BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30506_g1_i1 len=378 path=[1:0-377]

Length=378
                                                                      Score     E

gb|AAS65426.1|  Kunitz-type trypsin inhibitor                           100   2e-24   Ipomoea batatas [batate]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            98.6    6e-24   
dbj|BAA95697.1|  thionin like protein                                 96.3    6e-23   Nicotiana tabacum [American tobacco]
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            94.7    2e-22   
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            94.4    3e-22   
gb|ACB32234.1|  gamma-thionin/defensin                                90.5    8e-21   Solanum chacoense
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            90.1    1e-20   
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            89.7    2e-20   
gb|ABO36637.1|  defensin protein                                      89.7    2e-20   Solanum lycopersicum
gb|ABO36641.1|  defensin protein                                      89.4    2e-20   Solanum pimpinellifolium [currant tomato]
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       89.0    3e-20   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  89.0    3e-20   Capsicum annuum
gb|AFW90621.1|  protease inhibitor-related protein                    88.2    6e-20   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            88.2    7e-20   
gb|AIT42153.1|  defensin-like protein                                 88.2    7e-20   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      87.8    9e-20   
gb|AIT42147.1|  defensin-like protein                                 87.4    1e-19   
ref|XP_003628979.1|  Defensin                                         87.4    1e-19   
gb|AIT42152.1|  defensin-like protein                                 87.4    1e-19   
gb|AIT42148.1|  defensin-like protein                                 87.4    1e-19   
emb|CDP10468.1|  unnamed protein product                              86.7    3e-19   
gb|ACJ26760.1|  protease inhibitor-related protein                    86.3    3e-19   Solanum tuberosum [potatoes]
gb|AIT42149.1|  defensin-like protein                                 85.1    8e-19   
ref|NP_001234872.1|  gamma-thionin precursor                          84.3    2e-18   
ref|XP_003629332.1|  Defensin                                         84.3    2e-18   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      84.0    3e-18   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 83.6    3e-18   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    83.2    6e-18   Vitis vinifera
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          82.4    1e-17   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 82.0    1e-17   
ref|XP_003628978.1|  Defensin                                         81.3    3e-17   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               80.5    5e-17   
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           80.5    5e-17   
gb|AFK44299.1|  unknown                                               80.5    6e-17   
gb|ACN93800.1|  defensin precursor                                    80.1    8e-17   Vigna unguiculata
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               80.1    9e-17   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           79.7    1e-16   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    79.7    1e-16   
gb|ADK87340.1|  defensin                                              79.3    1e-16   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    79.3    2e-16   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               79.3    2e-16   
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            79.3    2e-16   
gb|EAY86781.1|  hypothetical protein OsI_08161                        84.3    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    79.0    2e-16   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  78.6    2e-16   Solanum tuberosum [potatoes]
gb|KHN06998.1|  Defensin-like protein                                 78.6    3e-16   
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          78.2    4e-16   
gb|AAL85480.1|  defensin protein 1                                    77.8    5e-16   Prunus persica
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               77.4    8e-16   
gb|AGT51229.1|  defensin                                              77.0    1e-15   
ref|NP_178320.1|  defensin-like protein 4                             77.0    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ACV84379.1|  defensin precursor                                    77.0    1e-15   Triticum aestivum [Canadian hard winter wheat]
gb|AIT42150.1|  defensin-like protein                                 76.3    2e-15   
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    76.3    2e-15   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            76.6    2e-15   
ref|NP_178321.1|  defensin-like protein 1                             76.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 76.6    2e-15   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            76.3    3e-15   
ref|XP_002886566.1|  protease inhibitor II                            75.5    4e-15   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  75.5    4e-15   Helianthus annuus
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               75.5    5e-15   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               75.5    5e-15   
ref|NP_176302.2|  defensin-like protein                               75.1    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    6e-15   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            76.3    6e-15   
gb|ABK28445.1|  unknown                                               75.1    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001047493.1|  Os02g0629800                                     75.1    8e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048853.1|  Os03g0130300                                     75.1    8e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  74.3    1e-14   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               74.3    1e-14   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           74.3    1e-14   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               73.9    2e-14   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               73.9    2e-14   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  73.9    2e-14   Petunia integrifolia [violet-flowered petunia]
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       73.6    3e-14   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               73.2    3e-14   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           73.2    3e-14   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       73.2    4e-14   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               73.2    4e-14   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 72.8    4e-14   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 72.8    4e-14   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               72.8    4e-14   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           72.8    5e-14   
gb|AGT51227.1|  defensin                                              72.4    6e-14   
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           72.4    7e-14   
gb|AAM62652.1|  protease inhibitor II                                 72.0    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178319.1|  defensin-like protein 2                             72.0    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         72.0    1e-13   
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            71.6    1e-13   
ref|XP_003628977.1|  Defensin                                         71.6    1e-13   
gb|KHN23780.1|  Defensin SD2                                          71.6    1e-13   
gb|ABK93231.1|  unknown                                               71.6    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           71.6    1e-13   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               71.2    1e-13   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              71.2    2e-13   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               71.2    2e-13   
emb|CEJ09690.1|  Defensin protein                                     71.2    2e-13   
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           70.9    2e-13   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           70.9    2e-13   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 70.9    3e-13   Jatropha curcas
emb|CDY48618.1|  BnaC09g20670D                                        70.5    3e-13   
ref|NP_001234987.1|  protease inhibitor precursor                     70.5    3e-13   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           70.5    4e-13   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               70.5    4e-13   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        70.5    4e-13   Sorghum bicolor [broomcorn]
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               70.1    4e-13   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      70.1    5e-13   Castanea sativa
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  70.1    5e-13   Ricinus communis
ref|XP_003630422.1|  Defensin                                         69.7    6e-13   
gb|ADK36631.1|  defensin-like protein                                 69.3    6e-13   
emb|CAH58740.1|  defensin                                             69.7    6e-13   Plantago major [cart-track plant]
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         69.7    6e-13   
ref|XP_002325734.2|  defensin-like family protein                     69.7    6e-13   Populus trichocarpa [western balsam poplar]
gb|ACS96442.1|  defensin                                              69.7    6e-13   Jatropha curcas
gb|AGT51228.1|  defensin                                              69.7    7e-13   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               69.7    7e-13   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 69.3    8e-13   
gb|KEH35661.1|  Defensin                                              69.3    8e-13   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       69.3    1e-12   
dbj|BAK07043.1|  predicted protein                                    69.7    1e-12   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    68.9    1e-12   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      68.9    1e-12   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        68.9    1e-12   Sorghum bicolor [broomcorn]
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        68.9    1e-12   Sorghum bicolor [broomcorn]
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           70.1    2e-12   
gb|EMT00351.1|  Defensin-like protein                                 68.6    2e-12   
ref|XP_003630421.1|  Defensin                                         68.2    2e-12   
gb|ADQ43196.1|  unknown                                               68.2    2e-12   
gb|AFD01290.1|  defensin 3                                            68.2    3e-12   
gb|AAA91049.1|  protease inhibitor II                                 68.2    3e-12   Brassica rapa
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  68.2    3e-12   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            67.8    3e-12   
ref|XP_003599384.1|  Defensin                                         68.2    3e-12   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    67.8    4e-12   
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  67.4    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        67.8    4e-12   Sorghum bicolor [broomcorn]
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           67.4    5e-12   
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               67.4    5e-12   
gb|ABK23404.1|  unknown                                               67.4    5e-12   Picea sitchensis
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               67.0    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306561.1|  PREDICTED: defensin D2-like                      67.4    6e-12   
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    67.0    6e-12   
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              67.0    6e-12   
ref|NP_001149230.1|  LOC100282852 precursor                           67.4    6e-12   Zea mays [maize]
gb|AIA67000.1|  defensin                                              67.0    7e-12   
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           67.0    7e-12   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               67.0    7e-12   
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     67.0    8e-12   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  67.0    8e-12   Zea mays [maize]
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 66.6    8e-12   
emb|CAA62761.1|  putative gamma-thionin protein                       67.0    8e-12   Picea abies
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     67.0    9e-12   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               67.0    1e-11   
gb|EMS65298.1|  Defensin-like protein 1                               66.6    1e-11   
gb|AFE88173.1|  g-thionin                                             66.6    1e-11   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  66.6    1e-11   
gb|ABS72000.1|  putative defensin protein 1                           65.9    1e-11   Olea europaea
gb|AHA50470.1|  defensin-like protein 1                               66.2    1e-11   
gb|ABK25062.1|  unknown                                               66.6    1e-11   Picea sitchensis
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       66.2    1e-11   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    66.2    1e-11   
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  65.9    1e-11   Spinacia oleracea
dbj|BAK07823.1|  predicted protein                                    67.0    1e-11   
gb|AAL14240.1|  proteinase inhibitor                                  65.5    2e-11   Musa acuminata [banana]
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           65.9    2e-11   
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               65.9    2e-11   
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               66.2    2e-11   
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               66.2    2e-11   
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  65.9    2e-11   Capsicum annuum
dbj|BAB64929.1|  defensin-like protein                                65.9    2e-11   Pyrus pyrifolia [sha li]
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          65.9    2e-11   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           65.9    2e-11   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  65.9    2e-11   
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    65.9    2e-11   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    65.5    2e-11   
gb|ABA81896.1|  putative defensin                                     65.5    3e-11   Aquilegia formosa
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               65.5    3e-11   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           65.1    3e-11   
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    65.1    3e-11   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            65.1    3e-11   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           65.1    3e-11   
sp|Q8GTM0.1|DEF_NICAL  RecName: Full=Flower-specific defensin; Al...  65.9    4e-11   Nicotiana alata [Indian tobacco]
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           65.1    4e-11   
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    65.1    4e-11   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           65.1    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009598624.1|  PREDICTED: defensin-like protein                 65.5    5e-11   
gb|AIA66999.1|  defensin                                              65.1    5e-11   
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  64.7    5e-11   
emb|CDP10467.1|  unnamed protein product                              65.1    6e-11   
gb|ACV84384.1|  defensin precursor                                    64.7    6e-11   Triticum turgidum subsp. durum
ref|XP_009793541.1|  PREDICTED: defensin-like protein                 64.7    7e-11   
gb|AIA67009.1|  defensin                                              64.3    7e-11   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               64.3    7e-11   
ref|XP_009630513.1|  PREDICTED: defensin-like protein 1               65.1    7e-11   
gb|AIA67004.1|  defensin                                              64.3    7e-11   
gb|AIA67012.1|  defensin                                              64.3    7e-11   
gb|ABM89231.1|  defensin                                              64.3    7e-11   Setaria italica
gb|EMT11359.1|  Defensin-like protein P322                            64.3    8e-11   
gb|ACV84381.1|  defensin precursor                                    64.3    8e-11   Triticum turgidum subsp. durum
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   64.3    8e-11   
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  63.9    1e-10   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           63.9    1e-10   Zea mays [maize]
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    63.9    1e-10   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           63.9    1e-10   
gb|EMS49334.1|  Defensin-like protein                                 63.9    1e-10   
gb|AIA67007.1|  defensin                                              63.2    2e-10   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          63.2    2e-10   
ref|NP_201171.1|  defensin-like protein 6                             63.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EMT30046.1|  Defensin-like protein P322                            63.2    2e-10   
gb|ABA86586.1|  putative defensin 1                                   62.8    2e-10   Aquilegia formosa
gb|AGC82207.1|  defensin                                              63.2    2e-10   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  63.2    2e-10   Zea mays [maize]
ref|NP_001148158.1|  LOC100281766 precursor                           63.2    2e-10   Zea mays [maize]
emb|CDY04774.1|  BnaC05g18150D                                        64.3    2e-10   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               62.8    2e-10   
gb|EMT06279.1|  Defensin-like protein 2                               63.2    2e-10   
gb|ADQ43197.1|  unknown                                               62.8    2e-10   
emb|CEJ09689.1|  Defensin protein                                     62.8    2e-10   
gb|ACB20518.1|  defensin precursor                                    62.8    3e-10   Saccharum officinarum [noble cane]
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           62.8    3e-10   
gb|AIA66994.1|  defensin                                              62.8    3e-10   
gb|AIA67010.1|  defensin                                              62.8    3e-10   
gb|ABA86587.1|  putative defensin 1                                   62.4    3e-10   Aquilegia chrysantha
ref|XP_009793542.1|  PREDICTED: defensin-like protein                 63.2    3e-10   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               62.4    4e-10   
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      62.4    4e-10   
gb|EMT03365.1|  Defensin-like protein 1                               62.4    4e-10   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  62.4    4e-10   
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   62.0    4e-10   Torenia fournieri [bluewings]
gb|KHN16909.1|  Defensin J1-2                                         62.4    4e-10   
gb|ABU40984.1|  putative flower-specific thionin                      62.8    4e-10   Nicotiana tabacum [American tobacco]
gb|AFK47422.1|  unknown                                               62.0    5e-10   
gb|AIA67015.1|  defensin                                              62.0    5e-10   
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           62.0    6e-10   
gb|AIC35288.1|  defensin 4                                            62.0    6e-10   
ref|NP_001052199.1|  Os04g0189400                                     62.4    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AIA66989.1|  defensin                                              62.0    6e-10   
ref|NP_001147137.1|  LOC100280744 precursor                           61.6    6e-10   Zea mays [maize]
gb|ABA86589.1|  putative defensin 1                                   61.6    7e-10   Aquilegia pyrenaica
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  61.6    7e-10   Capsicum annuum
gb|AAR84643.1|  defensin                                              61.6    8e-10   Picea glauca
gb|ACV84383.1|  defensin precursor                                    61.6    8e-10   Triticum turgidum subsp. durum
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               61.2    8e-10   
gb|AAS13434.1|  defensin                                              60.8    9e-10   Nicotiana attenuata
dbj|BAK07467.1|  predicted protein                                    61.2    9e-10   
gb|EEC76838.1|  hypothetical protein OsI_14993                        61.2    9e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  62.4    9e-10   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               61.2    9e-10   
gb|EMT17852.1|  hypothetical protein F775_43789                       61.2    1e-09   
gb|EMT18782.1|  Defensin-like protein                                 65.1    1e-09   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  61.2    1e-09   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   61.2    1e-09   Vitis vinifera
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    60.8    1e-09   
ref|XP_002862935.1|  low-molecular-weight cysteine-rich 76            61.2    1e-09   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  61.2    1e-09   
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    60.8    1e-09   Vitis vinifera
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       60.8    1e-09   
emb|CEJ09688.1|  Defensin protein                                     60.8    1e-09   
sp|A4L7R7.1|DEF1_PINSY  RecName: Full=Defensin-1; Flags: Precursor    60.8    2e-09   Pinus sylvestris [Scotch pine]
gb|ABK21016.1|  unknown                                               60.8    2e-09   Picea sitchensis
gb|AIA67014.1|  defensin                                              60.5    2e-09   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        60.5    2e-09   Sorghum bicolor [broomcorn]
gb|AIA67013.1|  defensin                                              60.5    2e-09   
dbj|BAA21114.1|  gamma-thionin                                        60.8    2e-09   Nicotiana excelsior
gb|ABK23037.1|  unknown                                               60.5    2e-09   Picea sitchensis
emb|CDM85870.1|  unnamed protein product                              60.5    2e-09   
gb|ADK91098.1|  PCP17C2                                               60.1    2e-09   
gb|ACV84382.1|  defensin precursor                                    60.5    2e-09   Triticum turgidum subsp. durum
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            60.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     60.8    2e-09   
ref|XP_006292097.1|  hypothetical protein CARUB_v10018292mg           60.8    2e-09   
gb|ABX84377.1|  amylase inhibitor-like protein                        60.1    2e-09   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK06284.1|  predicted protein                                    60.5    2e-09   
gb|ACV84385.1|  defensin precursor                                    60.1    3e-09   Triticum turgidum subsp. durum
gb|ABK20960.1|  unknown                                               60.1    3e-09   Picea sitchensis
emb|CDY39856.1|  BnaC02g42620D                                        60.1    3e-09   
gb|ABX84378.1|  amylase inhibitor-like protein                        60.1    3e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           59.7    3e-09   
gb|AIA66992.1|  defensin                                              60.1    3e-09   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           60.1    3e-09   
emb|CAA65045.1|  defensin                                             59.7    3e-09   
gb|AHA50472.1|  defensin-like protein 5                               59.7    3e-09   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  59.7    4e-09   
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  59.7    4e-09   
sp|A4L7R8.1|DEF2_PINSY  RecName: Full=Defensin-2; Flags: Precursor    59.7    4e-09   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               59.7    4e-09   
gb|EMT16291.1|  Defensin SD2                                          59.7    4e-09   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  59.3    4e-09   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              59.3    5e-09   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               59.3    5e-09   
ref|XP_010088525.1|  Defensin-like protein 2                          59.3    5e-09   
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             59.3    5e-09   
emb|CDP16306.1|  unnamed protein product                              59.3    5e-09   
ref|XP_004242654.1|  PREDICTED: defensin-like protein                 59.7    5e-09   
ref|XP_006365640.1|  PREDICTED: defensin-like protein-like            59.7    5e-09   
gb|EMT26158.1|  Defensin-like protein                                 59.3    5e-09   
emb|CAD41436.1|  OSJNBa0019D11.21                                     59.3    5e-09   
ref|XP_006422269.1|  hypothetical protein CICLE_v10005867mg           60.8    6e-09   
sp|O24115.1|DEF1_NICPA  RecName: Full=Defensin-like protein 1; Al...  59.7    6e-09   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             58.9    7e-09   
ref|NP_001031460.1|  low-molecular-weight cysteine-rich 76            58.9    7e-09   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  58.9    7e-09   
sp|P20159.1|DEF2_WHEAT  RecName: Full=Defensin-like protein 2; Al...  58.2    7e-09   
gb|AAS13436.1|  gamma-thionin                                         59.3    8e-09   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    58.9    8e-09   
gb|AAU04859.1|  defensin precursor                                    58.9    8e-09   
gb|EMS65297.1|  Defensin SD2                                          58.5    8e-09   
emb|CDO99915.1|  unnamed protein product                              58.9    8e-09   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            58.5    9e-09   
gb|KHN09675.1|  Defensin-like protein                                 58.2    9e-09   
gb|KHG09995.1|  Defensin-like protein 1                               58.5    9e-09   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            58.5    9e-09   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           58.5    9e-09   
ref|XP_007213203.1|  hypothetical protein PRUPE_ppb011708mg           58.5    1e-08   
gb|AIA67016.1|  defensin                                              58.5    1e-08   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            57.8    1e-08   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    58.2    1e-08   
sp|P84968.1|DEF2_TRIKH  RecName: Full=Defensin Tk-AMP-D2              57.8    1e-08   
dbj|BAJ86109.1|  predicted protein                                    58.5    1e-08   
ref|XP_009342667.1|  PREDICTED: defensin-like protein 2               58.5    1e-08   
gb|EPS67569.1|  gamma-thionin                                         57.8    1e-08   
gb|AAN40688.1|  putative plant defensin SPI1B                         58.2    1e-08   
gb|EMT03877.1|  Defensin Tk-AMP-D3                                    58.2    1e-08   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  58.2    1e-08   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  58.2    1e-08   
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    58.2    1e-08   
gb|AHA50468.1|  defensin-like protein 2                               58.2    1e-08   
gb|ACM50880.1|  defensin                                              57.4    2e-08   
sp|P81008.1|DEF1_MAIZE  RecName: Full=Defensin-like protein 1; Al...  57.4    2e-08   
sp|Q09198.1|DEF21_SORBI  RecName: Full=Defensin-like protein 21; ...  57.4    2e-08   
gb|EMT03364.1|  Defensin SD2                                          57.8    2e-08   
ref|XP_003581056.1|  PREDICTED: defensin Ec-AMP-D1-like               57.8    2e-08   
ref|NP_178322.1|  defensin-like protein 10                            57.8    2e-08   
sp|P21925.2|DEF3_SORBI  RecName: Full=Defensin-like protein 3; Al...  57.0    2e-08   
gb|AHA50471.1|  defensin-like protein 4                               57.4    2e-08   
emb|CAH65876.1|  OSIGBa0160I04.2                                      57.4    2e-08   
dbj|BAC10287.1|  defensin                                             57.4    2e-08   
gb|EMS54457.1|  Defensin Tk-AMP-D4                                    57.4    2e-08   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           57.4    2e-08   
gb|AIA66987.1|  defensin                                              57.4    2e-08   
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    57.4    2e-08   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               57.4    2e-08   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               57.4    3e-08   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  57.4    3e-08   
gb|AEW08922.1|  hypothetical protein CL2287Contig1_03                 57.0    3e-08   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        57.4    3e-08   
sp|P84965.1|DEF11_TRIKH  RecName: Full=Defensin Tk-AMP-D1.1           56.6    3e-08   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             57.4    3e-08   
sp|P21924.1|DEF2_SORBI  RecName: Full=Defensin-like protein 2; Al...  56.6    3e-08   
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      57.0    3e-08   
gb|ABW99097.1|  defensin                                              56.6    4e-08   
gb|AHA50473.1|  defensin-like protein 6                               57.0    4e-08   
sp|P20230.1|DEF1_HORVU  RecName: Full=Defensin-like protein 1; Al...  56.2    4e-08   
dbj|BAJ89304.1|  predicted protein                                    57.0    4e-08   
gb|EMT11361.1|  Defensin Tk-AMP-D6                                    56.6    4e-08   
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               56.6    4e-08   
gb|AIA66990.1|  defensin                                              56.6    5e-08   
ref|XP_004972594.1|  PREDICTED: defensin-like protein 21-like         56.6    5e-08   
gb|EMS54459.1|  Defensin Tk-AMP-D5                                    56.6    5e-08   
ref|XP_009608875.1|  PREDICTED: defensin-like protein                 57.0    5e-08   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           56.6    6e-08   
gb|ADK91116.1|  PCP17C2                                               55.8    6e-08   
gb|KHG06821.1|  Defensin-like protein                                 56.2    6e-08   
ref|XP_002864860.1|  predicted protein                                56.2    6e-08   
gb|ACV84380.1|  defensin precursor                                    56.2    6e-08   
ref|XP_006384382.1|  hypothetical protein POPTR_0004s14520g           56.2    6e-08   
ref|XP_010246429.1|  PREDICTED: defensin-like protein                 56.2    6e-08   
gb|AAG38520.1|AF283535_1  proteinase inhibitor se60-like protein      56.2    7e-08   
gb|EYU27578.1|  hypothetical protein MIMGU_mgv1a026683mg              56.2    7e-08   
ref|XP_009137059.1|  PREDICTED: LOW QUALITY PROTEIN: defensin-lik...  55.8    7e-08   
gb|AIA67011.1|  defensin                                              55.8    7e-08   
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            56.2    8e-08   
sp|P83399.1|DEF1_VIGUN  RecName: Full=Defensin-like protein 1; Al...  55.5    8e-08   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             55.8    9e-08   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               55.8    9e-08   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               55.8    1e-07   
ref|XP_004976260.1|  PREDICTED: defensin-like protein-like            55.8    1e-07   
ref|XP_008385108.1|  PREDICTED: defensin-like protein 2               55.8    1e-07   
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           55.8    1e-07   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  55.5    1e-07   
ref|XP_010038383.1|  PREDICTED: uncharacterized protein LOC104426904  57.4    1e-07   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           55.8    1e-07   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             55.5    1e-07   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               55.5    1e-07   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    55.5    1e-07   
gb|AFQ69079.1|  defensin precursor                                    55.5    1e-07   
ref|XP_006466198.1|  PREDICTED: defensin-like protein 6-like          55.1    2e-07   
gb|ACG49007.1|  hypothetical protein                                  54.7    2e-07   
gb|EMT03363.1|  hypothetical protein F775_43918                       55.1    2e-07   
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
ref|XP_008669654.1|  PREDICTED: defensin Ec-AMP-D1-like               55.1    2e-07   
gb|AIA66993.1|  defensin                                              55.1    2e-07   
gb|AAD21200.1|  putative gamma-thionin precursor                      55.5    2e-07   
gb|KDO61571.1|  hypothetical protein CISIN_1g029977mg                 56.2    2e-07   
gb|EMT02837.1|  Defensin J1-2                                         54.7    2e-07   
gb|ACU14316.1|  unknown                                               54.7    2e-07   
gb|KHN17432.1|  Defensin-like protein                                 54.3    2e-07   
ref|XP_003525155.1|  PREDICTED: uncharacterized LOC100306228          54.7    2e-07   
gb|ABF74600.1|  defensin precursor                                    54.7    2e-07   
dbj|BAK04173.1|  predicted protein                                    54.7    2e-07   
ref|XP_008780828.1|  PREDICTED: defensin-like protein 1               54.3    2e-07   
sp|P20158.1|DEF1_WHEAT  RecName: Full=Defensin-like protein 1; Al...  53.9    2e-07   
ref|XP_010497013.1|  PREDICTED: putative defensin-like protein 9      54.3    3e-07   
ref|XP_004250638.1|  PREDICTED: defensin-like protein                 54.7    3e-07   
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  55.1    3e-07   
ref|XP_006426419.1|  hypothetical protein CICLE_v10026887mg           53.5    5e-07   
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   53.5    5e-07   
sp|P84969.1|DEF61_TRIKH  RecName: Full=Defensin Tk-AMP-D6.1           53.1    5e-07   
ref|XP_006426420.1|  hypothetical protein CICLE_v10026887mg           53.5    6e-07   
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  53.5    6e-07   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             53.5    6e-07   
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               53.5    7e-07   
gb|ACI02057.1|  fabatin precursor                                     53.1    8e-07   
gb|KFK33427.1|  hypothetical protein AALP_AA5G011600                  53.1    8e-07   
gb|EMS53152.1|  Defensin-like protein 2                               53.1    9e-07   
ref|XP_010481691.1|  PREDICTED: putative defensin-like protein 9      53.1    9e-07   
sp|P84964.1|DEF12_TRIMO  RecName: Full=Defensin Tm-AMP-D1.2           52.4    9e-07   
ref|XP_010229304.1|  PREDICTED: defensin Tk-AMP-D1.1-like             53.1    9e-07   
ref|XP_004954814.1|  PREDICTED: defensin SD2-like                     53.1    1e-06   
ref|NP_001146997.1|  flower-specific gamma-thionin                    52.8    1e-06   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           52.8    1e-06   
ref|XP_002879355.1|  hypothetical protein ARALYDRAFT_482123           52.4    1e-06   
ref|XP_011070572.1|  PREDICTED: defensin J1-2-like                    52.8    1e-06   
dbj|BAD25113.1|  hypothetical protein                                 53.1    1e-06   
gb|AAW33979.1|  proteinase inhibitor SE60-like protein                52.4    1e-06   
ref|NP_001150374.1|  low-molecular-weight cysteine-rich protein L...  52.4    1e-06   
sp|P86518.1|DEF1_ECHCG  RecName: Full=Defensin Ec-AMP-D1              51.6    2e-06   
ref|XP_004975163.1|  PREDICTED: defensin-like protein-like            52.4    2e-06   
sp|P84966.1|DEF5_TRIKH  RecName: Full=Defensin Tk-AMP-D5              51.2    2e-06   
sp|P84967.1|DEF6_TRIKH  RecName: Full=Defensin Tk-AMP-D6              51.2    2e-06   
sp|P86519.1|DEF2_ECHCG  RecName: Full=Defensin Ec-AMP-D2              51.2    2e-06   
ref|XP_003581053.1|  PREDICTED: defensin Tk-AMP-D5-like               51.6    3e-06   
ref|XP_002446148.1|  hypothetical protein SORBIDRAFT_06g002510        51.6    3e-06   
ref|XP_011070575.1|  PREDICTED: defensin Ec-AMP-D2-like               51.6    3e-06   
sp|P81457.1|DEF2_VICFA  RecName: Full=Defensin-like protein 2; Al...  50.4    4e-06   
ref|XP_009351648.1|  PREDICTED: defensin-like protein 1               51.2    5e-06   
sp|P81456.1|DEF1_VICFA  RecName: Full=Defensin-like protein 1; Al...  50.4    5e-06   
sp|P84970.1|DEF3_TRIKH  RecName: Full=Defensin Tk-AMP-D3              50.4    5e-06   
sp|P84963.1|DEF1_TRIKH  RecName: Full=Defensin Tk-AMP-D1              50.4    5e-06   
ref|XP_002513755.1|  Low-molecular-weight cysteine-rich protein L...  50.8    5e-06   
ref|XP_008667949.1|  PREDICTED: LOC100281986 isoform X1               54.3    6e-06   
gb|EMT11360.1|  Defensin Tk-AMP-D4                                    50.4    6e-06   
dbj|BAK04559.1|  predicted protein                                    50.8    6e-06   
gb|EAZ14734.1|  hypothetical protein OsJ_04660                        50.8    7e-06   
ref|XP_009779973.1|  PREDICTED: defensin-like protein                 50.4    7e-06   
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               50.4    7e-06   
sp|Q07502.1|DEF_SOYBN  RecName: Full=Defensin-like protein; AltNa...  50.4    8e-06   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               50.4    8e-06   
gb|ACQ90609.1|  defensin-like protein                                 50.4    9e-06   
gb|EMS62517.1|  Defensin SD2                                          50.4    9e-06   
ref|XP_002451983.1|  hypothetical protein SORBIDRAFT_04g012170        50.4    9e-06   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               50.4    9e-06   
sp|B5LZ79.1|DEF_GYMCO  RecName: Full=Defensin-like protein; AltNa...  50.1    1e-05   
sp|B3F051.1|DEF_LENCC  RecName: Full=Defensin Lc-def; Flags: Prec...  50.1    1e-05   
ref|NP_001172723.1|  Os01g0932825                                     50.4    1e-05   
gb|AGT51230.1|  defensin                                              49.3    1e-05   
gb|EAY77111.1|  hypothetical protein OsI_05071                        50.1    1e-05   
gb|EYU33797.1|  hypothetical protein MIMGU_mgv1a018660mg              50.4    2e-05   
sp|Q8H6Q0.1|DEF2_PETHY  RecName: Full=Floral defensin-like protei...  49.7    2e-05   
ref|NP_001146981.1|  flower-specific gamma-thionin precursor          49.3    2e-05   
ref|XP_006339360.1|  PREDICTED: defensin-like protein-like            49.7    2e-05   
ref|XP_004975165.1|  PREDICTED: defensin-like protein 2-like          49.3    2e-05   
ref|XP_006395807.1|  hypothetical protein EUTSA_v10005233mg           49.3    2e-05   
gb|EMT19618.1|  hypothetical protein F775_43215                       48.9    2e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               49.3    2e-05   
dbj|BAB64931.1|  defensin-like protein                                49.3    2e-05   
gb|EMS56168.1|  Defensin-like protein 6                               49.3    2e-05   
ref|XP_011086331.1|  PREDICTED: putative defensin-like protein 3      49.7    2e-05   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               48.9    3e-05   
ref|XP_004953176.1|  PREDICTED: defensin-like protein-like            48.9    3e-05   
ref|XP_011070576.1|  PREDICTED: defensin Ec-AMP-D1-like               48.9    3e-05   
ref|XP_009627271.1|  PREDICTED: uncharacterized protein LOC104117854  51.2    3e-05   
gb|EAY84990.1|  hypothetical protein OsI_06352                        48.9    3e-05   
ref|NP_001148374.1|  LOC100281986 precursor                           48.5    3e-05   
sp|P81573.1|DEFD7_SPIOL  RecName: Full=Defensin D7; AltName: Full...  47.8    3e-05   
ref|XP_004306562.1|  PREDICTED: defensin-like protein 7-like          48.5    4e-05   
ref|XP_011086334.1|  PREDICTED: uncharacterized protein LOC105168097  49.3    4e-05   
sp|P84971.1|DEF4_TRIKH  RecName: Full=Defensin Tk-AMP-D4              47.8    4e-05   
gb|ACI02059.1|  defensin-like protein                                 48.1    4e-05   
gb|ACR46857.2|  putative defensin                                     48.1    5e-05   
gb|EYU45261.1|  hypothetical protein MIMGU_mgv1a019713mg              47.8    6e-05   
gb|ADQ43198.1|  unknown                                               47.8    6e-05   
gb|EMT32128.1|  Defensin-like protein                                 48.1    7e-05   
gb|AAF72043.1|  defensin CUA1                                         47.0    8e-05   
ref|NP_180172.1|  putative defensin-like protein                      47.4    8e-05   
gb|AIA67003.1|  defensin                                              47.0    1e-04   
ref|NP_001148704.1|  low-molecular-weight cysteine-rich protein L...  47.4    1e-04   
gb|AHI85718.1|  stress-induced protein 13                             47.4    1e-04   
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               47.0    1e-04   
ref|XP_010245186.1|  PREDICTED: defensin-like protein 1               47.0    1e-04   
ref|XP_007214706.1|  hypothetical protein PRUPE_ppb018272mg           47.0    1e-04   
ref|XP_011095738.1|  PREDICTED: extensin-like                         48.9    1e-04   
gb|AAF66592.1|  defensin                                              46.2    1e-04   
ref|XP_008643663.1|  PREDICTED: low-molecular-weight cysteine-ric...  47.4    1e-04   
ref|XP_004250637.1|  PREDICTED: defensin-like protein                 47.0    1e-04   
ref|XP_009598625.1|  PREDICTED: defensin-like protein 1               47.0    2e-04   
ref|XP_011099655.1|  PREDICTED: defensin-like protein 1               46.2    2e-04   
gb|ADV59772.1|  flower-derived plant defensin 2                       46.6    2e-04   
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               46.2    2e-04   
gb|KFK33429.1|  hypothetical protein AALP_AA5G012100                  46.6    2e-04   



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score =   100 bits (248),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  277  FVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRK  98
            FV+LFMATE+G N IMV EAR CES S +FKGPC+ D NCATVC +EGF  GDCKG  R+
Sbjct  14   FVMLFMATELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRR  73

Query  97   CVCIKPC  77
            C C KPC
Sbjct  74   CFCTKPC  80



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 98.6 bits (244),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L MATE+G  TI   EAR CES S +FKGPC+ D NCATVCL+E
Sbjct  1    MANSMRFFATVLLIALLVMATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C C +PC
Sbjct  59   GFSGGDCRGFRRRCFCTRPC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 96.3 bits (238),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L  ATE+G  TI   EAR CES S +FKGPC+ D NCATVCL+E
Sbjct  1    MANSMRFFATVLLIALLVTATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C C +PC
Sbjct  59   GFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA  LL  ILFMATE+G  TI   EAR+CES S +F+G C  +KNCA VC +E
Sbjct  1    MAKSMRFFATVLLLAILFMATEMGPMTI--AEARHCESQSQRFRGLCVREKNCAAVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C +PC
Sbjct  59   GFSGGDCRGLRRRCFCTRPC  78



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA  LL  +L MATE+G  TI   EAR CES S +F+GPC  +KNCA VC +E
Sbjct  1    MAKSMRFFATVLLLAMLVMATEMGPMTI--AEARRCESKSQRFRGPCVREKNCAAVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C +PC
Sbjct  59   GFSGGDCRGLRRRCFCTRPC  78



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L MAT   R    + EAR CES S +FKGPC S+KNCA+VC +E
Sbjct  1    MANSMRLFATMLLLAMLVMATGPTR----IVEARTCESQSHRFKGPCVSEKNCASVCETE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C +PC
Sbjct  57   GFSGGDCRGLRRRCFCTRPC  76



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA   L  +L MATE+G   I+  EAR+CES S +FKGPC SDKNCA+VC +E
Sbjct  1    MAQSIRFFATLFLLAMLVMATEMGPTRIV--EARHCESLSHRFKGPCVSDKNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C+G  R+C C KPC
Sbjct  59   RFSGGNCRGFRRRCFCTKPC  78



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L MATE+G  TI   EAR CES S +FKGPC+ D NCATVCL+E
Sbjct  1    MANSMRFFATVLLLTLLVMATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C C +PC
Sbjct  59   GFSGGDCRGFRRRCFCTRPC  78



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L MAT      + + EAR CES S +FKGPC S+KNCA+VC +E
Sbjct  1    MANSMRLFATMLLLAMLVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C C +PC
Sbjct  57   GFSGGDCRGFRRRCFCTRPC  76



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L MAT      + + EAR CES S +FKGPC S+KNCA+VC +E
Sbjct  1    MANSMRLFATMLLLAMLVMAT----GPMKIVEARTCESQSHRFKGPCVSEKNCASVCETE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C C +PC
Sbjct  57   GFSGGDCRGFRRRCFCTRPC  76



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA  L   +L M T++G   + + EAR CESPS +FKGPC +D+NCA+VC +E
Sbjct  1    MAHSMRFFATVLFLAMLVMDTKMG--PMRIIEARICESPSQRFKGPCLTDRNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C K C
Sbjct  59   GFTGGDCRGLRRRCFCTKEC  78



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA  LL  +L MATE+G   + + EAR CES S +FKG C S+ NCA+VC +E
Sbjct  1    MAHSMRFFAIVLLLAMLVMATEMG--PMRIVEARTCESQSHRFKGVCASETNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C C +PC
Sbjct  59   GFSGGDCRGFRRRCFCTRPC  78



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA   L  +L MATE+G   + + EARNCES S +FKGPCT D NCA+VC +E
Sbjct  1    MALSMRFFATFFLLAMLVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C G  R+C C KPC
Sbjct  59   RFSGGNCHGFRRRCFCTKPC  78



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 88.2 bits (217),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA+S+R FA  LL  +L MATE+G  TI   EAR CES   +FKGPC+ D NCATVCL+E
Sbjct  1    MANSMRFFATVLLLTLLVMATEMGPMTI--AEARTCESQRHRFKGPCSRDGNCATVCLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C +PC
Sbjct  59   GFSGGDCRGLRRRCFCTRPC  78



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 88.2 bits (217),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA   L  +L M+TE+G   + + EAR+CES S +FKGPC SDKNCA+VC +E
Sbjct  1    MALSMRFFATFFLLAMLVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C+G  R+C C KPC
Sbjct  59   RFSGGNCRGFRRRCFCTKPC  78



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +   L +++  ATE+G   IMV EARNCES S +FKG C S++NCA+VC +E
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G CKG+ R+C C++ C
Sbjct  60   GFPDGKCKGLRRRCFCLRNC  79



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R F    L  ++ MATE+G   + + EAR+CES S +FKGPC SDKNCA+VC +E
Sbjct  1    MAYSMRFFTIVFLLAMIVMATEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C+G  R+C C KPC
Sbjct  59   RFSGGNCRGFRRRCFCTKPC  78



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   +   +F +L +ATE+G   IMV EAR CE+PS  FKG C SD NCA+VC +E
Sbjct  1    MARSLPLVSTIFVFFLLLVATEMG--PIMVAEARTCETPSNNFKGLCVSDTNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G  ++C C KPC
Sbjct  59   GFPGGHCEGFRQRCFCTKPC  78



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R F+   L  +L MATE+G   + + EAR+CES S +FKGPC SD+NCA+VC +E
Sbjct  1    MALSMRFFSTFFLLAMLVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C+G  R+C C KPC
Sbjct  59   RFSGGNCRGFRRRCFCTKPC  78



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R F    L  ++ MATE+G   + + EARNCES S +FKGPCT D NCA+VC +E
Sbjct  1    MAHSMRFFTTVFLLAMIVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C G  R+C C KPC
Sbjct  59   RFSGGNCHGFRRRCFCTKPC  78



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R FA A L ++LFM+TE+  + + V EAR CES S +FKG C    NCA VC +E
Sbjct  1    MTYSMRLFATAFLLLMLFMSTEM--DPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C G+ R+C C KPC
Sbjct  59   GFPGGQCSGLRRRCFCSKPC  78



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R FA   L  +L MATE+G   + + EAR+CES S +FKGPCT D NCA+VC +E
Sbjct  1    MALSMRFFATFFLLAMLVMATEMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C G  R+C C KPC
Sbjct  59   RFSGGNCHGFRRRCFCTKPC  78



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R F+   L  +L MATE+G   + + EAR+CES S +FKGPC SD+NCA+VC +E
Sbjct  1    MALSMRFFSTFFLLAMLVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G+C+G  R C C KPC
Sbjct  59   RFSGGNCRGFRRLCFCTKPC  78



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = -3

Query  304  LRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
            +R FA  LL  +L MAT      + + EAR CES S +FKGPC S+KNCA+VC +EGF  
Sbjct  1    MRLFATMLLLAMLVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSG  56

Query  124  GDCKGVLRKCVCIKPC  77
            GDC+G  R+C C +PC
Sbjct  57   GDCRGFRRRCFCTRPC  72



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA    S     LF+++ +ATE+G  +IMV EAR C S S  FKG C SD+NCATVCL+E
Sbjct  1    MALQFLSIRTIFLFLLVLVATEMG--SIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  ++C C KPC
Sbjct  59   GFTDGRCRGFRQRCFCSKPC  78



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -3

Query  316  MASSLRSFADA-LLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLS  140
            M  S+R  +   LL +++F   E+G   IMV EARNCES S +FKG C S++NCA+VC +
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNT  59

Query  139  EGFPHGDCKGVLRKCVCIKPC  77
            EGFP G CKG+ R+C C++ C
Sbjct  60   EGFPDGKCKGLRRRCFCLRNC  80



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = -3

Query  304  LRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
            +R  +   L +++  ATE+G   +MV EARNCES S +FKG C S++NCA+VC +EGFP 
Sbjct  2    MRLLSTVFLLLMVVFATEMG--PVMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPD  59

Query  124  GDCKGVLRKCVCIKPC  77
            G CKG+ R+C C++ C
Sbjct  60   GKCKGLRRRCFCLRNC  75



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R F+  LL ++LFMATE+G    MV EAR CES S +FKG C    NCA VC +E
Sbjct  1    MKGSQRLFSAFLLVILLFMATEMG---PMVAEARTCESQSHRFKGTCVRQSNCAAVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C K C
Sbjct  58   GFHGGNCRGFRRRCFCTKHC  77



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M S +R F+   + ++L +AT +G NT MV EAR CES S +FKG C S+ NCA+VC +E
Sbjct  1    MESFMRMFSAVFVALLLLVATGMGPNT-MVAEARTCESLSHKFKGTCLSETNCASVCKTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C K C
Sbjct  60   GFSGGDCRGLRRRCFCTKHC  79



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M   +R F+  +L ++L  ATE+G     V EAR CES S +FKG C SD NCA+VC +E
Sbjct  1    MERGMRLFSSLVLVLLLVTATEMG---PKVAEARTCESQSHRFKGACLSDTNCASVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP GDCKG  R+C C+KPC
Sbjct  58   GFPAGDCKGARRRCFCVKPC  77



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +F +L +ATE+G + +    AR CE+PS  FKG C SD NCA+VC +E
Sbjct  1    MARSVSLVSTIFVFFLLIVATEMGPSMV---AARTCETPSNSFKGACFSDTNCASVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G CKG  ++C C KPC
Sbjct  58   GFPGGHCKGFRQRCFCTKPC  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F  A +F++L +AT       MV E R CES S +FKG C S  NCA VC +E
Sbjct  1    MERSMRLFPTAFVFLLLLVATGT-----MVAEGRTCESQSNRFKGTCVSKSNCAAVCQTE  55

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G+C+G+ R+C C K C
Sbjct  56   GFPGGNCRGLRRRCFCTKHC  75



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +F++L +ATE+G    MV EAR CES S +FKGPC SD NCA+VC +E
Sbjct  1    MARSVSFVSTIFVFLLLLLATEMGPR--MVAEARTCESQSHRFKGPCVSDTNCASVCRTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C C K C
Sbjct  59   RFSGGHCRGFRRRCFCTKHC  78



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   +   +F++L +ATE+G    MV EAR+CES S +FKGPC SD NCA+VC  E
Sbjct  1    MARSLPLVSTIFVFLLLLVATEMG--PTMVAEARDCESQSHRFKGPCVSDTNCASVCHGE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C C K C
Sbjct  59   KFSGGHCRGFRRRCFCTKHC  78



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +F++L +ATE+G    MV EAR CES S +FKGPC SD NCA+VC +E
Sbjct  1    MARSVPLVSTIFVFLLLLVATEMG--PTMVAEARTCESQSHRFKGPCVSDTNCASVCRTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C+C K C
Sbjct  59   RFSGGHCRGFRRRCLCTKHC  78



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 80.1 bits (196),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +FV+L +AT  G    M+ E R CES S +FKG C S  NCA+VC +E
Sbjct  1    MERSMRLFSTAFVFVLLLVAT--GMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G  R+C C K C
Sbjct  59   GFPGGHCRGFRRRCFCTKHC  78



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +F +L  A   G    MV EAR CES S +FKG C S  NCA+VC +E
Sbjct  1    MERSMRLFSTAFVFFLLLAA--AGMMGPMVAEARTCESQSNRFKGTCVSTSNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G  R+C C K C
Sbjct  59   GFPGGHCRGFRRRCFCTKHC  78



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   + FA   L ++L  ATE+G    MV EAR CES S +FKGPC    NCA VC +E
Sbjct  1    MAGFKKLFATVFLMLMLIFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFHGGHCRGFRRRCFCTKHC  77



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +FV+L +AT  G    M+ E R CES S +FKG C S  NCA+VC +E
Sbjct  1    MERSVRLFSTAFVFVLLLVAT--GMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G  R+C C K C
Sbjct  59   GFPGGHCRGFRRRCFCTKHC  78



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   + FA   L ++L  ATE+G    MV EAR CES S +FKGPC    NCA VC +E
Sbjct  1    MAGFKKLFATVFLMLMLVFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFHGGHCRGFRRRCFCTKHC  77



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +FV+L +AT  G    ++ E R CES S +FKG C S  NCA+VC +E
Sbjct  1    MERSMRLFSTAFVFVLLLVAT--GMMGPLLAEGRTCESQSRKFKGTCLSKTNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G+C+G  R+C C K C
Sbjct  59   GFPGGNCRGFRRRCFCTKHC  78



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R FA   L  +L ++TE+G  +    EAR CES S  FKGPC  D NCA+VC +E
Sbjct  1    MGYSMRLFATFFLVAMLLLSTEMGPMSGGA-EARTCESQSHSFKGPCVGDTNCASVCQTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C + C
Sbjct  60   GFIGGDCRGLRRQCFCTRNC  79



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A A L + + +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MAPSRRMVASAFLLLAILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G+ RKC C KPC
Sbjct  59   SFPDGECKSHGLERKCFCKKPC  80



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   + FA   L ++L  ATE+G    MV +AR CES S +FKGPC    NCA VC +E
Sbjct  1    MAGFKKLFATVFLVLMLVFATEMG---TMVADARTCESQSHRFKGPCVRKSNCAAVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G+ R+C C K C
Sbjct  58   GFHAGHCRGIRRRCFCTKHC  77



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  304  LRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
            +R FA   L  +L +AT++G   + + EAR+CES S +FKGPCT D NCA+VC +E F  
Sbjct  1    MRFFATFFLLAMLVVATKMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSG  58

Query  124  GDCKGVLRKCVCIKPC  77
            G+C G  R+C C KPC
Sbjct  59   GNCHGFRRRCFCTKPC  74



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   + ++L +ATE+G    MV EAR CES S +FKGPC SD NC +VC +E
Sbjct  1    MARSVPLVSTIFVLLLLLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  59   GFSGGHCRGFSRRCFCTKEC  78



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M S +R F+   + ++L +AT +G N  MV EAR CE+ S +FKG C  + NCA+VC +E
Sbjct  1    MESFMRMFSAVFVALLLLVATGMGPNA-MVAEARTCETLSHKFKGTCLRESNCASVCQTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C K C
Sbjct  60   GFTGGDCRGLRRRCFCTKHC  79



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +F +L  A  +     MV EAR CES S +FKG C S  NCA+VC +E
Sbjct  1    MERSMRLFSTAFVFFLLLAAAGMMMGP-MVAEARTCESQSNRFKGTCVSTSNCASVCQTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G  R+C C K C
Sbjct  60   GFPGGHCRGFRRRCFCTKHC  79



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +FV+L +AT  G    M+ E R CE+ S +FKG C S  NCATVC +E
Sbjct  1    MERSVRLFSTAFVFVLLLVAT--GMMGPMLAEGRTCEAHSRKFKGHCHSKSNCATVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C G+ R+C C K C
Sbjct  59   GFQGGHCHGIRRRCFCTKHC  78



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  ++F+AT +G  ++   EAR CES S +FKGPC SD NCA VC +E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVSV---EARTCESQSHRFKGPCVSDNNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G+ R+C C + C
Sbjct  58   GFGGGKCRGLRRRCFCTRHC  77



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L  V++F+AT +G  T+   EAR C S S +FKG C SD NC  VC +E
Sbjct  1    MKFSMRLISAVLFLVMIFVATGMGPVTV---EARTCASQSQRFKGKCVSDTNCENVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP GDC+G  R+C C + C
Sbjct  58   GFPGGDCRGFRRRCFCTRNC  77



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A ALL  +L +ATE+G  T+ V EARNC S S  FKG C S  NCA VC +E
Sbjct  1    MALSRRMTASALLLFLL-VATEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTE  59

Query  136  GFPHGDCKG--VLRKCVCIKPC  77
             FP G+C      RKC C +PC
Sbjct  60   NFPDGECHAPHYERKCFCKRPC  81



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = -3

Query  271  ILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCV  92
            +L M+TE+G   + + EAR+CES S +FKGPC SDKNCA+VC +E F  G+C+G  R+C 
Sbjct  1    MLVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCF  58

Query  91   CIKPC  77
            C KPC
Sbjct  59   CTKPC  63



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 6/80 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +F++L +ATE      MV EAR CES S +FKG C SD+NCA+VC +E
Sbjct  1    MARSIPMVSTIFVFLLLLVATE------MVAEARTCESKSQKFKGACVSDRNCASVCQTE  54

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             FP G C+G  R+C C   C
Sbjct  55   RFPGGHCRGFRRRCFCTTHC  74



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            R FA   L  +L +++E+G  T+   EAR CES S +FKG C  D NCATVC +EGF  G
Sbjct  6    RLFATFFLVAMLLLSSEMG--TMSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGG  63

Query  121  DCKGVLRKCVCIKPC  77
            +C+G  R+C C + C
Sbjct  64   NCRGFRRRCFCTRNC  78



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  + ALL  ++F+AT +G  T+   EAR CES S +FKGPC S  NCA VC +E
Sbjct  1    MKLSVRFISAALLLFMVFIATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFGGGKCRGFRRRCYCTRHC  77



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -3

Query  316  MASSLRSFADALLF-VILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLS  140
            MA S+R FA   L  ++L ++TE+G   I   EAR CES S  FKG C  D NCATVC +
Sbjct  1    MAHSIRLFATFFLVAMLLLLSTEMG--PISSAEARTCESQSNSFKGTCVRDSNCATVCQT  58

Query  139  EGFPHGDCKGVLRKCVCIKPC  77
            EGF  G+C+G  R+C C + C
Sbjct  59   EGFIGGNCRGFRRRCFCTRNC  79



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +  ++  +L +ATE+    IMV EAR CES S  FKG C  D NCA VC +E
Sbjct  1    MARSVPLVSTIIVIFLLLVATEM--RPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G CKG  R+C C KPC
Sbjct  59   GFTGGQCKGFRRRCFCNKPC  78



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
             ALL + + +AT +G  T+   EAR CE+ S  F GPC S  NCA VC +EGF  GDC+G
Sbjct  9    SALLLLFMILATGIGPVTV---EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRG  65

Query  109  VLRKCVCIKPC  77
              R+C+C +PC
Sbjct  66   FRRRCLCTRPC  76



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M SS++ FA  LL V+  +A E+G    +V EAR CES S +FKG C SD NCA VC SE
Sbjct  1    MKSSMKMFAALLLVVMCLLANEMG--GPLVVEARTCESQSHKFKGTCLSDTNCANVCHSE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C C   C
Sbjct  59   RFSGGKCRGFRRRCFCTTHC  78



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  ++F+AT +G  ++   EAR CES S +FKGPC S+ NCA VC +E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVSV---EARTCESQSHRFKGPCVSENNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G+ R+C C + C
Sbjct  58   GFGGGKCRGLRRRCFCTRHC  77



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+R F+  +LFV+LF+ T  G     V EAR CES S +FKG C    NCA VC +E
Sbjct  1    MARSMRLFS--ILFVVLFLLTATGMGP-KVAEARTCESQSHRFKGICVRKSNCAAVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFHGGHCRGFRRRCFCTKHC  77



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
             ALL + + +AT +G   ++  EAR CE+ S  F GPC S  NCA VC +EGF  GDC+G
Sbjct  9    SALLLLFMILATVMG---LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRG  65

Query  109  VLRKCVCIKPC  77
              R+C+C +PC
Sbjct  66   FRRRCLCTRPC  76



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A LF++L     +G    MV E R C+S S +FKG C S  NCATVC +E
Sbjct  1    MERSMRLFSTAFLFLLLVATGMMG---PMVAEGRTCDSQSHRFKGSCVSKSNCATVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFRGGHCRGFRRRCFCTKHC  77



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   + ++L +ATE+G    MV EAR CES S +FKGPC SD NC +VC +E
Sbjct  1    MARSVPLVSTIFVLLLLLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  58

Query  136  GFPHGDCKGVLRKCVCIK  83
            GF  G C+G  R+C C K
Sbjct  59   GFSGGHCRGFSRRCFCTK  76



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
             ALL + + +AT +G   ++  EAR CE+ S  F GPC S  NCA VC +EGF  GDC+G
Sbjct  9    SALLLLFMILATVMG---LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRG  65

Query  109  VLRKCVCIKPC  77
              R+C+C +PC
Sbjct  66   FRRRCLCTRPC  76



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 75.1 bits (183),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A A L + + +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MAPSRRMVASAFLLLAILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G+ RKC C K C
Sbjct  59   SFPDGECKSHGLERKCFCKKVC  80



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 75.1 bits (183),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M +S + F+  LL V+L  AT      +MV EAR CES S +FKGPC    NCA+VC +E
Sbjct  1    MEASRKVFSAMLLMVLLLAATGEMGGPVMVAEARTCESQSHRFKGPCARKANCASVCNTE  60

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C GV R+C+C KPC
Sbjct  61   GFPDGYCHGVRRRCMCTKPC  80



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = -3

Query  283  LLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVL  104
            +LF++L   T +G  T+   EAR CE+ S  F GPC S  NCA VC +EGFP GDC+G  
Sbjct  13   VLFMLLVATTGIGPVTV---EARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGFR  69

Query  103  RKCVCIKPC  77
            R+C+C +PC
Sbjct  70   RRCLCSRPC  78



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R F+ A +FV+L +AT  G    M+ E R CE+ S +FKG C    NCA+VC +E
Sbjct  1    MERSMRLFSTAFVFVLLLVAT--GMMGPMLAEGRTCEAHSRKFKGTCLGKSNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  59   GFHGGHCRGFRRRCFCTKHC  78



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L+  ++F+AT +G  T+   EAR CES S +FKGPC S  NCA VC +E
Sbjct  1    MKLSMRLISAVLIMFMVFVATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFGGGKCRGFRRRCYCTRHC  77



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  +LF+AT +G  T+   EAR CES S +F+GPC S  NC  VC +E
Sbjct  1    MKLSMRLISAVLLMFMLFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFSGGKCRGFRRRCFCTRHC  77



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  SLR  +  LL  ++F+A+ +G  T+   EAR CES S +F+GPC S  NCA VC +E
Sbjct  1    MKLSLRLISAVLLMFMIFVASGMGPVTV---EARTCESKSHKFRGPCVSRHNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFHGGKCRGFRRRCYCTRHC  77



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R FA   L  +LF++TE+G   +   EAR CES S +F G C  + NCA+VC +E
Sbjct  1    MGRSIRLFATFFLIAMLFLSTEMG--PMTSAEARTCESQSHRFHGTCVRESNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+   R+C C + C
Sbjct  59   GFIGGNCRAFRRRCFCTRNC  78



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +  +L +ATE+G   I V EAR C+S S  FKGPC  D +CA VC +E
Sbjct  1    MARSIPFISTIFVMFLLLVATEMG--PIKVAEARICDSQSNTFKGPCVIDHSCAIVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G+ R C C KPC
Sbjct  59   GFTGGQCEGLRRICFCTKPC  78



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  ++F+AT +G  T+   EAR CES S +F+GPC S  NC  VC +E
Sbjct  1    MKLSMRLISAVLLMFMIFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFSGGKCRGFRRRCFCTRHC  77



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 7/71 (10%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
             A+L + + +AT       +  E R CES S  F GPC S+ NCA VC +EGFP GDC+G
Sbjct  9    SAVLLLFMLLAT-------VTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGDCRG  61

Query  109  VLRKCVCIKPC  77
              R+C+C +PC
Sbjct  62   FRRRCMCTRPC  72



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A   L + + +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MAPSRRMVASVFLLLAILVATEMG--TTQVAEARHCLSQSHRFKGMCVSSNNCANVCKTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G+ RKC C K C
Sbjct  59   NFPDGECKSHGLERKCFCKKLC  80



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R     LL V++ +A+E+     M+ EAR CES S +FKGPC    NCA VC +E
Sbjct  1    MERSRRMLPAILLLVLIVVASEMA---TMMVEARTCESQSHKFKGPCLRASNCANVCKTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFHGGKCRGFRRRCFCTKHC  77



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M +SLR FA   L  +L +AT          EAR CES S  FKG C SD NC +VC +E
Sbjct  1    MGNSLRLFATFFLVAMLLLAT----GPTTSVEARTCESQSHHFKGNCLSDTNCGSVCRTE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  57   GFTGGNCRGFRRRCFCTRNC  76



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            R FA   L  +L +ATE+G+  +   EAR CES S +F G C  D NCA++C +EGF  G
Sbjct  3    RLFATFFLVAMLLLATEMGQ--MSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGG  60

Query  121  DCKGVLRKCVCIKPC  77
            +C+G  R+C C + C
Sbjct  61   NCRGFRRRCFCTRNC  75



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R    AL+ ++L +ATE+     MV EAR CES S +FKG C S  NCA+VC +E
Sbjct  1    MDFSKRLIPAALIVMLLLVATEM---EPMVVEARTCESQSQRFKGACVSKTNCASVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFHGGHCRGFRRRCFCTKHC  77



>ref|XP_002865329.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41588.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M SS++  +     VIL +A  + +   MV   + CE+ S  F+G CT  +NC  VC+SE
Sbjct  1    MKSSIQLISTLFFLVILVLAPGMMK---MVEGQQMCETQSINFRGMCTKWRNCQRVCMSE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G CKG +RKC+C KPC
Sbjct  58   GFPDGRCKGFIRKCICTKPC  77



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  SLR  +  LL +++F+A+ +G  T+   EAR  ES S +F+GPC S  NCA VC +E
Sbjct  1    MKLSLRLISAVLLMIMIFVASGMGPVTV---EARTSESKSHKFRGPCVSRHNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFHGGKCRGFRRRCYCTRHC  77



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  SL   +   + ++L +AT +G  T+   EAR CES S  F GPC S  NCA +C +E
Sbjct  3    MKISLPLISAIAIMLMLLLATGMGPVTV---EARMCESSSQLFNGPCLSTTNCANICHNE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G  R+C+C +PC
Sbjct  60   GFTDGDCQGFRRRCICTRPC  79



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
             ALL + + +AT +G    +  EAR CE+ S  F GPC S  NCA VC +EGF  GDC+G
Sbjct  9    SALLLLFMILATVMG---PVRVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRG  65

Query  109  VLRKCVCIKPC  77
              R+C+C +PC
Sbjct  66   FRRRCLCTRPC  76



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 72.0 bits (175),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L+  ++F+AT +G  T+   EAR CES S +FKG C S  NCA VC +E
Sbjct  1    MKLSMRLISAVLIMFMIFVATGMGPVTV---EARTCESQSHRFKGTCVSASNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  58   GFVGGNCRGFRRRCFCTRHC  77



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   +  A   L ++L  ATE+G    MV EAR CES S +FKG C S  NCA+VC +E
Sbjct  1    MAGYPKVVATVFLMLMLVFATEMG---PMVAEARTCESQSHRFKGLCFSKSNCASVCHTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFYGGHCRGFRRRCFCTRHC  77



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M +SLR FA   L  +L +AT          EAR CES S  FKG C SD NC +VC +E
Sbjct  1    MGNSLRLFATFFLVTMLLLAT----GPTTRVEARTCESKSHHFKGKCLSDTNCGSVCHTE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G+ ++C C + C
Sbjct  57   GFTGGNCRGLRQRCFCTRNC  76



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +F++L +AT       MV EAR CES S +FKGPC SD NCA+VC +E
Sbjct  1    MARSVPLVSTIFVFLLLLVAT----GPSMVAEARTCESQSHKFKGPCASDHNCASVCQTE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C C   C
Sbjct  57   RFSGGHCRGFRRRCFCTTHC  76



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M+ S+   +   + ++L +ATE+   T MV EAR CES S +FKGPC SD NC +VC +E
Sbjct  1    MSRSVPLVSTIFVLLLLLVATEMMGPT-MVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C C K C
Sbjct  60   RFTGGHCRGFRRRCFCTKHC  79



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            RSF    L +I+  + EV    ++ TEAR C+S S  FKGPC  D NCA VC +EGF  G
Sbjct  5    RSFGLFFLLLIVLASQEV----VVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGG  60

Query  121  DCKGVLRKCVCIKPC  77
             CKG  R+C C K C
Sbjct  61   RCKGFRRRCFCTKLC  75



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  +L  ++F+AT +G  T+   EAR CES S +FKG C S+ NC  VC +E
Sbjct  1    MKLSMRLISTVILVFMIFVATGMGPVTV---EARTCESKSHRFKGACLSETNCKNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G+ R+C C + C
Sbjct  58   GFRGGNCRGLRRRCFCTRNC  77



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
            A +F +L +         MV EAR CES S +FKG C S  NCA+VC +EGFP G+C+G 
Sbjct  5    ATVFFVLMLVVISTERGPMVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGF  64

Query  106  LRKCVCIKPC  77
             R+C C K C
Sbjct  65   RRRCFCTKHC  74



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEA-RNCESPSGQFKGPCTSDKNCATVCLS  140
            MAS LR FA AL  V+L  +T       MV EA R CE+ S +FKG C    NCA VC +
Sbjct  1    MASFLRLFATALFMVMLVFSTG------MVAEATRTCEAKSHRFKGICARKANCAAVCQT  54

Query  139  EGFPHGDCKGVLRKCVCIKPC  77
            EGF  G C+G  R+C C K C
Sbjct  55   EGFHGGHCRGFRRRCFCTKHC  75



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  ++F+AT +G  T+   EAR CES S +FKG C S  NC  VC +E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFGGGKCRGFRRRCYCTRHC  77



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MAPSRRMAAPVLVLMLLPVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G  RKC C K C
Sbjct  59   NFPGGECKAEGATRKCFCKKIC  80



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L+  ++F+AT +G  T+   EAR CES S +FKG C S+ NC  VC +E
Sbjct  1    MKLSMRLISAVLVMFMIFVATGMGPVTV---EARTCESKSHRFKGTCLSESNCKNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  58   GFQGGNCRGFRRRCFCTRHC  77



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  ++F+AT +G  T+   EAR CES S +FKG C S+ NC  VC +E
Sbjct  1    MKLSMRLISALLLVFMIFVATGMGPVTV---EARKCESKSHRFKGKCLSETNCKNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  58   GFTGGNCRGFRRRCFCTRNC  77



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M + +R F+  L  ++L +ATE+G     + EAR CES S +FKG C S+ NCA VC +E
Sbjct  1    MKNPMRPFSAVLFLLLLLVATEIGSK---MAEARTCESQSHKFKGTCLSETNCANVCKTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C + C
Sbjct  58   GFTGGDCRGLRRRCFCTRHC  77



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  SLR  +  LL  ++F+A+ +G  T+   EAR CES S +F+G C S  NCA VC +E
Sbjct  1    MKLSLRLISAVLLMFMIFVASGMGPVTV---EARTCESKSHKFRGLCVSRHNCANVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFHGGKCRGFRRRCYCTRHC  77



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M+ S+   +   + ++L +ATE+   T MV EAR CES S +FKGPC SD NC +VC +E
Sbjct  1    MSRSVPLVSTICVLLLLLVATEMMGPT-MVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
             F  G C+G  R+C C K C
Sbjct  60   RFTGGHCRGFRRRCFCTKHC  79



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L+  ++F+AT +G  T+   EAR CES S +FKG C S+ NC  VC +E
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCKNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  58   GFTGGNCRGFRRRCFCTRHC  77



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L+  ++F+AT +G  T+   EAR CES S +FKG C S+ NC  VC +E
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCRNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  58   GFSGGNCRGFRRRCFCTRHC  77



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -3

Query  259  ATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKP  80
            ATE+G   + V EAR C+S S +F+GPC   +NCA VC +EGFP G C+G  R+C C+  
Sbjct  20   ATEIG--AVAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTH  77

Query  79   C  77
            C
Sbjct  78   C  78



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  L+  ++F+AT +G  T+   EAR CES S +FKG C S+ NC  VC +E
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV---EARTCESQSHRFKGKCFSETNCRNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G+C+G  R+C C + C
Sbjct  58   GFSGGNCRGFRRRCFCTRYC  77



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M+ S+R F+   + ++L +AT+      MV EAR CES S +FKGPC    NCA+VC +E
Sbjct  1    MSRSMRVFSTVFVVLLLLVATQY--MGPMVAEARTCESQSHRFKGPCVRKSNCASVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  59   GFHGGQCRGFRRRCFCTKHC  78



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            R F   LL +I+  + E     I+ TEAR CES S  FKGPC  D NCA VC +E F  G
Sbjct  4    RFFGVFLLLLIVLASQE----AIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGG  59

Query  121  DCKGVLRKCVCIKPC  77
             CKGV R+C C K C
Sbjct  60   RCKGVRRRCFCTKLC  74



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = -3

Query  283  LLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVL  104
            L  + L +A +V    +   E R CES S +FKGPC SD NC +VC  EGF  GDC+GV 
Sbjct  9    LFMLFLVLAADV---AVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCRGVR  65

Query  103  RKCVCIKPC  77
             +C C + C
Sbjct  66   HRCFCTRNC  74



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  220  ARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            AR CES S +FKGPC S+KNCA+VC +EGF  GDC+G  R+C C +PC
Sbjct  1    ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  48



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  232  MVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            MV EAR C S S +FKG C SD NCA+VC +EGFP GDCKG+ R+C C   C
Sbjct  21   MVGEARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCKGLRRRCFCETHC  72



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   +  A   L ++L  A E+G    MV EAR CES S +FKG C S  NCA+VC +E
Sbjct  1    MAGFPKVLAIVFLMLMLVFANEMG---PMVAEARTCESQSHRFKGLCISKSNCASVCHTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  58   GFNGGHCRGFRRRCFCTRHC  77



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            RSF    L +I+  + E     ++ TEAR C+S S  FKGPC  D NCA VC +EGF  G
Sbjct  5    RSFGLFFLLLIVLASPE---EVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGG  61

Query  121  DCKGVLRKCVCIKPC  77
             CKG  R+C C K C
Sbjct  62   RCKGFRRRCFCTKLC  76



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M + +R F+  L  ++L +ATE+G     + EAR CES + +FKG C S+ NCA VC +E
Sbjct  1    MKNPMRPFSAVLFLLLLLVATEIGSK---MAEARTCESQTHKFKGTCLSETNCANVCKTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  GDC+G+ R+C C + C
Sbjct  58   GFTGGDCRGLRRRCFCTRHC  77



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LLF+I F+AT +G  T+   EAR CES S +FKG C S  NC  VC +E
Sbjct  1    MNLSMRLISAVLLFMI-FVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  57   GFGGGKCRGFRRRCYCTRHC  76



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            RSF    L +I+  + EV    ++ TEAR C S S  FKGPC  D NCA VC +EGF  G
Sbjct  5    RSFGLFFLLLIVLASQEV----VVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGG  60

Query  121  DCKGVLRKCVCIKPC  77
             CKG  R+C C K C
Sbjct  61   RCKGFRRRCFCTKLC  75



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            R FA   L  +L +ATE+G   +   EAR CES S +F G C    NCA+VC +EGF  G
Sbjct  3    RLFATFFLVAMLLLATEMG--PMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGG  60

Query  121  DCKGVLRKCVCIKPC  77
            +C+G+ R+C C + C
Sbjct  61   NCRGLRRRCFCTRNC  75



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
               F++L +   +    ++ TE R+CES S +FKG C SD NCA+VC  EGFP G+C+G 
Sbjct  7    GFFFILLIL---LASQMMVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRGF  63

Query  106  LRKCVCIKPC  77
             R+C C K C
Sbjct  64   RRRCFCKKRC  73



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA  L S +   +  +L + TE+G N  MV EAR+C S S  +KG C  D+NCA VC +E
Sbjct  1    MARLLSSVSTIFVMFLLLVVTEMGAN--MVAEARSCISKSFTYKGLCVHDRNCANVCRTE  58

Query  136  GFPHGDCKGVL--RKCVCIKPC  77
            GF  G C+G     +C C KPC
Sbjct  59   GFVEGHCRGFAFGSRCFCYKPC  80



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + V EAR CESPS  F+GPC    NCA VC +EGFP G+C+G+ R+C C   C
Sbjct  50   VAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHC  102



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA  LR FA A + ++L  +T       MV EAR CES S +FKG C    NCA VC +E
Sbjct  1    MACFLRMFATAFVMLMLVFSTG------MVAEARKCESQSHRFKGICLRKANCAAVCQTE  54

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G   +C C K C
Sbjct  55   GFHSGHCRGFRGRCFCTKHC  74



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = -3

Query  310  SSLRSFADALLFVILFMA-TEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEG  134
            +S R  A AL+F+++ +A +E+G  T  V EAR+C S S +F G C S  NC  VC +EG
Sbjct  4    TSRRMVASALVFLLMLLAASEMG--TTRVAEARHCTSQSHRFVGACMSKSNCENVCRTEG  61

Query  133  FPHGDCK--GVLRKCVCIKPC  77
            FP G+C+  G+ RKC C + C
Sbjct  62   FPWGECRWHGIERKCHCKRIC  82



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNT-----IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
             A LF +L +   +G NT     I +  AR CESPS +F+GPC+ D NCA+VCL+EGF  
Sbjct  4    SAKLFAVL-LLLLIGYNTETQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTG  62

Query  124  GDCKGVLRKCVCIKPC  77
            G+CKG+  +C C + C
Sbjct  63   GECKGLRHRCFCTRDC  78



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + V  AR C+S S +FKGPC+ D+NCATVCL+EGF  G C+G+ R+C C + C
Sbjct  26   VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMV-TEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCK  113
            D   F   FM   +  + +MV TE R+CES S +FKG C SD+NCA+VC  EGF  G+C+
Sbjct  74   DKARFGFFFMLLILLASQMMVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCR  133

Query  112  GVLRKCVCIKPC  77
            G  R+C C + C
Sbjct  134  GFRRRCFCTRHC  145



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  LL ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAASTLLLLVLLVATEMGATTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRTE  60

Query  136  GFPHGDC--KGVLRKCVCIKPC  77
             FP G+C  + + RKC C KPC
Sbjct  61   NFPDGECHRQHLERKCFCKKPC  82



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +   E R CES S +FKGPC+ D NCA+VC  EGF  GDC+G  R+C C + C
Sbjct  22   VKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  + ALL  ++F+A  +G  T+   EAR CES S +FKG C SD NC  VC +E
Sbjct  1    MKLSMRLISAALLMFMIFVAA-MGPVTV---EARTCESQSHRFKGKCLSDGNCGNVCHNE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  57   GFGGGKCRGFRRRCFCTRNC  76



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -3

Query  280  LFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCK--GV  107
            +F+++ +   +G   + V E R C++PSG+FKG C S  NC  VC +EGFP G C     
Sbjct  13   IFLLVLLVITIGMMAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGSCDFHVT  72

Query  106  LRKCVCIKPC  77
             RKC C KPC
Sbjct  73   SRKCYCYKPC  82



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S+R  +  LL  ++F+AT +G  T+   EAR CES S +FKG C S  NC  VC +E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G   +C C + C
Sbjct  58   GFGGGKCRGFRVRCYCTRHC  77



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  250  VGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +    ++  E R CES S +FKG C    NCA+VC  EGFP G C+GV R+C+C KPC
Sbjct  20   IASEEMVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
             +LF+   + T V    +   EAR CES S +FKG C SD  CA  C +EGF  GDC+G+
Sbjct  7    GVLFMFFLLLTAVTDVAVKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGL  66

Query  106  LRKCVCIKPC  77
             R+C C + C
Sbjct  67   RRRCFCNRLC  76



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+        F+ L ++TE+    +   EAR C+S S  FKG C    NCA VC +E
Sbjct  1    MARSITLVCTIFFFLFLLVSTEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTE  60

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C G  R+C C KPC
Sbjct  61   GFTGGHCHGFRRRCFCSKPC  80



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            R F   +LF++LF + EV +      E R C+S S  FKGPC  D NCA VC +EGF  G
Sbjct  4    RLFGLCILFLVLFASPEVKQ-----AEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGG  58

Query  121  DCKGVLRKCVCIKPC  77
             C G  R+C C + C
Sbjct  59   RCHGFFRRCYCTRLC  73



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  232  MVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +  EAR C+S S +FKGPC S+ NCA VC +EGFP GDC G+LR+C C   C
Sbjct  11   VTVEARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRCYCNTHC  62



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = -3

Query  265  FMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCI  86
            +  T++G  T+ +  AR CESPS +F+GPC+ D NCATVC +EGF  G CKG+  +C C 
Sbjct  19   YTDTQLGPVTMAL--ARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCT  76

Query  85   KPC  77
            K C
Sbjct  77   KDC  79



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
            AL+ +++F A+++G   +M +EAR CESPS  FKG C +D+NCA VCL+EGF  G C+G 
Sbjct  10   ALVLLVIF-ASDMG---VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGA  65

Query  106  LRKCVCIKPC  77
              +C C   C
Sbjct  66   RHRCFCTIIC  75



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 7/80 (9%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   +  A   L ++L  A E+       TEAR CES S ++KGPC    NCA VC +E
Sbjct  1    MAGFKKLLATFFLVLMLVFAAEL-------TEARTCESQSHRYKGPCVRKNNCANVCKTE  53

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  54   GFSGGHCRGFRRRCFCAKHC  73



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
            +  F+++ +   +G   + + EAR C++PSG+FKG C S  NC  VC +EGFP G C   
Sbjct  11   SAFFLLVLLVISIGMIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFH  70

Query  106  L--RKCVCIKPC  77
            +  RKC C KPC
Sbjct  71   VANRKCYCSKPC  82



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            ++  EAR CE+ S  F GPC S  NCA VC +EGF  GDC+G  R+C+C +PC
Sbjct  3    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>ref|XP_004306561.1| PREDICTED: defensin D2-like [Fragaria vesca subsp. vesca]
Length=74

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            + F  AL F+IL  + E+    ++ +EAR CE PS  FKG C  D +C   C SEG+ +G
Sbjct  4    KYFGFALFFIILLTSQEM----VIQSEARVCEVPSKTFKGMCFRDTHCIVRCHSEGYGYG  59

Query  121  DCKGVLRKCVCIKPC  77
             C  VLR+C C+K C
Sbjct  60   KCSHVLRRCKCLKAC  74



>gb|EMT22729.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=76

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = -3

Query  262  MATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG--VLRKCVC  89
            +ATE+G  T    EAR CES S +FKGPC SD NCATVC +E FP G C    V RKC C
Sbjct  15   VATEMG--TTKTAEARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCYC  72

Query  88   IKPC  77
             + C
Sbjct  73   ERDC  76



>gb|EYU27577.1| hypothetical protein MIMGU_mgv1a024490mg [Erythranthe guttata]
Length=71

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 40/74 (54%), Gaps = 8/74 (11%)
 Frame = -3

Query  298  SFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGD  119
            +FA  L  V +F   E         + R CES S  F+GPC  D NC  VC SEGF  GD
Sbjct  6    AFALVLFLVFVFACEEA--------KGRTCESQSFNFRGPCVIDHNCKAVCESEGFTDGD  57

Query  118  CKGVLRKCVCIKPC  77
            C+G  R+C C KPC
Sbjct  58   CQGFRRRCFCRKPC  71



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = -3

Query  310  SSLRSFADALLFVILFMA-TEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEG  134
            +S R  A AL+F+++ +A +E+G  T    EAR+C S S +F G C S  NC  VC +EG
Sbjct  4    TSRRMVASALVFLLMLLAASEMG--TTRXAEARHCTSQSHRFVGACMSKSNCENVCRTEG  61

Query  133  FPHGDCK--GVLRKCVCIKPC  77
            FP G+C+  G+ RKC C + C
Sbjct  62   FPWGECRWHGIERKCHCKRIC  82



>gb|AIA67000.1| defensin [Triticum aestivum]
Length=84

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = -3

Query  262  MATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG--VLRKCVC  89
            +ATE+G  T    EAR CES S +FKGPC SD NCATVC +E FP G C    V RKC C
Sbjct  23   VATEMG--TTKTAEARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCYC  80

Query  88   IKPC  77
             + C
Sbjct  81   ERDC  84



>ref|XP_006295860.1| hypothetical protein CARUB_v10024990mg [Capsella rubella]
 gb|EOA28758.1| hypothetical protein CARUB_v10024990mg [Capsella rubella]
Length=83

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
              L+FVIL         T+   + + CE+ S  F+G CT   NC  VC+SEGFP G CKG
Sbjct  9    STLIFVILLFLGPSMMKTVEGQDPQLCETKSLYFRGMCTKWANCKRVCISEGFPDGRCKG  68

Query  109  VLRKCVCIKPC  77
             +R CVC KPC
Sbjct  69   FIRDCVCRKPC  79



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query  298  SFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGD  119
            +F    +F+I+F++       +   EAR C SPS  + GPC  D NCA VC +EGF  GD
Sbjct  6    TFGFLFVFLIIFVSQ---MEMMRQVEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGD  62

Query  118  CKGVLRKCVCIKPC  77
            C G+ RKC C K C
Sbjct  63   CVGIQRKCYCTKLC  76



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  295  FADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDC  116
            F+ A+  ++L + T +G    MVTEAR CESPS +FKG C S  NC  VC +EGF  G C
Sbjct  4    FSAAIFLLLLLLGTGMG---PMVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHC  60

Query  115  KGVLRKCVCIKPC  77
            +G  R+C C K C
Sbjct  61   RGFRRRCFCTKHC  73



>gb|ACG41256.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = -3

Query  310  SSLRSFADALLFVILFMA-TEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEG  134
            +S R  A AL+F+++ +A +E+G  T  V EAR+C S S +F G C S  NC  VC +EG
Sbjct  4    TSRRMVASALVFLLMLLAASEMG--TTRVAEARHCTSQSHRFVGACMSKSNCENVCRTEG  61

Query  133  FPHGDCK--GVLRKCVCIKPC  77
            FP  +C+  G+ RKC C + C
Sbjct  62   FPWXECRWHGIERKCXCKRIC  82



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +TEAR CES S +FKG C S+ NCA+VC +EGF  GDC+G+ R+C C + C
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
            + +F+++ +   +G   + + E R C++PSG+FKG C S  NC  VC +EGFP G C   
Sbjct  11   SAIFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFH  70

Query  106  L--RKCVCIKPC  77
            +  RKC C KPC
Sbjct  71   VANRKCYCSKPC  82



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S + F+  LL ++L +ATEVG   + V EAR C S S +F+GPC    NCA VC +E
Sbjct  1    MELSRKLFSAVLLVLLLLVATEVG-GPVGVAEARTCLSQSHKFRGPCVRRANCANVCRTE  59

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G+ R+C C   C
Sbjct  60   GFPDGKCRGLRRRCFCTTHC  79



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 45/87 (52%), Gaps = 7/87 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVG-------RNTIMVTEARNCESPSGQFKGPCTSDKNC  158
            M  S+R  + A + V+L   TE+G         +    E R CE+ SG+FKG C S  NC
Sbjct  1    MEHSMRLVSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  157  ATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            A  C  E F  G CKG  R+C+C K C
Sbjct  61   ANTCAREKFDGGKCKGFRRRCMCTKKC  87



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +MV EAR CES S +F+GPC    NCA VC +EGFP G C+G  R+C C   C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 5/80 (6%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M   +R F    + ++L MAT      +   E R CES S +FKG C S  NCA VC +E
Sbjct  1    MGVLMRLFTTIFMVLMLLMATG-----LEPAEGRTCESQSHKFKGTCASGTNCANVCKTE  55

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GFP G C+G  R+C C   C
Sbjct  56   GFPGGKCRGFRRRCFCTTHC  75



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R F+ A + ++L +ATE+G       EAR C+S S +FKG C    NCA VC +E
Sbjct  1    MERSTRLFSAAFVLLLLLLATEMG---PKAAEARTCQSQSHRFKGMCMRKSNCAAVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  58   GFHSGHCRGFHRRCFCTKHC  77



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +MV +AR CES S +FKG C S  NCA VC +EGFP G C+G  R+C C K C
Sbjct  4    LMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -3

Query  304  LRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
            ++ F+ A+L ++L +AT +G    MVT+AR CESPS  FKG C S  NC  VC +EGF  
Sbjct  1    MKFFSAAILLLLLLLATGMG---PMVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHG  57

Query  124  GDCKGVLRKCVCIKPC  77
            G C+G  R+C C K C
Sbjct  58   GHCRGFRRRCFCTKHC  73



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
            +  F+++ +   +G   + + E R C++PSG+FKG C S  NC  VC +EGFP G C   
Sbjct  11   SAFFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFH  70

Query  106  L--RKCVCIKPC  77
            +  RKC C KPC
Sbjct  71   VANRKCYCSKPC  82



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M   +R F+  LL ++L +ATE G    MV EAR CES S +FKG C  + NCA +C +E
Sbjct  1    MKCPMRLFSTLLLLLLLLLATETG---PMVAEARTCESLSHRFKGICVRNSNCAAICQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G+ R+C C K C
Sbjct  58   GFQGGHCRGLRRRCFCTKHC  77



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  232  MVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            MVTEAR CESPS +FKG C S  NC  VC +EGF  G C+G  R+C C K C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>sp|P81571.1|DEFD2_SPIOL RecName: Full=Defensin D2; AltName: Full=Antimicrobial peptide 
D2; AltName: Full=So-D2, partial [Spinacia oleracea]
Length=52

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +  +R C++PS  FKG CT D NC T C  EG+P GDCKG+ R+C+C KPC
Sbjct  2    IFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC  52



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +MV EAR CES S +F+GPC    NCA VC +EGFP G C+G  R+C C   C
Sbjct  51   VMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>gb|AAL14240.1| proteinase inhibitor [Musa acuminata AAA Group]
Length=49

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  223  EARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            E+R CES S +FKG C    NCA+VC  EGFP G C+GV R+C+C KPC
Sbjct  1    ESRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  49



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -3

Query  259  ATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKP  80
            A+E+G   +   EAR CES S +FKGPC S  NCA VC +EGF  G C+G  R+C C K 
Sbjct  19   ASEMG---LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKR  75

Query  79   C  77
            C
Sbjct  76   C  76



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            ++ TEAR C S S  FKGPC    NCA VC +EGFP G+CKG  R+C C KPC
Sbjct  22   MVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 45/87 (52%), Gaps = 7/87 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVG-------RNTIMVTEARNCESPSGQFKGPCTSDKNC  158
            M  S+R  + A + V+L   TE+G         +    E R CE+ SG+FKG C S  NC
Sbjct  1    MEPSMRLVSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  157  ATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            A  C  E F  G CKG  R+C+C K C
Sbjct  61   ANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 7/87 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVG-------RNTIMVTEARNCESPSGQFKGPCTSDKNC  158
            M  S+R  + + + V+L +ATE+G         +  V E R CE+ SG+FKG C S  NC
Sbjct  1    MERSMRLVSASFVLVLLLVATEMGTMGVEARSKSSKVVEERTCEAASGKFKGLCFSSNNC  60

Query  157  ATVCLSEGFPHGDCKGVLRKCVCIKPC  77
               C  E F  G C+G  R+C+C K C
Sbjct  61   KHTCKREQFTGGKCRGFRRRCMCNKKC  87



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   +  A   L ++L  AT       MV EAR CES S +FKG C S  NC +VC +E
Sbjct  1    MAGFSKVIATIFLMMMLVFATG------MVAEARTCESQSHRFKGLCFSKSNCGSVCHTE  54

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  55   GFNGGHCRGFRRRCFCTRHC  74



>dbj|BAB64929.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 7/87 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVG-------RNTIMVTEARNCESPSGQFKGPCTSDKNC  158
            M  S+R  + A + ++L   TE+G         +    E R CE+ SG+FKG C S  NC
Sbjct  1    MEPSMRLISAAFVLILLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  157  ATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            A  C  E F  G CKG  R+C+C K C
Sbjct  61   ANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_004953175.1| PREDICTED: defensin-like protein 2-like [Setaria italica]
Length=80

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+F++L +A+E+G  T  V EAR+C S S  FKG C S  NCA VC  E
Sbjct  1    MALSRRMAAPVLVFLLLLIASEMGPAT--VAEARHCLSQSHHFKGLCLSSSNCANVCRVE  58

Query  136  GFPHGDCKGV--LRKCVCIKPC  77
             FP G+C+     RKC C + C
Sbjct  59   RFPDGECQTTAGTRKCFCKRIC  80



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S+   +   +F++L +ATE+G    MV EAR CES S   +G C SD+NCA+ C +E
Sbjct  1    MARSVSFVSTIFVFLLLLLATEMG--PRMVAEARGCESRSRHLRGKCESDENCASACRTE  58

Query  136  GFPHGDCKGVLRKCVCIK  83
             F  G C+G   +C C K
Sbjct  59   RFSGGHCRGFRCRCFCDK  76



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R     +L  +L + +++G  ++   EAR CES S +FKG C    NCA VC +E
Sbjct  1    MEDSRRMLPAIVLLFLLLITSDMGMTSV---EARKCESASHKFKGLCFRASNCANVCKTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G+ R+C C K C
Sbjct  58   GFHGGHCRGLRRRCFCTKHC  77



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +MV EAR CES S +F G C    NCA+VC +EGF  G C+G  R+C C KPC
Sbjct  28   VMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>ref|XP_010675153.1| PREDICTED: defensin-like protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=72

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 6/75 (8%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            R F   +LF++LF +       +   E R C+S S  FKGPC  D NCA VC +EGF  G
Sbjct  4    RLFGLCILFLVLFASQ------VKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGG  57

Query  121  DCKGVLRKCVCIKPC  77
             C G  R+C C + C
Sbjct  58   RCHGFFRRCYCTRLC  72



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  256  TEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            TE+G   + V EAR+CES S +FKG C    NCA+VC SEGF  G C+GV R+C C   C
Sbjct  12   TEMG---LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMAT-EVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLS  140
            M   +R  +  LL ++LF +T EVG     V EAR CE+ S +FKG C    NCA VC +
Sbjct  1    MDRFMRLISALLLVMLLFSSTAEVGPK---VAEARTCETRSHRFKGICGRKANCAAVCQA  57

Query  139  EGFPHGDCKGVLRKCVCIKPC  77
            EGF  G C+G  R+C C K C
Sbjct  58   EGFQGGHCRGFRRRCFCTKHC  78



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            ++FA   LF++LF + +     I+  E R C+S S  FK  C SD NCA +C +EGF  G
Sbjct  4    KTFAAIFLFLVLFSSQK-----IIGIEGRMCQSKSHHFKHMCWSDHNCAIICRNEGFSGG  58

Query  121  DCKGVLRKCVCIKPC  77
             C+G  R+C C + C
Sbjct  59   RCRGFHRRCYCTRLC  73



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  304  LRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
            ++ F+  +  ++L   + +     MV EAR CESPS  FKG C SD NC  +C +EGF  
Sbjct  1    MKFFSAPIFLLLLIFGSGM---APMVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSG  57

Query  124  GDCKGVLRKCVCIKPC  77
            G C+G  R+C C K C
Sbjct  58   GVCRGFRRRCFCTKHC  73



>gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus]
Length=73

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            ++ TEAR CES S  FKG CT D NCA VC +EGF  G+C+G  R+C C K C
Sbjct  21   VVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
 emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris]
 gb|ESW09810.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
Length=73

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            ++ TEAR CES S  FKG CT D NCA VC +EGF  G+C+G  R+C C K C
Sbjct  21   VVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>sp|Q8GTM0.1|DEF_NICAL RecName: Full=Flower-specific defensin; AltName: Full=NaD1; Flags: 
Precursor [Nicotiana alata]
 gb|AAN70999.1|AF509566_1 flower-specific defensin precursor [Nicotiana alata]
Length=105

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 8/94 (9%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   A A+L ++LF+A EV        +AR C++ S  F G C +   C   C+SE
Sbjct  1    MARSLCFMAFAILAMMLFVAYEV--------QARECKTESNTFPGICITKPPCRKACISE  52

Query  136  GFPHGDCKGVLRKCVCIKPC*FDHLSTYIARQML  35
             F  G C  +LR+C+C KPC FD   T    ++L
Sbjct  53   KFTDGHCSKILRRCLCTKPCVFDEKMTKTGAEIL  86



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -3

Query  283  LLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVL  104
            LLF++L     V R      EAR C S S  FKG C S+ NCATVCL+EGF  G C+G+ 
Sbjct  11   LLFLVLAADVAVKR-----AEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLR  65

Query  103  RKCVCIKPC  77
            R+C C K C
Sbjct  66   RRCFCSKNC  74



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   +  A  LL ++L  +T       M+ EAR CES S +FKG C S  NC +VC +E
Sbjct  1    MAGFSKLVATILLMLMLVFSTG------MIAEARTCESQSRRFKGLCFSKSNCGSVCHTE  54

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C + C
Sbjct  55   GFSGGHCRGFRRRCFCTRHC  74



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  244  RNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +  ++  EAR C S S  FKGPC    NCA+VC +EGFP G+CKG  R+C C KPC
Sbjct  19   QEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_009598624.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=105

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 48/84 (57%), Gaps = 8/84 (10%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   A A+L ++LF+A EV        +AR C++ S  F G C +   C   C+SE
Sbjct  1    MARSLCFMAFAVLAMMLFVAYEV--------QARECKTESNTFPGLCITKPPCRKACISE  52

Query  136  GFPHGDCKGVLRKCVCIKPC*FDH  65
            GF  G C  +LR+C+C KPC FD 
Sbjct  53   GFTDGHCSKILRRCLCTKPCVFDE  76



>gb|AIA66999.1| defensin [Triticum aestivum]
Length=82

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = -3

Query  259  ATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG--VLRKCVCI  86
            ATE+G  T+ V EAR CES S  FKG C SD NCA+VC +E FP G C    V RKC C 
Sbjct  22   ATEMG--TVKVAEARTCESQSHNFKGACFSDTNCASVCHTENFPRGQCHQHHVERKCYCE  79

Query  85   KPC  77
            + C
Sbjct  80   RDC  82



>gb|EMS52277.1| Defensin Tk-AMP-D1.1 [Triticum urartu]
Length=77

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -3

Query  259  ATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKP  80
            ATE    ++ V  AR+CES S +F G C SD NCA VC +EGF  G C GV R C C K 
Sbjct  17   ATEEQGGSVQVALARDCESDSHKFHGACFSDTNCANVCQTEGFTAGKCVGVQRHCHCTKD  76

Query  79   C  77
            C
Sbjct  77   C  77



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  217  RNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            R CE+PS +FKGPC  + NCA VC +EGF  G C+G+ R+C C +PC
Sbjct  55   RTCETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A ALL ++L +ATE+G  T+ + EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAASALLLLVLLVATEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTE  60

Query  136  GFPHGDC--KGVLRKCVCIKPC  77
             FP G+C      RKC C +PC
Sbjct  61   NFPDGECHTHNFARKCFCKRPC  82



>ref|XP_009793541.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=94

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 48/84 (57%), Gaps = 8/84 (10%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   A A+L ++LF+A EV        +AR C++ S  F G C +   C   C+ E
Sbjct  1    MARSLCFMAFAVLAMMLFVAYEV--------QARECKAESVTFSGLCITKTPCIEACICE  52

Query  136  GFPHGDCKGVLRKCVCIKPC*FDH  65
            GF +G C  +LR+C+C KPC FD 
Sbjct  53   GFTNGRCSTILRRCLCTKPCVFDE  76



>gb|AIA67009.1| defensin [Triticum aestivum]
Length=77

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -3

Query  259  ATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKP  80
            ATE    ++ V  AR+CES S +F G C SD NCA VC +EGF  G C GV R C C K 
Sbjct  17   ATEEQGGSVQVALARDCESDSHKFHGACFSDTNCAYVCQTEGFTAGKCVGVQRHCHCTKD  76

Query  79   C  77
            C
Sbjct  77   C  77



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -3

Query  241  NTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + +MV EAR CES S +F+GPC    NC  VC +EGF  G C+G  R+C C+  C
Sbjct  25   DQMMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>ref|XP_009630513.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=106

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 7/94 (7%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   A A+L ++LF+A EV   +        C++ S  F G C +   C   CLSE
Sbjct  1    MARSLCFMAFAVLAMMLFIAYEVQAQS-------TCKAESNTFPGICITKPPCRKACLSE  53

Query  136  GFPHGDCKGVLRKCVCIKPC*FDHLSTYIARQML  35
            GF  G C  +LR+C+C KPC FD   T    + L
Sbjct  54   GFTDGKCSKILRRCICYKPCVFDEKITKTGAETL  87



>gb|AIA67004.1| defensin [Triticum aestivum]
Length=84

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = -3

Query  259  ATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCK--GVLRKCVCI  86
            ATE+G   +     R+CES S +++G C  D NC  VC +EGFP G CK  G   KCVC 
Sbjct  21   ATEMGTTRVAEARHRHCESQSHRYRGACWRDDNCKHVCNTEGFPSGKCKFHGFESKCVCT  80

Query  85   KPC  77
            KPC
Sbjct  81   KPC  83



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +MV EAR CES S +F+GPC    NCA VC +EGF  G C+G  R+C C   C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>gb|ABM89231.1| defensin [Setaria italica]
 gb|AEG19551.1| defensin [Zea mays subsp. mays]
 emb|CDK12932.1| defensin [Zea mays subsp. mays]
 gb|AHG97966.1| defensin 1 [Zea mays]
 emb|CEJ09692.1| Defensin protein [Zea mays]
Length=80

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MAPSRRMAAPVLVLMLLLVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G  RKC C K C
Sbjct  59   NFPGGECKAEGATRKCFCKKIC  80



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 64.3 bits (155),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  244  RNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +  + V  AR C SPS +FKG C SD NCA+VCL+E FP G C G+ ++C+C + C
Sbjct  21   QGAVQVALARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 64.3 bits (155),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R    ALL ++L +ATE+G  T  V EAR+C S S  FKG C S  NC  VC +E
Sbjct  1    MALSRRMAPSALLLLVLLVATEMGATTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRTE  60

Query  136  GFPHGDCKG--VLRKCVCIKPC  77
             FP G+C      RKC C +PC
Sbjct  61   NFPDGECHTPHFERKCFCKRPC  82



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 64.3 bits (155),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M   +R F+  LL ++L +ATE G    MV EAR CES S +FKG C  + NCA +C +E
Sbjct  1    MKCPMRLFSTLLLLLLLLLATETG---PMVAEARTCESLSHRFKGICVRNSNCAAICQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC*FDH  65
            GF  G C+G+ R+C C   C   H
Sbjct  58   GFQGGHCRGLRRRCFCTMYCNNHH  81



>gb|ACG25019.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAAPVLVLLLLLVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G  RKC C K C
Sbjct  59   NFPGGECKAEGATRKCFCKKIC  80



>ref|NP_001147001.1| LOC100280611 precursor [Zea mays]
 gb|ACG29535.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30746.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30775.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG34029.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG43919.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|AFW72423.1| low-molecular-weight cysteine-rich protein LCR69 [Zea mays]
Length=80

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAAPVLVLMLLLVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G  RKC C K C
Sbjct  59   NFPGGECKAEGATRKCFCKKIC  80



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  232  MVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            MV EAR CESPS  FKG C SD NC  +C +EGF  G C+G  R+C C K C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>ref|XP_006410329.1| hypothetical protein EUTSA_v10017942mg [Eutrema salsugineum]
 gb|ESQ51782.1| hypothetical protein EUTSA_v10017942mg [Eutrema salsugineum]
Length=80

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = -3

Query  289  DALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKG  110
             +L F+++ +A        MV   + CE+ S  F+G C   +NC  VC+SEGFP G C G
Sbjct  9    SSLFFLVILLAAP---GMKMVQGQQICEARSINFRGMCMKWRNCQRVCMSEGFPDGRCAG  65

Query  109  VLRKCVCIKPC  77
             +R+C+C KPC
Sbjct  66   FIRRCICRKPC  76



>gb|EMS49334.1| Defensin-like protein [Triticum urartu]
 gb|AIA66991.1| defensin [Triticum aestivum]
Length=82

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 2/82 (2%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A ALL ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAASALLLLVLLVATEMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTE  60

Query  136  GFPHGDC--KGVLRKCVCIKPC  77
             FP G+C  + + RKC C +PC
Sbjct  61   KFPDGECHRQHLERKCFCKRPC  82



>gb|AIA67007.1| defensin [Triticum aestivum]
Length=77

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  226  TEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
             EA+ C   S  FKGPC SDKNCA VCL EG+  G+C G  R+C CI+ C
Sbjct  28   AEAKVCRQRSAGFKGPCVSDKNCAQVCLQEGWGGGNCDGPFRRCKCIRQC  77



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = -3

Query  286  ALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGV  107
               F++L + +      ++ TE R+CES S +FKG C S  NCA+VC  EGF  G C+G 
Sbjct  7    GFFFMLLILLSS---QMVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGF  63

Query  106  LRKCVCIKPC  77
             R+C C + C
Sbjct  64   RRRCFCTRHC  73



>ref|NP_201171.1| defensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FFP8.1|DEF06_ARATH RecName: Full=Defensin-like protein 6; AltName: Full=Low-molecular-weight 
cysteine-rich protein 74; Short=Protein LCR74; 
AltName: Full=Plant defensin 2.5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97782.1| defensin-like protein 6 [Arabidopsis thaliana]
Length=73

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 5/73 (7%)
 Frame = -3

Query  295  FADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDC  116
            FA   L ++LF + E     I+  E R C+S S  FK  CTS+ NCA VC +EGF  G C
Sbjct  6    FAAFFLLLVLFSSQE-----IIGGEGRTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGGRC  60

Query  115  KGVLRKCVCIKPC  77
             G  R+C C + C
Sbjct  61   HGFHRRCYCTRLC  73



>gb|EMT30046.1| Defensin-like protein P322 [Aegilops tauschii]
Length=78

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MASS + F   LL ++L +A EV        E R CE+ S +FKG C    NCA +CL+E
Sbjct  1    MASSHKFFPAVLLLLLLVVAMEVA--PAQAEEPRVCETDSTRFKGICMVGTNCANICLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C G+ RKC+C KPC
Sbjct  59   GFTSGKCSGLKRKCICTKPC  78



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            V EAR+CES S +FKG C    NCA+VC SEGF  G C+GV R+C C   C
Sbjct  18   VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AGC82207.1| defensin [Persea americana var. drymifolia]
Length=78

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = -3

Query  283  LLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVL  104
            LL   L + +E+    +   EA  CE+PS  F G C    NCA+VC  E F  G C+GV 
Sbjct  13   LLLCFLVIVSEIA---VTRVEAATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVR  69

Query  103  RKCVCIKPC  77
            R+C+C+KPC
Sbjct  70   RRCMCLKPC  78



>gb|ACG30752.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAAPVLVLMLLLVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+C+  G  RKC C K C
Sbjct  59   NFPGGECRAEGATRKCFCKKIC  80



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + +  AR CES S +FKGPC+ D NCA VCL+EGF  G CKG+  +C C + C
Sbjct  26   VTMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>emb|CDY04774.1| BnaC05g18150D [Brassica napus]
Length=136

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  232  MVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            +V   + CE+ S  FKG C   +NC  VC+SEGFP G CKG +RKCVC KPC
Sbjct  82   LVQGQQMCEAKSINFKGICLKCRNCKHVCISEGFPEGRCKGFVRKCVCRKPC  133



>ref|XP_009631841.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=62

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  226  TEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
             EAR C SPS  + GPC  D NCA VC +EGF  GDC G+ RKC C K C
Sbjct  13   VEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCYCTKLC  62



>gb|EMT06279.1| Defensin-like protein 2 [Aegilops tauschii]
Length=82

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA + R  A ALL ++L +ATE+G       EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MAPTRRMAASALLLLLLLVATEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRTE  60

Query  136  GFPHGDC--KGVLRKCVCIKPC  77
             FP G+C      RKC C + C
Sbjct  61   NFPDGECHTHNFARKCFCKRAC  82



>gb|ADQ43197.1| unknown [Eutrema parvulum]
Length=72

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  SLR  A ++L   + +   +G+      EA+ CESPSG++ G C + KNCA+VC SE
Sbjct  1    MKLSLR-LASSILLSFMLLLAAMGQ-----VEAKTCESPSGKYHGVCLNAKNCASVCPSE  54

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G CK +  +C CIK C
Sbjct  55   GFTGGHCKSL--RCYCIKTC  72



>emb|CEJ09689.1| Defensin protein [Zea mays]
 emb|CEJ09691.1| Defensin protein [Zea mays]
Length=80

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ ++L +ATE+G  T  V EAR+C S S +FKG C S  NCA  C +E
Sbjct  1    MAPSRRMAAPVLVLLLLLVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANACQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G  RKC C K C
Sbjct  59   NFPGGECKAEGATRKCFCKKIC  80



>gb|ACB20518.1| defensin precursor [Saccharum officinarum]
Length=80

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA S R  A  L+ V+L +ATE+G  T  V EAR C S S +FKG C S  NCA VC +E
Sbjct  1    MALSRRMAAPVLVLVLLLVATELG--TTTVAEARYCLSQSHRFKGLCMSSSNCANVCQTE  58

Query  136  GFPHGDCK--GVLRKCVCIKPC  77
             FP G+CK  G  RKC C K C
Sbjct  59   NFPGGECKADGATRKCFCKKIC  80



>ref|XP_007202934.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 ref|XP_007202943.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 ref|XP_007203068.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
 gb|EMJ04133.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 gb|EMJ04142.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 gb|EMJ04267.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
Length=85

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 44/88 (50%), Gaps = 11/88 (13%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTE--------ARNCESPSGQFKGPCTSDKN  161
            M  S R F+   + V+LF+A   G    MV E        +R CES S +FKGPC    N
Sbjct  1    MEGSKRMFSTVFILVLLFVAIGTGP---MVAEGKVETKETSRTCESLSTKFKGPCIRSSN  57

Query  160  CATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            CA +C  EGF  G C G   +C C K C
Sbjct  58   CANICEEEGFKGGKCVGFRLRCTCTKNC  85



>gb|AIA66994.1| defensin [Triticum aestivum]
Length=82

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA + R  A ALL ++L +ATE+G       EAR+C S S +FKG C S  NCA VC +E
Sbjct  1    MALTRRMAASALLLLLLLVATEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRTE  60

Query  136  GFPHGDC--KGVLRKCVCIKPC  77
             FP G+C      RKC C + C
Sbjct  61   NFPDGECHTHNFARKCFCKRAC  82



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + V EAR CE+ S +F+GPC   +NCA VC +EGFP G C+G   +C C   C
Sbjct  30   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  82



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = -3

Query  256  TEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            TE+G   + V  AR+CES S +FKG C    NCA+VC SEGF  G C+GV R+C C   C
Sbjct  12   TEMG---LKVAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_009793542.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
 sp|P32026.1|DEF_TOBAC RecName: Full=Defensin-like protein; AltName: Full=Flower-specific 
gamma-thionin; Flags: Precursor [Nicotiana tabacum]
 emb|CAA77806.1| flower-specific thionin [Nicotiana tabacum]
Length=105

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 8/84 (10%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   A A+L ++LF+A EV        +AR C++ S  F G C +   C   C+SE
Sbjct  1    MARSLCFMAFAILAMMLFVAYEV--------QARECKTESNTFPGICITKPPCRKACISE  52

Query  136  GFPHGDCKGVLRKCVCIKPC*FDH  65
             F  G C  +LR+C+C KPC FD 
Sbjct  53   KFTDGHCSKLLRRCLCTKPCVFDE  76



>ref|XP_003573542.1| PREDICTED: defensin-like protein 3 [Brachypodium distachyon]
Length=77

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = -3

Query  283  LLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVL  104
            +L +IL    E G N   V EA+ C   S  + G C SD+NCA VC +EG+  G+C G +
Sbjct  12   MLLIILAAQEEGGSN---VAEAKICRKRSAGYHGMCMSDRNCAQVCQAEGWGGGNCDGAV  68

Query  103  RKCVCIKPC  77
            R+C C + C
Sbjct  69   RRCKCSREC  77



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -3

Query  280  LFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLR  101
            ++V+L+   E     ++  +AR C++PS  F+G C  ++NC   C  EGFP G CKG+ R
Sbjct  6    VYVLLWFVAE---EMVVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRR  62

Query  100  KCVCIKPC  77
            +C C +PC
Sbjct  63   RCFCSRPC  70



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  235  IMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + V EAR CE+ S +F+GPC   +NCA VC +EGFP G C+G   +C C   C
Sbjct  28   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  80



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R F+ A + ++L +ATE         EAR C+S S +FKG C    NCA VC +E
Sbjct  1    MERSTRLFSAAFVLLLLLLATE--EMGPKAAEARTCQSQSHRFKGMCMRKSNCAAVCQTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+G  R+C C K C
Sbjct  59   GFHSGHCRGFHRRCFCTKHC  78



>dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri]
Length=71

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  211  CESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            C SPS +FKGPC SD NC +VC  EGF  G+C+G  R+C C KPC
Sbjct  27   CRSPSQKFKGPCFSDSNCQSVCEGEGFTGGECEGFRRRCFCSKPC  71



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = -3

Query  304  LRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPH  125
            L S  D  +++I ++A       +   E R+C S S  FKG C SD NCA VC +EGF  
Sbjct  16   LPSVKDRYIYIIPYVA-------VKRAEGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTG  68

Query  124  GDCKGVLRKCVCIKPC  77
            GDC G  R+C C + C
Sbjct  69   GDCGGFRRRCFCTRIC  84



>gb|ABU40984.1| putative flower-specific thionin [Nicotiana tabacum]
Length=105

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 8/84 (10%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA SL   A A+L ++LF+A EV        +AR C++ S  F G C +   C   C+SE
Sbjct  1    MARSLCFMAFAILAMMLFVAYEV--------QARECKTESNTFPGICITKPPCRKACISE  52

Query  136  GFPHGDCKGVLRKCVCIKPC*FDH  65
             F  G C  +LR+C+C KPC FD 
Sbjct  53   KFTDGHCSKLLRRCLCAKPCVFDE  76



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  280  LFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLR  101
            LF +LF+        ++ TE R+CES S +F G C S  NCA+VC  EGF  G C+G  +
Sbjct  8    LFFVLFILL-ASHQMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGFRK  66

Query  100  KCVCIKPC  77
            +C C K C
Sbjct  67   RCFCKKRC  74



>gb|AIA67015.1| defensin [Triticum aestivum]
Length=78

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MASS + F   LL ++L +  EV        E R CE+ S +FKG C    NCA +CL+E
Sbjct  1    MASSHKFFPAVLLLLLLVVTMEVA--PAQAEEGRVCETDSTRFKGICMVGTNCANICLTE  58

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C G+ RKC+C KPC
Sbjct  59   GFTSGKCSGLKRKCICTKPC  78



>ref|XP_007202863.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
 gb|EMJ04062.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
Length=85

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 44/88 (50%), Gaps = 11/88 (13%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTE--------ARNCESPSGQFKGPCTSDKN  161
            M  S R F+   + V+LF+A   G    MV E        +R CES S +FKGPC    N
Sbjct  1    MEGSKRMFSIVFILVLLFVAIGTGP---MVAEGKVETKETSRTCESLSTKFKGPCIRSSN  57

Query  160  CATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            CA +C  EGF  G C G   +C C K C
Sbjct  58   CANICEEEGFKGGKCVGFRLRCTCTKNC  85



>gb|AIC35288.1| defensin 4 [Pinus sylvestris]
Length=83

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = -3

Query  253  EVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCK--GVLRKCVCIKP  80
             +G   + V E R C++PSG+FKG C S  NC  VC +EGFP G C      RKC C KP
Sbjct  22   SIGMMEVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  79   C  77
            C
Sbjct  82   C  82



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
              +AR CE+PS +FKG C    NCA VCL+EGF  G C G  R+C+C K C
Sbjct  61   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  256  TEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDC--KGVLRKCVCIK  83
            TE+G  T+ + EAR+C S S +FKG C S  NCA VC +E FP G+C      RKC C +
Sbjct  21   TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  80

Query  82   PC  77
             C
Sbjct  81   AC  82



>ref|NP_001147137.1| LOC100280744 precursor [Zea mays]
 gb|ACG25630.1| low-molecular-weight cysteine-rich protein LCR68 precursor [Zea 
mays]
 gb|ACG25762.1| low-molecular-weight cysteine-rich protein LCR68 precursor [Zea 
mays]
 gb|AFW56985.1| defensin-like protein 1 [Zea mays]
Length=79

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            + EAR C   S  FKG C SD NCA VCL EG+  G+C G++R+C CI+ C
Sbjct  29   LAEARVCRRRSAGFKGVCMSDHNCAQVCLQEGYGGGNCDGIMRQCKCIREC  79



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
              EAR+CES S +FKG C    NCA+VC SEGF  G C+GV R+C C   C
Sbjct  18   AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 43/80 (54%), Gaps = 6/80 (8%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MA   +  A   L ++L  AT+      M+ EA+ CE+ SG FKG C S ++C  VC  E
Sbjct  1    MAGFSKVVATIFLMMLLVFATD------MMAEAKICEALSGNFKGLCLSSRDCGNVCRRE  54

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C G   +C C KPC
Sbjct  55   GFTDGSCIGFRLQCFCTKPC  74



>gb|AAR84643.1| defensin [Picea glauca]
Length=83

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -3

Query  250  VGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVL--RKCVCIKPC  77
            +G   + + EAR C++PSG+FKG C S  NC  VC +EGFP G C   +  RKC C KPC
Sbjct  23   IGMMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  82



>gb|ACV84383.1| defensin precursor [Triticum turgidum subsp. durum]
Length=85

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = -3

Query  313  ASSLRSFADALLFVILFMATEVGRNTIMVTEARN----CESPSGQFKGPCTSDKNCATVC  146
            ++S R  A  LL ++L +ATE+G  T+ V EAR+    CES S +++G C  D NC  VC
Sbjct  3    STSRRMVASVLLVLLLLVATEMG--TMRVAEARHGHRHCESQSHRYRGACWRDDNCEHVC  60

Query  145  LSEGFPHGDCK--GVLRKCVCIKPC  77
             +EGFP G CK     RKC C +PC
Sbjct  61   NTEGFPWGKCKFHDFERKCFCKRPC  85



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            M  S R     LL + L M +E+G     V EAR CES S +F+G C  + NCA VC +E
Sbjct  1    MEHSRRMLPAILLLLFLLMPSEMG---TKVAEARTCESQSHKFQGTCLRESNCANVCQTE  57

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C+GV R+C C + C
Sbjct  58   GFQGGVCRGVRRRCFCTRLC  77



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  232  MVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
            MV EAR CES S +F+G C S  NC +VC +EGF  G C+G  R+C C + C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>dbj|BAK07467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = -3

Query  316  MASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSE  137
            MASS + F   L+ ++L +A EV          R CE+ S QFKG C    NCA VCL+E
Sbjct  1    MASSQKFFPAVLVLLLLVVAMEV----TPAQAERVCETDSTQFKGICMVGTNCANVCLTE  56

Query  136  GFPHGDCKGVLRKCVCIKPC  77
            GF  G C G  RKC+C KPC
Sbjct  57   GFTSGKCSGFKRKCMCTKPC  76



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -3

Query  229  VTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
              +AR CE+PS +FKG C    NCA VCL+EGF  G C G  R+C+C K C
Sbjct  22   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 43/83 (52%), Gaps = 4/83 (5%)
 Frame = -3

Query  325  LQNMASSLRSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVC  146
            ++ +    RS     L +I+  +  V +      E R CES S +FKGPC  D NCA VC
Sbjct  63   IEGIEMEKRSLGIFFLLLIVLASQWVAQPA----EGRVCESKSHKFKGPCLGDHNCALVC  118

Query  145  LSEGFPHGDCKGVLRKCVCIKPC  77
             +EGF  G C+G   +C C K C
Sbjct  119  RNEGFSGGRCRGFRHRCFCTKLC  141



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 4/75 (5%)
 Frame = -3

Query  301  RSFADALLFVILFMATEVGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHG  122
            ++F    L +I+F +    +  I   E R C S S  ++GPC  D NCA VC +EGF  G
Sbjct  4    KTFGLIFLLLIVFAS----QMAIQRAEGRVCISQSHGYRGPCVHDHNCALVCRNEGFSGG  59

Query  121  DCKGVLRKCVCIKPC  77
            DC G  R+C C K C
Sbjct  60   DCIGWRRRCFCTKLC  74



>gb|EMT17852.1| hypothetical protein F775_43789 [Aegilops tauschii]
Length=77

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  226  TEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCKGVLRKCVCIKPC  77
             EA+ C   S  FKGPC SDKNCA VCL E +  G+C G LR+C CI+ C
Sbjct  28   AEAKICRQRSAGFKGPCVSDKNCAQVCLQERWGGGNCDGPLRRCKCIRQC  77



>gb|EMT18782.1| Defensin-like protein [Aegilops tauschii]
Length=404

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -3

Query  250  VGRNTIMVTEARNCESPSGQFKGPCTSDKNCATVCLSEGFPHGDCK--GVLRKCVCIKP  80
            +G  T  V EAR+C S S +FKG C S  NCA++C +E FP G+CK     RKC C +P
Sbjct  1    MGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKRP  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506875374522