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Glycine max]
 ref|XP_006576379.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Glycine max]
 ref|XP_006576380.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X3 [Glycine max]
 ref|XP_006576381.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X4 [Glycine max]
Length=223

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 20/128 (16%)
 Frame = +1

Query  16   NDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDV-AEAWGVLQGLRMVKDYGVRPLVLECD  192
            N G A  GGVLRD  G ++ GF   +  C++ + AE W +  G++ V   G R L++E D
Sbjct  82   NKGAA--GGVLRDWKGEFILGFSDALIECSSALEAELWAIKIGMQTVVARGYRNLIVESD  139

Query  193  SKPLVEALRQGDGD------GHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            S   ++ +    GD       H+   + R+C           + H+YRE N +AD  A  
Sbjct  140  SLKAIQIINAHKGDFLRSSIQHMTRMVDRIC-----------WNHVYRETNSVADGFAKH  188

Query  355  AFSQQEDH  378
              S  +D 
Sbjct  189  GLSLSQDQ  196



>ref|XP_008220882.1| PREDICTED: uncharacterized protein LOC103320918 [Prunus mume]
Length=687

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = +1

Query  1    DCSRRNDGQATCG-GVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPL  177
            D S + D    C   +LRDSNG W+ GF   IG      AE W + +GL MV D G+R L
Sbjct  591  DGSCKTDSWKICAVCLLRDSNGAWICGFSANIGIGNIYEAELWSLFRGLHMVWDKGIRSL  650

Query  178  VLECDSKPLVEALRQGDGDGH  240
             +ECDS  +V  + +     H
Sbjct  651  DIECDSLSVVSLIVKACNHSH  671



>ref|XP_008441930.1| PREDICTED: putative ribonuclease H protein At1g65750 [Cucumis 
melo]
Length=204

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G A+ GGVLRD    +L G+   IGR  + +AE   + +GL +V + G + + +E D K 
Sbjct  58   GLASIGGVLRDHKAQFLLGYAEAIGRANSAMAELTALTKGLELVLENGWKDVWVEGDDKG  117

Query  202  LVEALRQGD-----GDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
            LVE L                 I  L +    D  + +  HIYRE N++AD+ A +
Sbjct  118  LVEILADNKEVKCVETRSYFRYIKSLIL----DLDNCKVSHIYREGNKVADRFASI  169



>ref|XP_002523020.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39362.1| conserved hypothetical protein [Ricinus communis]
Length=147

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 58/114 (51%), Gaps = 11/114 (10%)
 Frame = +1

Query  10   RRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLEC  189
            +R+ G A   GVLR S+G  + GF   +G C+  + E W VL GLRM     +R + LE 
Sbjct  39   KRSSGCANSRGVLRTSDGKLVVGFMVNLGNCSVLMVELWSVLYGLRMSLQQDIRRIELEV  98

Query  190  DSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
            D+K +++          ++ NI++L      D+  +R  +IYRE     D + +
Sbjct  99   DNKVVID----------MILNISQLPYNCNRDWI-MRSKNIYRESTMYFDHMVN  141



>gb|EKD84584.1| ribonuclease H [uncultured bacterium]
Length=135

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 6/124 (5%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKD-YG--VRP  174
             SR N G A+ G  + + +G  L   G  IG  T +VAE   VL+ L+ VK+ Y   +R 
Sbjct  10   ASRGNPGHASYGFTISNEDGKLLHESGKYIGIATNNVAEYMAVLEALKYVKEKYSKDLRS  69

Query  175  LVLECDSKPLVEAL--RQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            + L  DSK + E L  R      HL   I  + I   E    + F H+ R +N  AD+LA
Sbjct  70   IELFADSKLVAEQLSGRYKVKSAHLKPLIGSIKILVLE-LGGVLFTHVPRAKNAEADRLA  128

Query  349  DMAF  360
            ++A 
Sbjct  129  NLAL  132



>ref|WP_017889809.1| hypothetical protein [Candidatus Caldatribacteirum californiense]
Length=144

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 59/120 (49%), Gaps = 7/120 (6%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S+ N G++    V+ D +G  L     +IG  T + AE W +L  L  ++ + V+ L +
Sbjct  19   ASKGNPGESAVAFVVCDGDGNVLFEMASRIGIATNNEAEYWALLLALDFLRQWKVKRLSV  78

Query  184  ECDSKPLVEALRQGDGDGHL----LNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
              DS+ LV   RQ  G   +    L+++ +L     + FP     HI RE+N+ AD LA 
Sbjct  79   FSDSELLV---RQLQGTYRVRSSRLSSLYQLVKERIQGFPSFAITHIPREKNQRADSLAS  135



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 58/123 (47%), Gaps = 1/123 (1%)
 Frame = +1

Query  1     DCSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLV  180
             D S +    A  GGVLRD  G  + GF   +G   +  AE   + +GL + +DY +R L 
Sbjct  2217  DGSAKLSQNAAGGGVLRDHAGVMIFGFSENLGIQNSLKAELLALYRGLILCRDYNIRRLW  2276

Query  181   LECDSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAF  360
             +E D+  ++  L QG+  G          IR+       R  HI+RE N+ AD LA+   
Sbjct  2277  IEMDATSVIRLL-QGNHRGPHAIRYLLGSIRQLLSHFSFRLTHIFREGNQAADFLANRGH  2335

Query  361   SQQ  369
               Q
Sbjct  2336  EHQ  2338



>ref|WP_013682242.1| ribonuclease H [Hippea maritima]
 ref|YP_004340265.1| ribonuclease H [Hippea maritima DSM 10411]
 gb|AEA34206.1| ribonuclease H [Hippea maritima DSM 10411]
Length=177

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 10/126 (8%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G+A  G V++  NG  +      IG  T +VAE   +++GL+ +K+ GV+ + +
Sbjct  56   ASSSNPGKAGIGVVIK-KNGVVVDKISEFIGIATNNVAEYSALIRGLKRLKELGVKKVNV  114

Query  184  ECDSKPLVEALR-----QGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
              DS+ +V+ L+     +      L N + RL    +  F  L   HI R++N +AD LA
Sbjct  115  FSDSELVVKQLKGIYRVKDKNLKTLYNEVLRL----SNKFEYLNIEHIKRDKNSMADTLA  170

Query  349  DMAFSQ  366
              A S+
Sbjct  171  KTAISR  176



>gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptase); Polynucleotidyl 
transferase, Ribonuclease H fold [Medicago truncatula]
Length=729

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  28   ATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPL  204
            A CGG+LRDS+G W++G+  KIG C    AE WG+  GL M        L++E DSK L
Sbjct  651  AGCGGLLRDSDGRWIKGYFKKIGMCDAFHAEMWGMYLGLDMAWRENTTHLIVESDSKIL  709



>ref|WP_026939604.1| hypothetical protein [Hippea alviniae]
Length=136

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 8/119 (7%)
 Frame = +1

Query  4    CSRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVL  183
             S  N G A  G V++ S    L+     IG+ T +VAE   ++ GL+ V D G++ + +
Sbjct  17   ASSGNPGSAGIGVVIK-SGDRVLKSLSKSIGKTTNNVAEYTALIVGLKEVLDLGIKKVSV  75

Query  184  ECDSKPLVEALRQGDGDGHLLNNIARLCIREAED----FPDLRFVHIYREQNRLADKLA  348
              DS+ +V   +Q +G   + N   +    E ED    F +    H+ RE+NR AD+LA
Sbjct  76   YSDSELVV---KQVNGIYRVNNERLKKLKSEIEDLKSKFDEFSITHVPREKNRFADRLA  131



>gb|KHN27033.1| Putative ribonuclease H protein [Glycine soja]
Length=160

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (46%), Gaps = 1/118 (1%)
 Frame = +1

Query  13   RNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDV-AEAWGVLQGLRMVKDYGVRPLVLEC  189
            R   +A  GG++RD    ++  F  ++G+C T + AE W +  G+          L++E 
Sbjct  13   RCGNKAAAGGIVRDWKANFVYAFSSRLGKCCTALEAELWAIKIGVETAVSRVYGNLIVES  72

Query  190  DSKPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADMAFS  363
            DS   ++ +  G   GH+  ++    +        + + H++RE N  AD LA    S
Sbjct  73   DSYASIQLINMGVPQGHIFYDLVSSILEIGNKANHIVWNHVFRETNSTADGLAKHGLS  130



>ref|XP_008385839.1| PREDICTED: uncharacterized protein LOC103448363 [Malus domestica]
Length=384

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (44%), Gaps = 17/126 (13%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDV-AEAWGVLQGLRMVKDYGVRPLVLECDS------  195
            GGV+R+ +G WL GF   +G     + AE W + +GL +  +YG  P+ +E DS      
Sbjct  62   GGVIRNQDGEWLSGFAENLGTGKKPIEAEVWALYRGLELAWNYGWYPIEVETDSAMAVTL  121

Query  196  ----------KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKL  345
                       P    + +         N+ R C+       +    H+YR++N +AD L
Sbjct  122  VFSPVQLYPKHPQFNLIHKSLNQIRNSENLIRNCLNLLNQIQNYSLQHVYRQKNSVADFL  181

Query  346  ADMAFS  363
            A+   +
Sbjct  182  ANFGLT  187



>ref|XP_009772061.1| PREDICTED: uncharacterized protein LOC104222525 [Nicotiana sylvestris]
Length=121

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 48/109 (44%), Gaps = 28/109 (26%)
 Frame = +1

Query  22   GQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKP  201
            G A  GGV+RDSNG W+ G+   +   T+   E  G+LQGLR+     + P  +  D+K 
Sbjct  26   GAAGYGGVIRDSNGNWIVGYTGSLKHTTSLHMELMGLLQGLRLAHLRQLTPSEVVVDAKE  85

Query  202  LVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLA  348
            LV                            D R  H YREQN++ D +A
Sbjct  86   LV----------------------------DPRVTHTYREQNQVVDSMA  106



>ref|XP_009334162.1| PREDICTED: uncharacterized protein LOC103926995 [Pyrus x bretschneideri]
Length=380

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (44%), Gaps = 17/126 (13%)
 Frame = +1

Query  37   GGVLRDSNGTWLRGFGYKIGRCTTDV-AEAWGVLQGLRMVKDYGVRPLVLECDS------  195
            GGV+R+ +G WL GF   +G     + AE W + +GL +  +YG  P+ +E DS      
Sbjct  58   GGVIRNQDGEWLTGFAENLGTGKKPIEAEVWALYRGLELAWNYGWYPIEVETDSAMAVTL  117

Query  196  ----------KPLVEALRQGDGDGHLLNNIARLCIREAEDFPDLRFVHIYREQNRLADKL  345
                       P    + +         N+ R C+       +    H+YR++N +AD L
Sbjct  118  VFSPVQLYPKHPQFNLIHKSLNQIRNSENLIRNCLNLLNQIQNYSLQHVYRQKNSVADFL  177

Query  346  ADMAFS  363
            A+   +
Sbjct  178  ANFGLT  183



>dbj|BAE71259.1| hypothetical protein [Trifolium pratense]
Length=553

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = +1

Query  55   SNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLECDSKPLVEALRQGDGD  234
            S G WL GF   +G C+  +AE WGV +GL   +  G   + L  DS  +V+A++ G   
Sbjct  417  SQGEWLGGFARGLGNCSAIIAELWGVAEGLSYARRLGFTAVELNVDSVVVVQAIKTGRFS  476

Query  235  GH----LLNNIARLCIREAEDFPDLRFVHIYREQNRLADKLADM  354
                  L+ +I R+   + E    ++  H YRE N+ AD +A++
Sbjct  477  SSVGLPLVKHIRRMLDLDWE----IKIEHAYRESNKCADAMANI  516



>ref|XP_008344853.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=346

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 2/116 (2%)
 Frame = +1

Query  7    SRRNDGQATCGGVLRDSNGTWLRGFGYKIGRCTTDVAEAWGVLQGLRMVKDYGVRPLVLE  186
            ++ N G A CGGV RDS G +L GF   +G  T+  AE   V+  + +    G + L LE
Sbjct  194  AKGNPGPAACGGVFRDSAGYFLGGFSLSLGHRTSFYAELHAVIXAVELAHARGWQNLWLE  253

Query  187  CDSKPLVEALRQGDGDGHL-LNNIARLCIREAEDFPDLRFVHIYREQNRLADKLAD  351
             +S  ++     G       L      C    ++    R  HI+R  N +ADKLA+
Sbjct  254  SBSSSVISCFASGSFSPPWSLQTRWNNCTLHLQNM-VFRCSHIFRXGNXVADKLAN  308



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511129456992