BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30487_g1_i1 len=1156 path=[1:0-1155]

Length=1156
                                                                      Score     E

ref|XP_010325918.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    237   9e-70   
ref|XP_006341248.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    231   1e-67   
ref|XP_007027722.1|  Basic-leucine zipper transcription factor fa...    211   4e-60   
ref|XP_011094355.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     206   2e-58   
ref|XP_009586572.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    206   7e-58   
ref|XP_010325920.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    204   2e-57   
ref|XP_009768885.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    204   3e-57   
ref|XP_011077930.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    204   7e-55   
gb|KHG21602.1|  abscisic acid-insensitive 5 -like protein               196   3e-54   
ref|XP_007027724.1|  Basic-leucine zipper transcription factor fa...    193   2e-53   
emb|CDP15406.1|  unnamed protein product                                194   2e-53   
ref|XP_007203311.1|  hypothetical protein PRUPE_ppa019833mg             189   3e-51   
gb|ADL62859.1|  abscisic acid insensitive                               188   3e-51   
ref|XP_008241247.1|  PREDICTED: LOW QUALITY PROTEIN: protein ABSC...    188   3e-51   
ref|XP_010271676.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    187   4e-51   
ref|XP_010271672.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    187   1e-50   
ref|XP_004149224.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    187   1e-50   
ref|XP_004167581.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    187   1e-50   
gb|AFO63293.1|  bZIP14                                                  187   3e-50   
ref|XP_010683741.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    186   3e-50   
ref|XP_010049460.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    185   3e-50   
gb|KHN13511.1|  Protein ABSCISIC ACID-INSENSITIVE 5                     184   1e-49   
ref|XP_008386994.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    184   2e-49   
ref|XP_009374729.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     182   5e-49   
ref|XP_006594214.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    182   1e-48   
ref|XP_004305345.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    181   1e-48   
ref|XP_003541461.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    181   1e-48   
ref|XP_006589850.1|  PREDICTED: cell division protein FtsZ homolo...    186   2e-48   
gb|KHG26140.1|  abscisic acid-insensitive 5 -like protein               180   3e-48   
ref|XP_010244710.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    177   4e-47   
gb|AAC49759.1|  Dc3 promoter-binding factor-1                           176   4e-47   Helianthus annuus
ref|XP_010049452.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    175   2e-46   
ref|XP_007027725.1|  Basic-leucine zipper transcription factor fa...    172   9e-46   
ref|XP_009768886.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    172   2e-45   
ref|XP_009586574.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    172   3e-45   
ref|XP_010654080.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     171   6e-45   
gb|ACA35280.1|  abscisic acid insensitive                               174   1e-44   Cucumis sativus [cucumbers]
ref|XP_003553595.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    167   6e-44   
gb|KDP42738.1|  hypothetical protein JCGZ_23678                         166   5e-43   
gb|KDO61128.1|  hypothetical protein CISIN_1g043882mg                   166   1e-42   
ref|NP_565840.1|  protein abscisic acid-insensitive 5                   165   1e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71955.1|  hypothetical protein VITISV_009883                     163   3e-42   Vitis vinifera
ref|XP_006430223.1|  hypothetical protein CICLE_v10013385mg             163   8e-42   
ref|XP_003625810.1|  Abscisic acid insensitive                          159   1e-40   
ref|XP_008386997.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    158   3e-40   
emb|CBI30287.3|  unnamed protein product                                155   2e-39   
ref|XP_009366660.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    152   5e-38   
ref|XP_007145326.1|  hypothetical protein PHAVU_007G229600g             151   1e-37   
ref|XP_002528738.1|  DNA binding protein, putative                      149   3e-37   Ricinus communis
emb|CDX75056.1|  BnaA05g08020D                                          149   6e-37   
gb|AGA16542.1|  bZIP transcription factor ABI5                          143   4e-36   
ref|XP_007162892.1|  hypothetical protein PHAVU_001G189400g             146   4e-36   
emb|CDX84141.1|  BnaC04g09030D                                          146   6e-36   
ref|XP_010505159.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    146   7e-36   
ref|XP_002881435.1|  hypothetical protein ARALYDRAFT_321332             146   9e-36   
gb|KHN02230.1|  Protein ABSCISIC ACID-INSENSITIVE 5                     144   1e-35   
ref|XP_010509494.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     145   1e-35   
gb|AFZ45968.1|  ABA insensitve 5-like protein                           144   4e-35   
gb|AGG35953.1|  ABA insensitive PP2C protein 5                          144   5e-35   
ref|XP_009141571.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    143   5e-35   
emb|CDY43738.1|  BnaAnng07530D                                          143   6e-35   
ref|XP_006296104.1|  hypothetical protein CARUB_v10025255mg             143   7e-35   
ref|XP_010516839.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    142   2e-34   
ref|XP_009143603.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     141   3e-34   
ref|XP_004494170.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    140   7e-34   
ref|XP_004494169.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    140   7e-34   
ref|XP_006836037.1|  hypothetical protein AMTR_s00114p00031980          134   5e-32   
ref|XP_010101577.1|  Protein ABSCISIC ACID-INSENSITIVE 5                134   1e-31   
ref|XP_007027726.1|  Basic-leucine zipper transcription factor fa...    132   4e-31   
ref|XP_010554860.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     130   2e-30   
ref|XP_009371918.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    127   2e-29   
ref|XP_006410797.1|  hypothetical protein EUTSA_v10016668mg             126   8e-29   
ref|XP_009364307.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    124   1e-28   
ref|XP_008383939.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    123   3e-28   
gb|KCW89189.1|  hypothetical protein EUGRSUZ_A01499                     121   2e-27   
ref|XP_009411951.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    120   5e-27   
gb|EYU38630.1|  hypothetical protein MIMGU_mgv1a006763mg                120   8e-27   
ref|XP_010089831.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 1         119   1e-26   
gb|AGZ05627.1|  abscisic acid-insensitive 5                             118   2e-26   
ref|XP_008228533.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    115   1e-25   
ref|XP_006481876.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    115   5e-25   
gb|AEK86263.1|  ABI5-like protein                                       107   4e-24   
gb|AFN25692.1|  ABI5 protein                                            107   6e-24   
gb|EPS62571.1|  hypothetical protein M569_12220                         109   7e-24   
gb|AFN84601.1|  abscisic acid responsive elements-binding factor 2      110   2e-23   
ref|XP_010907582.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    108   3e-23   
ref|XP_011019902.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5     108   3e-23   
ref|XP_009123529.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    107   1e-22   
ref|XP_009123528.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    106   2e-22   
ref|NP_001044866.1|  Os01g0859300                                       104   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000915.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    105   5e-22   
emb|CCE88374.1|  abscisic acid responsive elements-binding factor 2     105   5e-22   
gb|AGY78337.1|  hypothetical protein                                    105   6e-22   
ref|XP_002308147.1|  ABA insensitive 5 family protein                   104   7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_003574628.1|  PREDICTED: bZIP transcription factor TRAB1         104   8e-22   
dbj|BAB90559.1|  putative ABA response element binding factor           104   8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55706.1|  hypothetical protein OsJ_04142                          104   1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KDP31558.1|  hypothetical protein JCGZ_15213                         104   1e-21   
ref|XP_010046725.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    103   2e-21   
gb|EAZ00118.1|  hypothetical protein OsI_22122                          103   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006645053.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    103   2e-21   
gb|EEC71844.1|  hypothetical protein OsI_04509                          103   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004970655.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...    103   2e-21   
gb|ABM90394.1|  bZIP-type transcription factor ABI5 isoform 1           103   3e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KHG27504.1|  abscisic acid-insensitive 5-like protein 1              102   7e-21   
ref|XP_007015839.1|  Basic-leucine zipper transcription factor fa...    102   7e-21   
ref|XP_002964990.1|  hypothetical protein SELMODRAFT_266892             102   7e-21   
ref|XP_002977062.1|  hypothetical protein SELMODRAFT_443424             102   2e-20   
ref|XP_008458574.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    100   2e-20   
ref|XP_008458575.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    100   2e-20   
ref|NP_001183940.1|  ABRE binding protein                               100   2e-20   
ref|XP_008458572.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    100   3e-20   
ref|XP_004162472.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  99.0    3e-20   
ref|XP_009402117.1|  PREDICTED: bZIP transcription factor TRAB1-like    100   3e-20   
ref|XP_002274428.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  99.8    3e-20   Vitis vinifera
emb|CDY17109.1|  BnaC06g00420D                                        99.4    3e-20   
ref|XP_004149281.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  99.4    4e-20   
gb|KGN46957.1|  hypothetical protein Csa_6G152920                     99.4    4e-20   
ref|XP_002523794.1|  conserved hypothetical protein                   99.8    4e-20   Ricinus communis
ref|XP_010479095.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  99.8    7e-20   
dbj|BAJ94534.1|  predicted protein                                    97.8    1e-19   
ref|XP_006393640.1|  hypothetical protein EUTSA_v10011493mg           98.2    3e-19   
gb|KHG14558.1|  abscisic acid-insensitive 5-like protein 4            97.4    4e-19   
gb|KDO58067.1|  hypothetical protein CISIN_1g037676mg                 95.5    4e-19   
ref|XP_004964902.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  96.3    4e-19   
gb|ABH05132.1|  ABA responsive element binding factor 2               95.9    4e-19   Hordeum vulgare subsp. vulgare [barley]
ref|NP_849777.1|  abscisic acid responsive elements-binding factor 2  97.1    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393641.1|  hypothetical protein EUTSA_v10011493mg           97.1    7e-19   
ref|XP_006487955.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  95.5    1e-18   
ref|XP_007133528.1|  hypothetical protein PHAVU_011G186800g           94.7    1e-18   
ref|XP_008804818.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  95.9    2e-18   
ref|XP_003526362.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.4    2e-18   
ref|XP_004293073.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  95.1    2e-18   
ref|XP_003596811.1|  BZIP transcription factor                        94.0    2e-18   
ref|XP_006352088.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.0    4e-18   
gb|AAM75354.1|AF519803_1  ABA response element binding factor         93.6    5e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004957010.1|  PREDICTED: bZIP transcription factor TRAB1-like  93.6    5e-18   
ref|XP_010907998.1|  PREDICTED: LOW QUALITY PROTEIN: protein ABSC...  93.2    8e-18   
dbj|BAF36444.1|  bZip type transcription factor TaABI5                93.6    8e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004291101.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  94.0    9e-18   
gb|KDO38043.1|  hypothetical protein CISIN_1g025340mg                 90.9    1e-17   
ref|XP_003607958.1|  ABSCISIC ACID-INSENSITIVE 5-like protein         92.8    1e-17   
ref|XP_003628123.1|  BZIP transcription factor                        91.7    1e-17   
gb|KDO84148.1|  hypothetical protein CISIN_1g021624mg                 91.7    1e-17   
ref|XP_010500203.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  93.2    2e-17   
ref|NP_001239043.1|  ABA responsive transcription factor              92.4    2e-17   
ref|XP_009339236.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    2e-17   
ref|XP_006352089.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.7    2e-17   
ref|XP_009339232.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    2e-17   
ref|XP_009339238.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    2e-17   
ref|XP_010313017.1|  PREDICTED: ABA responsive transcription fact...  91.7    3e-17   
gb|ABE73182.1|  ABA response element binding factor                   89.7    4e-17   Avena fatua
ref|XP_004973666.1|  PREDICTED: bZIP transcription factor TRAB1-like  90.9    5e-17   
ref|NP_001150949.1|  bZIP transcription factor ABI5                   90.9    5e-17   Zea mays [maize]
ref|XP_010552516.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.7    6e-17   
ref|XP_010535682.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.5    6e-17   
gb|EYU35478.1|  hypothetical protein MIMGU_mgv1a023701mg              90.5    6e-17   
ref|XP_009394025.1|  PREDICTED: protein ABSCISIC ACID-INSENSITIVE...  92.0    6e-17   
ref|XP_006434756.1|  hypothetical protein CICLE_v10001159mg           91.3    7e-17   
ref|XP_006473315.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  91.3    7e-17   
ref|XP_002312814.1|  basic leucine zipper transcription factor fa...  90.1    8e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010538116.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.9    9e-17   
gb|KDO84149.1|  hypothetical protein CISIN_1g021624mg                 89.4    9e-17   
emb|CAN60742.1|  hypothetical protein VITISV_030212                   89.7    1e-16   Vitis vinifera
gb|ABE73184.1|  ABA response element binding factor                   88.6    1e-16   Avena fatua
gb|AFW85358.1|  putative bZIP transcription factor superfamily pr...  89.4    1e-16   
gb|ABE73185.1|  ABA response element binding factor                   88.2    1e-16   Avena fatua
ref|XP_002965670.1|  hypothetical protein SELMODRAFT_227594           89.7    1e-16   
ref|XP_008659130.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  89.4    1e-16   
ref|XP_002971668.1|  hypothetical protein SELMODRAFT_451399           89.7    2e-16   
ref|XP_008220233.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  90.1    2e-16   
dbj|BAL61091.1|  putative basic leucine-zipper transcription fact...  84.7    2e-16   
gb|ACN31650.1|  unknown                                               87.4    2e-16   Zea mays [maize]
ref|XP_002969410.1|  hypothetical protein SELMODRAFT_91900            88.2    2e-16   
ref|XP_010313014.1|  PREDICTED: ABA responsive transcription fact...  89.4    2e-16   
ref|XP_002970746.1|  hypothetical protein SELMODRAFT_94516            88.2    2e-16   
ref|XP_006656761.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    2e-16   
gb|ABE73183.1|  ABA response element binding factor                   87.4    3e-16   Avena fatua
gb|AFA37978.1|  ABA responsive element-binding protein                89.7    3e-16   
gb|EMS52660.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 6            85.5    3e-16   
ref|XP_010931491.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.2    3e-16   
ref|XP_006434755.1|  hypothetical protein CICLE_v10001159mg           89.4    3e-16   
ref|NP_001234596.1|  AREB-like protein                                89.4    4e-16   
gb|EMS53961.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2            86.3    4e-16   
gb|AHA43415.1|  AREB-like protein                                     89.4    4e-16   
ref|XP_009793574.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  89.4    4e-16   
ref|NP_001274925.1|  ABRE binding factor                              89.4    4e-16   
ref|XP_006354875.1|  PREDICTED: ABRE binding factor isoform X1        89.4    4e-16   
ref|XP_006826228.1|  hypothetical protein AMTR_s00132p00065700        89.4    5e-16   
ref|XP_008378040.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.6    5e-16   
ref|XP_011083868.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  89.0    5e-16   
gb|KHG23315.1|  abscisic acid-insensitive 5-like protein 5            88.6    5e-16   
gb|AHD24943.1|  ABRE binding factor                                   89.0    5e-16   
ref|XP_009592272.1|  PREDICTED: bZIP transcription factor TRAB1-like  89.0    5e-16   
ref|XP_009623872.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    6e-16   
gb|ABE73181.1|  ABA response element binding factor                   86.3    6e-16   Avena fatua
ref|XP_010066019.1|  PREDICTED: bZIP transcription factor TRAB1       88.6    6e-16   
ref|NP_001185157.1|  abscisic acid responsive elements-binding fa...  88.6    6e-16   
ref|XP_009359648.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.2    7e-16   
ref|XP_002894019.1|  hypothetical protein ARALYDRAFT_473850           88.2    7e-16   
emb|CBI28329.3|  unnamed protein product                              87.0    7e-16   
ref|NP_001149951.1|  bZIP transcription factor family protein         87.0    7e-16   Zea mays [maize]
ref|XP_008778650.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    7e-16   
gb|EMT24519.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   85.1    8e-16   
gb|KHG05529.1|  abscisic acid-insensitive 5-like protein 4            88.2    8e-16   
ref|XP_010461496.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  88.2    9e-16   
ref|XP_009774980.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.5    9e-16   
ref|XP_003546677.1|  PREDICTED: bZIP transcription factor bZIP128     86.3    1e-15   
emb|CDX69020.1|  BnaC01g04330D                                        87.0    1e-15   
ref|XP_007017213.1|  Abscisic acid responsive elements-binding fa...  87.8    1e-15   
ref|XP_009795221.1|  PREDICTED: bZIP transcription factor TRAB1-like  87.8    1e-15   
gb|AGG39700.1|  bZIP transcription factor bZIP8                       87.8    1e-15   
gb|EPS63836.1|  hypothetical protein M569_10951                       86.7    1e-15   
ref|XP_008793932.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.5    1e-15   
ref|XP_008794151.1|  PREDICTED: LOW QUALITY PROTEIN: bZIP transcr...  87.4    1e-15   
ref|XP_004142865.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.4    1e-15   
ref|XP_002456667.1|  hypothetical protein SORBIDRAFT_03g040510        87.4    1e-15   Sorghum bicolor [broomcorn]
ref|XP_010552514.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.8    1e-15   
ref|XP_008444613.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.4    1e-15   
ref|XP_006307554.1|  hypothetical protein CARUB_v10009177mg           87.4    2e-15   
gb|AEQ94117.1|  putative abscissic acid                               86.3    2e-15   
ref|XP_007222748.1|  hypothetical protein PRUPE_ppa006503mg           87.0    2e-15   
ref|XP_008378039.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    2e-15   
ref|XP_002436690.1|  hypothetical protein SORBIDRAFT_10g007090        85.9    2e-15   Sorghum bicolor [broomcorn]
ref|XP_010943073.1|  PREDICTED: bZIP transcription factor TRAB1 i...  86.7    2e-15   
ref|XP_010061749.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  87.0    2e-15   
ref|XP_006659491.1|  PREDICTED: bZIP transcription factor TRAB1-like  82.8    2e-15   
gb|KDP38330.1|  hypothetical protein JCGZ_04255                       86.7    2e-15   
ref|NP_001057118.1|  Os06g0211200                                     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009598935.1|  PREDICTED: bZIP transcription factor TRAB1-like  87.0    2e-15   
ref|XP_009399710.1|  PREDICTED: bZIP transcription factor TRAB1-like  86.7    2e-15   
ref|XP_009403361.1|  PREDICTED: bZIP transcription factor TRAB1       86.3    3e-15   
ref|XP_011017194.1|  PREDICTED: bZIP transcription factor TRAB1-like  86.7    3e-15   
ref|XP_008807330.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.5    3e-15   
gb|EEE65317.1|  hypothetical protein OsJ_20562                        85.9    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABP88226.1|  transcription factor bZIP71                           82.4    3e-15   Glycine max [soybeans]
ref|XP_006649073.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    3e-15   
gb|EMT17350.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2            85.1    3e-15   
ref|XP_010263531.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  86.3    3e-15   
ref|XP_010939411.1|  PREDICTED: bZIP transcription factor TRAB1 i...  86.3    3e-15   
ref|NP_001290004.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 5       86.7    3e-15   
ref|XP_002302435.1|  bZIP transcription factor 6 family protein       86.7    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008373133.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  86.3    4e-15   
gb|EEE57861.1|  hypothetical protein OsJ_08504                        85.5    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87653.1|  hypothetical protein OsI_09065                        85.5    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006471287.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    4e-15   
ref|NP_001048225.1|  Os02g0766700                                     85.5    4e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406635.1|  PREDICTED: bZIP transcription factor TRAB1-l...  85.9    4e-15   
ref|XP_002510209.1|  DNA binding protein, putative                    86.3    4e-15   Ricinus communis
gb|KCW68739.1|  hypothetical protein EUGRSUZ_F02337                   85.9    4e-15   
tpg|DAA48436.1|  TPA: putative bZIP transcription factor superfam...  85.1    4e-15   
ref|XP_010943075.1|  PREDICTED: bZIP transcription factor TRAB1 i...  85.9    4e-15   
gb|AHZ96957.1|  bZIP transcription factor 9                           80.5    4e-15   
emb|CDP01369.1|  unnamed protein product                              85.1    4e-15   
ref|XP_009346256.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.9    5e-15   
ref|XP_007042439.1|  Abscisic acid responsive element-binding fac...  85.9    5e-15   
ref|XP_008664522.1|  PREDICTED: bZIP transcription factor TRAB1-like  86.3    5e-15   
gb|ABH05131.1|  ABA responsive element binding factor 1               85.5    5e-15   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK03778.1|  predicted protein                                    85.5    6e-15   
gb|ABF29696.1|  abscisic acid responsive element-binding protein 2    85.5    6e-15   Populus suaveolens [Mongolian poplar]
ref|XP_006374927.1|  bZIP transcription factor 6 family protein       85.5    6e-15   
ref|XP_007199909.1|  hypothetical protein PRUPE_ppa006752mg           85.5    6e-15   
gb|KHG25900.1|  abscisic acid-insensitive 5-like protein 5            85.5    6e-15   
gb|ABZ91908.2|  FD-like 2 protein                                     84.3    6e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002446988.1|  hypothetical protein SORBIDRAFT_06g026410        80.9    7e-15   Sorghum bicolor [broomcorn]
emb|CDY68227.1|  BnaAnng26550D                                        84.7    7e-15   
ref|XP_011029850.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    7e-15   
ref|XP_011014474.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    7e-15   
ref|XP_004136974.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    7e-15   
gb|AAM75355.1|AF519804_1  ABA response element binding factor         85.1    7e-15   Triticum aestivum [Canadian hard winter wheat]
gb|ACF85671.1|  unknown                                               83.6    7e-15   Zea mays [maize]
ref|XP_008454957.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    8e-15   
ref|XP_010927394.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    8e-15   
ref|XP_003603049.1|  ABSCISIC ACID-INSENSITIVE 5-like protein         85.5    8e-15   
ref|XP_003564107.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    8e-15   
ref|NP_001189934.1|  ABRE binding factor 4                            85.5    8e-15   
gb|ABG90380.1|  bZIP transcription factor                             85.1    8e-15   Caragana korshinskii
dbj|BAF61106.1|  bZip type transcription factor TmABI5                84.7    8e-15   Triticum monococcum [einkorn wheat]
gb|ACG48984.1|  ABA response element binding factor                   85.1    8e-15   Zea mays [maize]
ref|XP_008236589.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    9e-15   
ref|NP_001151515.1|  ABA response element binding factor              85.1    9e-15   
gb|KHN22325.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 5            83.6    9e-15   
ref|XP_006473314.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    9e-15   
emb|CDM81868.1|  unnamed protein product                              84.7    1e-14   
gb|AHA43414.1|  abscisic acid-insensitive 5-like protein              85.1    1e-14   
emb|CDM81865.1|  unnamed protein product                              84.7    1e-14   
ref|XP_009419106.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    1e-14   
ref|XP_004173635.1|  PREDICTED: LOW QUALITY PROTEIN: ABSCISIC ACI...  84.7    1e-14   
ref|XP_009117601.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    1e-14   
ref|NP_567949.1|  abscisic acid responsive elements-binding factor 3  85.1    1e-14   
ref|XP_011074426.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    1e-14   
ref|XP_003531785.1|  PREDICTED: transcription factor bZIP70 isofo...  83.6    1e-14   
ref|XP_008797272.1|  PREDICTED: bZIP transcription factor TRAB1 i...  85.1    1e-14   
ref|XP_006297700.1|  hypothetical protein CARUB_v10013729mg           84.7    1e-14   
ref|XP_008454956.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  85.1    1e-14   
ref|XP_010552515.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    1e-14   
ref|XP_006424253.1|  hypothetical protein CICLE_v10028635mg           84.3    1e-14   
gb|EEC83723.1|  hypothetical protein OsI_29562                        83.2    1e-14   
gb|KHN10138.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2            82.8    1e-14   
ref|XP_002883170.1|  hypothetical protein ARALYDRAFT_479444           84.7    1e-14   
gb|ACG45784.1|  bZIP transcription factor                             84.0    1e-14   
ref|XP_008676656.1|  PREDICTED: uncharacterized protein LOC100216...  84.0    1e-14   
ref|XP_010487862.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.7    2e-14   
ref|XP_006851403.1|  hypothetical protein AMTR_s00040p00057740        83.2    2e-14   
gb|EMS49435.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   83.6    2e-14   
gb|AIL01830.1|  bZIP transcription factor                             83.6    2e-14   
ref|NP_001132507.1|  uncharacterized protein LOC100193967             83.6    2e-14   
ref|XP_006660694.1|  PREDICTED: bZIP transcription factor TRAB1-like  84.0    2e-14   
ref|XP_006284949.1|  hypothetical protein CARUB_v10006251mg           84.3    2e-14   
ref|XP_002869180.1|  hypothetical protein ARALYDRAFT_491272           84.3    2e-14   
dbj|BAA83740.1|  TRAB1                                                83.2    2e-14   
gb|AFW61798.1|  putative bZIP transcription factor superfamily pr...  83.6    2e-14   
gb|AAK39132.1|AF369792_1  bZIP transcription factor 6                 84.3    2e-14   
gb|AEQ28125.1|  ABA response element binding protein 1                84.3    2e-14   
gb|AEQ28124.1|  ABA response element binding protein 1                84.3    2e-14   
ref|XP_003578228.1|  PREDICTED: bZIP transcription factor TRAB1-like  83.6    2e-14   
ref|XP_010500522.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    2e-14   
ref|XP_003523938.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.3    2e-14   
ref|XP_007136688.1|  hypothetical protein PHAVU_009G065500g           84.3    2e-14   
ref|NP_001062018.1|  Os08g0472000                                     82.8    2e-14   
gb|AIL01831.1|  bZIP transcription factor                             83.6    2e-14   
ref|XP_009145804.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    2e-14   
ref|XP_010269648.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.3    2e-14   
gb|EEC84700.1|  hypothetical protein OsI_31640                        83.6    2e-14   
gb|AIL01832.1|  bZIP transcription factor                             83.6    2e-14   
gb|AGV54705.1|  bZIP transcription factor 6                           84.0    2e-14   
ref|XP_004501562.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    2e-14   
ref|XP_006305034.1|  hypothetical protein CARUB_v10009399mg           83.6    2e-14   
ref|NP_001063362.1|  Os09g0456200                                     83.6    2e-14   
gb|AED99724.1|  stress-related bZIP transcription factor              83.2    2e-14   
ref|XP_003528292.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  84.0    2e-14   
ref|NP_566629.1|  ABRE binding factor 4                               84.0    2e-14   
ref|XP_010939413.1|  PREDICTED: bZIP transcription factor TRAB1 i...  83.6    2e-14   
gb|AFN84602.1|  abscisic acid responsive elements-binding factor 3    84.0    2e-14   
ref|XP_006412286.1|  hypothetical protein EUTSA_v10025203mg           84.0    2e-14   
ref|XP_006297699.1|  hypothetical protein CARUB_v10013729mg           84.0    2e-14   
ref|XP_002518757.1|  DNA binding protein, putative                    84.0    2e-14   
emb|CDX92320.1|  BnaA05g20870D                                        83.2    2e-14   
ref|XP_002460329.1|  hypothetical protein SORBIDRAFT_02g026570        83.2    2e-14   
ref|XP_009147888.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.2    3e-14   
ref|XP_010507592.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    3e-14   
ref|XP_010466063.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  84.0    3e-14   
gb|KEH38980.1|  ABA response element-binding factor                   82.0    3e-14   
gb|ADQ48070.1|  bZIP transcription factor ABI5                        83.2    3e-14   
gb|AAO06115.1|  bZIP transcription factor ABI5                        82.8    3e-14   
ref|XP_010263534.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    3e-14   
gb|AGG35957.1|  ABA-responsive element binding factor 4               83.6    3e-14   
gb|EAZ44981.1|  hypothetical protein OsJ_29624                        84.0    3e-14   
gb|AFP33247.1|  ABA responsive element binding factor 1               82.8    3e-14   
gb|AFP33245.1|  ABA responsive element binding factor 1               82.8    3e-14   
gb|AGG35956.1|  ABA-responsive element binding factor 3               83.6    3e-14   
emb|CDM80221.1|  unnamed protein product                              83.2    3e-14   
ref|XP_010466066.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    3e-14   
ref|XP_010507609.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    3e-14   
dbj|BAK02549.1|  predicted protein                                    83.2    3e-14   
gb|AIS25790.1|  ABA responsive element binding factor 1               82.8    3e-14   
ref|XP_010487864.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.6    3e-14   
ref|XP_002454604.1|  hypothetical protein SORBIDRAFT_04g034190        82.8    3e-14   
emb|CDX99242.1|  BnaC05g33570D                                        82.8    3e-14   
dbj|BAN15747.1|  ABA responsive element binding factor                83.2    3e-14   
gb|EEE68849.1|  hypothetical protein OsJ_27642                        84.0    3e-14   
ref|XP_003570566.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    4e-14   
ref|XP_009145807.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  83.2    4e-14   
ref|XP_010236077.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.4    4e-14   
ref|XP_006406516.1|  hypothetical protein EUTSA_v10020772mg           83.2    4e-14   
emb|CDY51041.1|  BnaA06g03040D                                        82.0    5e-14   
ref|XP_004954029.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.4    5e-14   
gb|AGG35955.1|  ABA-responsive element binding factor 1               82.4    5e-14   
ref|XP_009112062.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    5e-14   
emb|CDY18575.1|  BnaA01g26200D                                        82.0    5e-14   
dbj|BAG16726.1|  basic region leucine zipper protein                  82.0    5e-14   
ref|XP_002285116.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.8    5e-14   
emb|CDY63041.1|  BnaCnng41320D                                        82.0    6e-14   
gb|KHG23193.1|  abscisic acid-insensitive 5-like protein 6            82.4    6e-14   
ref|XP_010112189.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 5       82.8    6e-14   
gb|ACJ85326.1|  unknown                                               79.0    6e-14   
gb|AFK40202.1|  unknown                                               79.7    6e-14   
gb|AAL86016.1|  Raba1                                                 77.0    6e-14   
gb|KHG05813.1|  abscisic acid-insensitive 5-like protein 1            82.0    7e-14   
ref|XP_004294799.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.4    7e-14   
gb|KHN37514.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 4            82.8    7e-14   
gb|AIL01834.1|  bZIP transcription factor B                           81.6    7e-14   
dbj|BAG16727.1|  basic region leucine zipper protein                  81.6    8e-14   
ref|NP_001238690.1|  stress-related protein 1                         82.4    8e-14   
gb|EMS67642.1|  bZIP transcription factor TRAB1                       79.3    8e-14   
gb|AIL01835.1|  bZIP transcription factor D                           81.6    8e-14   
emb|CDY28083.1|  BnaC06g02640D                                        79.7    8e-14   
gb|AHN16206.1|  ABF4-2.1                                              82.0    9e-14   
ref|XP_004306446.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.9    9e-14   
ref|XP_010432479.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.4    9e-14   
ref|XP_009406636.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    1e-13   
gb|AEF32521.1|  stress-related bZIP transcription factor              81.3    1e-13   
ref|XP_011000551.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.0    1e-13   
ref|XP_010437681.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  82.0    1e-13   
ref|XP_010479441.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    1e-13   
ref|XP_011092390.1|  PREDICTED: G-box-binding factor 4-like           80.9    1e-13   
ref|XP_010530772.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    1e-13   
ref|XP_010260968.1|  PREDICTED: G-box-binding factor 4-like isofo...  80.1    1e-13   
ref|XP_004505228.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.3    1e-13   
ref|XP_010647747.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    1e-13   
ref|XP_003554082.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.5    1e-13   
ref|XP_010451060.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.6    1e-13   
gb|EMT21515.1|  Protein ABSCISIC ACID-INSENSITIVE 5                   81.3    1e-13   
emb|CAN64991.1|  hypothetical protein VITISV_001773                   81.6    1e-13   
ref|XP_009390055.1|  PREDICTED: G-box-binding factor 4-like           79.3    1e-13   
ref|XP_008797273.1|  PREDICTED: bZIP transcription factor TRAB1 i...  81.3    2e-13   
ref|XP_002313119.1|  hypothetical protein POPTR_0009s10400g           81.6    2e-13   
ref|XP_010107932.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 6       81.6    2e-13   
ref|XP_004954028.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.9    2e-13   
gb|EPS63595.1|  hypothetical protein M569_11189                       79.3    2e-13   
emb|CDX82302.1|  BnaA03g35190D                                        80.9    2e-13   
ref|XP_009135624.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.5    2e-13   
ref|XP_006583882.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.3    2e-13   
dbj|BAG16725.1|  basic region leucine zipper protein                  80.5    2e-13   
gb|KDP42271.1|  hypothetical protein JCGZ_01595                       81.3    2e-13   
ref|XP_002442847.1|  hypothetical protein SORBIDRAFT_08g003760        79.3    2e-13   
ref|XP_002990372.1|  hypothetical protein SELMODRAFT_428822           79.3    2e-13   
ref|XP_002979399.1|  hypothetical protein SELMODRAFT_177659           79.7    2e-13   
ref|XP_010466068.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  81.3    2e-13   
ref|XP_007159037.1|  hypothetical protein PHAVU_002G203300g           78.6    2e-13   
gb|EMT03076.1|  bZIP transcription factor TRAB1                       80.1    2e-13   
ref|XP_002891529.1|  abscisic acid responsive element-binding fac...  80.5    3e-13   
ref|XP_007218688.1|  hypothetical protein PRUPE_ppa008716mg           79.7    3e-13   
ref|NP_191244.1|  ABA-responsive element binding protein 3            79.3    3e-13   
gb|AAK19601.1|AF334208_1  bZIP protein DPBF3                          79.3    3e-13   
gb|EYU25430.1|  hypothetical protein MIMGU_mgv1a019627mg              79.3    3e-13   
ref|XP_008231752.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.7    3e-13   
ref|XP_006393221.1|  hypothetical protein EUTSA_v10012271mg           80.5    3e-13   
gb|KHN42146.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2            79.3    3e-13   
ref|NP_001280812.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2       79.3    3e-13   
ref|XP_003520322.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.3    3e-13   
ref|XP_008375407.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.3    4e-13   
ref|XP_010461819.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.1    4e-13   
ref|XP_009104023.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    4e-13   
gb|KHN34586.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2            79.3    4e-13   
ref|XP_003596807.1|  Abscisic acid insensitive                        79.3    4e-13   
ref|XP_006487113.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.5    4e-13   
ref|XP_007156509.1|  hypothetical protein PHAVU_003G291800g           80.1    4e-13   
ref|NP_001031785.2|  abscisic acid responsive elements-binding fa...  80.1    4e-13   
ref|XP_006423008.1|  hypothetical protein CICLE_v10028435mg           80.1    4e-13   
gb|ADM53098.1|  ABA responsive element binding factor                 80.1    5e-13   
emb|CDM81873.1|  unnamed protein product                              79.7    5e-13   
ref|XP_010550827.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.0    5e-13   
ref|XP_006487112.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  80.1    5e-13   
ref|XP_010504595.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    5e-13   
ref|XP_002439989.1|  hypothetical protein SORBIDRAFT_09g023920        79.0    5e-13   
ref|XP_006423013.1|  hypothetical protein CICLE_v10028435mg           80.1    5e-13   
dbj|BAD97366.1|  bZIP transcription factor                            79.3    5e-13   
ref|XP_010427526.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    5e-13   
ref|XP_010504594.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    5e-13   
ref|XP_010516285.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    6e-13   
ref|XP_010516284.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    6e-13   
ref|XP_007156508.1|  hypothetical protein PHAVU_003G291800g           79.7    6e-13   
ref|XP_010427524.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    6e-13   
ref|XP_009760513.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.7    6e-13   
ref|XP_010427522.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    6e-13   
ref|XP_010479442.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.7    7e-13   
ref|XP_011087814.1|  PREDICTED: G-box-binding factor 4-like           77.4    7e-13   
ref|XP_006339213.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.0    7e-13   
gb|EYU35424.1|  hypothetical protein MIMGU_mgv1a016878mg              74.7    7e-13   
ref|XP_009621966.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.3    7e-13   
ref|XP_010911997.1|  PREDICTED: G-box-binding factor 4-like isofo...  77.8    7e-13   
gb|AAY82589.1|  bZIP                                                  79.3    8e-13   
dbj|BAL61092.1|  putative basic leucine-zipper transcription fact...  77.4    8e-13   
gb|EYU18526.1|  hypothetical protein MIMGU_mgv1a013542mg              76.6    9e-13   
ref|XP_011079132.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    9e-13   
gb|KHN32879.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 1            78.2    1e-12   
ref|XP_002878113.1|  aba-responsive element binding protein 3         77.8    1e-12   
ref|XP_003541970.2|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    1e-12   
ref|XP_006402942.1|  hypothetical protein EUTSA_v10006121mg           77.8    1e-12   
ref|XP_010241691.1|  PREDICTED: G-box-binding factor 4-like isofo...  77.8    1e-12   
ref|XP_004249361.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    1e-12   
ref|XP_006402943.1|  hypothetical protein EUTSA_v10006121mg           77.8    1e-12   
ref|XP_003624832.1|  ABSCISIC ACID-INSENSITIVE 5-like protein         77.8    1e-12   
dbj|BAB02453.1|  abscisic acid responsive elements-binding factor     79.0    1e-12   
gb|KFK34922.1|  hypothetical protein AALP_AA5G211100                  77.4    1e-12   
emb|CAT00686.1|  bZIP transcription factor                            77.0    1e-12   
ref|NP_001234974.1|  transcription factor bZIP10                      76.6    1e-12   
ref|XP_009355071.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    1e-12   
ref|XP_006356585.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  79.0    1e-12   
gb|AFN84600.1|  abscisic acid responsive elements-binding factor 1    78.6    1e-12   
ref|XP_006423012.1|  hypothetical protein CICLE_v10028435mg           78.6    1e-12   
ref|XP_009355069.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    1e-12   
ref|NP_001281045.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 2       77.8    1e-12   
ref|XP_006356586.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.6    1e-12   
ref|XP_008346168.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.4    1e-12   
ref|NP_001150281.1|  LOC100283911                                     77.4    2e-12   
ref|XP_009759591.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    2e-12   
ref|XP_009139071.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  76.6    2e-12   
ref|XP_006592764.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.8    2e-12   
ref|NP_564551.1|  abscisic acid-insensitive 5-like protein 4          78.2    2e-12   
ref|XP_009614068.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.4    2e-12   
ref|XP_004487500.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.4    2e-12   
ref|XP_009783835.1|  PREDICTED: G-box-binding factor 4-like           77.0    2e-12   
ref|XP_010548013.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  78.2    2e-12   
ref|XP_004493288.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  77.0    2e-12   
emb|CDY65560.1|  BnaA10g28780D                                        77.0    2e-12   
gb|KHG26680.1|  abscisic acid-insensitive 5-like protein 2            77.4    2e-12   
gb|KHN27651.1|  ABSCISIC ACID-INSENSITIVE 5-like protein 1            78.6    2e-12   
ref|NP_001185183.1|  abscisic acid-insensitive 5-like protein 4       78.2    2e-12   



>ref|XP_010325918.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325919.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 184/266 (69%), Gaps = 11/266 (4%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ TFGEMTLEDFLV+AGVVREQGN+A  PP +                 A     + 
Sbjct  167  TQRQATFGEMTLEDFLVKAGVVREQGNSAPAPPQQQSYMMYPNSANPTMAAMARPVIGLG  226

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGY  372
                G+G G ++P Y  LPQ GVV EAP YP   KRG G+ Q S PVYGGRMGNGS VGY
Sbjct  227  GVTGGVGVGVSIPGYPPLPQTGVV-EAPVYPMSMKRGSGFPQQSTPVYGGRMGNGSGVGY  285

Query  373  AHM-QGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
              + QG+ G+GSP+SPVS D LCVN    GG   YGL+ G+RGG          PVEKVV
Sbjct  286  GQVVQGVAGMGSPLSPVSSDALCVNQIDSGG--QYGLEIGMRGGRKRVLDG---PVEKVV  340

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E++RKRKQ+ F+E
Sbjct  341  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAELERKRKQQYFDE  400

Query  727  VKPTTPTKAQKASKKlrllrrTLSWP  804
             K    TKAQKA+ KLR +RR+LS P
Sbjct  401  AKMKAQTKAQKANGKLRGMRRSLSCP  426



>ref|XP_006341248.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Solanum 
tuberosum]
Length=427

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 166/273 (61%), Positives = 186/273 (68%), Gaps = 28/273 (10%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ TFGEMTLEDFLV+AGVVREQGN+A  PP +                    PT +A
Sbjct  171  TQRQTTFGEMTLEDFLVKAGVVREQGNSAPAPPQQQSYMMYPNSAN---------PT-MA  220

Query  202  RPVMGLGGGG-------AVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMG  351
            RPV+GLGG         A+P Y  LPQ GVV EAP YP   KRG G+ Q   PVYGGRMG
Sbjct  221  RPVIGLGGVTGGVGVGVAIPGYPPLPQTGVV-EAPVYPMSMKRGSGFPQQPTPVYGGRMG  279

Query  352  NGSAVGYAHM--QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriid  525
            NGS VGY  +     G+GSP+SPVS DGLCVN   + G   YGL+ G+RGG         
Sbjct  280  NGSGVGYGQVVQSVTGMGSPLSPVSSDGLCVNQIDNVG--QYGLEIGMRGGRKRVLDG--  335

Query  526  gPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKR  705
             PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E++RKR
Sbjct  336  -PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAELERKR  394

Query  706  KQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            KQ+ F+E K    TKAQKA+ KLR +RR+ S P
Sbjct  395  KQQYFDEAKTKAQTKAQKANGKLRGMRRSFSCP  427



>ref|XP_007027722.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007027723.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08224.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08225.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 1 [Theobroma cacao]
Length=418

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 175/268 (65%), Gaps = 20/268 (7%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGV REQ    APPP    QY       N        P +V+RP
Sbjct  161  RQPTFGEMTLEDFLIKAGV-REQCMLPAPPPQHQPQYGLYQSGNNAAG----GPGFVSRP  215

Query  208  VMGLG--GGGAVPAYQALPQGGVVAEAPGY---PKRGGGYAQPSPP----VYGGRMGNGS  360
            +MG+   GG    AYQ +P GGV+ ++ GY    KRG GY   +PP     Y G++   +
Sbjct  216  IMGVDSKGGFGGSAYQTMPPGGVIGDSSGYVNDCKRGSGYQPTAPPPTTVCYSGKVA--A  273

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
            A  Y   Q +G+ SP+SPVS +G+C N   D    H+G+D G   G          P+EK
Sbjct  274  AGAYVRGQAMGVVSPMSPVSSEGMC-NSQVDNAANHFGMDMGGLRGRKRIIEG---PIEK  329

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            VVERRQRRMIKNRESAARSRARKQAYTVELEAEL+QLK+ENA LKQAL+E+DRKRKQ+ F
Sbjct  330  VVERRQRRMIKNRESAARSRARKQAYTVELEAELDQLKQENAHLKQALEELDRKRKQQYF  389

Query  721  EEVKPTTPTKAQKASKKlrllrrTLSWP  804
            EE K  T T+AQKA +KLR++RR LS P
Sbjct  390  EERKMITQTEAQKAKEKLRIIRRNLSCP  417



>ref|XP_011094355.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Sesamum indicum]
 ref|XP_011094356.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Sesamum indicum]
Length=401

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 170/267 (64%), Gaps = 26/267 (10%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ TFGEMTLEDFLVRAG+VREQ    AP P +P      + +        + P + A
Sbjct  154  TQRQPTFGEMTLEDFLVRAGIVREQNVAPAPVPQQPAYGMYQSSHHPP-----VGPNFAA  208

Query  202  RPVMGLGG----GGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVG  369
            RP+M +GG    G  V  YQALPQ GV           G Y+Q S  V  G      + G
Sbjct  209  RPIMAIGGPSAGGVNVATYQALPQSGV-----------GAYSQQSSAVSYGGRMGNGSGG  257

Query  370  YAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVE  549
            +  +QGLG+GS   PVS DGLC+N   D GNQ YG DTG   GG  R      PVEKVVE
Sbjct  258  FGQVQGLGMGSSACPVSTDGLCMNQV-DSGNQ-YGADTGGSRGGRKRIIDG--PVEKVVE  313

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E + KRKQ+ +EE 
Sbjct  314  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEFEMKRKQQYYEET  373

Query  730  --KPTTPTKAQKASKKlrllrrTLSWP  804
              K    +KAQKA+++LR +RR+ S P
Sbjct  374  RAKAQMQSKAQKANERLRTMRRSSSCP  400



>ref|XP_009586572.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586573.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=435

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 189/265 (71%), Gaps = 11/265 (4%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQVTFGEMTLEDFLV+AGVVREQ N A P P + Q Y       N        P    
Sbjct  178  TQRQVTFGEMTLEDFLVKAGVVREQENAAVPAPPQQQSYMMYQNSNNPAMATMARPVIGV  237

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGY  372
               +  G G  +P+Y  LPQ GVV EAP YP   KRGGG+ Q    VYGGRMGNG  VGY
Sbjct  238  G-GVTGGVGVGIPSYPPLPQSGVV-EAPVYPVSMKRGGGFPQQPTAVYGGRMGNGGGVGY  295

Query  373  AHMQGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVE  549
              +QG+ G+GSP+SPVS DGLCVN    GG   YGL+    G  GGRKRIIDGPVEKVVE
Sbjct  296  GQVQGVAGMGSPLSPVSSDGLCVNQVDSGG--QYGLEM---GMRGGRKRIIDGPVEKVVE  350

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E++RKRKQ+ F+EV
Sbjct  351  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALVELERKRKQQYFDEV  410

Query  730  KPTTPTKAQKASKKlrllrrTLSWP  804
            K    TKAQKA+ KLR +RR+LS P
Sbjct  411  KMKVQTKAQKANDKLRGMRRSLSCP  435



>ref|XP_010325920.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Solanum 
lycopersicum]
Length=415

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 154/226 (68%), Gaps = 11/226 (5%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ TFGEMTLEDFLV+AGVVREQGN+A  PP +                 A     + 
Sbjct  167  TQRQATFGEMTLEDFLVKAGVVREQGNSAPAPPQQQSYMMYPNSANPTMAAMARPVIGLG  226

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGY  372
                G+G G ++P Y  LPQ GVV EAP YP   KRG G+ Q S PVYGGRMGNGS VGY
Sbjct  227  GVTGGVGVGVSIPGYPPLPQTGVV-EAPVYPMSMKRGSGFPQQSTPVYGGRMGNGSGVGY  285

Query  373  AHM-QGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
              + QG+ G+GSP+SPVS D LCVN    GG   YGL+ G+RGG          PVEKVV
Sbjct  286  GQVVQGVAGMGSPLSPVSSDALCVNQIDSGG--QYGLEIGMRGGRKRVLDG---PVEKVV  340

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
            ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL
Sbjct  341  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQAL  386



>ref|XP_009768885.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Nicotiana 
sylvestris]
Length=433

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 166/269 (62%), Positives = 187/269 (70%), Gaps = 23/269 (9%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQVTFGEMTLEDFLV+AGVVREQ N  APP  +       +  P        A   +AR
Sbjct  179  QRQVTFGEMTLEDFLVKAGVVREQENAPAPPQQQSYMMYQNSNNP--------AMANMAR  230

Query  205  PVMGLGGGGA-----VPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGS  360
            PV+GLGG        +P+Y  LPQ GVV EAP YP   KRG G+ Q    VYGGRMGNG 
Sbjct  231  PVIGLGGVTGSVGVGIPSYPPLPQTGVV-EAPIYPVSMKRGAGFPQQPTAVYGGRMGNGG  289

Query  361  AVGYAHMQGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
             VGY  +QG+ G+GSP+SPVS DGLCVN    GG   YGL+ G+RGG          PVE
Sbjct  290  GVGYGQVQGVAGMGSPLSPVSSDGLCVNQVDSGG--QYGLEMGMRGGRKRIIDG---PVE  344

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
            KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E++RKRKQ+ 
Sbjct  345  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAELERKRKQQY  404

Query  718  FEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            F+E K    TKAQKA+ KLR +RR+LS P
Sbjct  405  FDEGKMKVQTKAQKATNKLRGMRRSLSCP  433



>ref|XP_011077930.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
2-2, chloroplastic-like [Sesamum indicum]
Length=892

 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 182/265 (69%), Gaps = 17/265 (6%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ TFGEMTLEDFL+RAGVVREQ    APP          + +P       + P++VA
Sbjct  158  TQRQPTFGEMTLEDFLIRAGVVREQNFAPAPPQQPQFGMFQNSSHPV------MGPSFVA  211

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPV-YGGRMGNGSAVG  369
            RPVM +GGG      Q +PQ  V  EA GY    KR  GY+QP+P V YGGR+GNG+  G
Sbjct  212  RPVMAIGGGVNNVTAQPMPQSAV-GEALGYTGGMKRASGYSQPTPTVNYGGRLGNGNGGG  270

Query  370  YAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVE  549
            +  +QGLG+GSPVSPVS DGL  N   D GNQ YGLD G   GG  R      PV KVVE
Sbjct  271  FGQVQGLGMGSPVSPVSSDGLGTN-HVDSGNQ-YGLDMGGARGGRKRIIDG--PVXKVVE  326

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE-  726
            RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ +EE 
Sbjct  327  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKHALAELERKRKQQYYEEA  386

Query  727  -VKPTTPTKAQKASKKlrllrrTLS  798
              K    +KAQKA++ ++ +RRTLS
Sbjct  387  RAKAQMQSKAQKANETVQAMRRTLS  411



>gb|KHG21602.1| abscisic acid-insensitive 5 -like protein [Gossypium arboreum]
Length=422

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 174/271 (64%), Gaps = 18/271 (7%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            + RQ TFGEMTLEDFLV+AGVVRE      P      Q+         +   A+ P++V 
Sbjct  159  STRQPTFGEMTLEDFLVKAGVVRE--PCVPPAVPPHSQHQQQFGLHQASNNPAVGPSFVP  216

Query  202  RPVMGLGGGGAVP--AYQALPQGGVVAEAPGYP---KRGGGYAQPSPPV-----YGGRMG  351
            RP+MG+GG G      YQ +P  GV+ ++ GY    K GGGY   + P+     Y G++G
Sbjct  217  RPIMGMGGSGGFGGSTYQTMPPSGVLGDSSGYLNDGKGGGGYQPAAAPLSTAIFYNGKVG  276

Query  352  NGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgP  531
              +A GY   Q +G+ SP+SPVSPDG+C N   +   Q +G++ G   G          P
Sbjct  277  --AAGGYGPGQAMGVVSPISPVSPDGVCTNQVDNAATQ-FGIEIGGLRGRKRIIDG---P  330

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLK+EN  LKQAL E++RKRKQ
Sbjct  331  IEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKQENTHLKQALVELERKRKQ  390

Query  712  EAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            + FEE    T TKAQKA +KLR++RR LS P
Sbjct  391  QYFEEWSMKTQTKAQKAKEKLRVMRRNLSGP  421



>ref|XP_007027724.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY08226.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 3 [Theobroma cacao]
Length=410

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 161/257 (63%), Gaps = 24/257 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGV REQ    APPP    QY       N        P +V+RP
Sbjct  161  RQPTFGEMTLEDFLIKAGV-REQCMLPAPPPQHQPQYGLYQSGNNAAG----GPGFVSRP  215

Query  208  VMGLG--GGGAVPAYQALPQGGVVAEAPGY---PKRGGGYAQPSPP----VYGGRMGNGS  360
            +MG+   GG    AYQ +P GGV+ ++ GY    KRG GY   +PP     Y G++   +
Sbjct  216  IMGVDSKGGFGGSAYQTMPPGGVIGDSSGYVNDCKRGSGYQPTAPPPTTVCYSGKVA--A  273

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
            A  Y   Q +G+ SP+SPVS +G+C N   D    H+G+D G   G          P+EK
Sbjct  274  AGAYVRGQAMGVVSPMSPVSSEGMC-NSQVDNAANHFGMDMGGLRGRKRIIEG---PIEK  329

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            VVERRQRRMIKNRESAARSRARKQAYTVELEAEL+QLK+ENA LKQAL+E+DRKRKQ   
Sbjct  330  VVERRQRRMIKNRESAARSRARKQAYTVELEAELDQLKQENAHLKQALEELDRKRKQ---  386

Query  721  EEVKPTTPTKAQKASKK  771
             +V   T +K  +A KK
Sbjct  387  -QVNYLTDSKCTEAGKK  402



>emb|CDP15406.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 161/255 (63%), Gaps = 10/255 (4%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQ+TFGEMTLEDFLVRAGVVREQ      P  +  Q      +  NN    +   +V R
Sbjct  172  QRQITFGEMTLEDFLVRAGVVREQTQPPPSPLPQQPQQPYGGTFYQNNDTNVMGTGFVTR  231

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEA-PGYPKRGGGYA-QPSPPVYGGRMGNGSAVGYAH  378
            PV  +GG   V  YQ +PQ G  + A PG  KRGGGYA QP+   +GGRMGNG + G   
Sbjct  232  PV--IGGSANVVGYQPMPQTGDASAAYPGSMKRGGGYAAQPTAACFGGRMGNGGSGGGYG  289

Query  379  MQGLG-LGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg---PVEKVV  546
                  +GSPVSPVS +GLC N   DG N  YG+D G   G G           P+EKVV
Sbjct  290  QVQGLGMGSPVSPVSSEGLCANQM-DGAN-PYGMDVGGMRGSGAGGGRKRIIDGPIEKVV  347

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LKQAL E++RKR+Q+  EE
Sbjct  348  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENGHLKQALAELERKRRQQQVEE  407

Query  727  VKPTTPTKAQKASKK  771
             K    T+ Q+   K
Sbjct  408  SKMKAQTRTQRNDDK  422



>ref|XP_007203311.1| hypothetical protein PRUPE_ppa019833mg [Prunus persica]
 gb|EMJ04510.1| hypothetical protein PRUPE_ppa019833mg [Prunus persica]
Length=449

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 145/278 (52%), Positives = 173/278 (62%), Gaps = 23/278 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamy--pnnntpaaIAPTYVA  201
            RQ TFGEMTLEDFLV+AGVVRE  +  A     P Q            N+  A+ P++  
Sbjct  175  RQPTFGEMTLEDFLVKAGVVREPDSMLAAGAVPPPQPQQQQQQYGMYQNSNQAVGPSFAN  234

Query  202  RPVMGLGGGGA----------VPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP--  330
            RPVMG+G  GA          +P YQ +PQ G  VVAE+ GY    KR G Y    PP  
Sbjct  235  RPVMGMGAAGAAGASTSTAAGMPNYQGIPQNGATVVAESSGYAANGKRNGAYPAVPPPQA  294

Query  331  VYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
            V  G        GYA  Q +G+ +PVSPVS DG+C +   + G Q +GLD G   G    
Sbjct  295  VCFGGRVVNGGGGYAAGQPIGMAAPVSPVSSDGMCTSQVENSGGQ-FGLDMGGLRGRKRI  353

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EENA LKQAL E
Sbjct  354  LDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENAHLKQALAE  410

Query  691  MDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            ++RKRKQ+ F+E++    ++AQKA +KLR+LRR  S P
Sbjct  411  LERKRKQQYFDEMQMRIQSRAQKAKEKLRVLRRCHSCP  448



>gb|ADL62859.1| abscisic acid insensitive [Prunus armeniaca]
Length=436

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 171/278 (62%), Gaps = 23/278 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamy--pnnntpaaIAPTYVA  201
            RQ TFGEMTLEDFLV+AGVVRE  +  A     P Q            N+  A+ P++  
Sbjct  162  RQPTFGEMTLEDFLVKAGVVREPDSMLAAGAVPPPQPQQQQQQYGMYQNSNQAVGPSFAN  221

Query  202  RPVMGLGGGGA----------VPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP--  330
            RPVMG+G  G           +P YQ +PQ G  VVAE+ GY    KR G Y    PP  
Sbjct  222  RPVMGMGAAGTAGASTSTAAGMPNYQGMPQNGATVVAESSGYAANGKRNGAYPAVPPPQA  281

Query  331  VYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
            V  G        GYA  Q +G+ +PVSPVS DG+C +   + G Q +G D G   G    
Sbjct  282  VCFGGRVVNGGGGYAAGQPIGMAAPVSPVSSDGMCTSQVENSGGQ-FGFDMGGLRGRKRI  340

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EENA LKQAL E
Sbjct  341  LDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENAHLKQALAE  397

Query  691  MDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            ++RKRKQ+ F+E++    ++AQKA +KLR+LRR  S P
Sbjct  398  LERKRKQQYFDEMQTRVQSRAQKAKEKLRVLRRCHSCP  435



>ref|XP_008241247.1| PREDICTED: LOW QUALITY PROTEIN: protein ABSCISIC ACID-INSENSITIVE 
5 [Prunus mume]
Length=436

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 171/278 (62%), Gaps = 23/278 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamy--pnnntpaaIAPTYVA  201
            RQ TFGEMTLEDFLV+AGVVRE  +  A     P Q            N+  A+ P++  
Sbjct  162  RQPTFGEMTLEDFLVKAGVVREPDSMLAAGAVPPPQPQQQQQQYGMYQNSNQAVGPSFAN  221

Query  202  RPVMGLGGGGA----------VPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP--  330
            RPVMG+G  G           +P YQ +PQ G  VVAE+ GY    KR G Y    PP  
Sbjct  222  RPVMGMGAAGTAGASTSTAAGMPNYQGMPQNGATVVAESSGYAANGKRNGAYPAVPPPQA  281

Query  331  VYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
            V  G        GYA  Q +G+ +PVSPVS DG+C +   + G Q +G D G   G    
Sbjct  282  VCFGGRVVNGGGGYAAGQPIGMAAPVSPVSSDGMCTSQVENSGGQ-FGFDMGGLRGRKRI  340

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EENA LKQAL E
Sbjct  341  LDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENAHLKQALAE  397

Query  691  MDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            ++RKRKQ+ F+E++    ++AQKA +KLR+LRR  S P
Sbjct  398  LERKRKQQYFDEMQTRVQSRAQKAKEKLRVLRRCHSCP  435



>ref|XP_010271676.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010271677.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010271678.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Nelumbo nucifera]
Length=410

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 158/264 (60%), Gaps = 17/264 (6%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ+TFGEMTLEDFL+RAGVVRE             Q            PA   P Y  
Sbjct  153  TQRQITFGEMTLEDFLIRAGVVRE-------TCGSSSQQHRLMTPATGLPPATATPQYGY  205

Query  202  RPVMGLGGG--GAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAV  366
                  G G    VP YQ  PQ G   E   Y    KR   Y Q +   +GGR GNG+  
Sbjct  206  SDHQSTGNGVESGVPTYQTFPQSGS-GEPSNYTANGKRNSDYQQ-TGVCFGGREGNGA--  261

Query  367  GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
            GYA      LGS V+  + DG+C N   +     YG+D     G  GRKRI+DGP+EKVV
Sbjct  262  GYATAVTNTLGSQVNSATSDGICTNQVDNTAATQYGMD-MGGDGIRGRKRILDGPIEKVV  320

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA LK  L E ++KR+QE  EE
Sbjct  321  ERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKMTLAEAEKKRRQEMEEE  380

Query  727  VKPTTPTKAQKASKKlrllrrTLS  798
            +K   PTKAQKA+ KL+ +RRT+S
Sbjct  381  MKVKPPTKAQKAADKLKAIRRTVS  404



>ref|XP_010271672.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010271673.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010271675.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Nelumbo nucifera]
Length=478

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 158/264 (60%), Gaps = 17/264 (6%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQ+TFGEMTLEDFL+RAGVVRE             Q            PA   P Y  
Sbjct  221  TQRQITFGEMTLEDFLIRAGVVRE-------TCGSSSQQHRLMTPATGLPPATATPQYGY  273

Query  202  RPVMGLGGG--GAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAV  366
                  G G    VP YQ  PQ G   E   Y    KR   Y Q +   +GGR GNG+  
Sbjct  274  SDHQSTGNGVESGVPTYQTFPQSGS-GEPSNYTANGKRNSDYQQ-TGVCFGGREGNGA--  329

Query  367  GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
            GYA      LGS V+  + DG+C N   +     YG+D     G  GRKRI+DGP+EKVV
Sbjct  330  GYATAVTNTLGSQVNSATSDGICTNQVDNTAATQYGMD-MGGDGIRGRKRILDGPIEKVV  388

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA LK  L E ++KR+QE  EE
Sbjct  389  ERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKMTLAEAEKKRRQEMEEE  448

Query  727  VKPTTPTKAQKASKKlrllrrTLS  798
            +K   PTKAQKA+ KL+ +RRT+S
Sbjct  449  MKVKPPTKAQKAADKLKAIRRTVS  472



>ref|XP_004149224.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Cucumis 
sativus]
Length=436

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 140/282 (50%), Positives = 165/282 (59%), Gaps = 32/282 (11%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGVVRE                +       N+   I   YV+RP
Sbjct  163  RQPTFGEMTLEDFLIKAGVVREH---CIGGGVPQPLPPSQQYGMYQNSNHTIGAGYVSRP  219

Query  208  VMGLG------------GGGAVPAYQALPQGG-VVAEAPGYP---KRGGGYAQPSPPVYG  339
            +MGL               G +  YQ +PQGG  + +  G+    KR   ++   PP   
Sbjct  220  IMGLNTSAAGGGASGNAAAGGITTYQPVPQGGSTIGDTSGFAGNGKRNSVFSSQPPPAVC  279

Query  340  -------GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgg  498
                   G  G G   GY   Q +GL +PVSPVSP+G+C N   D  NQ +GLD G   G
Sbjct  280  YGGRVVNGGGGGGGGGGYPPAQPMGLAAPVSPVSPEGMCTNQV-DSSNQ-FGLDLGGLRG  337

Query  499  gggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQ  678
                      PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQ
Sbjct  338  RKRIIDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQ  394

Query  679  ALDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            AL E++RKRKQ+  EE K    TKAQ+A +KLR++RRTLS P
Sbjct  395  ALAELERKRKQQYLEETK-NFHTKAQRAKEKLRVMRRTLSCP  435



>ref|XP_004167581.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Cucumis 
sativus]
 gb|KGN59126.1| hypothetical protein Csa_3G776860 [Cucumis sativus]
Length=443

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 140/282 (50%), Positives = 165/282 (59%), Gaps = 32/282 (11%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGVVRE                +       N+   I   YV+RP
Sbjct  170  RQPTFGEMTLEDFLIKAGVVREH---CIGGGVPQPLPPSQQYGMYQNSNHTIGAGYVSRP  226

Query  208  VMGLG------------GGGAVPAYQALPQGG-VVAEAPGYP---KRGGGYAQPSPPVYG  339
            +MGL               G +  YQ +PQGG  + +  G+    KR   ++   PP   
Sbjct  227  IMGLNTSAAGGGASGNAAAGGITTYQPVPQGGSTIGDTSGFAGNGKRNSVFSSQPPPAVC  286

Query  340  -------GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgg  498
                   G  G G   GY   Q +GL +PVSPVSP+G+C N   D  NQ +GLD G   G
Sbjct  287  YGGRVVNGGGGGGGGGGYPPAQPMGLAAPVSPVSPEGMCTNQV-DSSNQ-FGLDLGGLRG  344

Query  499  gggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQ  678
                      PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQ
Sbjct  345  RKRIIDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQ  401

Query  679  ALDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            AL E++RKRKQ+  EE K    TKAQ+A +KLR++RRTLS P
Sbjct  402  ALAELERKRKQQYLEETK-NFHTKAQRAKEKLRVMRRTLSCP  442



>gb|AFO63293.1| bZIP14 [Tamarix hispida]
Length=506

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 167/285 (59%), Gaps = 40/285 (14%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGnta---------appparpqqyaaaamypnnntpa  177
            QRQ TFGEMTLEDFL+RAGVV+EQG +A              + QQ          N   
Sbjct  214  QRQQTFGEMTLEDFLIRAGVVQEQGASAPLVSGPPPHNHLQQQQQQQQQHHYGLYQNNNP  273

Query  178  aIAPTYVARPVMGLGGGGAVPAYQALP-QGGVVA-EAPGYP----KRGGGYAQPSPP---  330
             +   +V RP+M +  GG    YQ +P Q    A EA GY     KR  GYA   P    
Sbjct  274  QVGQAFV-RPIMTMAHGGIPAGYQNMPPQNNTAAGEACGYGAANGKRINGYAPAQPTPPP  332

Query  331  ------VYGGRMGNGSAV---GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDT  483
                  VYGGR+GNG+     GY    GLG+ SPVSPVS DG+C     D    HYG+D 
Sbjct  333  LPPGAMVYGGRVGNGAVPLPPGYG-AAGLGMTSPVSPVSSDGMCAPGQVDSSVGHYGVDM  391

Query  484  girgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  663
            G   GG  R      PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN
Sbjct  392  GAALGGRKRGIDG--PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREEN  449

Query  664  ASLKQALDEMDRKRKQEAFEEV---------KPTTPTKAQKASKK  771
            A LKQAL+E++R++ Q+  EE+         + + P+KAQKA +K
Sbjct  450  AQLKQALEELERQKNQQHMEEMLLLQQQQQQQQSEPSKAQKAQEK  494



>ref|XP_010683741.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 160/268 (60%), Gaps = 33/268 (12%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnn------ntpaaIA  186
            QRQ TFGEMTLEDFL++AGVVREQ  TA   P      A              +T   + 
Sbjct  186  QRQATFGEMTLEDFLIKAGVVREQCGTAPQTPLAAVAPAPPPTQHPPHHQYGFSTAPQMG  245

Query  187  PTYVARPVMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQP----SPPVYGGR  345
            PT+V RP++G+  GGA   YQ +P      E+ GY    KR  GY  P    S   YGGR
Sbjct  246  PTFVTRPMIGMAPGGA---YQPMPPSA--GESSGYTGNGKRNNGYPAPVVGPSVACYGGR  300

Query  346  MGNGSAVGYAHMQGLGLGSPVSPVSPDGLC-----VNPGGDGGNQHYGLDTgirgggggr  510
            M NG A G     G GL SPVSPVSP+G+C      NPGG      YGLD G   G    
Sbjct  301  MNNGGAPGGGFAPGPGL-SPVSPVSPEGMCGPGQVDNPGG-----QYGLDMGALRGRKRI  354

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EENA LKQAL E
Sbjct  355  IDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENAQLKQALAE  411

Query  691  MDRKRKQEAFEEVK-PTTPTKAQKASKK  771
            ++R+RKQ+  EE       ++AQ+A  K
Sbjct  412  IERQRKQQYREEQNIQVILSRAQRAQDK  439



>ref|XP_010049460.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Eucalyptus 
grandis]
Length=423

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 169/270 (63%), Gaps = 20/270 (7%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            T RQ TFGEMTLEDFL++AGVVREQ       P           +       +I P +V 
Sbjct  164  TPRQPTFGEMTLEDFLIKAGVVREQ-----HMPHPQPTQPPEQPFGMYPNNLSIGPGFVP  218

Query  202  RPVMGLGGGGA--VPAYQALPQGGVVAEAPGYP---KRGGGYA-QPSPPVYGGRMGNGSA  363
            RP+MG+GG  A  VP YQ  P    + E   Y    KR GGY   P P  YG R+GNGS 
Sbjct  219  RPIMGMGGAAANAVP-YQ--PMAAAIGEPSVYQANGKRNGGYVPAPMPVSYGQRVGNGSG  275

Query  364  VGYAHMQGLG-LGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
             G         +G PVSPVS DG+C  P  + G Q +G+D G   GG  R      PV+K
Sbjct  276  GGAYGAGQAMGMGLPVSPVSSDGMCGAPVENSGGQ-FGMDMGGARGGRKRIIDG--PVDK  332

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E+++KRKQ++ 
Sbjct  333  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKQALAELEKKRKQQSL  392

Query  721  EE--VKPTTPTKAQKASKKlrllrrTLSWP  804
            EE  +K  + T+A +A +KL+++RR LS P
Sbjct  393  EELRLKAQSQTRAYRAKEKLKMIRRNLSSP  422



>gb|KHN13511.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Glycine soja]
Length=431

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 161/263 (61%), Gaps = 10/263 (4%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVREQG  AA P                N    +  ++V RP
Sbjct  174  RQPTFGEMTLEDFLVKAGVVREQGGMAAMPVQASAHQHVQQYGMYPNNNPTMGASFVGRP  233

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGYAH  378
            VMG+ GG        +  GG +AE+ GY    KR  GY   +P V  G        GYA 
Sbjct  234  VMGMAGGAVPQGGVGVGVGGAIAESSGYAGNGKRDVGYPPGAPGVCFGGRVLNGGGGYAA  293

Query  379  MQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQ  558
            +  +G+ +PVSPVSP+G  +  G + G Q +G+D  +  G          PVEKVVERRQ
Sbjct  294  VSNMGVVAPVSPVSPEG--IGTGENSGGQ-FGMDMSMLRGRKRVLDG---PVEKVVERRQ  347

Query  559  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE-EVKP  735
            RRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LK AL +++R+RKQ+  + EV  
Sbjct  348  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENGQLKLALADLERRRKQQHLDQEVNG  407

Query  736  TTPTKAQKASKKlrllrrTLSWP  804
               T AQKA KKLR LR+TLS P
Sbjct  408  RVQTNAQKAKKKLRSLRKTLSCP  430



>ref|XP_008386994.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Malus 
domestica]
 ref|XP_008386996.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Malus 
domestica]
 ref|XP_008366599.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Malus domestica]
 ref|XP_008366600.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Malus domestica]
Length=461

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 163/264 (62%), Gaps = 22/264 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVREQ  + A     PQ           N   A+ P++V RP
Sbjct  192  RQPTFGEMTLEDFLVKAGVVREQ-XSMAATVVPPQPQQQQQYGMYQNGNQAVVPSFVNRP  250

Query  208  VMGLGGGGA--------VPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP---VYG  339
            VMG+G  GA        +  YQ +PQ G  VV E+  Y    KR G Y    PP    +G
Sbjct  251  VMGMGAAGAAGTSTATGIRNYQTIPQSGSAVVGESSAYAANGKRNGAYPTVPPPQSVCFG  310

Query  340  GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
            GR+ NG   GYA  Q +G+G+ VSPVS DG+  +   + G Q +GL+ G   G       
Sbjct  311  GRVVNGGD-GYAAGQTIGMGALVSPVSSDGMGTSQVENSGGQ-FGLEMGGLRGRKRGLDG  368

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
                VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ L QAL E++R
Sbjct  369  A---VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSHLNQALAELER  425

Query  700  KRKQEAFEEVKPTTPTKAQKASKK  771
            KRKQ+ FEE+K     +A+K  +K
Sbjct  426  KRKQQYFEEMKMRVQNRARKVKEK  449



>ref|XP_009374729.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5, partial [Pyrus 
x bretschneideri]
Length=452

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 159/263 (60%), Gaps = 20/263 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVREQ + AA       Q         N   A + P++V RP
Sbjct  183  RQPTFGEMTLEDFLVKAGVVREQDSMAATVVPPQPQQQQQYGMYQNGNQA-VVPSFVNRP  241

Query  208  VMGLGGGG--------AVPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP--VYGG  342
            VMG+G  G         VP YQ +PQ G  VV E+  Y    KR G Y    PP  V  G
Sbjct  242  VMGMGAAGAAGTSTAAVVPNYQTIPQSGSAVVGESSAYAANAKRNGAYPTVPPPQSVCFG  301

Query  343  RMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkrii  522
                    GYA  Q +G+ +PVSPVS DG+  +   + G Q +GL+ G   G        
Sbjct  302  GRVVNGGGGYAAGQTIGMVAPVSPVSSDGMGTSQVENSGGQ-FGLEMGGLRGRKRGLDGA  360

Query  523  dgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRK  702
               VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ LKQAL E++RK
Sbjct  361  ---VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSHLKQALAELERK  417

Query  703  RKQEAFEEVKPTTPTKAQKASKK  771
            RKQ+ FEE+K     +AQK  +K
Sbjct  418  RKQQYFEEIKMRVQNRAQKVKEK  440



>ref|XP_006594214.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Glycine max]
Length=494

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 143/281 (51%), Positives = 168/281 (60%), Gaps = 28/281 (10%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypn---nntpaaIAPTYV  198
            RQ TFGEMTLEDFLV+AGVVREQG  AA P    Q  A   M       N    +  ++V
Sbjct  219  RQPTFGEMTLEDFLVKAGVVREQGGMAAMPAMPAQASAHQHMQQYGMYANNNPTMGASFV  278

Query  199  ARPVMGLGGGGA----------VPAYQALPQGGV---VAEAPGYPKRG------GGYAQP  321
             RPVMG+ GG             P YQA+PQGGV   + ++ GY   G         A P
Sbjct  279  GRPVMGMAGGVDVGGGGGGNVVAPPYQAVPQGGVGGAIGDSSGYAGNGKRDVGYPPAAVP  338

Query  322  SPPVYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirggg  501
             P V  G        GYA +  +G+ +PVSPVSP+G  +  G + G Q +G+D  +  G 
Sbjct  339  PPGVCFGGRVLNGGGGYAAVSNMGMVAPVSPVSPEG--IGTGENSGGQ-FGMDISVLRGR  395

Query  502  ggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQA  681
                     PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LK A
Sbjct  396  KRVLDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENGQLKLA  452

Query  682  LDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            L +++R+RKQ+  EEV     T AQKA KKLR LR+TLS P
Sbjct  453  LADLERRRKQQCLEEVNGRVQTNAQKAKKKLRSLRKTLSCP  493



>ref|XP_004305345.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 151/262 (58%), Gaps = 30/262 (11%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE       P +                   +  +++   
Sbjct  180  RQPTFGEMTLEDFLVKAGVVRE-------PDSMSVAPLPPQPQQQPQQYGVVGQSFM---  229

Query  208  VMGLGGGG--------AVPAYQALPQGGV-VAEAPGYP---KRGGGYAQP-SPPVYGGRM  348
             MG+G            +P YQ +PQGG  V E+PGY    KR G Y  P S  V  G  
Sbjct  230  -MGMGANAGASTSTTPVLPNYQTIPQGGAPVGESPGYATNGKRNGVYLPPPSQAVCFGGR  288

Query  349  GNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQH-YGLDTgirgggggrkriid  525
                  GYA  Q +G+ +P+SPVS DG+C +   + G QH  G+                
Sbjct  289  MVNGGGGYAPTQPIGMAAPLSPVSSDGMCASQIENSGGQHGMGMGALRGRKRIIDG----  344

Query  526  gPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKR  705
             PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EENA+LKQAL E++ KR
Sbjct  345  -PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENANLKQALTELEMKR  403

Query  706  KQEAFEEVKPTTPTKAQKASKK  771
            KQ+  EE++    ++AQKA +K
Sbjct  404  KQQHCEEMRKRVQSRAQKAMEK  425



>ref|XP_003541461.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Glycine max]
Length=453

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 143/281 (51%), Positives = 168/281 (60%), Gaps = 28/281 (10%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypn---nntpaaIAPTYV  198
            RQ TFGEMTLEDFLV+AGVVREQG  AA P    Q  A   M       N    +  ++V
Sbjct  178  RQPTFGEMTLEDFLVKAGVVREQGGMAAMPAMPAQASAHQHMQQYGMYANNNPTMGASFV  237

Query  199  ARPVMGLGGGGA----------VPAYQALPQGGV---VAEAPGYPKRG------GGYAQP  321
             RPVMG+ GG             P YQA+PQGGV   + ++ GY   G         A P
Sbjct  238  GRPVMGMAGGVDVGGGGGGNVVAPPYQAVPQGGVGGAIGDSSGYAGNGKRDVGYPPAAVP  297

Query  322  SPPVYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirggg  501
             P V  G        GYA +  +G+ +PVSPVSP+G  +  G + G Q +G+D  +  G 
Sbjct  298  PPGVCFGGRVLNGGGGYAAVSNMGMVAPVSPVSPEG--IGTGENSGGQ-FGMDISVLRGR  354

Query  502  ggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQA  681
                     PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LK A
Sbjct  355  KRVLDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENGQLKLA  411

Query  682  LDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            L +++R+RKQ+  EEV     T AQKA KKLR LR+TLS P
Sbjct  412  LADLERRRKQQCLEEVNGRVQTNAQKAKKKLRSLRKTLSCP  452



>ref|XP_006589850.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like 
[Glycine max]
Length=939

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 141/279 (51%), Positives = 167/279 (60%), Gaps = 26/279 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVREQG  AA P                N    +  ++V RP
Sbjct  174  RQPTFGEMTLEDFLVKAGVVREQGGMAAMPVQASAHQHVQQYGMYPNNNPTMGASFVGRP  233

Query  208  VMGLGGGG---------AVPAYQALPQGG-------VVAEAPGYP---KRGGGYAQPSPP  330
            VMG+ GG            P YQA+PQGG        +AE+ GY    KR  GY   +P 
Sbjct  234  VMGMAGGVRVGSGGRNVVAPPYQAVPQGGVGVGVGGAIAESSGYAGNGKRDVGYPPGAPG  293

Query  331  VYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
            V  G        GYA +  +G+ +PVSPVSP+G  +  G + G Q +G+D  +  G    
Sbjct  294  VCFGGRVVNGGGGYAAVSNMGVVAPVSPVSPEG--IGTGENSGGQ-FGMDMSMLRGRKRV  350

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LK AL +
Sbjct  351  LDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENGQLKLALAD  407

Query  691  MDRKRKQEAFE-EVKPTTPTKAQKASKKlrllrrTLSWP  804
            ++R+RKQ+  + EV     T AQKA KKLR LR+TLS P
Sbjct  408  LERRRKQQHLDQEVNGRVQTNAQKAKKKLRSLRKTLSCP  446



>gb|KHG26140.1| abscisic acid-insensitive 5 -like protein [Gossypium arboreum]
Length=414

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 156/258 (60%), Gaps = 27/258 (10%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaa--aamypnnntpaaIAPTY  195
            T+RQ+TFGEMTLEDFL++AGVVREQ     PP   P  +                ++P +
Sbjct  165  TRRQLTFGEMTLEDFLIKAGVVREQCMPPQPPSVLPSPHHQPPQYGLYRTGNNPTVSPGF  224

Query  196  VARPVMGLGGGGAVPAYQALPQGGVVAEAPGYP--KRGGGYAQPSPP----VYGGRMGNG  357
            V+RPV G  G     AYQ +P        PG    K GG Y   +PP    +Y G++  G
Sbjct  225  VSRPV-GFSGT----AYQTMP--------PGLNDGKTGGAYQPAAPPLTTVIYNGKVTGG  271

Query  358  SAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
               G    + +G  +PVSPVS + LC N   +  +Q +G++     G          P+E
Sbjct  272  GGYGPG--KTIGGVAPVSPVSSERLCTNQVDNAASQ-FGMEMVAVRGRQRIIDG---PIE  325

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
            KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLK+ENA LKQAL E++RKRKQ+ 
Sbjct  326  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKQENAHLKQALAELERKRKQQC  385

Query  718  FEEVKPTTPTKAQKASKK  771
            FEE K  T TKA+KA ++
Sbjct  386  FEEWKTKTQTKARKARER  403



>ref|XP_010244710.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Nelumbo 
nucifera]
Length=432

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 165/282 (59%), Gaps = 25/282 (9%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparp------qqyaaaamypnnntpaaI  183
            TQRQ+TFGEMTLEDFL+RAG+VRE    ++    +          A        N  A +
Sbjct  152  TQRQLTFGEMTLEDFLIRAGIVREACGPSSKHQLQTPATVPPTGTATQQYGLYQNNNAGV  211

Query  184  APTYVARPVMGLG-------GGGA---VPAYQALPQGG-VVAEAPGYP---KRGGGYAQP  321
             P +   P++GLG       G G    V +YQ  PQ G V+ E   Y    KR GG+  P
Sbjct  212  DPNFGMGPLLGLGFSEQRSTGNGVANGVLSYQTFPQSGTVLGEPSNYAPNGKRNGGF--P  269

Query  322  SPPVYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirggg  501
            +   +GGR GNG+    A      LG PV PV+ +G+C +   +     YG+D     G 
Sbjct  270  ATVCFGGRTGNGAGYVAAAAAANTLGPPVCPVTSEGMCTSQVDNATANQYGVDISGIRGR  329

Query  502  ggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQA  681
                     PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEEN  LK+A
Sbjct  330  KRLIDS---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENGRLKEA  386

Query  682  LDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWPS  807
            L   ++KR++E  E++K   PTKAQK ++KL+ ++RT+S P+
Sbjct  387  LAASEKKRREELEEKMKTKPPTKAQKTAEKLKSMKRTVSCPT  428



>gb|AAC49759.1| Dc3 promoter-binding factor-1 [Helianthus annuus]
Length=378

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 175/269 (65%), Gaps = 18/269 (7%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAP---TY  195
            QRQ T+GEMTLEDFLV+AGVVREQ +  APP  +    +      N N      P    +
Sbjct  120  QRQPTYGEMTLEDFLVKAGVVREQNHPNAPPVPQQVPASFGLYPTNGNNRIIGPPPSSAH  179

Query  196  VARPVMGL---GGGGAVPAYQALPQGGVVAEAPGYP--KRGGGYAQPSPPVYGGRMGNGS  360
            + RP++GL   GG   +P Y  L     + E PGYP  KR G Y Q  PP YGG  GN  
Sbjct  180  MVRPMLGLSTGGGASVIPPYSPL-----IRETPGYPGGKRAGNYQQ-QPPPYGGIGGNAG  233

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
             V   + QGLG+GSP SPVS DG+      D GNQ Y L+    G  GGRKRIIDGPVEK
Sbjct  234  GVAGGYGQGLGIGSPPSPVSSDGIATT-QLDSGNQ-YALEM--GGIRGGRKRIIDGPVEK  289

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            VVERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA LKQAL E++RKRKQ+  
Sbjct  290  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNMLKEENAQLKQALAEIERKRKQQFS  349

Query  721  EEVKPTTPTKAQKASKKlrllrrTLSWPS  807
            EE++    TK QK   K R+LRRT S P+
Sbjct  350  EEIRMKGVTKCQKVRDKSRMLRRTSSCPT  378



>ref|XP_010049452.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1 [Eucalyptus 
grandis]
Length=429

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 155/256 (61%), Gaps = 18/256 (7%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            T RQ TFGEMTLEDFL++AGVVREQ       P           +       +I P +V 
Sbjct  164  TPRQPTFGEMTLEDFLIKAGVVREQ-----HMPHPQPTQPPEQPFGMYPNNLSIGPGFVP  218

Query  202  RPVMGLGGG--GAVPAYQALPQGGVVAEAPGYP---KRGGGYA-QPSPPVYGGRMGNGSA  363
            RP+MG+GG    AVP YQ  P    + E   Y    KR GGY   P P  YG R+GNGS 
Sbjct  219  RPIMGMGGAAANAVP-YQ--PMAAAIGEPSVYQANGKRNGGYVPAPMPVSYGQRVGNGSG  275

Query  364  VGYAHMQGLG-LGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
             G         +G PVSPVS DG+C  P  + G Q +G+D G   GG  R      PV+K
Sbjct  276  GGAYGAGQAMGMGLPVSPVSSDGMCGAPVENSGGQ-FGMDMGGARGGRKRIIDG--PVDK  332

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL E+++KRKQ+  
Sbjct  333  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKQALAELEKKRKQQDC  392

Query  721  EEVKPTTPTKAQKASK  768
              V   T  ++ K+++
Sbjct  393  CTVSGRTEVESSKSNQ  408



>ref|XP_007027725.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
 ref|XP_007027727.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOY08227.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOY08229.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 4 [Theobroma cacao]
Length=383

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 143/228 (63%), Gaps = 20/228 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGV REQ    APPP    QY       N        P +V+RP
Sbjct  161  RQPTFGEMTLEDFLIKAGV-REQCMLPAPPPQHQPQYGLYQSGNNAAG----GPGFVSRP  215

Query  208  VMGLG--GGGAVPAYQALPQGGVVAEAPGY---PKRGGGYAQPSPP----VYGGRMGNGS  360
            +MG+   GG    AYQ +P GGV+ ++ GY    KRG GY   +PP     Y G++   +
Sbjct  216  IMGVDSKGGFGGSAYQTMPPGGVIGDSSGYVNDCKRGSGYQPTAPPPTTVCYSGKVA--A  273

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
            A  Y   Q +G+ SP+SPVS +G+C N   D    H+G+D G   G          P+EK
Sbjct  274  AGAYVRGQAMGVVSPMSPVSSEGMC-NSQVDNAANHFGMDMGGLRGRKRIIEG---PIEK  329

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
            VVERRQRRMIKNRESAARSRARKQAYTVELEAEL+QLK+ENA LKQAL
Sbjct  330  VVERRQRRMIKNRESAARSRARKQAYTVELEAELDQLKQENAHLKQAL  377



>ref|XP_009768886.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Nicotiana 
sylvestris]
Length=422

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 157/229 (69%), Gaps = 23/229 (10%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQVTFGEMTLEDFLV+AGVVREQ N  APP  +       +  P        A   +AR
Sbjct  179  QRQVTFGEMTLEDFLVKAGVVREQENAPAPPQQQSYMMYQNSNNP--------AMANMAR  230

Query  205  PVMGLGGGGA-----VPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGS  360
            PV+GLGG        +P+Y  LPQ GVV EAP YP   KRG G+ Q    VYGGRMGNG 
Sbjct  231  PVIGLGGVTGSVGVGIPSYPPLPQTGVV-EAPIYPVSMKRGAGFPQQPTAVYGGRMGNGG  289

Query  361  AVGYAHMQGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
             VGY  +QG+ G+GSP+SPVS DGLCVN    GG   YGL+ G+RGG          PVE
Sbjct  290  GVGYGQVQGVAGMGSPLSPVSSDGLCVNQVDSGG--QYGLEMGMRGGRKRIIDG---PVE  344

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
            KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL
Sbjct  345  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQAL  393



>ref|XP_009586574.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=422

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 162/230 (70%), Gaps = 21/230 (9%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            TQRQVTFGEMTLEDFLV+AGVVREQ N A P P + Q Y       N       A   +A
Sbjct  178  TQRQVTFGEMTLEDFLVKAGVVREQENAAVPAPPQQQSYMMYQNSNNP------AMATMA  231

Query  202  RP-----VMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNG  357
            RP      +  G G  +P+Y  LPQ GVV EAP YP   KRGGG+ Q    VYGGRMGNG
Sbjct  232  RPVIGVGGVTGGVGVGIPSYPPLPQSGVV-EAPVYPVSMKRGGGFPQQPTAVYGGRMGNG  290

Query  358  SAVGYAHMQGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPV  534
              VGY  +QG+ G+GSP+SPVS DGLCVN    GG   YGL+    G  GGRKRIIDGPV
Sbjct  291  GGVGYGQVQGVAGMGSPLSPVSSDGLCVNQVDSGG--QYGLEM---GMRGGRKRIIDGPV  345

Query  535  EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
            EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL
Sbjct  346  EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQAL  395



>ref|XP_010654080.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Vitis vinifera]
Length=402

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 162/266 (61%), Gaps = 18/266 (7%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
             RQ T GEMTLEDFL+RAGVVREQ     P    P Q+     Y        I+PT+ AR
Sbjct  148  HRQPTLGEMTLEDFLIRAGVVREQ-----PTATAPAQHQQQHQYGLYQNNNTISPTF-AR  201

Query  205  PVMGLGGGGAVPAYQALPQG-GVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGY  372
            PVMG+GGG  V ++Q LPQ  G   E+ GY    KR GGY  P      G         Y
Sbjct  202  PVMGMGGGAGVGSFQTLPQSSGAAGESSGYAGNGKRNGGY--PKTSACLGGRVGNGGGVY  259

Query  373  AHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVER  552
               Q L + S VSPVS DG+C N   +   Q +GLD G   G          PVEKVVER
Sbjct  260  GPGQTLAMESTVSPVSSDGMCPNQIDNTAGQ-FGLDVGGLRGRKRIIDG---PVEKVVER  315

Query  553  RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD--RKRKQEAFEE  726
            RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  L+QAL E D  RKRKQ+  EE
Sbjct  316  RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTLLQQALAEADFERKRKQQYLEE  375

Query  727  VKPTTPTKAQKASKKlrllrrTLSWP  804
            +K  T TKA+KA +KL+ +R+T S P
Sbjct  376  LKMKTQTKAEKAKEKLKKMRKTWSCP  401



>gb|ACA35280.1| abscisic acid insensitive [Cucumis sativus]
Length=747

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 148/260 (57%), Gaps = 31/260 (12%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGVVRE                +       N+   I   YV+RP
Sbjct  170  RQPTFGEMTLEDFLIKAGVVREH---CIGGGVPQPLPPSQQYGMYQNSNHTIGAGYVSRP  226

Query  208  VMGLG------------GGGAVPAYQALPQGG-VVAEAPGYP---KRGGGYAQPSPPVYG  339
            +MGL               G +  YQ +PQGG  + +  G+    KR   ++   PP   
Sbjct  227  IMGLNTSAAGGGASGNAAAGGITTYQPVPQGGSTIGDTSGFAGNGKRNSVFSSQPPPAVC  286

Query  340  -------GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgg  498
                   G  G G   GY   Q +GL +PVSPVSP+G+C N   D  NQ +GLD G   G
Sbjct  287  YGGRVVNGGGGGGGGGGYPPAQPMGLAAPVSPVSPEGMCTNQV-DSSNQ-FGLDLGGLRG  344

Query  499  gggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQ  678
                      PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQ
Sbjct  345  RKRIIDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQ  401

Query  679  ALDEMDRKRKQEAFEEVKPT  738
            AL E++RKRKQ+ F+ +  T
Sbjct  402  ALAELERKRKQQPFQFLSTT  421



>ref|XP_003553595.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Glycine 
max]
Length=387

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 156/260 (60%), Gaps = 26/260 (10%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE        P  P  ++    Y NNN   A+AP++V R 
Sbjct  152  RQPTFGEMTLEDFLVKAGVVRE----TTCAPPLPVSHSHQPHYANNNNNVAMAPSFVGRH  207

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQG  387
            V G       P YQ      VV EA       GGY +      G     G   GY     
Sbjct  208  V-GAVSNVVAPGYQQ-----VVGEA------SGGYGKRDHNGGGYHCFGGGGGGYGVGPT  255

Query  388  LGLGSPVSPV-SPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
            +G+G PVSP  S DG+    G DGG   +GLD G   G          PVEKVVERRQRR
Sbjct  256  MGMGGPVSPANSSDGI----GNDGG--QFGLDMGGLRGRKRVVDG---PVEKVVERRQRR  306

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTP  744
            MIKNRESAARSRARKQAYTVELEAELNQL+EEN+ LKQAL E++R RKQ+ FEEV  +  
Sbjct  307  MIKNRESAARSRARKQAYTVELEAELNQLREENSQLKQALAELERGRKQQCFEEVNVSVK  366

Query  745  TKAQKASKKlrllrrTLSWP  804
            TKAQKA +KLR LRR +S P
Sbjct  367  TKAQKAKEKLRALRRNMSCP  386



>gb|KDP42738.1| hypothetical protein JCGZ_23678 [Jatropha curcas]
Length=419

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 154/263 (59%), Gaps = 17/263 (6%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            T RQ TFGEMTLEDFL++AGVVREQ    +  P+   Q        N N   A+A ++++
Sbjct  171  TPRQPTFGEMTLEDFLIKAGVVREQ---QSAAPSAQPQQFGLYQSTNTNNNNAMATSFLS  227

Query  202  RPVMGLGGGGAVPA-YQALPQG-GVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYA  375
            RPV+G+   G     YQ + Q  G V E    P  G  Y               S  GY+
Sbjct  228  RPVLGMAAAGGGGGGYQTIQQNAGPVVETAAPPPPGSVYGG---------RVGNSGGGYS  278

Query  376  HMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERR  555
              Q +G+   VSPVS D +  N   D     +G+D G   G          PVEKVVERR
Sbjct  279  PNQAMGVVGQVSPVSNDAMVSNNSIDNTVNQFGIDMGGLRGRKRIIDG---PVEKVVERR  335

Query  556  QRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKP  735
            QRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  L+ AL E+++KRKQ+  E+++ 
Sbjct  336  QRRMIKNRESAARSRARKQAYTVELEAELNQLKEENEQLRHALAELEKKRKQQNLEDLRM  395

Query  736  TTPTKAQKASKKlrllrrTLSWP  804
               TKAQKA  KLR++RR LS P
Sbjct  396  KAQTKAQKAKDKLRMMRRNLSCP  418



>gb|KDO61128.1| hypothetical protein CISIN_1g043882mg [Citrus sinensis]
Length=456

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 169/287 (59%), Gaps = 35/287 (12%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGVVREQ  T    P   QQ+       N      ++P +    
Sbjct  176  RQPTFGEMTLEDFLIKAGVVREQNTTPVAQPPPQQQFGIYQTNNNPV----MSPNFGTGH  231

Query  208  VMGLGG-------GGAVP----AYQALPQG-GVVAE-------APGYPKRGGGYAQPSPP  330
            V+GL G        G+VP    AYQ +P   GVV          P   K  GGY+    P
Sbjct  232  VLGLTGVSNGASNNGSVPVPAPAYQQMPPARGVVGSDQSSAYMGPTNEKGSGGYSATQQP  291

Query  331  VYGGRMGNGSAVGYAHMQGLGLG--------SPVSPVSPDGLCVNPGGDGGNQH-YGLDT  483
                      AV Y    G G G        + +SPVS + +  +   DG   H +G+D 
Sbjct  292  PQPPPSPPPLAVCYGGRVGTGGGYASGGQPVAAMSPVSSEAVGTDQQVDGSASHQFGMD-  350

Query  484  girgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  663
                GG  +KRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN
Sbjct  351  --HMGGIRKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  408

Query  664  ASLKQALDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            A LKQAL EM+RK+KQ+ FEE+K    TKAQKA +KLR++RR LS P
Sbjct  409  AHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLRIMRRNLSCP  455



>ref|NP_565840.1| protein abscisic acid-insensitive 5 [Arabidopsis thaliana]
 sp|Q9SJN0.1|ABI5_ARATH RecName: Full=Protein ABSCISIC ACID-INSENSITIVE 5; AltName: Full=Dc3 
promoter-binding factor 1; Short=AtDPBF1; AltName: Full=Protein 
GROWTH-INSENSITIVITY TO ABA 1; AltName: Full=bZIP 
transcription factor 39; Short=AtbZIP39 [Arabidopsis thaliana]
 gb|AAD21438.1| abscisic acid insensitive 5 (ABI5) [Arabidopsis thaliana]
 gb|AAK19599.1| bZIP protein [Arabidopsis thaliana]
 gb|ABH04624.1| At2g36270 [Arabidopsis thaliana]
 gb|AEC09226.1| protein abscisic acid-insensitive 5 [Arabidopsis thaliana]
Length=442

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 144/248 (58%), Gaps = 19/248 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE           P           N  P+++ P    + 
Sbjct  198  RQPTFGEMTLEDFLVKAGVVREH----------PTNPKPNPNPNQNQNPSSVIPAAAQQQ  247

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKR--GGGYAQPSPPVYGGRMGNGSAVGYAHM  381
            + G+  G   P++     G  V +  GY KR  GGGY Q +PPV  G    G     A  
Sbjct  248  LYGVFQGTGDPSFPGQAMG--VGDPSGYAKRTGGGGYQQ-APPVQAGVCYGGGVGFGAGG  304

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            Q +G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVVERRQR
Sbjct  305  QQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVVDG---PVEKVVERRQR  360

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K   
Sbjct  361  RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLKSRA  420

Query  742  PTKAQKAS  765
              K  K++
Sbjct  421  QPKLPKSN  428



>emb|CAN71955.1| hypothetical protein VITISV_009883 [Vitis vinifera]
Length=392

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 141/236 (60%), Gaps = 18/236 (8%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
             RQ T GEMTLEDFL+RAGVVREQ     P    P Q+     Y        I+PT+ AR
Sbjct  148  HRQPTLGEMTLEDFLIRAGVVREQ-----PTATAPAQHQQQHQYGLYQNNNTISPTF-AR  201

Query  205  PVMGLGGGGAVPAYQALPQG-GVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGY  372
            PVMG+GGG  V ++Q LPQ  G   E+ GY    KR GGY  P      G         Y
Sbjct  202  PVMGMGGGAGVGSFQTLPQSSGAAGESSGYXGNGKRNGGY--PKTSACXGGRVGNGGGVY  259

Query  373  AHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVER  552
               Q L + S VSPVS DG+C N   +   Q +GLD G   G          PVEKVVER
Sbjct  260  GPGQTLAMESTVSPVSSDGMCPNQIDNTAGQ-FGLDVGXLRGRKRIIDG---PVEKVVER  315

Query  553  RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD--RKRKQE  714
            RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  L+QAL E D  RKRKQ+
Sbjct  316  RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTLLQQALAEADFERKRKQQ  371



>ref|XP_006430223.1| hypothetical protein CICLE_v10013385mg [Citrus clementina]
 gb|ESR43463.1| hypothetical protein CICLE_v10013385mg [Citrus clementina]
Length=462

 Score =   163 bits (413),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 168/285 (59%), Gaps = 35/285 (12%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGVVREQ  T    P   QQ+       N      ++P +    
Sbjct  182  RQPTFGEMTLEDFLIKAGVVREQNTTPVAQPPPQQQFGIYQTNNNPV----MSPNFGTGH  237

Query  208  VMGLGG-------GGAVP----AYQALPQG-GVVAE-------APGYPKRGGGYAQPSPP  330
            V+GL G        G+VP    AYQ +P   GVV          P   K  GGY+    P
Sbjct  238  VLGLTGVSNGASNNGSVPVPAPAYQQMPPARGVVGSDQSSAYMGPTNEKGSGGYSATQQP  297

Query  331  VYGGRMGNGSAVGYAHMQGLGLG--------SPVSPVSPDGLCVNPGGDGGNQH-YGLDT  483
                      AV Y    G G G        + +SPVS + +  +   DG   H +G+D 
Sbjct  298  PQPPPPPPPLAVCYGGRVGTGGGYASGGQPVAAMSPVSSEAVGTDQQVDGSASHQFGMD-  356

Query  484  girgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  663
                GG  +KRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN
Sbjct  357  --HMGGIRKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  414

Query  664  ASLKQALDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLS  798
            A LKQAL EM+RK+KQ+ FEE+K    TKAQKA +KLR++RR LS
Sbjct  415  AHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLRIMRRNLS  459



>ref|XP_003625810.1| Abscisic acid insensitive [Medicago truncatula]
 gb|AES82028.1| ABA response element-binding factor [Medicago truncatula]
Length=431

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 162/272 (60%), Gaps = 29/272 (11%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamyp-nnntpaaIAP---  189
            T RQ TFGEMTLEDFLV+AGVVREQ +      A P   AA + +       AA+ P   
Sbjct  155  TPRQPTFGEMTLEDFLVKAGVVREQQSGMPVAIAPPPTAAAVSSHRPQQQHYAAVYPNNN  214

Query  190  -TYVARPVMGLGGGGAV----PAYQALPQGG-VVAE--APGY-------PKRGGGYAQPS  324
             T        +GGGG +    P YQ + QGG  V E  + GY          G GY  P 
Sbjct  215  STMAQAASFAIGGGGNLNVVAPPYQTVAQGGGAVGEPSSSGYVGNGKTRDSIGTGYPPPP  274

Query  325  PPV-YGGRMGNGSAVGY--AHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirg  495
            P + YGGR+ NG+A GY  A  Q +G+G PVSPVS DG+    G +     +G+D     
Sbjct  275  PAICYGGRVVNGAAGGYGVAVAQTMGMGGPVSPVSSDGI----GNENSGGQFGIDMNGLR  330

Query  496  ggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLK  675
            G          PVE+VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ LK
Sbjct  331  GRKRMVDG---PVERVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSQLK  387

Query  676  QALDEMDRKRKQEAFEEVKPTTPTKAQKASKK  771
            QAL E++R+R+Q+  EE      TKAQKA +K
Sbjct  388  QALAELERRRRQQCSEETNVRVQTKAQKAKEK  419



>ref|XP_008386997.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2 [Malus 
domestica]
Length=433

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 143/235 (61%), Gaps = 22/235 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVREQ  + A     PQ           N   A+ P++V RP
Sbjct  192  RQPTFGEMTLEDFLVKAGVVREQ-XSMAATVVPPQPQQQQQYGMYQNGNQAVVPSFVNRP  250

Query  208  VMGLGGGGA--------VPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP---VYG  339
            VMG+G  GA        +  YQ +PQ G  VV E+  Y    KR G Y    PP    +G
Sbjct  251  VMGMGAAGAAGTSTATGIRNYQTIPQSGSAVVGESSAYAANGKRNGAYPTVPPPQSVCFG  310

Query  340  GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
            GR+ NG   GYA  Q +G+G+ VSPVS DG+  +   + G Q +GL+ G   G       
Sbjct  311  GRVVNGGD-GYAAGQTIGMGALVSPVSSDGMGTSQVENSGGQ-FGLEMGGLRGRKRGLDG  368

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
                VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ L QAL
Sbjct  369  A---VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSHLNQAL  420



>emb|CBI30287.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 142/263 (54%), Gaps = 45/263 (17%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
             RQ T GEMTLEDFL+RAGVVREQ                              PT  A 
Sbjct  132  HRQPTLGEMTLEDFLIRAGVVREQ------------------------------PTATA-  160

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYP---KRGGGYAQPSPPVYGGRMGNGSAVGYA  375
                            L Q     ++ GY    KR GGY + S  + G     G   G  
Sbjct  161  -----PAQHQQQHQYGLYQNNNTIKSSGYAGNGKRNGGYPKTSACLGGRVGNGGGVYGPG  215

Query  376  HMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERR  555
              Q L + S VSPVS DG+C N   +   Q +GLD G   G          PVEKVVERR
Sbjct  216  --QTLAMESTVSPVSSDGMCPNQIDNTAGQ-FGLDVGGLRGRKRIIDG---PVEKVVERR  269

Query  556  QRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKP  735
            QRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  L+QAL + +RKRKQ+  EE+K 
Sbjct  270  QRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTLLQQALADFERKRKQQYLEELKM  329

Query  736  TTPTKAQKASKKlrllrrTLSWP  804
             T TKA+KA +KL+ +R+T S P
Sbjct  330  KTQTKAEKAKEKLKKMRKTWSCP  352



>ref|XP_009366660.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Pyrus x 
bretschneideri]
Length=413

 Score =   152 bits (383),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 134/236 (57%), Gaps = 22/236 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVREQ + AA                 N+  A + P++V RP
Sbjct  170  RQPTFGEMTLEDFLVKAGVVREQDSMAATVVPPQPHQQQQYGMYQNDNQA-VGPSFVNRP  228

Query  208  VM----------GLGGGGAVPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP--VY  336
            VM                 +P+YQ +PQ G  VV E+  Y    KR G Y    PP  V 
Sbjct  229  VMGMGAAAAVGASTSTAAGIPSYQTIPQSGAAVVRESSAYAANGKRNGAYLGVPPPHSVC  288

Query  337  GGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkr  516
             G        GYA  Q +G+ +P SP+S DG+  +   +   Q +GLD G   G      
Sbjct  289  FGGRVVNGGGGYAAEQTIGMAAPGSPLSSDGMGTSQVENSAFQ-FGLDMGGLRGRKRGLD  347

Query  517  iidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
                PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELN L+EEN+ LKQAL
Sbjct  348  G---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLREENSHLKQAL  400



>ref|XP_007145326.1| hypothetical protein PHAVU_007G229600g [Phaseolus vulgaris]
 gb|ESW17320.1| hypothetical protein PHAVU_007G229600g [Phaseolus vulgaris]
Length=421

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 170/274 (62%), Gaps = 30/274 (11%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQ-GntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            +RQ TFGEMTLEDFL++AG+VREQ     + P +  Q +         N    + P++V 
Sbjct  163  RRQPTFGEMTLEDFLIKAGIVREQRSIAISVPASTSQNHHMQHYGFFPNNNRTMEPSFVG  222

Query  202  RPVMGLGGGG---------AVPAYQALPQGGVVA----EAPGYPKRGGGYAQPSPPVYGG  342
            R VMG+GGG            P YQA+ QGG       E+  Y       A P+   +G 
Sbjct  223  RQVMGVGGGAGGGCAGGNVVAPPYQAVAQGGGGGGAVGESSVY-----SAAVPAAVCFGP  277

Query  343  RMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkrii  522
            R+ NG   GYA +  +G+ +PVSPVSP+G+     G+     +G+D   RG   GRKR++
Sbjct  278  RVVNGGG-GYAAVSKMGVVAPVSPVSPEGIGT---GENFGCGFGMD---RGVLRGRKRVL  330

Query  523  dgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRK  702
            DGPVEKVVERRQRRMIKNRESAARSRARK AYTVELEAELNQLKEEN  LK AL +++R+
Sbjct  331  DGPVEKVVERRQRRMIKNRESAARSRARKLAYTVELEAELNQLKEENGELKLALADIERR  390

Query  703  RKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            RKQ+  EE       + +KA KKLR LRRTLS P
Sbjct  391  RKQQNLEEGN----CRVEKAKKKLRSLRRTLSCP  420



>ref|XP_002528738.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33650.1| DNA binding protein, putative [Ricinus communis]
Length=403

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 141/239 (59%), Gaps = 17/239 (7%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappp--arpqqyaaaamypnnntpaaIAPTYVA  201
            RQ TFGEMTLEDFLV+AG+VRE G+ AAP    +  QQ          N   AI   +V+
Sbjct  171  RQPTFGEMTLEDFLVKAGIVREHGSPAAPSILPSHQQQQYVLYNQSVTNNNHAIGTGFVS  230

Query  202  RPVMGLGGGGAVPA----YQAL-PQGGVVAEAPGYPKRGGGYA---QPSPPVYGGRMGNG  357
            RPV+G+ GGG        YQ + PQ G   E PG   R  G+      +P         G
Sbjct  231  RPVLGVSGGGTGGGNSVGYQTMAPQSGAAGETPG---RNAGFIPQGAVAPSGSVYGGRVG  287

Query  358  SAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
            +  GYA  +G+G+   VSPVS D + VN   D     +G+D G   G          PVE
Sbjct  288  NGGGYAPTEGMGVVGQVSPVSSDAM-VNTSVDNTANQFGIDMGGLRGRKRIIDG---PVE  343

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQE  714
            KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  L+  L E++RKRKQ+
Sbjct  344  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENKQLRHVLTELERKRKQQ  402



>emb|CDX75056.1| BnaA05g08020D [Brassica napus]
Length=399

 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 135/253 (53%), Gaps = 52/253 (21%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  178  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  206

Query  208  VMGLGGGGAVPAYQALPQ-GGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
            ++       +PA     Q  GV +        GGG   PS PV  G  G  +  G  + Q
Sbjct  207  MLNPTPTSVIPASTQQQQLYGVFS--------GGG--DPSFPVGVGDYGKRTGGGGGYQQ  256

Query  385  ------GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
                  G+G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVV
Sbjct  257  APPVQPGMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVVDG---PVEKVV  312

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE 
Sbjct  313  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKRKQQYFES  372

Query  727  VKPTTPTKAQKAS  765
            +K     K  K S
Sbjct  373  LKTRAQPKVPKVS  385



>gb|AGA16542.1| bZIP transcription factor ABI5, partial [Sisymbrium officinale]
Length=258

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 148/261 (57%), Gaps = 20/261 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE      P P   Q  ++             A T   + 
Sbjct  15   RQPTFGEMTLEDFLVKAGVVREHPTNPKPNPNPNQNPSSVIP----------AATQQQQQ  64

Query  208  VMGLGGGGAVPAY--QALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
            + G+  G   P +  QA+   GV   +    + GGG  Q  PP+  G    G     A  
Sbjct  65   LYGVFQGAGDPTFPGQAM---GVGDPSGYGKRTGGGGYQQVPPIQPGVCYGGGGGFGASG  121

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            Q + +G P+SPVS DGL  +   + G Q YG+D G   G          PVEKVVERRQR
Sbjct  122  QQMMVG-PLSPVSSDGLGHSQVDNIGGQ-YGVDMGGLRGRKRVVDG---PVEKVVERRQR  176

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K   
Sbjct  177  RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKRKQQYFESLKTRA  236

Query  742  PTKAQKASKKlrllrrTLSWP  804
              K  K S +LR L R  S P
Sbjct  237  QPKVPKVSGRLRTLVRNPSCP  257



>ref|XP_007162892.1| hypothetical protein PHAVU_001G189400g [Phaseolus vulgaris]
 gb|ESW34886.1| hypothetical protein PHAVU_001G189400g [Phaseolus vulgaris]
Length=393

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 146/276 (53%), Gaps = 48/276 (17%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGnt--aappparpqqyaaaamypnnntpaaIAPTYVA  201
            RQ TF EMTLEDFLV+AGVVREQ       P P+   Q        N   P     ++V 
Sbjct  149  RQPTFDEMTLEDFLVKAGVVREQPCVPPLLPHPSHHLQQQQHYTNNNGAMPGMGGSSFVG  208

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
            R V+G       P YQ       V EA       GGYA       GG           H 
Sbjct  209  RNVIGAVSNVVAPGYQ-------VGEA------SGGYAGNGKRDGGGGF---------HQ  246

Query  382  QGLGLG-------------SPVSPV-SPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
            QG+  G              PVSP  S DG+    G D G   +GLD G   G       
Sbjct  247  QGVCFGGSGYGMGPTMGMGGPVSPANSSDGI----GNDCG--QFGLDMGGLRGRKRIGDG  300

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
               PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  L+QAL EM+R
Sbjct  301  ---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTQLRQALAEMER  357

Query  700  KRKQEAFEEVKPT-TPTKAQKASKKlrllrrTLSWP  804
            +RKQ+ FEE+      T AQK  +K+R LRR +S+P
Sbjct  358  RRKQQCFEELNNIRVQTNAQKVKEKMRTLRRNMSYP  393



>emb|CDX84141.1| BnaC04g09030D [Brassica napus]
Length=394

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 133/262 (51%), Gaps = 70/262 (27%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  173  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  201

Query  208  VMGLGGGGAVPA-------YQALPQGGVVAEAPGYPKRGGGYA---------QPSPPVYG  339
            ++       +PA       Y   P GG     P +P   G Y          Q +PP  G
Sbjct  202  MLNPTPTSVIPASTQQQQLYGVFPGGG----DPTFPMGVGDYGKRAGGGGGYQQAPP--G  255

Query  340  GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
            G             Q +G+  P+SPVS DGL      + G Q YG+D G   G       
Sbjct  256  G-------------QQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVVDG  301

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
               PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++R
Sbjct  302  ---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELER  358

Query  700  KRKQEAFEEVKPTTPTKAQKAS  765
            KRKQ+ FE +K     K  K S
Sbjct  359  KRKQQYFESLKTRAQPKVPKVS  380



>ref|XP_010505159.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Camelina 
sativa]
Length=444

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 145/258 (56%), Gaps = 23/258 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE           P           N   +++ P    + 
Sbjct  200  RQPTFGEMTLEDFLVKAGVVREH----------PTNPKPNPNQSQNQNTSSVIPAAAQQQ  249

Query  208  VMGLGGGGAVPAY--QALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
            + G+  G   P +  QA+   GV   +    + GGG  Q +PPV  G    G     A  
Sbjct  250  LYGVFQGTGDPTFPGQAM---GVGDPSGYGKRAGGGGYQQAPPVQAGVCYGGGGGFGAGG  306

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            Q +G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVVERRQR
Sbjct  307  QQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVADG---PVEKVVERRQR  362

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K   
Sbjct  363  RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLK---  419

Query  742  PTKAQKASKKlrllrrTL  795
             T+AQ    K     RTL
Sbjct  420  -TRAQPKLPKSNGRLRTL  436



>ref|XP_002881435.1| hypothetical protein ARALYDRAFT_321332 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57694.1| hypothetical protein ARALYDRAFT_321332 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 146/258 (57%), Gaps = 23/258 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE           P           N  P+++ P    + 
Sbjct  195  RQPTFGEMTLEDFLVKAGVVREH----------PTNPKPNPNPNQNQNPSSVIPAAAQQQ  244

Query  208  VMGLGGGGAVPAY--QALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
            + G+  G   P +  QA+   GV   +    + GGG  Q +PPV  G    G     A  
Sbjct  245  LYGVFQGTGDPTFPGQAM---GVGDPSGYGKRTGGGGYQQAPPVQAGVCYGGGGGFGAGG  301

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            Q +G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVVERRQR
Sbjct  302  QQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDLGGLRGRKRVVDG---PVEKVVERRQR  357

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K   
Sbjct  358  RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLK---  414

Query  742  PTKAQKASKKlrllrrTL  795
             T+AQ    K     RTL
Sbjct  415  -TRAQPKLPKSNGRLRTL  431



>gb|KHN02230.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Glycine soja]
Length=338

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 126/209 (60%), Gaps = 22/209 (11%)
 Frame = +1

Query  181  IAPTYVARPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGS  360
            +AP++V R V G       P YQ      VV EA       GGY +      G     G 
Sbjct  150  MAPSFVGRHV-GAVSNVVAPGYQQ-----VVGEA------SGGYGKRDHNGGGYHCFGGG  197

Query  361  AVGYAHMQGLGLGSPVSPV-SPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
              GY     +G+G PVSP  S DG+    G DGG   +GLD G   G          PVE
Sbjct  198  GGGYGVGPTMGMGGPVSPANSSDGI----GNDGG--QFGLDMGGLRGRKRVVDG---PVE  248

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
            KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ LKQAL E++R RKQ+ 
Sbjct  249  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSQLKQALAELERGRKQQC  308

Query  718  FEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            FEEV  +  TKAQKA +KLR LRR +S P
Sbjct  309  FEEVNVSVKTKAQKAKEKLRALRRNMSCP  337



>ref|XP_010509494.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Camelina sativa]
Length=445

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 142/245 (58%), Gaps = 23/245 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE           P           N  P+++ P    + 
Sbjct  201  RQPTFGEMTLEDFLVKAGVVREH----------PTNPKPNPNQSQNQNPSSVIPAAAQQQ  250

Query  208  VMGLGGGGAVPAY--QALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
            + G+  G   P +  QA+   GV   +    + GGG  Q +PPV  G    G     A  
Sbjct  251  LYGVFQGTGDPTFPGQAM---GVGDPSGYGKRAGGGGYQQAPPVQAGVCYGGGGGFGAGG  307

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            Q +G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVVERRQR
Sbjct  308  QQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVADG---PVEKVVERRQR  363

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K   
Sbjct  364  RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLK---  420

Query  742  PTKAQ  756
             T+AQ
Sbjct  421  -TRAQ  424



>gb|AFZ45968.1| ABA insensitve 5-like protein [Brassica oleracea var. capitata]
Length=425

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 138/259 (53%), Gaps = 48/259 (19%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  188  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  216

Query  208  VMGLGGGGAVPA-------YQALPQGGVVAEAPG---YPKRGGGYA---QPSPPVYGGRM  348
            ++       +PA       Y   P GG  + + G   Y KR GG     Q +PPV  G  
Sbjct  217  MLNPTPTSVIPASTQQQQLYGVFPGGGDPSFSVGVGDYGKRAGGGGGGYQQAPPVQQGVC  276

Query  349  GNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg  528
              G     A  Q +G+  P+SPVS DGL      + G Q YG+D G   G          
Sbjct  277  YGGGGGFGAGGQQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVVDG---  332

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRK
Sbjct  333  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKRK  392

Query  709  QEAFEEVKPTTPTKAQKAS  765
            Q+ FE +K     K  K S
Sbjct  393  QQYFESLKTRAQPKVPKVS  411



>gb|AGG35953.1| ABA insensitive PP2C protein 5 [Brassica napus]
Length=438

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 134/263 (51%), Gaps = 56/263 (21%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  201  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  229

Query  208  VMGLGGGGAVPA-------YQALPQGGVVAEAPGYPKRGGGYA----------QPSPPVY  336
            ++       +PA       Y     GG     P +P   G Y           Q +PPV 
Sbjct  230  MLNPTPTSVIPASTQQQQLYGVFSGGG----DPSFPVGVGDYGKRTGGGGGGYQQAPPVQ  285

Query  337  GGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkr  516
             G    G     A  Q +G+  P+SPVS DGL      + G Q YG+D G   G      
Sbjct  286  PGVCYGGGGGFGAGGQQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVVD  344

Query  517  iidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD  696
                PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++
Sbjct  345  G---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELE  401

Query  697  RKRKQEAFEEVKPTTPTKAQKAS  765
            RKRKQ+ FE +K     K  K S
Sbjct  402  RKRKQQYFESLKTRAQPKVPKVS  424



>ref|XP_009141571.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Brassica 
rapa]
Length=403

 Score =   143 bits (361),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 131/247 (53%), Gaps = 46/247 (19%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  188  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  216

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVY-GGRMGNGSAVGYAHMQ  384
            ++       +PA     Q   V + PG           +PPV  G   G G     A  Q
Sbjct  217  ILNPTPSSVIPAATHQQQLYGVFQGPGQ----------APPVQPGVCYGGGGGGFGASGQ  266

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
             + +  P+SPVS +GL      + G Q YG+D G   G          PVEKVVERRQRR
Sbjct  267  QMAMVGPLSPVSSEGLGHGQVDNIGGQ-YGVDMGGIRGRKRVVDG---PVEKVVERRQRR  322

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTP  744
            MIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K    
Sbjct  323  MIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKRKQQYFESLKTRAQ  382

Query  745  TKAQKAS  765
             K  KAS
Sbjct  383  PKLPKAS  389



>emb|CDY43738.1| BnaAnng07530D [Brassica napus]
Length=404

 Score =   143 bits (360),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 130/248 (52%), Gaps = 47/248 (19%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  188  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  216

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPV--YGGRMGNGSAVGYAHM  381
            ++       +PA     Q   V + PG           +PPV       G G     A  
Sbjct  217  ILNPTPSSVIPAATHQQQLYGVFQGPGQ----------APPVQPGVCYGGGGGGGFGASG  266

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            Q + +  P+SPVS +GL      + G Q YG+D G   G          PVEKVVERRQR
Sbjct  267  QQMAMVRPLSPVSSEGLGHGQVDNIGGQ-YGVDMGGIRGRKRVVDG---PVEKVVERRQR  322

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K   
Sbjct  323  RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKRKQQYFESLKTRA  382

Query  742  PTKAQKAS  765
              K  KAS
Sbjct  383  QPKLPKAS  390



>ref|XP_006296104.1| hypothetical protein CARUB_v10025255mg [Capsella rubella]
 gb|EOA29002.1| hypothetical protein CARUB_v10025255mg [Capsella rubella]
Length=440

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 141/244 (58%), Gaps = 19/244 (8%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE             +         N  P+++ P    + 
Sbjct  194  RQPTFGEMTLEDFLVKAGVVREH--------PTNPKANPNQNQNQNQNPSSVIPAAAQQQ  245

Query  208  VMGLGGGGAVPAYQALPQG-GVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
            + G+  G   P +    QG GV   +    + GGG  Q +PPV  G    G     A  Q
Sbjct  246  LYGVFQGAGDPTFPG--QGMGVGDPSGYGKRTGGGGYQQAPPVQPGVCYGGGGGFGAGGQ  303

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
             +G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVVERRQRR
Sbjct  304  QMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVADG---PVEKVVERRQRR  359

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTP  744
            MIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K    
Sbjct  360  MIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLK----  415

Query  745  TKAQ  756
            T+AQ
Sbjct  416  TRAQ  419



>ref|XP_010516839.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Camelina 
sativa]
Length=444

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 147/259 (57%), Gaps = 24/259 (9%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE           P           N  P+++ P    + 
Sbjct  199  RQPTFGEMTLEDFLVKAGVVREH----------PTNPKPNPNQSQNQNPSSVIPAAAQQQ  248

Query  208  VMGLGGGGAVPAY--QALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRM-GNGSAVGYAH  378
            + G+  G   P +  QA+   GV   +    + GGG  Q +PPV  G   G G     A 
Sbjct  249  LYGVFQGTGDPTFPGQAM---GVGDPSGYGKRAGGGGYQQAPPVQAGVCYGGGGGGFGAG  305

Query  379  MQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQ  558
             Q +G+  P+SPVS DGL      + G Q YG+D G   G          PVEKVVERRQ
Sbjct  306  GQQMGMVGPLSPVSSDGLGHGQVDNIGGQ-YGVDMGGLRGRKRVADG---PVEKVVERRQ  361

Query  559  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPT  738
            RRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K  
Sbjct  362  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLK--  419

Query  739  TPTKAQKASKKlrllrrTL  795
              T+AQ    K     RTL
Sbjct  420  --TRAQPKLPKSNGRLRTL  436



>ref|XP_009143603.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Brassica rapa]
Length=438

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 139/266 (52%), Gaps = 63/266 (24%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFLV+AGVVRE                               PT   +P
Sbjct  202  RQPTFGEMTLEDFLVKAGVVREH------------------------------PTN-PKP  230

Query  208  VMGLGGGGAVPA-------YQALPQGGVVAEAPGYPKRGGGYA---------QPSPPVYG  339
            ++       +PA       Y     GG     P +P   G Y          Q +PPV  
Sbjct  231  MLNPTPTSVIPASTQQQQLYGVFSGGG----DPSFPVGVGDYGKRTGGGGGYQQAPPVQP  286

Query  340  GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGL----CVNPGGDGGNQHYGLDTgirggggg  507
            G    G     A  Q +G+  P+SPVS DGL      N GG  G    GL         G
Sbjct  287  GVCYGGGGGFGAGGQQMGMVGPLSPVSSDGLGHGQVDNIGGQYGVVMGGL--------RG  338

Query  508  rkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALD  687
            RKR++DGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK AL 
Sbjct  339  RKRVVDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALG  398

Query  688  EMDRKRKQEAFEEVKPTTPTKAQKAS  765
            E++RKRKQ+ FE +K     K  K S
Sbjct  399  ELERKRKQQYFESLKTRAQPKVPKVS  424



>ref|XP_004494170.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2 
[Cicer arietinum]
 ref|XP_004494171.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X3 
[Cicer arietinum]
Length=427

 Score =   140 bits (354),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 153/267 (57%), Gaps = 26/267 (10%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAP----TY  195
            RQ TFGEMTLEDFLV+AGVVREQ +   P         AAA+  +      + P    T 
Sbjct  156  RQPTFGEMTLEDFLVKAGVVREQQSVMQPAALAVAPTVAAAVSSHRPQHYTVYPNNNSTM  215

Query  196  VARP-VMGLGGGG---AVPAYQALPQGGVVAEAP------GYPKR---GGGYAQPSPPVY  336
             A+     +GGG      P YQ + QGG     P      G  KR   G GY  P    Y
Sbjct  216  AAQAGSFAIGGGTGNVVAPPYQTVAQGGGAVGEPSGSGYVGNGKRDNIGTGYPPPPGVCY  275

Query  337  GGRMGNGSAVGYAHM--QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
            GGR+ NG   GY     Q +G+G PVSPVS DG+    G D     +G+D     G    
Sbjct  276  GGRVVNGGGGGYGVAVAQTMGMGGPVSPVSSDGI----GNDNSGGKFGIDMSGLRGRKRM  331

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVE+VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ LKQAL E
Sbjct  332  IDG---PVERVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSQLKQALTE  388

Query  691  MDRKRKQEAFEEVKPTTPTKAQKASKK  771
            ++R+R+Q+  EE      TKAQKA +K
Sbjct  389  LERRRRQQCSEETNVRVQTKAQKAKEK  415



>ref|XP_004494169.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1 
[Cicer arietinum]
Length=447

 Score =   140 bits (354),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 153/267 (57%), Gaps = 26/267 (10%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAP----TY  195
            RQ TFGEMTLEDFLV+AGVVREQ +   P         AAA+  +      + P    T 
Sbjct  176  RQPTFGEMTLEDFLVKAGVVREQQSVMQPAALAVAPTVAAAVSSHRPQHYTVYPNNNSTM  235

Query  196  VARP-VMGLGGGG---AVPAYQALPQGGVVAEAP------GYPKR---GGGYAQPSPPVY  336
             A+     +GGG      P YQ + QGG     P      G  KR   G GY  P    Y
Sbjct  236  AAQAGSFAIGGGTGNVVAPPYQTVAQGGGAVGEPSGSGYVGNGKRDNIGTGYPPPPGVCY  295

Query  337  GGRMGNGSAVGYAHM--QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
            GGR+ NG   GY     Q +G+G PVSPVS DG+    G D     +G+D     G    
Sbjct  296  GGRVVNGGGGGYGVAVAQTMGMGGPVSPVSSDGI----GNDNSGGKFGIDMSGLRGRKRM  351

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVE+VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN+ LKQAL E
Sbjct  352  IDG---PVERVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENSQLKQALTE  408

Query  691  MDRKRKQEAFEEVKPTTPTKAQKASKK  771
            ++R+R+Q+  EE      TKAQKA +K
Sbjct  409  LERRRRQQCSEETNVRVQTKAQKAKEK  435



>ref|XP_006836037.1| hypothetical protein AMTR_s00114p00031980 [Amborella trichopoda]
 gb|ERM98890.1| hypothetical protein AMTR_s00114p00031980 [Amborella trichopoda]
Length=386

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 143/254 (56%), Gaps = 53/254 (21%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYV-  198
            + RQ TFGEMTLEDFLV+AGVVR+ G  +                          PTY  
Sbjct  151  STRQPTFGEMTLEDFLVKAGVVRDGGAPSGGN-----------------------PTYEY  187

Query  199  -----ARP----VMGLG----GGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYG  339
                  RP    V+G+G    GG ++       Q  VV E  GY KRG G         G
Sbjct  188  PSGQGERPGFGHVIGMGYNGNGGFSLSNSNHHQQSMVVGEGGGYGKRGIGGL-----CMG  242

Query  340  GRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
            GRMGNG         GL +GSPVSP+S +G+C    G GG   YG      G  GGRKR+
Sbjct  243  GRMGNG---------GLCIGSPVSPLSSEGMCAV--GTGGGVEYGGGEMGGGMRGGRKRV  291

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
            +D PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA L++  +E   
Sbjct  292  LDAPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAKLRKQQEEATE  351

Query  700  KRKQEAFEEVKPTT  741
            KR+++  E +  T 
Sbjct  352  KRRKKLLETLATTN  365



>ref|XP_010101577.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Morus notabilis]
 gb|EXB88716.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Morus notabilis]
Length=426

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 100/158 (63%), Gaps = 15/158 (9%)
 Frame = +1

Query  331  VYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggr  510
             Y GR  NG       +Q LGL +PVSPVS DG+C +   D G+Q +GLD     G    
Sbjct  283  CYSGRAVNGGGGY-GGVQSLGLAAPVSPVSSDGICASQVDDAGSQ-FGLDIRALRGRKRI  340

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL+EEN  LKQAL  
Sbjct  341  IDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENTHLKQAL--  395

Query  691  MDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
                     FEE+K    TK+ K  +KLR+ RR LS P
Sbjct  396  --------YFEEMKMKVQTKSYKGKEKLRVFRRNLSCP  425



>ref|XP_007027726.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 5 [Theobroma cacao]
 gb|EOY08228.1| Basic-leucine zipper transcription factor family protein, putative 
isoform 5 [Theobroma cacao]
Length=374

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 120/205 (59%), Gaps = 20/205 (10%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGV REQ    APPP    QY       N        P +V+RP
Sbjct  161  RQPTFGEMTLEDFLIKAGV-REQCMLPAPPPQHQPQYGLYQSGNNAAG----GPGFVSRP  215

Query  208  VMGLG--GGGAVPAYQALPQGGVVAEAPGY---PKRGGGYAQPSPP----VYGGRMGNGS  360
            +MG+   GG    AYQ +P GGV+ ++ GY    KRG GY   +PP     Y G++   +
Sbjct  216  IMGVDSKGGFGGSAYQTMPPGGVIGDSSGYVNDCKRGSGYQPTAPPPTTVCYSGKVA--A  273

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
            A  Y   Q +G+ SP+SPVS +G+C N   D    H+G+D G   G          P+EK
Sbjct  274  AGAYVRGQAMGVVSPMSPVSSEGMC-NSQVDNAANHFGMDMGGLRGRKRIIEG---PIEK  329

Query  541  VVERRQRRMIKNRESAARSRARKQA  615
            VVERRQRRMIKNRESAARSRARKQ 
Sbjct  330  VVERRQRRMIKNRESAARSRARKQT  354



>ref|XP_010554860.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Tarenaya hassleriana]
Length=414

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 112/179 (63%), Gaps = 13/179 (7%)
 Frame = +1

Query  295  KRGGGYAQPSPP----VYGGRMGNGSAVG-----YAHMQGLGLGSPVSPVSPDGLCVNPG  447
            K GGGY Q  P      YGGR+   ++ G     Y   Q +    P+SP+S DGL     
Sbjct  239  KTGGGYPQAMPTQPGVCYGGRVPTATSGGGGAGGYVPGQQVATVGPLSPISSDGLGHGQV  298

Query  448  GDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVE  627
             + GNQ +G+D     G          PVEKVVERRQRRMIKNRESAARSRARKQAYTVE
Sbjct  299  DNMGNQ-FGVDMSPLRGRKRIVDG---PVEKVVERRQRRMIKNRESAARSRARKQAYTVE  354

Query  628  LEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            LEAELNQLKEENA LK AL E++ K KQ+  E ++  T +K+QKA+ +LR LRR  S P
Sbjct  355  LEAELNQLKEENAQLKHALVELEGKMKQQYSEAMETETLSKSQKAAGRLRTLRRNSSCP  413



>ref|XP_009371918.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Pyrus 
x bretschneideri]
Length=372

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 135/269 (50%), Gaps = 59/269 (22%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQ T GE+TLEDFLV+AGVV+E               + +           I      R
Sbjct  154  QRQQTIGEITLEDFLVKAGVVQE-------------SPSKSKPSEKRVANTPIQQHCGNR  200

Query  205  PVMGLGGGGAVPAYQAL-PQGGVVAE---APGYPKRGGGYAQPSPPVYGGRMGNGSAVGY  372
                 G GG V A   L PQ  + +E     GYP  G  Y     P++G           
Sbjct  201  FDADFGIGGQVFASAFLSPQNVMESELFSGNGYPI-GTTY-----PMFG-----------  243

Query  373  AHMQGLGLGSPVSPVSPDGLC-----VNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
               Q +G  S  S +     C      + GG   N+   +D               GP+E
Sbjct  244  --TQSMGESSCFSDIEK---CHSLPESSSGGGSKNKKRIID---------------GPLE  283

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
             VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LKQ++DE +++RKQE 
Sbjct  284  VVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTKLKQSVDESEKRRKQEG  343

Query  718  FEEVKPTTPTKAQKASKKlrllrrTLSWP  804
                +    T+AQK ++KLR +RR +S P
Sbjct  344  LRRKEIKQSTRAQKLAEKLRTMRRAVSLP  372



>ref|XP_006410797.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
 ref|XP_006410798.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
 gb|ESQ52250.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
 gb|ESQ52251.1| hypothetical protein EUTSA_v10016668mg [Eutrema salsugineum]
Length=439

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 86/121 (71%), Gaps = 4/121 (3%)
 Frame = +1

Query  403  PVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNRE  582
            P+SPVS DGL      + G+Q YG+D G   G          PVEKVVERRQRRMIKNRE
Sbjct  309  PLSPVSSDGLGHGQVDNIGSQ-YGVDMGGLRGRKRVVDG---PVEKVVERRQRRMIKNRE  364

Query  583  SAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPTKAQKA  762
            SAARSRARKQAYTVELEAELNQLKEENA LK AL E++RKRKQ+ FE +K     K  KA
Sbjct  365  SAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKRKQQYFESLKTRAQPKLPKA  424

Query  763  S  765
            S
Sbjct  425  S  425



>ref|XP_009364307.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Pyrus 
x bretschneideri]
Length=372

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 134/269 (50%), Gaps = 59/269 (22%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQ T GE+TLEDFLV+AGVV+E               + +           I      R
Sbjct  154  QRQQTIGEITLEDFLVKAGVVQE-------------SPSKSKPSEKRVANTPIQQHCGNR  200

Query  205  PVMGLGGGGAVPAYQAL-PQGGVVAEA---PGYPKRGGGYAQPSPPVYGGRMGNGSAVGY  372
                 G GG V A   L PQ  + +E     GYP  G  Y     P++G           
Sbjct  201  FDADFGIGGQVFASAFLSPQNVMESELFSGNGYPI-GTTY-----PMFG-----------  243

Query  373  AHMQGLGLGSPVSPVSPDGLC-----VNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
               Q +G  S  S +     C      + GG   N+   +D               GP E
Sbjct  244  --TQSMGESSCFSDIEK---CHSLPESSSGGGAKNKKRIID---------------GPPE  283

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
             VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LKQ++DE +++RKQE 
Sbjct  284  VVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTRLKQSVDESEKRRKQEV  343

Query  718  FEEVKPTTPTKAQKASKKlrllrrTLSWP  804
                +    T+AQK ++KLR +RR +S P
Sbjct  344  LRRKEIKQSTRAQKLAEKLRTMRRAVSLP  372



>ref|XP_008383939.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Malus 
domestica]
 ref|XP_008383940.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Malus 
domestica]
Length=372

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 137/274 (50%), Gaps = 69/274 (25%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA-  201
            QRQ T GE+TLEDFLV+AGVV+E                  +   +  +   +A T +  
Sbjct  154  QRQQTIGEITLEDFLVKAGVVQE------------------SPSKSKPSEKRVASTPIQL  195

Query  202  ----RPVMGLGGGGAVPAYQAL-PQGGVVAEA---PGYPKRGGGYAQPSPPVYGGRMGNG  357
                R     G GG V A   L PQ  +  E     GYP  G  Y     P++G      
Sbjct  196  HCGNRFDADFGIGGQVFASAFLNPQNAMENELFSGNGYPI-GTTY-----PMFG------  243

Query  358  SAVGYAHMQGLGLGSPVSPVSPDGLC-----VNPGGDGGNQHYGLDTgirgggggrkrii  522
                    Q +G    +S +     C      + GG   N+   +D              
Sbjct  244  -------TQSMGESFCLSDIEK---CHSLPESSSGGGAKNKKRIID--------------  279

Query  523  dgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRK  702
             GP E VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LKQ++DE +++
Sbjct  280  -GPPEVVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTRLKQSVDESEKR  338

Query  703  RKQEAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            RKQE     +    T+AQK ++KLR +RR +S P
Sbjct  339  RKQEVLRRKEIKQSTRAQKLAEKLRTMRRAVSLP  372



>gb|KCW89189.1| hypothetical protein EUGRSUZ_A01499 [Eucalyptus grandis]
Length=383

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 125/227 (55%), Gaps = 22/227 (10%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            T RQ TFGEMTLEDFL++AGVVREQ       P           +       +I P +V 
Sbjct  164  TPRQPTFGEMTLEDFLIKAGVVREQ-----HMPHPQPTQPPEQPFGMYPNNLSIGPGFVP  218

Query  202  RPVMGLGGGGA--VPAYQALPQGGVVAEAPGYP---KRGGGYA-QPSPPVYGGRMGNGSA  363
            RP+MG+GG  A  VP YQ  P    + E   Y    KR GGY   P P  YG R+GNGS 
Sbjct  219  RPIMGMGGAAANAVP-YQ--PMAAAIGEPSVYQANGKRNGGYVPAPMPVSYGQRVGNGSG  275

Query  364  VGYAHMQGLG-LGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
             G         +G PVSPVS DG+C  P  + G Q +G+D G   GG  R      PV+K
Sbjct  276  GGAYGAGQAMGMGLPVSPVSSDGMCGAPVENSGGQ-FGMDMGGARGGRKRIIDG--PVDK  332

Query  541  VVERRQRRMIKNRESAARSRARKQA---YTVE-LEAELNQLKEENAS  669
            VVERRQRRMIKNRESAARSRARKQ    Y  E L   L Q KE NAS
Sbjct  333  VVERRQRRMIKNRESAARSRARKQVQVLYQFEVLFWVLPQNKEVNAS  379



>ref|XP_009411951.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411952.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411953.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411954.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411955.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411956.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 131/251 (52%), Gaps = 28/251 (11%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ TFGEMTLEDFL++AGVVRE      P    P Q   A             P   A  
Sbjct  174  RQPTFGEMTLEDFLIKAGVVREGYGGGPPGAPSPHQQPVA------------PPPAPAAQ  221

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQG  387
              G+ G G V           +  A G     GGY+  +   +GGR+GNG      +   
Sbjct  222  QYGMAGFGHVVGMAGYVDEQGLGSAAGVGN--GGYSVGNG--FGGRVGNG------YAAA  271

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTg---irgggggrkriidgPVEKVVERRQ  558
              +GSP SPVS +G+    GG   N   G       + GGGG ++      V+KVVERRQ
Sbjct  272  AAVGSPASPVSSEGIG---GGQVDNTVAGYVADGPRVGGGGGRKRPTDGAAVDKVVERRQ  328

Query  559  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPT  738
            RRMIKNRESAARSRARKQAYTVELEAELNQLKE+NA L++    +   RKQ   E +   
Sbjct  329  RRMIKNRESAARSRARKQAYTVELEAELNQLKEDNARLREEQGRVMALRKQLLLESMSEQ  388

Query  739  TPTKAQKASKK  771
                 QKA++K
Sbjct  389  ARINVQKAARK  399



>gb|EYU38630.1| hypothetical protein MIMGU_mgv1a006763mg [Erythranthe guttata]
Length=432

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +1

Query  400  SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNR  579
            SPVSP S DG   N    G    YGL+ G    G  R      PVEKVVERRQRRMIKNR
Sbjct  299  SPVSPASSDGFGANQMDSG----YGLEMGGARSGRKRIIDG--PVEKVVERRQRRMIKNR  352

Query  580  ESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPTKAQK  759
            ESAARSRARKQAYTVELEAELNQLKEEN  L+Q+L E++RKRKQ+ +EE +     + Q 
Sbjct  353  ESAARSRARKQAYTVELEAELNQLKEENEHLQQSLAELERKRKQQYYEEEEARKKARGQS  412

Query  760  ASKK  771
             S +
Sbjct  413  KSSR  416



>ref|XP_010089831.1| ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Morus notabilis]
 gb|EXB38447.1| ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Morus notabilis]
Length=383

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 128/254 (50%), Gaps = 49/254 (19%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQ T GEMTLEDFLV+AGVV+E  +  +                            V  
Sbjct  162  QRQQTLGEMTLEDFLVKAGVVQESPSEGSSQNKT-----------------------VTF  198

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
             V     G A        + G++    G+  R               +GNG+  G+A  Q
Sbjct  199  LVEDQSAGKA--------ENGILDSCSGFSTR-------QSVDQNHFLGNGTCSGFAAYQ  243

Query  385  -----GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVE  549
                 G+ +G  V      G   + G  G     GL T   G   G+KRIIDGP E VVE
Sbjct  244  VHGQSGVLVGQQVCNNVNSGASTSVGEKGN----GL-TETGGTKTGKKRIIDGPPEVVVE  298

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LKQ + E++ KRK+E   + 
Sbjct  299  RRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENEKLKQIMAEIELKRKREVLMKR  358

Query  730  KPTTPTKAQKASKK  771
            K  + TKAQ  ++K
Sbjct  359  KQCS-TKAQNMAEK  371



>gb|AGZ05627.1| abscisic acid-insensitive 5 [Gladiolus hybrid cultivar]
Length=406

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 131/245 (53%), Gaps = 31/245 (13%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +R+ T GEMTLEDFL++AGVVREQ   A  PP    +  +              P + A 
Sbjct  156  ERKATMGEMTLEDFLIKAGVVREQHVPAPIPPPPVDESPSPRSVVQ-------PPPHSAM  208

Query  205  PVMGLGGGGAVPAYQALPQGGVV---AEAPGYP-----KRGGGYAQPSPPVYGGRMGNGS  360
            P+        +    A   GG +   A APG+      ++     Q     YGG + NG+
Sbjct  209  PLQHNFYPSPMNGVNANLDGGYMMAPAAAPGFDYSQQSQQQQQQQQQMTECYGGPV-NGN  267

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGL----DTgirgggggrkriidg  528
            +        L LGSPVSPVS DG      G G  ++ GL    +TG  G   GRKR  DG
Sbjct  268  SYQ------LRLGSPVSPVSSDGF-----GSGHVENVGLTGSAETGNGGAKNGRKRSADG  316

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
             VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA L+         RK
Sbjct  317  GVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNMLKEENACLRADERRTKATRK  376

Query  709  QEAFE  723
            Q   E
Sbjct  377  QVILE  381



>ref|XP_008228533.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Prunus 
mume]
Length=380

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 131/268 (49%), Gaps = 52/268 (19%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            Q Q T GE+TLEDFLV+AGVV+E                  ++  +      +  T + +
Sbjct  156  QHQQTIGEITLEDFLVKAGVVQE------------------SLSESKPPLKRMESTLIQQ  197

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVG--YAH  378
                   G  +        G       G    G G+      V     GNG A+G  Y  
Sbjct  198  QCGDTNTGNEISTCLDASFG------IGRQLFGAGFFNLQNDVPSNLSGNGYAIGATYPM  251

Query  379  MQGLGLGSPVSPVSPDGLC-----VNPGGDGGNQHYGLDTgirgggggrkriidgPVEKV  543
            +  + +G P S VS    C      + GG   N+   +D               GP E V
Sbjct  252  LGNVIVGEP-SCVSAIEKCHSLPESSSGGGAKNKKRIID---------------GPPEVV  295

Query  544  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  LKQ++ E ++KRKQE   
Sbjct  296  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTKLKQSVAESEQKRKQELLG  355

Query  724  EVKPTTPTKAQKASKKlrll--rrTLSW  801
            + +    T+AQK + KLR +    +L+W
Sbjct  356  KKQ---STRAQKLAGKLRTMRRAVSLAW  380



>ref|XP_006481876.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Citrus sinensis]
Length=537

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL EM+RK+K
Sbjct  459  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKK  518

Query  709  QE  714
            Q+
Sbjct  519  QQ  520



>gb|AEK86263.1| ABI5-like protein [Pinus taeda]
Length=152

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 97/151 (64%), Gaps = 28/151 (19%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGL--------CVNP---GGDGGNQHYGLDTgirgggggrkriidgP  531
             +G GSP SP+S DG+         ++P   G DGG +             GRKR ++GP
Sbjct  18   AIGAGSPTSPLSSDGVGPSHVDNPTISPVPYGMDGGMR-------------GRKRCLEGP  64

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+NQLKEEN  LK+   EM  +RK+
Sbjct  65   VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVNQLKEENTKLKKQQAEMAERRKK  124

Query  712  EAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            +  E + P     A++   K R LRRTL+ P
Sbjct  125  QILEVMAPV----AKQLGTKTRALRRTLTGP  151



>gb|AFN25692.1| ABI5 protein, partial [Pyrus pyrifolia]
Length=196

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 110/201 (55%), Gaps = 20/201 (10%)
 Frame = +1

Query  46   EMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARPVMGLGG  225
            EMTLEDFLV+AGVVREQ ++ A     PQ           N   A+ P++V RPVMG+G 
Sbjct  1    EMTLEDFLVKAGVVREQ-DSMAATVVPPQPQQQQQYGMYQNGNQAVVPSFVNRPVMGMGA  59

Query  226  GGA--------VPAYQALPQGG--VVAEAPGYP---KRGGGYAQPSPP--VYGGRMGNGS  360
             GA        +P YQ +PQ G  VV E+  Y    KR G Y    PP  V  G      
Sbjct  60   AGAADTSTAAVIPNYQTIPQCGSAVVGESSAYAANAKRNGAYPTVPPPQSVCFGGRVVNG  119

Query  361  AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEK  540
              GYA  Q +G+ +PVSPVS DG+  +   + G Q +GL+ G   G           VEK
Sbjct  120  GGGYAAGQTIGMVAPVSPVSSDGMGTSQVENSGGQ-FGLEMGGLRGRKRGLDGA---VEK  175

Query  541  VVERRQRRMIKNRESAARSRA  603
            VVERRQRRMIKNRESAARSRA
Sbjct  176  VVERRQRRMIKNRESAARSRA  196



>gb|EPS62571.1| hypothetical protein M569_12220, partial [Genlisea aurea]
Length=271

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 79/99 (80%), Gaps = 11/99 (11%)
 Frame = +1

Query  391  GLGSPVSPVSPDGLCVNPGG-DGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRM  567
            G GSPVSP S DG   NP   DGGNQ +G         GGRKR++DGPVEKVVERRQRRM
Sbjct  178  GNGSPVSPASSDG--PNPNQIDGGNQ-FG-------SRGGRKRVLDGPVEKVVERRQRRM  227

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
            IKNRESAARSRARKQAYTVELEAELNQLKEENA LKQAL
Sbjct  228  IKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQAL  266



>gb|AFN84601.1| abscisic acid responsive elements-binding factor 2 [Eutrema salsugineum]
Length=396

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 107/245 (44%), Positives = 132/245 (54%), Gaps = 27/245 (11%)
 Frame = +1

Query  37   TFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaI--------APT  192
            T GE+TLE+FLVRAGVVRE+   AA          A A +    +P  +          T
Sbjct  140  TLGEVTLEEFLVRAGVVREEAQVAAKDKDGYFGNDANAGFSVQASPRVVPGLMENLGVET  199

Query  193  YVARPVMG----LGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQ-PSPPVYGGRMGNG  357
                 V G    L   GA   YQ  P   ++ + PG+   G   AQ  SP V GG MG G
Sbjct  200  ANHLQVQGSSLPLNVNGARSTYQQQP---ILPKQPGF-GYGTQIAQLNSPVVRGGLMGLG  255

Query  358  S---AVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg  528
                      +QG+G  SPV+P+S DG+    G + G+      +     GG R R   G
Sbjct  256  DQPLTNNMGFVQGVGAVSPVTPLSSDGI----GKNNGDSSSLSPSPYMFNGGVRGRKSGG  311

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDR  699
             VEKVVERRQ+RMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM +
Sbjct  312  TVEKVVERRQKRMIKNRESAARSRARKQAYTVELEAEIAKLKEENDELQRKQAKIIEMQK  371

Query  700  KRKQE  714
             ++ E
Sbjct  372  NQEME  376



>ref|XP_010907582.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Elaeis guineensis]
 ref|XP_010907583.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Elaeis guineensis]
 ref|XP_010907584.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Elaeis guineensis]
Length=398

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +1

Query  334  YGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrk  513
            +GGR+GNG    Y  +  +G GSP SP S +G+     G G  ++ G   G  GG GGRK
Sbjct  254  FGGRVGNG----YGAVAAVG-GSPASPGSSEGV-----GGGQVENSGAAEGGGGGKGGRK  303

Query  514  riidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEM  693
            R +DG VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK+A  +M
Sbjct  304  RPLDGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENARLKEAEKKM  363

Query  694  DRKRKQEAFEEVKPTTPTKAQK  759
               +KQ   E +       AQK
Sbjct  364  LALKKQLLMEAMAERARVNAQK  385



>ref|XP_011019902.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 [Populus euphratica]
Length=374

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 99/139 (71%), Gaps = 6/139 (4%)
 Frame = +1

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRM  567
            LG+ +P+SP S DG+  N   + GNQ +G+D G RG           PVE+VVERRQRRM
Sbjct  241  LGMVAPLSPASSDGMVTN-FDNSGNQ-FGMDIGGRGRKRIIDG----PVERVVERRQRRM  294

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPT  747
            IKNRESAARSRARKQAYTVELEAELNQLKEEN  LK  L E++RKRKQ+ FEE +    T
Sbjct  295  IKNRESAARSRARKQAYTVELEAELNQLKEENKQLKHDLAELERKRKQQYFEESRMKART  354

Query  748  KAQKASKKlrllrrTLSWP  804
            KA K  +KLRL RR+ S P
Sbjct  355  KAHKTKEKLRLARRSSSCP  373



>ref|XP_009123529.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Brassica rapa]
 ref|XP_009123530.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Brassica rapa]
 ref|XP_009123531.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Brassica rapa]
Length=372

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 121/239 (51%), Gaps = 27/239 (11%)
 Frame = +1

Query  43   GEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARPVMG--  216
            GE+TLE+FLVRAGVVRE+   AA          A+            A T     V G  
Sbjct  130  GEVTLEEFLVRAGVVREEAQIAAKDANTGFSVQASPQVVPGLMGNLGAETVNHMQVQGSS  189

Query  217  --LGGGGAVPAYQALPQGGVVAEAPGYPKR-GGGY-AQPSPPVYGGRMGNGSAVGYAHM-  381
              L   GA   YQ           P  PK+ G GY     P + GG MG G      +M 
Sbjct  190  LPLNVNGARSTYQQ--------HQPIMPKQPGFGYGTHVGPGIRGGLMGLGDQSLTNNMG  241

Query  382  --QGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVER  552
              QG+ G  SPV+PVS DG+  N G           +       G +    G VEKVVER
Sbjct  242  LVQGVVGAVSPVTPVSADGIGKNNGDSSS------LSPSPYMFNGVRGRKSGTVEKVVER  295

Query  553  RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRKRKQEAF  720
            RQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM + ++ E  
Sbjct  296  RQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENQELQRKQAKIMEMQKNQEMEMM  354



>ref|XP_009123528.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Brassica rapa]
Length=387

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 121/239 (51%), Gaps = 27/239 (11%)
 Frame = +1

Query  43   GEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARPVMG--  216
            GE+TLE+FLVRAGVVRE+   AA          A+            A T     V G  
Sbjct  145  GEVTLEEFLVRAGVVREEAQIAAKDANTGFSVQASPQVVPGLMGNLGAETVNHMQVQGSS  204

Query  217  --LGGGGAVPAYQALPQGGVVAEAPGYPKR-GGGY-AQPSPPVYGGRMGNGSAVGYAHM-  381
              L   GA   YQ           P  PK+ G GY     P + GG MG G      +M 
Sbjct  205  LPLNVNGARSTYQQ--------HQPIMPKQPGFGYGTHVGPGIRGGLMGLGDQSLTNNMG  256

Query  382  --QGL-GLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVER  552
              QG+ G  SPV+PVS DG+  N G           +       G +    G VEKVVER
Sbjct  257  LVQGVVGAVSPVTPVSADGIGKNNGDSSS------LSPSPYMFNGVRGRKSGTVEKVVER  310

Query  553  RQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRKRKQEAF  720
            RQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM + ++ E  
Sbjct  311  RQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENQELQRKQAKIMEMQKNQEMEMM  369



>ref|NP_001044866.1| Os01g0859300 [Oryza sativa Japonica Group]
 dbj|BAF06780.1| Os01g0859300, partial [Oryza sativa Japonica Group]
Length=323

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 108/241 (45%), Gaps = 49/241 (20%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQ--GntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            RQVT GEMTLEDFLV+AGVVR    G  A                        + P    
Sbjct  100  RQVTLGEMTLEDFLVKAGVVRGSFTGQAAMGSGMVNGPVNPMQQGQGGPMMFPVGPVNAM  159

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGY-----AQPSPPVYGGRMGNGSAV  366
             PVMG G                     GYP   GGY       P PP  G  +      
Sbjct  160  YPVMGDG--------------------MGYP---GGYNGMAIVPPPPPAQGAMV------  190

Query  367  GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
                         VSP S DG+      D  N   G    I  G   R    DG  EK V
Sbjct  191  ------------VVSPGSSDGMSAMTHADMMN-CIGNGMMIENGTRKRPHREDGCAEKTV  237

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELN LK+ENA LK+A   +   +KQ   E+
Sbjct  238  ERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEAEKTVLLTKKQMLVEK  297

Query  727  V  729
            +
Sbjct  298  M  298



>ref|XP_011000915.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform 
X1 [Populus euphratica]
 ref|XP_011000916.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform 
X1 [Populus euphratica]
Length=351

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEENA LKQ ++E++ KRK
Sbjct  261  PPEVVVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENAKLKQIVEEIEEKRK  320

Query  709  QEAFEEVKPTTPTKAQKASKKlrllrrTLSW  801
            QE          T+ +    +      +L+W
Sbjct  321  QEVMRRKSSKMTTQKKDDKLRGIRRTVSLAW  351



>emb|CCE88374.1| abscisic acid responsive elements-binding factor 2 [Brassica 
napus]
 emb|CCE88375.1| abscisic acid responsive elements-binding factor 2 [Brassica 
napus]
Length=373

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 123/242 (51%), Gaps = 33/242 (14%)
 Frame = +1

Query  43   GEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARPVMG--  216
            GE+TLE+FLVRAGVVRE+   AA          A+            A T     V G  
Sbjct  131  GEVTLEEFLVRAGVVREEAQIAAKDANTGFSVQASPQVVPGLMGNLGAETVNHMQVQGSS  190

Query  217  --LGGGGAVPAYQALPQGGVVAEAPGYPKR-GGGY-AQPSPPVYGGRMGNGSAVGYAHM-  381
              L   GA   YQ           P  PK+ G GY     P + GG MG G      +M 
Sbjct  191  LPLNVNGARSTYQQ--------HQPIMPKQPGFGYGTHVGPGIRGGLMGLGDQSLTNNMG  242

Query  382  --QGL-GLGSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKV  543
              QG+ G  SPV+PVS DG+     GD  +     Y  +        G +    G VEKV
Sbjct  243  LVQGVVGAVSPVTPVSADGIG-KTNGDSSSLSPSPYMFN--------GVRGRKSGTVEKV  293

Query  544  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRKRKQE  714
            VERRQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM + ++ E
Sbjct  294  VERRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENQELQRKQAKIMEMQKNQEME  353

Query  715  AF  720
              
Sbjct  354  MM  355



>gb|AGY78337.1| hypothetical protein [Setaria italica]
Length=399

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 101/261 (39%), Positives = 117/261 (45%), Gaps = 79/261 (30%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQVT GEMTLEDFLV+AGVVR                                       
Sbjct  176  RQVTLGEMTLEDFLVKAGVVRG--------------------------------------  197

Query  208  VMGLGGG-----GAVPA--YQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMG--NGS  360
                 GG     G VPA     + Q G +A  P   +     A    PV G  MG  NG 
Sbjct  198  --AFAGGHGQAVGMVPAGPMGHMQQQGQLAATPMMYQVAPANAAAVYPVMGDGMGYHNGY  255

Query  361  AVGYAHMQ----GLGLGSPVSPVSPDGL----------CVNPGG---DGGNQHYGLDTgi  489
            A G A +        +   VSP S DG+          C+  GG   +GG+     D+  
Sbjct  256  AGGMAVVPPPPPSQCVAPAVSPGSSDGMSAMTQAEMMSCIGNGGMVRNGGSNARKRDSPE  315

Query  490  rgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAS  669
             G             EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA 
Sbjct  316  DGC-----------TEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENAR  364

Query  670  LKQALDEMDRKRKQEAFEEVK  732
            LK   +E+  K  ++A E + 
Sbjct  365  LK--AEELVEKMMEQARENIN  383



>ref|XP_002308147.1| ABA insensitive 5 family protein [Populus trichocarpa]
 gb|EEE91670.1| ABA insensitive 5 family protein [Populus trichocarpa]
Length=373

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = +1

Query  400  SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNR  579
            +P+SP S DG+  N   + GNQ +G+D G  G           PVE+VVERRQRRMIKNR
Sbjct  244  APLSPASSDGMVTN-FDNSGNQ-FGMDIGGMGRKRIIDG----PVERVVERRQRRMIKNR  297

Query  580  ESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPTKAQK  759
            ESAARSRARKQAYTVELEAELNQLKEEN  LK  L E++RKRKQ+ FEE +    TKA K
Sbjct  298  ESAARSRARKQAYTVELEAELNQLKEENKQLKHDLAELERKRKQQYFEESRMKARTKAHK  357

Query  760  ASKKlrllrrTLSWP  804
              +KLRL RR+ S P
Sbjct  358  TKEKLRLTRRSSSCP  372



>ref|XP_003574628.1| PREDICTED: bZIP transcription factor TRAB1 [Brachypodium distachyon]
Length=353

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 97/251 (39%), Positives = 119/251 (47%), Gaps = 54/251 (22%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T GEMTLEDFLVRAGVVRE                           AA+ P   AR
Sbjct  124  KRQPTLGEMTLEDFLVRAGVVREN------------------PAAAAAVDAAVPPPLAAR  165

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
            P+  +  G           G   A A G+   G G   PS P     MGNG   G A   
Sbjct  166  PIQVVNNGSMFFENFGGANGASGASAMGFAPVGIG--DPSHPT----MGNGMMPGVA---  216

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgP-----------  531
            G+G+G+         + V P      Q   LD+  +  G     +   P           
Sbjct  217  GMGVGA---------VTVGPLDTSMGQ---LDSVGKVNGELSSPVEPVPYPFEGVIRGRR  264

Query  532  ----VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
                VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE+N  L++  +EM  
Sbjct  265  SGGHVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNEELQKKQEEMLE  324

Query  700  KRKQEAFEEVK  732
             +K +A E + 
Sbjct  325  MQKNKALEVIN  335



>dbj|BAB90559.1| putative ABA response element binding factor [Oryza sativa Japonica 
Group]
 dbj|BAB91752.1| putative ABA response element binding factor [Oryza sativa Japonica 
Group]
 gb|ABM90395.1| bZIP-type transcription factor ABI5 isoform 2 [Oryza sativa]
Length=388

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 116/247 (47%), Gaps = 61/247 (25%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQVT GEMTLEDFLV+AGVVR                       +    AA+    V  P
Sbjct  165  RQVTLGEMTLEDFLVKAGVVR----------------------GSFTGQAAMGSGMVNGP  202

Query  208  V--MGLGGGGAVPAYQALPQGGVVAEAP------GYPKRGGGY-----AQPSPPVYGGRM  348
            V  M  G GG +      P G V A  P      GYP   GGY       P PP  G  +
Sbjct  203  VNPMQQGQGGPM----MFPVGPVNAMYPVMGDGMGYP---GGYNGMAIVPPPPPAQGAMV  255

Query  349  GNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg  528
                               VSP S DG+      D  N   G    I  G   R    DG
Sbjct  256  ------------------VVSPGSSDGMSAMTHADMMN-CIGNGMMIENGTRKRPHREDG  296

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
              EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LK+ENA LK+A   +   +K
Sbjct  297  CAEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEAEKTVLLTKK  356

Query  709  QEAFEEV  729
            Q   E++
Sbjct  357  QMLVEKM  363



>gb|EEE55706.1| hypothetical protein OsJ_04142 [Oryza sativa Japonica Group]
Length=384

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 116/247 (47%), Gaps = 61/247 (25%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQVT GEMTLEDFLV+AGVVR                       +    AA+    V  P
Sbjct  161  RQVTLGEMTLEDFLVKAGVVR----------------------GSFTGQAAMGSGMVNGP  198

Query  208  V--MGLGGGGAVPAYQALPQGGVVAEAP------GYPKRGGGY-----AQPSPPVYGGRM  348
            V  M  G GG +      P G V A  P      GYP   GGY       P PP  G  +
Sbjct  199  VNPMQQGQGGPM----MFPVGPVNAMYPVMGDGMGYP---GGYNGMAIVPPPPPAQGAMV  251

Query  349  GNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg  528
                               VSP S DG+      D  N   G    I  G   R    DG
Sbjct  252  ------------------VVSPGSSDGMSAMTHADMMN-CIGNGMMIENGTRKRPHREDG  292

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
              EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LK+ENA LK+A   +   +K
Sbjct  293  CAEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEAEKTVLLTKK  352

Query  709  QEAFEEV  729
            Q   E++
Sbjct  353  QMLVEKM  359



>gb|KDP31558.1| hypothetical protein JCGZ_15213 [Jatropha curcas]
Length=369

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEENA LKQ ++E+++ RK
Sbjct  280  PPEVVVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENAKLKQLVEEIEQNRK  339

Query  709  QEAFEEVKPTTPTKAQKASK-KlrllrrTLSW  801
            +E       T P K  KA K +      +L+W
Sbjct  340  EEVLRRKPSTMPQK--KADKLRSIRRTVSLTW  369



>ref|XP_010046725.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Eucalyptus 
grandis]
Length=365

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ + E ++KR+
Sbjct  275  PPEIVVERRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENEKLKRIVAESEQKRR  334

Query  709  QEAFEEVKPTTPTKAQKASKKlrllrrTLS  798
            +E    +K   PTKA+KA++K +L+RRT S
Sbjct  335  KEMM--MKWKLPTKAEKAAEKFKLMRRTTS  362



>gb|EAZ00118.1| hypothetical protein OsI_22122 [Oryza sativa Indica Group]
Length=363

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 117/246 (48%), Gaps = 58/246 (24%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAP-TYVA  201
            QRQ T GEMTLE+FLVRAGVVRE                            A+ P + V 
Sbjct  125  QRQPTLGEMTLEEFLVRAGVVRED---------------MGQTIVLPPQAQALFPGSNVV  169

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
             P M L  G        LP  GVV+ APG        A  +P V  G            +
Sbjct  170  APAMQLANG-------MLP--GVVSVAPGAAAAMTVAAPATPVVLNG---------LGKV  211

Query  382  QGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            +G  L S +SPV                 Y  DT +R   G         VEKVVERRQR
Sbjct  212  EGGDLSS-LSPVP----------------YPFDTALRVRKGPT-------VEKVVERRQR  247

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTT  741
            RMIKNRESAARSRARKQAY +ELEAE+ +LKE+ A L++   EM +K+K E  E +    
Sbjct  248  RMIKNRESAARSRARKQAYIMELEAEVAKLKEQKAELQKKQVEMIQKQKDEVMERITQQL  307

Query  742  PTKAQK  759
              KA++
Sbjct  308  GPKAKR  313



>ref|XP_006645053.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Oryza brachyantha]
Length=387

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 116/241 (48%), Gaps = 35/241 (15%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQVT GEMTLEDFLV+AGVVR                       + +  A +A   V  P
Sbjct  164  RQVTLGEMTLEDFLVKAGVVR----------------------GSFSGQAPMAAGMVHGP  201

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQG  387
            V  +  G A P    +     +     YP  G G   P     GG   NG AV       
Sbjct  202  VNPMQQGQAGPMMFPMAPANTI-----YPVMGDGMGYP-----GGY--NGMAVVPPPPPA  249

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRM  567
             G  + +SP S DG+      D  N   G    I  G   R    DG  EK VERRQRRM
Sbjct  250  QGAIAALSPGSSDGMSAMTHADMMN-CIGNGMIIENGTRKRPHREDGCAEKTVERRQRRM  308

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPT  747
            IKNRESAARSRARKQAYTVELEAELN LK+ENA L+ A   +   +KQ   E++   +  
Sbjct  309  IKNRESAARSRARKQAYTVELEAELNYLKQENARLRDAEKTILLTKKQMLVEKMMEQSKE  368

Query  748  K  750
            K
Sbjct  369  K  369



>gb|EEC71844.1| hypothetical protein OsI_04509 [Oryza sativa Indica Group]
Length=384

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 109/241 (45%), Gaps = 49/241 (20%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQ--GntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            RQ+T GEMTLEDFLV+AGVVR    G  A                  +     + P    
Sbjct  161  RQLTLGEMTLEDFLVKAGVVRGSFTGQAAMGSGMVNGPVNPMQQGQGDPMMFPVGPVNAM  220

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGY-----AQPSPPVYGGRMGNGSAV  366
             PVMG G                     GYP   GGY       P PP  G  +      
Sbjct  221  YPVMGDG--------------------MGYP---GGYNGMAIVPPPPPAQGAMV------  251

Query  367  GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
                         VSP S DG+      D  N   G    I  G   R    DG  EK V
Sbjct  252  ------------VVSPGSSDGMSAMTHADMMN-CIGNGMMIENGTRKRPHREDGCAEKTV  298

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEE  726
            ERRQRRMIKNRESAARSRARKQAYTVELEAELN LK+ENA LK+A   +   +KQ   E+
Sbjct  299  ERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEAEKTVLLTKKQMLVEK  358

Query  727  V  729
            +
Sbjct  359  M  359



>ref|XP_004970655.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Setaria 
italica]
Length=409

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 108/242 (45%), Gaps = 77/242 (32%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQVT GEMTLEDFLV+AGVVR                                       
Sbjct  176  RQVTLGEMTLEDFLVKAGVVRG--------------------------------------  197

Query  208  VMGLGGG-----GAVPA--YQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMG--NGS  360
                 GG     G VPA     + Q G +A  P   +     A    PV G  MG  NG 
Sbjct  198  --AFAGGHGQAVGMVPAGPMGHMQQQGQLAATPMMYQVAPANAAAVYPVMGDGMGYHNGY  255

Query  361  AVGYAHMQ----GLGLGSPVSPVSPDGL----------CVNPGG---DGGNQHYGLDTgi  489
            A G A +        +   VSP S DG+          C+  GG   +GG+     D+  
Sbjct  256  AGGMAVVPPPPPSQCVAPAVSPGSSDGMSAMTQAEMMSCIGNGGMVRNGGSNARKRDSPE  315

Query  490  rgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAS  669
             G             EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA 
Sbjct  316  DGC-----------TEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENAR  364

Query  670  LK  675
            LK
Sbjct  365  LK  366



>gb|ABM90394.1| bZIP-type transcription factor ABI5 isoform 1 [Oryza sativa]
Length=378

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 118/248 (48%), Gaps = 63/248 (25%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQVT GEMTLEDFLV+AGVVR                       +    AA+    V  P
Sbjct  165  RQVTLGEMTLEDFLVKAGVVR----------------------GSFTGQAAMGSGMVNGP  202

Query  208  V--MGLGGGGAVPAYQALPQGGVVAEAP------GYPKRGGGY-----AQPSPPVYGGRM  348
            V  M  G GG +      P G V A  P      GYP   GGY       P PP  G  +
Sbjct  203  VNPMQQGQGGPM----MFPVGPVNAMYPVMGDGMGYP---GGYNGMAIVPPPPPAQGAMV  255

Query  349  GNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg  528
                               VSP S DG+      D  N   G    I  G   R    DG
Sbjct  256  ------------------VVSPGSSDGMSAMTHADMMN-CIGNGMMIENGTRKRPHREDG  296

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
              EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LK+ENA LK+A  E+  K  
Sbjct  297  CAEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEA--ELVEKMM  354

Query  709  QEAFEEVK  732
            +++ E++ 
Sbjct  355  EQSKEKMN  362



>gb|KHG27504.1| abscisic acid-insensitive 5-like protein 1 [Gossypium arboreum]
Length=391

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLK+ENA LKQ ++E ++KRK
Sbjct  300  PPEVVVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKQENAKLKQLVEENEQKRK  359

Query  709  QEAFEEVKPTTPTKAQKASK-KlrllrrTLSW  801
            QE  +  +   P + +   K +      +L W
Sbjct  360  QEVLKRKQSKLPAQRKVVDKMRTLRRTVSLGW  391



>ref|XP_007015839.1| Basic-leucine zipper transcription factor family protein, putative 
[Theobroma cacao]
 gb|EOY33458.1| Basic-leucine zipper transcription factor family protein, putative 
[Theobroma cacao]
Length=382

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLK+ENA LKQ ++E +++RK
Sbjct  293  PPEVVVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKQENAKLKQLVEENEQRRK  352

Query  709  QEAFEEVKPTTPTKAQKASKKlrllrrTLSW  801
            QE  +  K +T T+ +    +      +L W
Sbjct  353  QEVLKR-KQSTHTQRKVDRMRTLRRTVSLGW  382



>ref|XP_002964990.1| hypothetical protein SELMODRAFT_266892 [Selaginella moellendorffii]
 gb|EFJ33828.1| hypothetical protein SELMODRAFT_266892 [Selaginella moellendorffii]
Length=400

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 86/116 (74%), Gaps = 6/116 (5%)
 Frame = +1

Query  400  SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNR  579
            SP SP+S D L  N GG GG  +YG   G  G   GRKRI+D P+EK+VERRQRRMIKNR
Sbjct  274  SPGSPLS-DALDQN-GGYGGLSNYG--GGFDGPLRGRKRILDAPLEKIVERRQRRMIKNR  329

Query  580  ESAARSRARKQAYTVELEAELNQLKEENASLKQALDE--MDRKRKQEAFEEVKPTT  741
            ESAARSRARKQAYTVELEAE+ QLKEEN  L++  +E  + RK++Q+A E + P T
Sbjct  330  ESAARSRARKQAYTVELEAEVTQLKEENMKLRKMQEEENIKRKKQQQALEVITPMT  385



>ref|XP_002977062.1| hypothetical protein SELMODRAFT_443424 [Selaginella moellendorffii]
 gb|EFJ21671.1| hypothetical protein SELMODRAFT_443424 [Selaginella moellendorffii]
Length=463

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = +1

Query  400  SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNR  579
            SP SP+S D L  N GG GG  +YG   G  G   GRKRI+D P+EK+VERRQRRMIKNR
Sbjct  338  SPGSPLS-DALDQN-GGYGGLSNYG--GGFDGPLRGRKRILDAPLEKIVERRQRRMIKNR  393

Query  580  ESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKR-KQEAFEEVKPTT  741
            ESAARSRARKQAYTVELEAE+ QLKEEN  L++  +E + KR KQ+A E + P T
Sbjct  394  ESAARSRARKQAYTVELEAEVTQLKEENMKLRKMQEEENIKRKKQQALEVITPMT  448



>ref|XP_008458574.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform 
X3 [Cucumis melo]
Length=339

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VV+RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LKQ + E +R RK
Sbjct  250  PTEVVVQRRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENIKLKQIVAESERNRK  309

Query  709  QEAFE  723
            QE  +
Sbjct  310  QEIMQ  314



>ref|XP_008458575.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform 
X4 [Cucumis melo]
Length=324

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VV+RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LKQ + E +R RK
Sbjct  235  PTEVVVQRRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENIKLKQIVAESERNRK  294

Query  709  QEAFE  723
            QE  +
Sbjct  295  QEIMQ  299



>ref|NP_001183940.1| ABRE binding protein [Zea mays]
 gb|ADA70308.1| ABRE binding protein [Zea mays]
Length=385

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 114/253 (45%), Gaps = 58/253 (23%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            ++QVT  +MTLEDFLV+AGVVR  G  A                                
Sbjct  148  RQQVTLADMTLEDFLVKAGVVR--GAFA--------------------------------  173

Query  205  PVMGLGGGGAVPAYQALPQGGV-VAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHM  381
                 G G AV     +P G + + +    P      A P+P      MGNG+     + 
Sbjct  174  -----GHGHAVVGMAPIPAGRMGIQQQHAAPTMSYQVAAPAPNAVYPVMGNGTGYHNGYP  228

Query  382  QGLGLGSP-------VSPVSPDGL----------CVNPGGDGGNQHYGLDTgirgggggr  510
            + + +  P       VSP S DG+          C+   G G  ++YG   G        
Sbjct  229  RAIAVVPPSQCVTAAVSPGSSDGVSAMTQAEMMSCIGNEGAGTVRNYGGGGGGGSARKRD  288

Query  511  kriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDE  690
                    EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEEN  L+     
Sbjct  289  SPEDAC-TEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENDRLRAEQKT  347

Query  691  MDRKRKQEAFEEV  729
            +   +K++  E++
Sbjct  348  ILLSKKKKLVEKM  360



>ref|XP_008458572.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform 
X1 [Cucumis melo]
Length=405

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VV+RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LKQ + E +R RK
Sbjct  316  PTEVVVQRRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENIKLKQIVAESERNRK  375

Query  709  QEAFE  723
            QE  +
Sbjct  376  QEIMQ  380



>ref|XP_004162472.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1-like [Cucumis 
sativus]
Length=295

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VV+RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ + E +R RK
Sbjct  206  PTEVVVQRRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENIKLKEIVAESERNRK  265

Query  709  QEAFE  723
            QE  +
Sbjct  266  QEIMQ  270



>ref|XP_009402117.1| PREDICTED: bZIP transcription factor TRAB1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402119.1| PREDICTED: bZIP transcription factor TRAB1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402120.1| PREDICTED: bZIP transcription factor TRAB1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402121.1| PREDICTED: bZIP transcription factor TRAB1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402122.1| PREDICTED: bZIP transcription factor TRAB1-like [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 122/282 (43%), Gaps = 78/282 (28%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ T GEMTLE+FLVRAGV RE+                    P +      +  +   P
Sbjct  118  RQPTLGEMTLEEFLVRAGVAREE-----------LTPPPVHPRPADTKINTTSVFFGDLP  166

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGG-----------YAQPSPPVYGGRMGN  354
             +    G +V   +A    G VA AP  P                YA P P   G  MGN
Sbjct  167  TVSSSTGLSVGFNRANQSNGNVANAP-VPHSSAANFGMTVTAARSYAAPMPLETGVDMGN  225

Query  355  ------GSAVGYAH----------MQGLGL-------GSPVSPVSPDGL--------CVN  441
                  G  V +            M GLG        GSP + +SPD L         V+
Sbjct  226  PQGMRGGGLVSFGDAGMDNQLMKGMVGLGTAGVVTAKGSPATHLSPDVLGKANGDLSSVS  285

Query  442  PG------GDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRA  603
            P       G  G +H G                   VEKV+ERRQ+RMIKNRESAARSRA
Sbjct  286  PAPYTVNSGMRGRKHSG------------------AVEKVIERRQKRMIKNRESAARSRA  327

Query  604  RKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            RKQAYT+ELEAE+ +LKE+N  L++   EM    K +A + +
Sbjct  328  RKQAYTMELEAEVAKLKEQNQELQKKQAEMLEMEKNQALQMI  369



>ref|XP_002274428.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Vitis 
vinifera]
 ref|XP_010651900.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Vitis 
vinifera]
Length=348

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +E  VERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ + E +RKR++
Sbjct  260  LEMAVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENTKLKKIVAEAERKRRE  319

Query  712  EAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
            +  + ++    TKAQK +K+L+ LRRT+S P
Sbjct  320  K--QAIEGKEATKAQKIAKQLKKLRRTVSAP  348



>emb|CDY17109.1| BnaC06g00420D [Brassica napus]
Length=335

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 96/176 (55%), Gaps = 18/176 (10%)
 Frame = +1

Query  229  GAVPAYQALPQGGVV---AEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQGLGLG  399
            G V   + L + GVV   A+        G   Q SP V  G MGN  A    +M GL  G
Sbjct  148  GEVTLEEFLVRAGVVREEAQIAAKDANTGFSVQASPQVVPGLMGNLGAETSLNM-GLVQG  206

Query  400  ------SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
                  SPV+PVS DG+  N G         L        GG +    G VEKVVERRQR
Sbjct  207  VVGAAVSPVTPVSADGIGKNNG-----DSSSLSPSPYMFNGGVRGRKSGTVEKVVERRQR  261

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRKRKQEAF  720
            RMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM + ++ E  
Sbjct  262  RMIKNRESAARSRARKQAYTVELEAEVAKLKEENEELQRKQAKIMEMQKNQEMEMM  317



>ref|XP_004149281.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1-like [Cucumis 
sativus]
Length=339

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VV+RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ + E +R RK
Sbjct  250  PTEVVVQRRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENIKLKEIVAESERNRK  309

Query  709  QEAFE  723
            QE  +
Sbjct  310  QEIMQ  314



>gb|KGN46957.1| hypothetical protein Csa_6G152920 [Cucumis sativus]
Length=339

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VV+RRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ + E +R RK
Sbjct  250  PTEVVVQRRQRRMIKNRESAARSRARKQAYTVELEVELNQLKEENIKLKEIVAESERNRK  309

Query  709  QEAFE  723
            QE  +
Sbjct  310  QEIMQ  314



>ref|XP_002523794.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38520.1| conserved hypothetical protein [Ricinus communis]
Length=358

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEENA LK  ++E+++ RK
Sbjct  269  PPEVVVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENAKLKLLVEEIEQNRK  328

Query  709  QEAFEEVKPTTPTKAQKASKKlrllrrTLSW  801
            +E     KP    K +    +      +L+W
Sbjct  329  EEVLRR-KPLIMPKKKVDKLRSIRRTVSLTW  358



>ref|XP_010479095.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Camelina 
sativa]
Length=428

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 107/270 (40%), Positives = 128/270 (47%), Gaps = 55/270 (20%)
 Frame = +1

Query  37   TFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntp----aaIAPTYVAR  204
            T GE+TLE+FLVRAGVVRE+   AA         A       N          +P  VA 
Sbjct  149  TLGEVTLEEFLVRAGVVREEAEIAAKAQIAENNKAGYFGNDANMGFPVGFQQPSPRVVAA  208

Query  205  PVMG---------------LGGGGAVPAYQALPQG---GVVAEAPGYPKRGGGYAQP---  321
             VMG               L   GA   YQ  PQ     ++ + PG+     GY      
Sbjct  209  GVMGAENANPLQVQGSSLPLNVNGARSTYQQ-PQQLQPTIMPKQPGF-----GYGTQIGQ  262

Query  322  --SPPVYGG------------RMG--NGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGD  453
              SP + GG             MG  NG A       G+G  SPV+P+S +G+     G 
Sbjct  263  LNSPGIRGGGIMGFGYQSQTNNMGLVNGGAAAIPGAVGVGAVSPVTPLSSEGI-----GK  317

Query  454  GGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELE  633
                   L        GG +    G VEKVVERRQRRMIKNRESAARSRARKQAYTVELE
Sbjct  318  SNGDCSSLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELE  377

Query  634  AELNQLKEENASL--KQA-LDEMDRKRKQE  714
            AE+ +LKEEN  L  KQA + EM + ++ E
Sbjct  378  AEVAKLKEENDELQRKQAKIMEMQKNQEME  407



>dbj|BAJ94534.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 115/250 (46%), Gaps = 67/250 (27%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T G MTLE+FLVRAGVVRE                                     
Sbjct  134  ERQQTLGRMTLEEFLVRAGVVRED------------------------------------  157

Query  205  PVMGLGGGGAVPAY-QAL-PQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAH  378
              MG G    VPA  QAL PQG VVA                P +  G       VG   
Sbjct  158  --MG-GQTVVVPARAQALFPQGNVVA----------------PTMQVGNGVVHGVVGQGA  198

Query  379  MQGLGLGSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKVVE  549
               + + +P +P   +G     GGD  +     Y  DT  R   G         VEKVVE
Sbjct  199  GVPMTVAAPTTPGVLNGFGKMEGGDLSSLSPVPYPFDTVTRARKGPT-------VEKVVE  251

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            RRQRRMIKNRESAARSR RKQAY +ELEAE+ +LKE N +L++   EM +K+K E  E +
Sbjct  252  RRQRRMIKNRESAARSRQRKQAYIMELEAEVAKLKENNEALQKKQVEMLQKQKDEVIERI  311

Query  730  KPTTPTKAQK  759
            +     KA++
Sbjct  312  EKQLGPKAKR  321



>ref|XP_006393640.1| hypothetical protein EUTSA_v10011493mg [Eutrema salsugineum]
 gb|ESQ30926.1| hypothetical protein EUTSA_v10011493mg [Eutrema salsugineum]
Length=426

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 125/248 (50%), Gaps = 46/248 (19%)
 Frame = +1

Query  37   TFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaI--------APT  192
            T GE+TLE+FLVRAGVVRE+   AA          A A +    +P  +          T
Sbjct  183  TLGEVTLEEFLVRAGVVREEAQVAAKDKDGYFGNDANAGFSVQASPRVVPGLMENLGVET  242

Query  193  YVARPVMG----LGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQ-PSPPVYGGRMGNG  357
                 V G    L   GA   YQ  P   ++ + PG+   G   AQ  SP V GG MG G
Sbjct  243  ANHLQVQGSSLPLNVNGARSTYQQQP---ILPKQPGFGY-GTQIAQLNSPVVRGGLMGLG  298

Query  358  -----SAVGYAHMQGLGLGS-PVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
                 + +G+    G+G  +   S +SP     N GG  G +  G               
Sbjct  299  DQPLTNNMGFVQ-DGIGKNNGDSSSLSPSPYMFN-GGVRGRKSGG---------------  341

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDE  690
                VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + E
Sbjct  342  ---TVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEIAKLKEENDELQRKQAKIIE  398

Query  691  MDRKRKQE  714
            M + ++ E
Sbjct  399  MQKNQEME  406



>gb|KHG14558.1| abscisic acid-insensitive 5-like protein 4 [Gossypium arboreum]
Length=406

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 120/262 (46%), Gaps = 35/262 (13%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQ----GntaappparpqqyaaaamypnnntpaaIAPT  192
            QRQ T  EMTLE+FL RAGVVRE     G              A      N     ++  
Sbjct  138  QRQQTLREMTLEEFLGRAGVVREDMQPVGVPNNNGFFDNNSGLALQFQQTNGNNGFLSNN  197

Query  193  YVAR---PVMGLGGGGAVPAYQ------ALPQGGVVAEAPG--------YPKRG--GGYA  315
                   P++ L   GA  ++         P+   VA AP         +P  G  G   
Sbjct  198  NSVLNQPPILPLDVSGAKSSHSQQKQQPLFPKQQTVAFAPSMHLINTTHFPSPGARGSVV  257

Query  316  QPSPPVYGGRMGNGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirg  495
            + S       +   S +    M  +GL SP S +SPD +  N           +DT +  
Sbjct  258  ETSDLSMNTNLVQSSGLQSGGMGIVGLPSPASHISPDVISKN----------SVDTTLSP  307

Query  496  g--gggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAS  669
                 GR R     +EKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  
Sbjct  308  VPYVLGRGRKRSAALEKVVERRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNEE  367

Query  670  LKQALDEMDRKRKQEAFEEVKP  735
            L +  +E+   +K +  E + P
Sbjct  368  LLRKQEEVMEMQKNQMLETLNP  389



>gb|KDO58067.1| hypothetical protein CISIN_1g037676mg [Citrus sinensis]
Length=267

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE EL QLK EN  LK+A+ E++RKR 
Sbjct  194  PHEVVVERRQRRMIKNRESAARSRARKQAYTVELELELTQLKAENDKLKEAVKELERKRV  253

Query  709  QEAFE  723
            QE  +
Sbjct  254  QEDIQ  258



>ref|XP_004964902.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like [Setaria 
italica]
Length=325

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 113/252 (45%), Gaps = 72/252 (29%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ T G MTLE+FLVRAG                                      V R 
Sbjct  127  RQPTLGSMTLEEFLVRAG--------------------------------------VVRE  148

Query  208  VMGLGGGGAVPAYQAL-PQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
             MG       P  QAL  QG  VA                P     ++GNG        Q
Sbjct  149  DMGQQPLVLPPHAQALFSQGNAVA----------------PQTL--QLGNGMVTAVVG-Q  189

Query  385  GLG----LGSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKV  543
            GLG    + +P +PV  +G+     GD  +     Y  DT +R   G         VEKV
Sbjct  190  GLGGAMTVAAPTTPVVLNGMGKVEAGDLSSLSPVPYPFDTALRVRKGPT-------VEKV  242

Query  544  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            VERRQRRMIKNRESAARSRARKQAY +ELEAE+ +LKE+N  L++   EM +K+K E  E
Sbjct  243  VERRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKEQNDELQKKQVEMLKKQKDEVLE  302

Query  724  EVKPTTPTKAQK  759
             +      KA+K
Sbjct  303  RINNQLGPKAKK  314



>gb|ABH05132.1| ABA responsive element binding factor 2 [Hordeum vulgare subsp. 
vulgare]
Length=302

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 114/250 (46%), Gaps = 67/250 (27%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T G MTLE+FLVRAGVVRE                                     
Sbjct  104  ERQQTLGRMTLEEFLVRAGVVRED------------------------------------  127

Query  205  PVMGLGGGGAVPAY-QAL-PQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAH  378
              MG G    VPA  QAL PQG VVA                P +  G       VG   
Sbjct  128  --MG-GQTVVVPARAQALFPQGNVVA----------------PTMQVGNGVVHGVVGQGA  168

Query  379  MQGLGLGSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKVVE  549
               + + +P +P   +G     GGD  +     Y  DT  R   G         VEKVVE
Sbjct  169  GVPMTVAAPTTPGVLNGFGKMEGGDLSSLSPVPYPFDTVTRARKGPT-------VEKVVE  221

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            RRQRRMIKNRESAARSR  KQAY +ELEAE+ +LKE N +L++   EM +K+K E  E +
Sbjct  222  RRQRRMIKNRESAARSRQSKQAYIMELEAEVAKLKENNEALQKKQVEMLQKQKDEVIERI  281

Query  730  KPTTPTKAQK  759
            +     KA++
Sbjct  282  EKQLGPKAKR  291



>ref|NP_849777.1| abscisic acid responsive elements-binding factor 2 [Arabidopsis 
thaliana]
 sp|Q9M7Q4.1|AI5L5_ARATH RecName: Full=ABSCISIC ACID-INSENSITIVE 5-like protein 5; AltName: 
Full=ABA-responsive element-binding protein 1; AltName: 
Full=Abscisic acid responsive elements-binding factor 2; Short=ABRE-binding 
factor 2; AltName: Full=bZIP transcription 
factor 36; Short=AtbZIP36 [Arabidopsis thaliana]
 gb|AAF27180.1|AF093545_1 abscisic acid responsive elements-binding factor [Arabidopsis 
thaliana]
 dbj|BAB12404.1| ABA-responsive element binding protein 1 (AREB1) [Arabidopsis 
thaliana]
 gb|ABH04550.1| At1g45249 [Arabidopsis thaliana]
 gb|AEE32110.1| abscisic acid responsive elements-binding factor 2 [Arabidopsis 
thaliana]
Length=416

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 129/266 (48%), Gaps = 45/266 (17%)
 Frame = +1

Query  37   TFGEMTLEDFLVRAGVVREQGntaappparpqqya----aaamypnnntpaaIAPTYVAR  204
            T GE+TLE+FLVRAGVVRE+   AA                A    +      +P  VA 
Sbjct  135  TLGEVTLEEFLVRAGVVREEAQVAARAQIAENNKGGYFGNDANTGFSVEFQQPSPRVVAA  194

Query  205  PVMGLGGGGAVPAYQ----ALPQG---------GVVAEAPGYPKR-GGGYAQP-----SP  327
             VMG  G     + Q    +LP               + P  PK+ G GY        SP
Sbjct  195  GVMGNLGAETANSLQVQGSSLPLNVNGARTTYQQSQQQQPIMPKQPGFGYGTQMGQLNSP  254

Query  328  PVYGGRM---GNGSA---VGYAH--------MQGLGLGSPVSPVSPDGLCVNPGGDGGNQ  465
             + GG +   G+ S    VG+            G+G  SPV+P+S +G+     G     
Sbjct  255  GIRGGGLVGLGDQSLTNNVGFVQGASAAIPGALGVGAVSPVTPLSSEGI-----GKSNGD  309

Query  466  HYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELN  645
               L        GG +    G VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ 
Sbjct  310  SSSLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVA  369

Query  646  QLKEENASL--KQA-LDEMDRKRKQE  714
            +LKEEN  L  KQA + EM + ++ E
Sbjct  370  KLKEENDELQRKQARIMEMQKNQETE  395



>ref|XP_006393641.1| hypothetical protein EUTSA_v10011493mg [Eutrema salsugineum]
 gb|ESQ30927.1| hypothetical protein EUTSA_v10011493mg [Eutrema salsugineum]
Length=436

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 120/242 (50%), Gaps = 50/242 (21%)
 Frame = +1

Query  37   TFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaI--------APT  192
            T GE+TLE+FLVRAGVVRE+   AA          A A +    +P  +          T
Sbjct  183  TLGEVTLEEFLVRAGVVREEAQVAAKDKDGYFGNDANAGFSVQASPRVVPGLMENLGVET  242

Query  193  YVARPVMG----LGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQ-PSPPVYGGRMGNG  357
                 V G    L   GA   YQ  P   ++ + PG+   G   AQ  SP V GG MG G
Sbjct  243  ANHLQVQGSSLPLNVNGARSTYQQQP---ILPKQPGF-GYGTQIAQLNSPVVRGGLMGLG  298

Query  358  -----SAVGYAHMQGLGLGS-PVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkri  519
                 + +G+    G+G  +   S +SP     N GG  G +  G               
Sbjct  299  DQPLTNNMGFVQ-DGIGKNNGDSSSLSPSPYMFN-GGVRGRKSGG---------------  341

Query  520  idgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
                VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN       DE+ R
Sbjct  342  ---TVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEIAKLKEEN-------DELQR  391

Query  700  KR  705
            K+
Sbjct  392  KQ  393



>ref|XP_006487955.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1-like [Citrus 
sinensis]
Length=370

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE EL QLK EN  LK+A+ E++RKR 
Sbjct  297  PHEVVVERRQRRMIKNRESAARSRARKQAYTVELELELTQLKAENDKLKEAVKELERKRV  356

Query  709  QEAFE  723
            QE  +
Sbjct  357  QEDIQ  361



>ref|XP_007133528.1| hypothetical protein PHAVU_011G186800g [Phaseolus vulgaris]
 ref|XP_007133529.1| hypothetical protein PHAVU_011G186800g [Phaseolus vulgaris]
 ref|XP_007133530.1| hypothetical protein PHAVU_011G186800g [Phaseolus vulgaris]
 gb|ESW05522.1| hypothetical protein PHAVU_011G186800g [Phaseolus vulgaris]
 gb|ESW05523.1| hypothetical protein PHAVU_011G186800g [Phaseolus vulgaris]
 gb|ESW05524.1| hypothetical protein PHAVU_011G186800g [Phaseolus vulgaris]
Length=323

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 113/252 (45%), Gaps = 81/252 (32%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ T GEMTLEDFLV+AGVV E  N                                  P
Sbjct  124  RQPTLGEMTLEDFLVKAGVVAETSNRKNTG-----------------------------P  154

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPG---YPKRG--------GGYAQPSPPVYGGRMGN  354
            V G+     VP + +  QG  +   P    +P++G         G AQP        MG 
Sbjct  155  VAGIDSNMVVPQFPS--QGQWIQYPPAQYQHPQQGLMQIYMPGQGMAQPM------HMGP  206

Query  355  GSA--VGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidg  528
            G++  V YA  Q + + SP+     D     PG   G     +                 
Sbjct  207  GASLDVSYADSQVVAMPSPLMGTMSDSHT--PGRKRGTPEDMM-----------------  247

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
              EK VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN          +R RK
Sbjct  248  --EKTVERRQKRMIKNRESAARSRARKQAYTNELEHKVSRLEEEN----------ERLRK  295

Query  709  QEAFEEVKPTTP  744
            ++  E++ P+TP
Sbjct  296  RQEIEKMLPSTP  307



>ref|XP_008804818.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
 ref|XP_008804819.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
 ref|XP_008804820.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
 ref|XP_008804821.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Phoenix 
dactylifera]
Length=404

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK+   ++   +KQ
Sbjct  316  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENARLKEEEKKILALKKQ  375

Query  712  EAFEEVKPTTPTKAQK  759
               E +       AQK
Sbjct  376  LLMEAMAERARVNAQK  391



>ref|XP_003526362.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2-like [Glycine 
max]
 gb|KHN26436.1| ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Glycine soja]
Length=316

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 103/226 (46%), Gaps = 50/226 (22%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T GEMTLEDFLV+AG+V E                             +AP +   
Sbjct  117  ERQSTLGEMTLEDFLVKAGIVAE------------ASNRKNTGATVGVDSNVVAPQF---  161

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
            P  G     A P YQ   QG +    PG  K     AQP        MG G A    +  
Sbjct  162  PQHGPWIQYAQPQYQHPQQGLMGIYIPGQNK-----AQPL------HMGAGVATDVLYAD  210

Query  385  G-LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            G + L SPV     D     PG   G                     +  VEK VERRQ+
Sbjct  211  GQVALSSPVMGTLSD--TRRPGRKRGT-------------------SEDMVEKTVERRQK  249

Query  562  RMIKNRESAARSRARKQAYTVELEAELNQLKEENASLK--QALDEM  693
            RMIKNRESAARSRARKQAYT ELE ++++L+EEN  L+  Q L++M
Sbjct  250  RMIKNRESAARSRARKQAYTTELEHKVSRLEEENEKLRRQQELEKM  295



>ref|XP_004293073.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Fragaria 
vesca subsp. vesca]
Length=366

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P+E VVERRQRRMIKNRESAARSRARKQAYTVELEAE+N L+EEN  LK+ +  ++ +R+
Sbjct  279  PLEVVVERRQRRMIKNRESAARSRARKQAYTVELEAEVNHLEEENERLKETVAGIEERRR  338

Query  709  QEAFEEVKPTTPTKAQKASKKlrllrrTLS  798
            QE     +    TKAQ+ + K R +RRT+S
Sbjct  339  QEVMARKQ---STKAQRLAAKSRTMRRTVS  365



>ref|XP_003596811.1| BZIP transcription factor [Medicago truncatula]
 gb|AES67062.1| ABA response element-binding factor [Medicago truncatula]
Length=288

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E +++R+QRRM+KNRESAARSRARKQAYT+ELEAELN L+EEN  LKQ L E +RKRK
Sbjct  204  PPEVLLDRKQRRMMKNRESAARSRARKQAYTIELEAELNLLQEENKQLKQFLAEAERKRK  263

Query  709  QEAFE  723
            QE  +
Sbjct  264  QELLQ  268



>ref|XP_006352088.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006352090.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7-like isoform 
X3 [Solanum tuberosum]
Length=366

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 112/248 (45%), Gaps = 36/248 (15%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QR+ T GEMTLE+FLVRAG VRE    A                 +       A      
Sbjct  123  QRESTLGEMTLEEFLVRAGAVREDMQPAGYSNDVTFASGFTQPSSSVTIAFQQA---TQN  179

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGR------MGNGSAV  366
            P   + G      +  +       + P +PK+       SP   GG       M N SA 
Sbjct  180  PGHQIAGNNI---FNVVSTTTSSTQQPLFPKQTT-VEFASPLQLGGSPGTRPPMSNPSAN  235

Query  367  GYAHMQGLGLGSPVSPVSP---DGLCVNPG----GDGGNQHYGLDTgirgggggrkriid  525
              + MQG  +  PV  VSP   D   ++P     G+GG       +              
Sbjct  236  TSSVMQGGVMTMPVKGVSPGNIDTSSLSPSPYACGEGGRGRRSCTS--------------  281

Query  526  gPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKR  705
               EKVVERR++RMIKNRESAARSR RKQAYT+ELEAE+ +LKE    L++   E   K+
Sbjct  282  --FEKVVERRRKRMIKNRESAARSRDRKQAYTLELEAEVAKLKEIKQELQKKQAEFIEKQ  339

Query  706  KQEAFEEV  729
            K++  E++
Sbjct  340  KKQLLEKM  347



>gb|AAM75354.1|AF519803_1 ABA response element binding factor [Triticum aestivum]
Length=351

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 115/262 (44%), Gaps = 87/262 (33%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ T GEMTLE FLV+AGVVR                                       
Sbjct  124  RQGTLGEMTLEQFLVKAGVVR---------------------------------------  144

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVY-----GGR---MGNGSA  363
              G G GG  P    +P G V A+    P + G   QP P +Y      G    MG+G  
Sbjct  145  --GSGAGGQAP----VPVGMVHAQM--NPVQQG--QQPGPMMYPMAPANGMFQVMGDGMG  194

Query  364  V---GYAHMQ----------GLGLGSPVSPVSPDGLC-------VNPGGDGGNQHYGLDT  483
                GYA M           G+G+   VSP S DG         +N  GDG     G   
Sbjct  195  FVPNGYAGMAVVPPPPPPQGGMGI---VSPGSSDGRSAMTQADMMNCMGDGAMMENG---  248

Query  484  girgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  663
                G   R    D   E+ +ERR RRMIKNRESAARSRARKQAYTVELEAELN LKEEN
Sbjct  249  ----GARKRGAPEDQSCERSIERRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEEN  304

Query  664  ASLKQALDEMDRKRKQEAFEEV  729
            A LK     +   +KQ   E++
Sbjct  305  ARLKAEEKTILLTKKQMLVEKM  326



>ref|XP_004957010.1| PREDICTED: bZIP transcription factor TRAB1-like [Setaria italica]
Length=355

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 106/245 (43%), Gaps = 49/245 (20%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
             RQ T GEMTLE+FLVRAGVVRE               A A        P  +AP   A 
Sbjct  132  HRQSTLGEMTLEEFLVRAGVVREN---------PAPAAAPAPPPMLPPRPVPVAPKSTA-  181

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAP---GYPKRGGGYAQPSPPVYGGR-MGNGSAVGY  372
                    G  P          +  AP   G P  G G   P     GG  M   +AV  
Sbjct  182  ------FLGNFPGADDAAAAVALGFAPIGMGDPALGNGLMPPRAAGMGGSAMAVQTAVNQ  235

Query  373  AHMQGLGLGSPVSPVSP-----DGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
                G G    +SP  P     +G+       GG                        VE
Sbjct  236  LDSGGKGYSDLLSPTEPLPYSFEGMIRGRRNGGG------------------------VE  271

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
            KVVERR RRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++   E+   +K E 
Sbjct  272  KVVERRHRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNQELERKQAEIMEMQKNEL  331

Query  718  FEEVK  732
             E +K
Sbjct  332  PEMLK  336



>ref|XP_010907998.1| PREDICTED: LOW QUALITY PROTEIN: protein ABSCISIC ACID-INSENSITIVE 
5-like [Elaeis guineensis]
Length=377

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEL QLKEEN  LK+   +M   +KQ
Sbjct  289  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELKQLKEENVRLKEEERKMLALKKQ  348

Query  712  EAFEEVKPTTPTKAQKA  762
               E +       AQK 
Sbjct  349  VLMESMAERARVNAQKT  365



>dbj|BAF36444.1| bZip type transcription factor TaABI5 [Triticum aestivum]
 dbj|BAF62438.1| bZip type transcription factor TaABI5 [Triticum aestivum]
Length=390

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 115/262 (44%), Gaps = 87/262 (33%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ T GEMTLE FLV+AGVVR                                       
Sbjct  163  RQGTLGEMTLEQFLVKAGVVR---------------------------------------  183

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVY-----GGR---MGNGSA  363
              G G GG  P    +P G V A+    P + G   QP P +Y      G    MG+G  
Sbjct  184  --GSGAGGQAP----VPVGMVHAQM--NPVQQG--QQPGPMMYPMAPANGMFQVMGDGMG  233

Query  364  V---GYAHMQ----------GLGLGSPVSPVSPDGLC-------VNPGGDGGNQHYGLDT  483
                GYA M           G+G+   VSP S DG         +N  GDG     G   
Sbjct  234  FVPNGYAGMAVVPPPPPPQGGMGI---VSPGSSDGRSAMTQADMMNCMGDGAMMENG---  287

Query  484  girgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEEN  663
                G   R    D   E+ +ERR RRMIKNRESAARSRARKQAYTVELEAELN LKEEN
Sbjct  288  ----GARKRGAPEDQSCERSIERRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEEN  343

Query  664  ASLKQALDEMDRKRKQEAFEEV  729
            A LK     +   +KQ   E++
Sbjct  344  ARLKAEEKTILLTKKQMLVEKM  365



>ref|XP_004291101.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score = 94.0 bits (232),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            PVEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  LK+  DEM   +K
Sbjct  363  PVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELKKKQDEMMELQK  422

Query  709  QEAFE  723
             +  E
Sbjct  423  NQDIE  427



>gb|KDO38043.1| hypothetical protein CISIN_1g025340mg [Citrus sinensis]
Length=254

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  DEM   +K 
Sbjct  170  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKN  229

Query  712  EAFE  723
            +  E
Sbjct  230  QVLE  233



>ref|XP_003607958.1| ABSCISIC ACID-INSENSITIVE 5-like protein [Medicago truncatula]
 gb|AES90155.1| ABA response element-binding factor [Medicago truncatula]
Length=376

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 119/257 (46%), Gaps = 42/257 (16%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QRQ T GE+TLE+FLVRAGVV+E     A    RP      + +  +N    +      +
Sbjct  118  QRQPTLGEVTLEEFLVRAGVVKEDTPNHAQQIERPNNNEWFSDFSRSNNNTNLL--GFQQ  175

Query  205  PVMGLG----GGGAVPAYQALPQGGVVAEA-----PGYPK-RGGGYAQPSPPVYGGRMGN  354
            P    G        VP +  LP   +         P +PK     +A P   +   ++GN
Sbjct  176  PNGNNGDMSDNNNLVPKHVPLPPSSINLNHSQRPPPLFPKPTTVAFASPMHLLNNAQLGN  235

Query  355  -----GSAVGYAHMQGLGLGSPV----SPVSPDGLCVNPGGDGGNQHYGLDTgirggg--  501
                 G  VG   +    + +PV    S +SPD +              LD  +      
Sbjct  236  NGRSVGPGVGTLGLSASNITAPVASPGSKMSPDLIT----------KRNLDPSLLSPVPY  285

Query  502  ggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQA  681
               +     PVEK VERRQ+RMIKNRESAARSRARKQAYTVELEAE+ +LKE N  L   
Sbjct  286  AINRGRKCVPVEKGVERRQKRMIKNRESAARSRARKQAYTVELEAEVAKLKEVNEEL---  342

Query  682  LDEMDRKRKQEAFEEVK  732
                  +RKQ  F E++
Sbjct  343  ------QRKQAEFMEMQ  353



>ref|XP_003628123.1| BZIP transcription factor [Medicago truncatula]
 gb|AET02599.1| bZIP transcription factor [Medicago truncatula]
Length=313

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 104/243 (43%), Gaps = 70/243 (29%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA-  201
            +RQ T GEMTLEDFLV+AG+V E  +                           A + VA 
Sbjct  122  ERQTTLGEMTLEDFLVKAGIVAEASSNKTNTDTTAA-----------------ADSNVAV  164

Query  202  --RPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYA  375
               P  G       P YQ L Q  +    P         AQP                  
Sbjct  165  SQFPSQGQWIQYPQPQYQHLQQSSMGIYMPS-----QSMAQP------------------  201

Query  376  HMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERR  555
                L +GS VS   P            + H  LDT + G        +   VEK VERR
Sbjct  202  ----LHMGSGVSMEIP----------FADSHMALDTQMPGRKRSTPEDM---VEKTVERR  244

Query  556  QRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKP  735
            Q+RMIKNRESAARSRARKQAYT ELE ++++L+EEN        EM RKRK+   E + P
Sbjct  245  QKRMIKNRESAARSRARKQAYTNELEIKVSRLEEEN--------EMLRKRKE--LENMLP  294

Query  736  TTP  744
              P
Sbjct  295  CAP  297



>gb|KDO84148.1| hypothetical protein CISIN_1g021624mg [Citrus sinensis]
Length=310

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 73/113 (65%), Gaps = 4/113 (4%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
            G+ LGSP + +S DG+    G   G+            G  R R  +G VEKVVERRQRR
Sbjct  181  GVSLGSPANQLSSDGI----GKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRR  236

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            MIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K +  E
Sbjct  237  MIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQEEMMEMQKNQVLE  289



>ref|XP_010500203.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Camelina 
sativa]
 ref|XP_010500204.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Camelina 
sativa]
Length=420

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 83/144 (58%), Gaps = 10/144 (7%)
 Frame = +1

Query  298  RGGGYAQPSPPVYGGRMG--NGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHY  471
            RGGG            MG  NGSA       G+G  SPV+P+S +G+     G       
Sbjct  261  RGGGIMGFGDQSQTNNMGLVNGSAAAIPGAVGVGAVSPVTPLSSEGI-----GKSNGDCS  315

Query  472  GLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL  651
             L        GG +    G VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ +L
Sbjct  316  SLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVAKL  375

Query  652  KEENASL--KQA-LDEMDRKRKQE  714
            KEEN  L  KQA + EM + ++ E
Sbjct  376  KEENDELQRKQAKIMEMQKNQEME  399



>ref|NP_001239043.1| ABA responsive transcription factor [Solanum lycopersicum]
 dbj|BAL04566.1| ABA responsive transcription factor [Solanum lycopersicum]
Length=365

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 87/249 (35%), Positives = 113/249 (45%), Gaps = 39/249 (16%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QR+ T GEMTLE+FLVRAG V+E    A                 +       A      
Sbjct  123  QRESTLGEMTLEEFLVRAGAVQEDMQPAGYSNDVTFASGFTQPSSSVTIAFQQATQNPGH  182

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGG-GYAQP----SPPVYGGR--MGNGSA  363
             +        V    + PQ       P +PK+    +A P    SP   G R  M N SA
Sbjct  183  QIAANNIFNVVSTTTSSPQ------QPLFPKQTTVEFASPMQLGSP---GKRLPMSNPSA  233

Query  364  VGYAHMQGLGLGSPVSPVSP---DGLCVNPG----GDGGNQHYGLDTgirgggggrkrii  522
               + MQG  +  PV  VSP   D   ++P     G+GG       +             
Sbjct  234  NTSSVMQGGVMTMPVKGVSPGNLDTSSLSPSPYACGEGGRGRRSCTS-------------  280

Query  523  dgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRK  702
                EKVVERR++RMIKNRESAARSR RKQAYT+ELEAE+ +LKE    L++   E   K
Sbjct  281  ---FEKVVERRRKRMIKNRESAARSRDRKQAYTLELEAEVAKLKEIKQELQKKQAEFIEK  337

Query  703  RKQEAFEEV  729
            +K +  E++
Sbjct  338  QKNQLLEKM  346



>ref|XP_009339236.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009339237.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X2 [Pyrus x bretschneideri]
Length=319

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 113/247 (46%), Gaps = 69/247 (28%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T GEMTLEDFLV+AGVV E                            A +    A 
Sbjct  119  ERQRTLGEMTLEDFLVKAGVVAE--------------------------AEASSDKQCAG  152

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEA-PGY--PKRG--GGY--AQPSPPVYGGRMGNGSA  363
            P++G+    A       PQG  +  + P Y  P++   G Y  +QP PP      G    
Sbjct  153  PLVGVDANVAA----QFPQGQWMQYSQPQYQHPQQSMMGVYMPSQPIPPPMHVGAGAMME  208

Query  364  VGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKV  543
            V Y   Q + L SP+     D     PG   GN                       VEK 
Sbjct  209  VPYPDNQ-VPLPSPLMGALSD--TQTPGRKRGNSE-------------------DIVEKT  246

Query  544  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN          +R RKQ+  E
Sbjct  247  VERRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEEN----------ERLRKQKELE  296

Query  724  EVKPTTP  744
            +V P+ P
Sbjct  297  KVLPSAP  303



>ref|XP_006352089.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7-like isoform 
X2 [Solanum tuberosum]
Length=342

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 109/243 (45%), Gaps = 36/243 (15%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QR+ T GEMTLE+FLVRAG VRE    A                 +       A      
Sbjct  123  QRESTLGEMTLEEFLVRAGAVREDMQPAGYSNDVTFASGFTQPSSSVTIAFQQA---TQN  179

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGR------MGNGSAV  366
            P   + G      +  +       + P +PK+       SP   GG       M N SA 
Sbjct  180  PGHQIAGNNI---FNVVSTTTSSTQQPLFPKQTT-VEFASPLQLGGSPGTRPPMSNPSAN  235

Query  367  GYAHMQGLGLGSPVSPVSP---DGLCVNPG----GDGGNQHYGLDTgirgggggrkriid  525
              + MQG  +  PV  VSP   D   ++P     G+GG       +              
Sbjct  236  TSSVMQGGVMTMPVKGVSPGNIDTSSLSPSPYACGEGGRGRRSCTS--------------  281

Query  526  gPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKR  705
               EKVVERR++RMIKNRESAARSR RKQAYT+ELEAE+ +LKE    L++   E   K+
Sbjct  282  --FEKVVERRRKRMIKNRESAARSRDRKQAYTLELEAEVAKLKEIKQELQKKQAEFIEKQ  339

Query  706  KQE  714
            K++
Sbjct  340  KKQ  342



>ref|XP_009339232.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009339233.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009339234.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009339235.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X1 [Pyrus x bretschneideri]
Length=322

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 113/247 (46%), Gaps = 69/247 (28%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T GEMTLEDFLV+AGVV E                            A +    A 
Sbjct  122  ERQRTLGEMTLEDFLVKAGVVAE--------------------------AEASSDKQCAG  155

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEA-PGY--PKRG--GGY--AQPSPPVYGGRMGNGSA  363
            P++G+    A       PQG  +  + P Y  P++   G Y  +QP PP      G    
Sbjct  156  PLVGVDANVAA----QFPQGQWMQYSQPQYQHPQQSMMGVYMPSQPIPPPMHVGAGAMME  211

Query  364  VGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKV  543
            V Y   Q + L SP+     D     PG   GN                       VEK 
Sbjct  212  VPYPDNQ-VPLPSPLMGALSD--TQTPGRKRGNSE-------------------DIVEKT  249

Query  544  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN          +R RKQ+  E
Sbjct  250  VERRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEEN----------ERLRKQKELE  299

Query  724  EVKPTTP  744
            +V P+ P
Sbjct  300  KVLPSAP  306



>ref|XP_009339238.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform 
X3 [Pyrus x bretschneideri]
Length=317

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 113/247 (46%), Gaps = 69/247 (28%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ T GEMTLEDFLV+AGVV E                            A +    A 
Sbjct  117  ERQRTLGEMTLEDFLVKAGVVAE--------------------------AEASSDKQCAG  150

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEA-PGY--PKRG--GGY--AQPSPPVYGGRMGNGSA  363
            P++G+    A       PQG  +  + P Y  P++   G Y  +QP PP      G    
Sbjct  151  PLVGVDANVAA----QFPQGQWMQYSQPQYQHPQQSMMGVYMPSQPIPPPMHVGAGAMME  206

Query  364  VGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKV  543
            V Y   Q + L SP+     D     PG   GN                       VEK 
Sbjct  207  VPYPDNQ-VPLPSPLMGALSD--TQTPGRKRGNSE-------------------DIVEKT  244

Query  544  VERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN          +R RKQ+  E
Sbjct  245  VERRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEEN----------ERLRKQKELE  294

Query  724  EVKPTTP  744
            +V P+ P
Sbjct  295  KVLPSAP  301



>ref|XP_010313017.1| PREDICTED: ABA responsive transcription factor isoform X1 [Solanum 
lycopersicum]
Length=365

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 87/249 (35%), Positives = 113/249 (45%), Gaps = 39/249 (16%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QR+ T GEMTLE+FLVRAG V+E    A                 +       A      
Sbjct  123  QRESTLGEMTLEEFLVRAGAVQEDMQPAGYSNDVTFASGFTQPSCSVTIAFQQATQNPGH  182

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGG-GYAQP----SPPVYGGR--MGNGSA  363
             +        V    + PQ       P +PK+    +A P    SP   G R  M N SA
Sbjct  183  QIAANNIFNVVSTTTSSPQ------QPLFPKQTTVEFASPMQLGSP---GKRLPMSNPSA  233

Query  364  VGYAHMQGLGLGSPVSPVSP---DGLCVNPG----GDGGNQHYGLDTgirgggggrkrii  522
               + MQG  +  PV  VSP   D   ++P     G+GG       +             
Sbjct  234  NTSSVMQGGVMTMPVKGVSPGNLDTSSLSPSPYACGEGGRGRRSCTS-------------  280

Query  523  dgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRK  702
                EKVVERR++RMIKNRESAARSR RKQAYT+ELEAE+ +LKE    L++   E   K
Sbjct  281  ---FEKVVERRRKRMIKNRESAARSRDRKQAYTLELEAEVAKLKEIKQELQKKQAEFIEK  337

Query  703  RKQEAFEEV  729
            +K +  E++
Sbjct  338  QKNQLLEKM  346



>gb|ABE73182.1| ABA response element binding factor [Avena fatua]
Length=272

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P EK VERR RRMIKNRESAARSRARKQAYTVELEAELN+LKEENA LK     +   RK
Sbjct  181  PGEKSVERRHRRMIKNRESAARSRARKQAYTVELEAELNELKEENARLKAEETTILLARK  240

Query  709  QEAFEEV  729
            Q   E++
Sbjct  241  QMLLEKM  247



>ref|XP_004973666.1| PREDICTED: bZIP transcription factor TRAB1-like [Setaria italica]
Length=360

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE NA L++  DEM   +K 
Sbjct  276  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNAELQKKQDEMMEMQKN  335

Query  712  EAFEEV  729
            +  E V
Sbjct  336  QVLEVV  341



>ref|NP_001150949.1| bZIP transcription factor ABI5 [Zea mays]
 gb|ACG41055.1| bZIP transcription factor ABI5 [Zea mays]
Length=355

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 109/236 (46%), Gaps = 44/236 (19%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QR  T GE+TLE+FLVRAGVVRE      P P  P   A A   P       +    V  
Sbjct  144  QRHPTLGEITLEEFLVRAGVVREDMTAPPPVPPAPVCPAPAPRPPVLFPHGNVLAPLV--  201

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQ  384
            P +  G G            G V +     +RGG    P PP    R    SA G     
Sbjct  202  PPLQFGNGFV---------SGAVGQ-----QRGG----PVPPAVSPRPVTASAFGKMEGD  243

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
             L   SP SPV      +  GG  G +   ++                   KVVERRQRR
Sbjct  244  DLSSLSP-SPVP----YIFGGGLRGRKPPAME-------------------KVVERRQRR  279

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVK  732
            MIKNRESAARSR RKQAY +ELEAE+ +LKE N  L++   EM  K+K E  E ++
Sbjct  280  MIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQVEMLEKQKNEVLERMR  335



>ref|XP_010552516.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X3 [Tarenaya hassleriana]
Length=429

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = +1

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRM  567
            +G  SPV+P+S DG     G   G+            GG R R   G VEKVVERRQRRM
Sbjct  302  IGGASPVTPLSTDG----TGKSNGDTSSVSPLPYMFSGGMRGRKSSGAVEKVVERRQRRM  357

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            IKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   EM   +K +A E
Sbjct  358  IKNRESAARSRARKQAYTMELEAEIAKLKEENQELRKKQAEMMEMQKNQAME  409



>ref|XP_010535682.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Tarenaya 
hassleriana]
 ref|XP_010535683.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 [Tarenaya 
hassleriana]
Length=341

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E ++ERRQRRMIKNRESAARSRARKQAYTVELE ELNQL EEN  LK+ ++E ++ R+
Sbjct  252  PPEVLMERRQRRMIKNRESAARSRARKQAYTVELELELNQLVEENLKLKKIVEENEKTRR  311

Query  709  QEAF  720
            QE  
Sbjct  312  QEVM  315



>gb|EYU35478.1| hypothetical protein MIMGU_mgv1a023701mg [Erythranthe guttata]
Length=359

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 82/145 (57%), Gaps = 28/145 (19%)
 Frame = +1

Query  403  PVSPVSPDGLCVNPGG-------DGGNQHYGLDTgirgggggrkriidgPVEKVVERRQR  561
            P++ V P   CV+          D GNQ +GLD    GG          P+EKVVE  QR
Sbjct  209  PITAVGPG--CVDVASYQTLAQVDSGNQ-FGLDNLRGGGRKRIIDG---PLEKVVESGQR  262

Query  562  RMIKNRESAARSRARKQA--YTV-----------ELEAELNQLKEENASLKQALDEMDRK  702
            RMIK RESAARSRARKQ   Y V             E+ELNQLKEENA LKQA+ E +RK
Sbjct  263  RMIKIRESAARSRARKQINLYCVLMMIIGLYVRISFESELNQLKEENAQLKQAMAEFERK  322

Query  703  RKQEAFEEVKPTT--PTKAQKASKK  771
            R+Q+  EEVK  T   +KAQ A +K
Sbjct  323  RRQQLCEEVKVETKVKSKAQMAKEK  347


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 9/81 (11%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
            +QR+ TFGEMTLEDFLVRAGVVR Q             +AA    P       + P++ A
Sbjct  156  SQRRTTFGEMTLEDFLVRAGVVRGQN--------VSPPFAAPPPPPPQQPMYPVGPSFGA  207

Query  202  RPVMGLGGGGA-VPAYQALPQ  261
            RP+  +G G   V +YQ L Q
Sbjct  208  RPITAVGPGCVDVASYQTLAQ  228



>ref|XP_009394025.1| PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score = 92.0 bits (227),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            V+KVVERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEENA L +        R Q
Sbjct  418  VDKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNVLKEENARLTEEQRTAMASRTQ  477

Query  712  EAFEEVKPTTPTKAQKASKK  771
               E +   +    QKA +K
Sbjct  478  LLLESMAEQSRINVQKAVRK  497



>ref|XP_006434756.1| hypothetical protein CICLE_v10001159mg [Citrus clementina]
 gb|ESR47996.1| hypothetical protein CICLE_v10001159mg [Citrus clementina]
Length=445

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  DEM   +K 
Sbjct  361  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKN  420

Query  712  EAFE  723
            +  E
Sbjct  421  QVLE  424



>ref|XP_006473315.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like isoform 
X2 [Citrus sinensis]
Length=445

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 73/113 (65%), Gaps = 4/113 (4%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
            G+ LGSP + +S DG+    G   G+            G  R R  +G VEKVVERRQRR
Sbjct  316  GVSLGSPANQLSSDGI----GKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRR  371

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            MIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K +  E
Sbjct  372  MIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQEEMMEMQKNQVLE  424



>ref|XP_002312814.1| basic leucine zipper transcription factor family protein [Populus 
trichocarpa]
 gb|EEE86769.1| basic leucine zipper transcription factor family protein [Populus 
trichocarpa]
Length=350

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQAL  684
            P E VVERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEENA LKQ +
Sbjct  261  PPEVVVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENAKLKQIV  312



>ref|XP_010538116.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Tarenaya 
hassleriana]
 ref|XP_010538117.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Tarenaya 
hassleriana]
Length=433

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +1

Query  400  SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNR  579
            SPV+P+S DG+  +  GD  +      +     GG R R   G VEKVVERRQRRMIKNR
Sbjct  309  SPVTPLSSDGIGKSNNGDTSSVS---PSPYMFSGGVRGRKRSGAVEKVVERRQRRMIKNR  365

Query  580  ESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            ESAARSRARKQAYT+ELEAE+ +LKEEN  L++   EM   +K +A E
Sbjct  366  ESAARSRARKQAYTMELEAEVAKLKEENQELRRKQAEMVEMQKNQANE  413



>gb|KDO84149.1| hypothetical protein CISIN_1g021624mg [Citrus sinensis]
Length=304

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
            G+ LGSP + +S DG+    G   G+            G  R R  +G VEKVVERRQRR
Sbjct  181  GVSLGSPANQLSSDGI----GKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRR  236

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
            MIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K + 
Sbjct  237  MIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQEEMMEMQKNQV  287



>emb|CAN60742.1| hypothetical protein VITISV_030212 [Vitis vinifera]
Length=338

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 65/91 (71%), Gaps = 12/91 (13%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +E  VERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ +  ++ K   
Sbjct  260  LEMAVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENTKLKKIVQAIEGKE--  317

Query  712  EAFEEVKPTTPTKAQKASKKlrllrrTLSWP  804
                       TKAQK +K+L+ LRRT+S P
Sbjct  318  ----------ATKAQKIAKQLKKLRRTVSAP  338



>gb|ABE73184.1| ABA response element binding factor [Avena fatua]
Length=266

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P EK VERR RRMIKNRESAARSRARKQAYTVELEAELN+LKEENA LK     +   +K
Sbjct  175  PGEKSVERRHRRMIKNRESAARSRARKQAYTVELEAELNELKEENARLKAEETTILLAKK  234

Query  709  QEAFEEV  729
            Q   E++
Sbjct  235  QMLLEKM  241



>gb|AFW85358.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB05996.1| bZIP transcription factor, partial [Zea mays]
Length=349

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 75/124 (60%), Gaps = 10/124 (8%)
 Frame = +1

Query  397  GSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKVVERRQRRM  567
             +P +PV  +GL     GD  +     Y  DT +R   G         VEKVVERRQRRM
Sbjct  222  AAPTTPVVFNGLGKVEAGDLSSLSPVPYPFDTALRMRKGPT-------VEKVVERRQRRM  274

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPT  747
            IKNRESAARSRARKQAY +ELEAE+ +LK++N  L++   EM +K+K E  E +      
Sbjct  275  IKNRESAARSRARKQAYIMELEAEVAKLKDQNEELQKKQVEMLKKQKDEVLERINSQHGP  334

Query  748  KAQK  759
            KA+K
Sbjct  335  KAKK  338



>gb|ABE73185.1| ABA response element binding factor [Avena fatua]
Length=273

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P EK VERR RRMIKNRESAARSRARKQAYTVELEAELN+LKEENA LK     +   +K
Sbjct  182  PGEKSVERRHRRMIKNRESAARSRARKQAYTVELEAELNELKEENARLKAEETTILLAKK  241

Query  709  QEAFEEV  729
            Q   E++
Sbjct  242  QMLLEKM  248



>ref|XP_002965670.1| hypothetical protein SELMODRAFT_227594 [Selaginella moellendorffii]
 gb|EFJ33090.1| hypothetical protein SELMODRAFT_227594 [Selaginella moellendorffii]
Length=377

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD-RKR  705
            PVE V+ERRQRRMIKNRESAARSRARKQAYTVELEAE++ LKEEN  LK+  +E + R R
Sbjct  286  PVEVVLERRQRRMIKNRESAARSRARKQAYTVELEAEVSHLKEENTRLKKQQEECEVRDR  345

Query  706  KQEAFEEV  729
            KQ    E 
Sbjct  346  KQAKILEA  353



>ref|XP_008659130.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Zea mays]
Length=351

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 75/124 (60%), Gaps = 10/124 (8%)
 Frame = +1

Query  397  GSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKVVERRQRRM  567
             +P +PV  +GL     GD  +     Y  DT +R   G         VEKVVERRQRRM
Sbjct  224  AAPTTPVVFNGLGKVEAGDLSSLSPVPYPFDTALRMRKGPT-------VEKVVERRQRRM  276

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKPTTPT  747
            IKNRESAARSRARKQAY +ELEAE+ +LK++N  L++   EM +K+K E  E +      
Sbjct  277  IKNRESAARSRARKQAYIMELEAEVAKLKDQNEELQKKQVEMLKKQKDEVLERINSQHGP  336

Query  748  KAQK  759
            KA+K
Sbjct  337  KAKK  340



>ref|XP_002971668.1| hypothetical protein SELMODRAFT_451399 [Selaginella moellendorffii]
 gb|EFJ27417.1| hypothetical protein SELMODRAFT_451399 [Selaginella moellendorffii]
Length=382

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD-RKR  705
            PVE V+ERRQRRMIKNRESAARSRARKQAYTVELEAE++ LKEEN  LK+  +E + R R
Sbjct  291  PVEVVLERRQRRMIKNRESAARSRARKQAYTVELEAEVSHLKEENTRLKKQQEECEVRDR  350

Query  706  KQEAFEEV  729
            KQ    E 
Sbjct  351  KQAKILEA  358



>ref|XP_008220233.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Prunus mume]
Length=419

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 83/140 (59%), Gaps = 19/140 (14%)
 Frame = +1

Query  352  NGSAVGYAHMQGLGLG----------SPVSPVSPDGLCVNPGGDGGNQH---YGLDTgir  492
            NG+ V  + M  +GLG          SP + +S DG+  + G D  +     Y  + G R
Sbjct  269  NGTLVQSSGMGMVGLGAAGAVRVATGSPANQLSSDGIGKSNGTDTSSVSPVPYVFNGGFR  328

Query  493  gggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL  672
            G  GG       PVEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L
Sbjct  329  GRKGGG------PVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQEL  382

Query  673  KQALDEMDRKRKQEAFEEVK  732
            ++   EM   +K +  E + 
Sbjct  383  QKKQAEMMEMQKNQDMEIIN  402



>dbj|BAL61091.1| putative basic leucine-zipper transcription factor fragment, 
partial [Diospyros kaki]
Length=115

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +E+   +K 
Sbjct  31   VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELQKRQEEIIETQKN  90

Query  712  EAFEEVK  732
            +  E +K
Sbjct  91   QIMEMMK  97



>gb|ACN31650.1| unknown [Zea mays]
Length=231

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAY +ELEAE+ +LK+ N  L++   EM +K+K 
Sbjct  145  VEKVVERRQRRMIKNRESAARSRARKQAYIIELEAEVAKLKDLNDELQKKQVEMLKKQKD  204

Query  712  EAFEEVKPTTPTKAQK  759
            E  E +      KA+K
Sbjct  205  EVLERINNQHGPKAKK  220



>ref|XP_002969410.1| hypothetical protein SELMODRAFT_91900 [Selaginella moellendorffii]
 gb|EFJ29498.1| hypothetical protein SELMODRAFT_91900 [Selaginella moellendorffii]
Length=295

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD  696
            VEK VERRQRRMIKNRESAARSRARKQAYTVELEAEL QLKEEN  LK+    +D
Sbjct  239  VEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELTQLKEENTRLKRWQVRLD  293



>ref|XP_010313014.1| PREDICTED: ABA responsive transcription factor isoform X2 [Solanum 
lycopersicum]
 ref|XP_010313015.1| PREDICTED: ABA responsive transcription factor isoform X2 [Solanum 
lycopersicum]
 ref|XP_010313016.1| PREDICTED: ABA responsive transcription factor isoform X2 [Solanum 
lycopersicum]
Length=369

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 110/244 (45%), Gaps = 39/244 (16%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            QR+ T GEMTLE+FLVRAG V+E    A                 +       A      
Sbjct  123  QRESTLGEMTLEEFLVRAGAVQEDMQPAGYSNDVTFASGFTQPSCSVTIAFQQATQNPGH  182

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGG-GYAQP----SPPVYGGR--MGNGSA  363
             +        V    + PQ       P +PK+    +A P    SP   G R  M N SA
Sbjct  183  QIAANNIFNVVSTTTSSPQ------QPLFPKQTTVEFASPMQLGSP---GKRLPMSNPSA  233

Query  364  VGYAHMQGLGLGSPVSPVSP---DGLCVNPG----GDGGNQHYGLDTgirgggggrkrii  522
               + MQG  +  PV  VSP   D   ++P     G+GG       +             
Sbjct  234  NTSSVMQGGVMTMPVKGVSPGNLDTSSLSPSPYACGEGGRGRRSCTS-------------  280

Query  523  dgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRK  702
                EKVVERR++RMIKNRESAARSR RKQAYT+ELEAE+ +LKE    L++   E   K
Sbjct  281  ---FEKVVERRRKRMIKNRESAARSRDRKQAYTLELEAEVAKLKEIKQELQKKQAEFIEK  337

Query  703  RKQE  714
            +K +
Sbjct  338  QKNQ  341



>ref|XP_002970746.1| hypothetical protein SELMODRAFT_94516 [Selaginella moellendorffii]
 gb|EFJ28072.1| hypothetical protein SELMODRAFT_94516 [Selaginella moellendorffii]
Length=295

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD  696
            VEK VERRQRRMIKNRESAARSRARKQAYTVELEAEL QLKEEN  LK+    +D
Sbjct  239  VEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELTQLKEENTRLKRWQVRLD  293



>ref|XP_006656761.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like [Oryza 
brachyantha]
Length=234

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAY +ELEAE+ +LKE+ A L++   EM +K+K 
Sbjct  148  VEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKEQKAELQKKQVEMIQKQKD  207

Query  712  EAFEEV  729
            E  E +
Sbjct  208  EVMERI  213



>gb|ABE73183.1| ABA response element binding factor [Avena fatua]
Length=264

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P E+ VERR RRMIKNRESAARSRARKQAYTVELEAELN+LKEENA LK     +   +K
Sbjct  173  PGERSVERRHRRMIKNRESAARSRARKQAYTVELEAELNELKEENARLKAEETTILLAKK  232

Query  709  QEAFEEV  729
            Q   E++
Sbjct  233  QMLLEKM  239



>gb|AFA37978.1| ABA responsive element-binding protein [Solanum torvum]
Length=442

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  358  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEEMLEMQKN  417

Query  712  EAFE  723
            +  E
Sbjct  418  QVME  421



>gb|EMS52660.1| ABSCISIC ACID-INSENSITIVE 5-like protein 6 [Triticum urartu]
Length=181

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKVVERR  555
             + + +P +P   +G     GGD  +     Y  DT  R   G         VEKVVERR
Sbjct  44   AMTVAAPTTPGVLNGFGKMEGGDLSSLSPVPYPFDTVTRARKGPT-------VEKVVERR  96

Query  556  QRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVKP  735
            QRRMIKNRESAARSR RKQAY +ELEAE+ +LKE N +L++   EM +K+K E  E ++ 
Sbjct  97   QRRMIKNRESAARSRQRKQAYIMELEAEVAKLKENNEALQKKQVEMLQKQKDEVIERIEK  156

Query  736  TTPTKAQK  759
                KA++
Sbjct  157  QLGPKAKR  164



>ref|XP_010931491.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Elaeis 
guineensis]
Length=328

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 111/230 (48%), Gaps = 46/230 (20%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQVT GEMTLEDFLV+AGVV E                  +    N+   ++ P   A 
Sbjct  118  ERQVTLGEMTLEDFLVKAGVVVE-----------------GSAKDANDMMRSVGPVGSAN  160

Query  205  PVMG--LGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAH  378
            PV G    G GA    Q      +     G     G Y  PS PV               
Sbjct  161  PVGGPQDFGQGAHWLQQYRQMSAMDQHQQGQQSMMGAYV-PSRPVP--------------  205

Query  379  MQGLGLG-SPV-SPVSPDG-LCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVE  549
             Q LGLG SP+   V PDG + ++  G G               G ++       +K+VE
Sbjct  206  -QPLGLGASPILDAVFPDGQMSISSPGLGA-------LSDPQTPGRKRAASGDKTDKLVE  257

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDR  699
            RRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN  LK+   E+D+
Sbjct  258  RRQKRMIKNRESAARSRARKQAYTNELEYKVSRLEEENERLKKQ-KELDK  306



>ref|XP_006434755.1| hypothetical protein CICLE_v10001159mg [Citrus clementina]
 gb|ESR47995.1| hypothetical protein CICLE_v10001159mg [Citrus clementina]
Length=422

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  DEM   +K 
Sbjct  361  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKN  420

Query  712  E  714
            +
Sbjct  421  Q  421



>ref|NP_001234596.1| AREB-like protein [Solanum lycopersicum]
 ref|XP_010320059.1| PREDICTED: AREB-like protein isoform X1 [Solanum lycopersicum]
 gb|AAS20434.1| AREB-like protein [Solanum lycopersicum]
Length=447

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  363  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEMQKN  422

Query  712  EAFE  723
            +  E
Sbjct  423  QVIE  426



>gb|EMS53961.1| ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Triticum urartu]
Length=216

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 100/223 (45%), Gaps = 59/223 (26%)
 Frame = +1

Query  31   QVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARPV  210
            Q TFGEMTLEDFLV+AGVV E                                 ++  P+
Sbjct  36   QPTFGEMTLEDFLVKAGVVAE--------------------------------GHLKDPI  63

Query  211  MGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGG-----YAQPSPPVYGGRMGNGSAVGYA  375
                  GAV        G  V EA       G      Y +P  P    RM       + 
Sbjct  64   DLPANMGAV--------GSSVIEAAAPSLNPGAHWLQQYLEPQHP----RMAGPFMASHL  111

Query  376  HMQGLGL--GSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVE  549
              Q L +  G+ + P+ PDG   +P  D                  ++   DG  +KVVE
Sbjct  112  GPQPLSVATGAIMEPIYPDGQITSPMLDA--------LSDPQTARRKRGASDGVTDKVVE  163

Query  550  RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQ  678
            RRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN  LK+
Sbjct  164  RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK  206



>gb|AHA43415.1| AREB-like protein [Solanum nigrum]
Length=451

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  367  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEMQKN  426

Query  712  EAFE  723
            +  E
Sbjct  427  QVME  430



>ref|XP_009793574.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Nicotiana 
sylvestris]
Length=436

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  352  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEEMLEMQKN  411

Query  712  EAFE  723
            +  E
Sbjct  412  QVME  415



>ref|NP_001274925.1| ABRE binding factor [Solanum tuberosum]
 gb|ADL70202.1| ABRE binding factor [Solanum tuberosum]
Length=453

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  369  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEMQKN  428

Query  712  EAFE  723
            +  E
Sbjct  429  QVME  432



>ref|XP_006354875.1| PREDICTED: ABRE binding factor isoform X1 [Solanum tuberosum]
 ref|XP_006354876.1| PREDICTED: ABRE binding factor isoform X2 [Solanum tuberosum]
Length=453

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  369  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEMQKN  428

Query  712  EAFE  723
            +  E
Sbjct  429  QVME  432



>ref|XP_006826228.1| hypothetical protein AMTR_s00132p00065700 [Amborella trichopoda]
 gb|ERM93465.1| hypothetical protein AMTR_s00132p00065700 [Amborella trichopoda]
Length=493

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +++   RK 
Sbjct  410  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEENMELQKKQEQLMELRKN  469

Query  712  EAFE  723
            +  E
Sbjct  470  QVLE  473



>ref|XP_008378040.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X2 [Malus domestica]
Length=419

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            PVEKVVERRQRRMIKNRESAARSRARKQAYT ELEAE+ +LKEEN  L +   EM   +K
Sbjct  335  PVEKVVERRQRRMIKNRESAARSRARKQAYTTELEAEVAELKEENQELLKKQAEMVEMQK  394

Query  709  QEAFEEVK  732
             +  E + 
Sbjct  395  NQDLEIIN  402



>ref|XP_011083868.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011083869.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011083870.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
 ref|XP_011083871.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Sesamum 
indicum]
Length=435

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEE+  L++   EM   +K 
Sbjct  351  LEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEEHEELRKKQVEMMEMQKN  410

Query  712  EAFEEVKPTTPTKAQ  756
            +  E +K    TK Q
Sbjct  411  QVLEMMKQQNGTKRQ  425



>gb|KHG23315.1| abscisic acid-insensitive 5-like protein 5 [Gossypium arboreum]
Length=404

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 89/179 (50%), Gaps = 22/179 (12%)
 Frame = +1

Query  202  RPVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGG--GYAQPSPP---VYGGRMGNGSAV  366
            +P +G G       +Q   Q G    +PG   RGG  G     PP   + GG+MG    +
Sbjct  223  QPAVGFG-------FQMPLQSGGQLGSPG--NRGGITGMGDQGPPNGLIQGGKMG---MI  270

Query  367  GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
            G      +  GSP +  S DG+     G        +        G  +      VEKV 
Sbjct  271  GLGGPVSVATGSPANHFSSDGI-----GKSSADTSSVSPVPYVFNGSSRGRKCSAVEKVA  325

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            ERRQRRMIKNRESAARSRARKQAYT ELEAEL +LKEEN  L++   E+   +K +  E
Sbjct  326  ERRQRRMIKNRESAARSRARKQAYTTELEAELAKLKEENEELRKKHAELMEMQKNQVME  384



>gb|AHD24943.1| ABRE binding factor [Nicotiana tabacum]
Length=434

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  350  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEEMLEIQKN  409

Query  712  EAFE  723
            +  E
Sbjct  410  QVME  413



>ref|XP_009592272.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana tomentosiformis]
 ref|XP_009592273.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana tomentosiformis]
Length=434

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +EM   +K 
Sbjct  350  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEEMLEIQKN  409

Query  712  EAFE  723
            +  E
Sbjct  410  QVME  413



>ref|XP_009623872.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Nicotiana 
tomentosiformis]
Length=182

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 60/89 (67%), Gaps = 5/89 (6%)
 Frame = +1

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            V+E+RQRRMIKNRESAARSRARKQAYT ELE ELN L+EEN  LK  + ++  +RK    
Sbjct  97   VMEKRQRRMIKNRESAARSRARKQAYTAELEIELNGLREENEKLKLLVAQIATRRKD---  153

Query  721  EEVKPTTPTKAQKASKK--lrllrrTLSW  801
            EE K   PTKAQ  + K        ++SW
Sbjct  154  EEEKMKQPTKAQWIANKLRRLRRMSSVSW  182



>gb|ABE73181.1| ABA response element binding factor [Avena fatua]
Length=265

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            P EK VERR RRMIK+RESAARSRARKQAYTVELEAELN+LKEENA LK     +   +K
Sbjct  174  PGEKSVERRHRRMIKSRESAARSRARKQAYTVELEAELNKLKEENARLKAEETTILLAKK  233

Query  709  QEAFEEV  729
            Q   E++
Sbjct  234  QMLLEKM  240



>ref|XP_010066019.1| PREDICTED: bZIP transcription factor TRAB1 [Eucalyptus grandis]
 gb|KCW63772.1| hypothetical protein EUGRSUZ_G01436 [Eucalyptus grandis]
 gb|KCW63773.1| hypothetical protein EUGRSUZ_G01436 [Eucalyptus grandis]
Length=425

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++  DE+   +K 
Sbjct  341  LEKVVERRQRRMIKNRESAARSRARKQAYTLELEAEIQKLKELNQELQRKQDELMEMQKS  400

Query  712  EAFEEVK  732
            +  E+V 
Sbjct  401  QIVEKVN  407



>ref|NP_001185157.1| abscisic acid responsive elements-binding factor 2 [Arabidopsis 
thaliana]
 gb|AEE32112.1| abscisic acid responsive elements-binding factor 2 [Arabidopsis 
thaliana]
Length=427

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 129/277 (47%), Gaps = 56/277 (20%)
 Frame = +1

Query  37   TFGEMTLEDFLVRAGVVREQGntaappparpqqya----aaamypnnntpaaIAPTYVAR  204
            T GE+TLE+FLVRAGVVRE+   AA                A    +      +P  VA 
Sbjct  135  TLGEVTLEEFLVRAGVVREEAQVAARAQIAENNKGGYFGNDANTGFSVEFQQPSPRVVAA  194

Query  205  PVMGLGGGGAVPAYQ----ALPQG---------GVVAEAPGYPKR-GGGYAQP-----SP  327
             VMG  G     + Q    +LP               + P  PK+ G GY        SP
Sbjct  195  GVMGNLGAETANSLQVQGSSLPLNVNGARTTYQQSQQQQPIMPKQPGFGYGTQMGQLNSP  254

Query  328  PVYGGRM---GNGSA---VGYAH--------MQGLGLGSPVSPVSPDGLCVNPGGDGGNQ  465
             + GG +   G+ S    VG+            G+G  SPV+P+S +G+     G     
Sbjct  255  GIRGGGLVGLGDQSLTNNVGFVQGASAAIPGALGVGAVSPVTPLSSEGI-----GKSNGD  309

Query  466  HYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQ-----------  612
               L        GG +    G VEKVVERRQRRMIKNRESAARSRARKQ           
Sbjct  310  SSSLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNRESAARSRARKQIFTADQTIYWN  369

Query  613  AYTVELEAELNQLKEENASL--KQA-LDEMDRKRKQE  714
            AYTVELEAE+ +LKEEN  L  KQA + EM + ++ E
Sbjct  370  AYTVELEAEVAKLKEENDELQRKQARIMEMQKNQETE  406



>ref|XP_009359648.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009359658.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Pyrus x bretschneideri]
Length=415

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            PVEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   +M   +K
Sbjct  331  PVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELQKKQAQMAEVQK  390

Query  709  QEAFE  723
             +  E
Sbjct  391  NQNME  395



>ref|XP_002894019.1| hypothetical protein ARALYDRAFT_473850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70278.1| hypothetical protein ARALYDRAFT_473850 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 76/123 (62%), Gaps = 8/123 (7%)
 Frame = +1

Query  355  GSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPV  534
            G+A       G+G  SPV+P+S +G+     G        L        GG +    G V
Sbjct  272  GAAAAIPGALGVGAVSPVTPLSSEGI-----GKSNGDSSSLSPSPYMFNGGVRGRKSGTV  326

Query  535  EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRKR  705
            EKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM + +
Sbjct  327  EKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENDELQRKQARIMEMQKNQ  386

Query  706  KQE  714
            + E
Sbjct  387  EME  389



>emb|CBI28329.3| unnamed protein product [Vitis vinifera]
Length=324

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMD  696
            +E  VERRQRRMIKNRESAARSRARKQAYTVELE ELNQLKEEN  LK+ +  +D
Sbjct  238  LEMAVERRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENTKLKKIVVRVD  292



>ref|NP_001149951.1| bZIP transcription factor family protein [Zea mays]
 gb|ACG37315.1| bZIP transcription factor family protein [Zea mays]
Length=336

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAY +ELEAE+ +LK+ N  L++   EM +K+K 
Sbjct  250  VEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKDLNDELQKKQVEMLKKQKD  309

Query  712  EAFEEVKPTTPTKAQK  759
            E  E +      KA+K
Sbjct  310  EVLERINNQHGPKAKK  325



>ref|XP_008778650.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Phoenix 
dactylifera]
Length=330

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLK  675
            +EKVVERRQRRMIKNRESAARSRARKQAYTVELEA+L QLKEENA LK
Sbjct  242  LEKVVERRQRRMIKNRESAARSRARKQAYTVELEAQLKQLKEENARLK  289



>gb|EMT24519.1| Protein ABSCISIC ACID-INSENSITIVE 5 [Aegilops tauschii]
Length=209

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
             E+ +ERR RRMIKNRESAARSRARKQAYTVELEAELN LKEENA LK     +   +KQ
Sbjct  104  CERSIERRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKAEEKTILLTKKQ  163

Query  712  EAFEEV  729
               E++
Sbjct  164  MLVEKM  169



>gb|KHG05529.1| abscisic acid-insensitive 5-like protein 4 [Gossypium arboreum]
Length=426

 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 71/118 (60%), Gaps = 13/118 (11%)
 Frame = +1

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirg---ggggrkriidgPVEKVVERRQ  558
            +G+GSP S +S D +  N           +DT          GR R     +EKVVERRQ
Sbjct  300  VGIGSPASQISSDVISKN----------SVDTSSLSPVPYVFGRGRKCSAALEKVVERRQ  349

Query  559  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEVK  732
            RRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++  +EM   +K +  E V 
Sbjct  350  RRMIKNRESAARSRARKQAYTLELEAEVAKLKEINEELQKKQEEMMEMQKNQTLEAVN  407



>ref|XP_010461496.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Camelina 
sativa]
 ref|XP_010461497.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Camelina 
sativa]
Length=424

 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 81/144 (56%), Gaps = 10/144 (7%)
 Frame = +1

Query  298  RGGGYAQPSPPVYGGRMG--NGSAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHY  471
            RGGG            MG  NG A       G+   SPV+P+S +G+     G       
Sbjct  265  RGGGIMGFGDQSQTNNMGLVNGGAAAIPGAVGVDAVSPVTPLSSEGI-----GKSNGDCS  319

Query  472  GLDTgirgggggrkriidgPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQL  651
             L        GG +    G VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ +L
Sbjct  320  SLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVAKL  379

Query  652  KEENASL--KQA-LDEMDRKRKQE  714
            KEEN  L  KQA + EM + ++ E
Sbjct  380  KEENDELQRKQAKIMEMQKNQEME  403



>ref|XP_009774980.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Nicotiana 
sylvestris]
Length=255

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 3/77 (4%)
 Frame = +1

Query  541  VVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            V+E+RQRRMIKNRESAARSRARKQAYT ELE ELN+L+EEN  LK  + ++  +RK    
Sbjct  170  VMEKRQRRMIKNRESAARSRARKQAYTAELEIELNRLREENEKLKLLVAQVATRRKD---  226

Query  721  EEVKPTTPTKAQKASKK  771
            EE K   PTKAQ  + K
Sbjct  227  EEEKMKQPTKAQWIANK  243



>ref|XP_003546677.1| PREDICTED: bZIP transcription factor bZIP128 [Glycine max]
Length=302

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 106/249 (43%), Gaps = 74/249 (30%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            R  T GEMTLEDFLV+AGVV +  +                                   
Sbjct  102  RHPTLGEMTLEDFLVKAGVVADASSNRTNTGT----------------------------  133

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRG------GGYAQPSP----PVYGGRMGNG  357
            + G+    AVP +   P  G   + P    +       GG   PS     P++ G   + 
Sbjct  134  IAGVDSNVAVPQF---PSQGQWIQYPQVQYQHSPQSLMGGIYMPSQGMVQPIHMGAEASI  190

Query  358  SAVGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVE  537
              V +A  Q + L SP+    PD L   PG    N     D                  E
Sbjct  191  D-VSFADSQ-VALPSPLMGTMPDMLT--PGRKWSNSE---DMR----------------E  227

Query  538  KVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEA  717
            K VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN          +R RKQ+ 
Sbjct  228  KTVERRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEEN----------ERLRKQKE  277

Query  718  FEEVKPTTP  744
             E + P  P
Sbjct  278  LELMLPCEP  286



>emb|CDX69020.1| BnaC01g04330D [Brassica napus]
Length=350

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKV+ERRQ+RMIKNRESAARSRARKQAYT+ELEAE+ QLKE+N  L++   E+  K+K+
Sbjct  266  LEKVIERRQKRMIKNRESAARSRARKQAYTLELEAEVAQLKEQNEELQRKQVEIMEKQKK  325

Query  712  EAFEEVKPTTPTKAQ  756
            +  E ++ T   K Q
Sbjct  326  QLLEPMRQTWGCKRQ  340



>ref|XP_007017213.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
 ref|XP_007017214.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
 gb|EOY14438.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
 gb|EOY14439.1| Abscisic acid responsive elements-binding factor 2 isoform 1 
[Theobroma cacao]
Length=436

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LK+EN  L++  +E+   +K 
Sbjct  352  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKDENQELRKKHEEIMEMQKN  411

Query  712  EAFEEVKPTTPTKAQKASKKlrllrrTLSW  801
            +  E     T    Q A K+     +T  W
Sbjct  412  QVME-----TMNMQQGAKKRCLRRTQTGPW  436



>ref|XP_009795221.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana sylvestris]
Length=436

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRK  702
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L  KQA + EM + 
Sbjct  352  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQAEMMEMQKN  411

Query  703  RKQEAFE  723
            R QE   
Sbjct  412  RVQEMMN  418



>gb|AGG39700.1| bZIP transcription factor bZIP8 [Camellia sinensis]
Length=436

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  +E+   +K 
Sbjct  352  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKQEEIMELQKN  411

Query  712  EAFE  723
            +  E
Sbjct  412  QVLE  415



>gb|EPS63836.1| hypothetical protein M569_10951, partial [Genlisea aurea]
Length=335

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEM  693
            +EKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+N+LKEEN +L +   EM
Sbjct  280  LEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVNKLKEENEALMRKQAEM  333



>ref|XP_008793932.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Phoenix 
dactylifera]
Length=280

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRK  708
            PV++VV +RQ+RMIKNRESAARSR RKQAYTVELE+ + QL+EENA L +  +E  ++R 
Sbjct  193  PVDRVVLQRQKRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLKYQEEQHKERL  252

Query  709  QEAFEEVKPTTPTKAQKAS  765
            Q+  E V P T  K  K S
Sbjct  253  QQLMENVIPVTENKKPKLS  271



>ref|XP_008794151.1| PREDICTED: LOW QUALITY PROTEIN: bZIP transcription factor TRAB1-like 
[Phoenix dactylifera]
Length=412

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE+N  L++  +EM   +K 
Sbjct  328  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEQNQELQKKQEEMMEMQKN  387

Query  712  EAFEEVK  732
            +  E + 
Sbjct  388  KVLEIIN  394



>ref|XP_004142865.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like [Cucumis 
sativus]
 gb|KGN62498.1| hypothetical protein Csa_2G357210 [Cucumis sativus]
Length=411

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            V+KVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L+Q   E+   +K 
Sbjct  327  VDKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRQKQAEIMEMQKN  386

Query  712  EAFE  723
             A E
Sbjct  387  RALE  390



>ref|XP_002456667.1| hypothetical protein SORBIDRAFT_03g040510 [Sorghum bicolor]
 gb|EES01787.1| hypothetical protein SORBIDRAFT_03g040510 [Sorghum bicolor]
Length=401

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
             EK VERRQRRMIKNRESAARSRARKQAYTVELEAELN LKEEN  L+   +E+  K  +
Sbjct  321  TEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENERLR--AEELVEKMME  378

Query  712  EAFEEV  729
            +A E V
Sbjct  379  QARENV  384



>ref|XP_010552514.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Tarenaya hassleriana]
Length=470

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +1

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRM  567
            +G  SPV+P+S DG     G   G+            GG R R   G VEKVVERRQRRM
Sbjct  302  IGGASPVTPLSTDG----TGKSNGDTSSVSPLPYMFSGGMRGRKSSGAVEKVVERRQRRM  357

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQE  714
            IKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   EM   +K +
Sbjct  358  IKNRESAARSRARKQAYTMELEAEIAKLKEENQELRKKQAEMMEMQKNQ  406



>ref|XP_008444613.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Cucumis 
melo]
Length=411

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            V+KVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L+Q   E+   +K 
Sbjct  327  VDKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRQKQAEIMEMQKN  386

Query  712  EAFE  723
             A E
Sbjct  387  RALE  390



>ref|XP_006307554.1| hypothetical protein CARUB_v10009177mg, partial [Capsella rubella]
 gb|EOA40452.1| hypothetical protein CARUB_v10009177mg, partial [Capsella rubella]
Length=438

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 70/108 (65%), Gaps = 8/108 (7%)
 Frame = +1

Query  400  SPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRMIKNR  579
            SPV+P+S +GL     G        L        GG +    G VEKVVERRQRRMIKNR
Sbjct  315  SPVTPLSSEGL-----GKSNGDCSSLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNR  369

Query  580  ESAARSRARKQAYTVELEAELNQLKEENASL--KQA-LDEMDRKRKQE  714
            ESAARSRARKQAYTVELEAE+ +LKEEN  L  KQA + EM + ++ E
Sbjct  370  ESAARSRARKQAYTVELEAEVAKLKEENDELQRKQAKIMEMQKNQEME  417



>gb|AEQ94117.1| putative abscissic acid [Elaeis guineensis]
Length=356

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++  +EM   +K 
Sbjct  272  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKELNQELQKKQEEMMEMQKN  331

Query  712  EAFEEVK  732
            +  E + 
Sbjct  332  KVLEIIN  338



>ref|XP_007222748.1| hypothetical protein PRUPE_ppa006503mg [Prunus persica]
 gb|EMJ23947.1| hypothetical protein PRUPE_ppa006503mg [Prunus persica]
Length=409

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALD  687
            PVEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++  D
Sbjct  335  PVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELQKKQD  387



>ref|XP_008378039.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Malus domestica]
Length=420

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +1

Query  529  PVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEM-DRKR  705
            PVEKVVERRQRRMIKNRESAARSRARKQAYT ELEAE+ +LKEEN  L +   EM + ++
Sbjct  335  PVEKVVERRQRRMIKNRESAARSRARKQAYTTELEAEVAELKEENQELLKKQAEMVEMQK  394

Query  706  KQEAFEEVK  732
             Q+  E + 
Sbjct  395  NQQDLEIIN  403



>ref|XP_002436690.1| hypothetical protein SORBIDRAFT_10g007090 [Sorghum bicolor]
 gb|EER88057.1| hypothetical protein SORBIDRAFT_10g007090 [Sorghum bicolor]
Length=325

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 10/114 (9%)
 Frame = +1

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQH---YGLDTgirgggggrkriidgPVEKVVERRQ  558
            + + +P +PV  +G+     GD  +     Y  DT +R   G         VEKVVERRQ
Sbjct  218  MTVAAPTTPVVLNGMGKVEAGDLSSLSPVPYPFDTALRVRKGPT-------VEKVVERRQ  270

Query  559  RRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAF  720
            RRMIKNRESAARSRARKQAY +ELEAE+ +LK++N  L++   EM +K+K E +
Sbjct  271  RRMIKNRESAARSRARKQAYIMELEAEVAKLKDQNDELQKKQVEMLKKQKDEKY  324



>ref|XP_010943073.1| PREDICTED: bZIP transcription factor TRAB1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010943074.1| PREDICTED: bZIP transcription factor TRAB1 isoform X1 [Elaeis 
guineensis]
Length=403

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++  +EM   +K 
Sbjct  319  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKELNQELQKKQEEMMEMQKN  378

Query  712  EAFEEVK  732
            +  E + 
Sbjct  379  KVLEIIN  385



>ref|XP_010061749.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Eucalyptus 
grandis]
 gb|KCW68736.1| hypothetical protein EUGRSUZ_F02337 [Eucalyptus grandis]
 gb|KCW68737.1| hypothetical protein EUGRSUZ_F02337 [Eucalyptus grandis]
 gb|KCW68738.1| hypothetical protein EUGRSUZ_F02337 [Eucalyptus grandis]
Length=437

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 70/113 (62%), Gaps = 5/113 (4%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
            G+  GSP +PVS DG+     G        +        G  +R  +  VEKVVERRQRR
Sbjct  309  GMPTGSPANPVSSDGM-----GRSNGDTSSVSPVPYVFNGSVRRKCNSAVEKVVERRQRR  363

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFE  723
            MIKNRESAARSRARKQAYT+ELEAE+ +LK+EN  L++   E+   +K +  E
Sbjct  364  MIKNRESAARSRARKQAYTMELEAEVAKLKDENEELRKKQAEIMEIQKNQVKE  416



>ref|XP_006659491.1| PREDICTED: bZIP transcription factor TRAB1-like [Oryza brachyantha]
Length=167

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  535  EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEM  693
            EKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE+N  L++  +EM
Sbjct  76   EKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKKQEEM  128



>gb|KDP38330.1| hypothetical protein JCGZ_04255 [Jatropha curcas]
Length=413

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   E+   +K 
Sbjct  329  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKQTEIMEMQKN  388

Query  712  EAFE  723
            +  E
Sbjct  389  QVLE  392



>ref|NP_001057118.1| Os06g0211200 [Oryza sativa Japonica Group]
 dbj|BAD35712.1| putative bZIP transcription factor [Oryza sativa Japonica Group]
 dbj|BAD35171.1| putative bZIP transcription factor [Oryza sativa Japonica Group]
 dbj|BAF19032.1| Os06g0211200 [Oryza sativa Japonica Group]
 dbj|BAG95943.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97190.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADK60888.1| putative expressed bZIP transcription factor [Oryza sativa]
Length=324

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAY +ELEAE+ +LKE+ A L++   EM +K+  
Sbjct  238  VEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKEQKAELQKKQVEMIQKQND  297

Query  712  EAFEEVKPTTPTKAQK  759
            E  E +      KA++
Sbjct  298  EVMERITQQLGPKAKR  313



>ref|XP_009598935.1| PREDICTED: bZIP transcription factor TRAB1-like [Nicotiana tomentosiformis]
Length=442

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   EM   +K 
Sbjct  358  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQAEMMEMQKN  417

Query  712  EAFE  723
            +  E
Sbjct  418  QVQE  421



>ref|XP_009399710.1| PREDICTED: bZIP transcription factor TRAB1-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKV+ERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++  ++M   +K 
Sbjct  323  VEKVLERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKELNEELQKKQEKMMDMQKH  382

Query  712  EAFEEVK  732
            + FE + 
Sbjct  383  QVFEIIN  389



>ref|XP_009403361.1| PREDICTED: bZIP transcription factor TRAB1 [Musa acuminata subsp. 
malaccensis]
Length=383

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKV+ERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE+N  L++   EM   +K 
Sbjct  299  VEKVIERRQRRMIKNRESAARSRARKQAYTMELEAEVEKLKEQNQELQEKQAEMMEMQKN  358

Query  712  EAFEEVKPTTPTK  750
            +  + +     TK
Sbjct  359  QDLQMISQLHGTK  371



>ref|XP_011017194.1| PREDICTED: bZIP transcription factor TRAB1-like [Populus euphratica]
Length=454

 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   EM   +K 
Sbjct  370  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQAEMMEIQKN  429

Query  712  EAFE  723
            +  E
Sbjct  430  QVAE  433



>ref|XP_008807330.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Phoenix 
dactylifera]
Length=334

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 109/251 (43%), Gaps = 64/251 (25%)
 Frame = +1

Query  22   TQRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVA  201
             +RQ T GEMTLEDFLV+AGVV E                       N+    + P   A
Sbjct  122  CERQSTLGEMTLEDFLVKAGVVVE-----------------GCAKDVNDIMGNVGPVGSA  164

Query  202  RPVMGLG--GGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSA----  363
             P  GL   G GA    Q      +     G     G Y  PS PV    +G G++    
Sbjct  165  NPAAGLQDFGQGAHWLQQYHQMSAMDQHQQGQQSMMGAYV-PSCPVPQP-LGLGTSPILD  222

Query  364  ----VGYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgP  531
                 G  ++    LG+   P +P G      GDG                         
Sbjct  223  AVFPDGQMNISSPRLGALSDPQTPPGRKRAASGDG-------------------------  257

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
             +++VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN  LK          KQ
Sbjct  258  TDRLVERRQKRMIKNRESAARSRARKQAYTNELEIKVSRLEEENVRLK----------KQ  307

Query  712  EAFEEVKPTTP  744
            +  E++  + P
Sbjct  308  KELEKILFSVP  318



>gb|EEE65317.1| hypothetical protein OsJ_20562 [Oryza sativa Japonica Group]
Length=363

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAY +ELEAE+ +LKE+ A L++   EM +K+  
Sbjct  238  VEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKEQKAELQKKQVEMIQKQND  297

Query  712  EAFEEVKPTTPTKAQK  759
            E  E +      KA++
Sbjct  298  EVMERITQQLGPKAKR  313



>gb|ABP88226.1| transcription factor bZIP71, partial [Glycine max]
Length=153

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKV+ERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   E+   +K 
Sbjct  69   VEKVIERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQAEIMEIQKN  128

Query  712  EAFE  723
            +  E
Sbjct  129  QVKE  132



>ref|XP_006649073.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like [Oryza 
brachyantha]
Length=239

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSR RKQAY +ELEAE+ +LKE N  L++  DE+  ++K 
Sbjct  153  IEKVVERRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNEELQKKQDEILEQQKN  212

Query  712  EAFEEV  729
            E  E +
Sbjct  213  EVLERM  218



>gb|EMT17350.1| ABSCISIC ACID-INSENSITIVE 5-like protein 2 [Aegilops tauschii]
Length=306

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 102/224 (46%), Gaps = 56/224 (25%)
 Frame = +1

Query  25   QRQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVAR  204
            +RQ TFGEMTLEDFLV+AGV                                +A  ++  
Sbjct  123  ERQPTFGEMTLEDFLVKAGV--------------------------------VAEGHLKD  150

Query  205  PVMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGG------YAQPSPPVYGGRMGNGSAV  366
             +      GAV        G  V EA   P    G      Y +P  P   G     S +
Sbjct  151  LIDLPANMGAV--------GRSVIEAAAPPSLNPGAHWLQQYLEPQHPSMAGPF-MASHL  201

Query  367  GYAHMQGLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVV  546
            G   +  +  G+ + P+ PDG   +P  D                  ++   DG  +KVV
Sbjct  202  GPQPL-SVATGAIMEPIYPDGQITSPMLDA--------LSDPQTPRRKRGASDGVTDKVV  252

Query  547  ERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQ  678
            ERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN  LK+
Sbjct  253  ERRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK  296



>ref|XP_010263531.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010263532.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010263533.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform 
X1 [Nelumbo nucifera]
Length=422

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LK+EN  L++   E+ + +K 
Sbjct  337  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKDENQELQKKQAEIMQMQKN  396

Query  712  EAFEEVK  732
            +  E + 
Sbjct  397  QVLEMIN  403



>ref|XP_010939411.1| PREDICTED: bZIP transcription factor TRAB1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939412.1| PREDICTED: bZIP transcription factor TRAB1 isoform X1 [Elaeis 
guineensis]
Length=410

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LK +N  L++  +EM   +K 
Sbjct  326  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKAQNQDLQKKQEEMMEMQKN  385

Query  712  EAFEEVK  732
            +  E + 
Sbjct  386  QVLEIIN  392



>ref|NP_001290004.1| ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010685236.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Beta vulgaris 
subsp. vulgaris]
 emb|CAP66259.1| ABA-responsive element binding protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=489

 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 6/90 (7%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            V+KVVERRQRRMIKNRESAARSRARKQAYT+ELE E+ +LKEEN  L++   E+   +K 
Sbjct  406  VDKVVERRQRRMIKNRESAARSRARKQAYTMELEQEVQKLKEENQELRKKQAEIMEMQKN  465

Query  712  EAFEEVKPTTPTKAQKASKKlrllrrTLSW  801
            +  E +       AQ  S+K     +T  W
Sbjct  466  QVMEMI------NAQSGSRKKLRRTQTGPW  489



>ref|XP_002302435.1| bZIP transcription factor 6 family protein [Populus trichocarpa]
 gb|EEE81708.1| bZIP transcription factor 6 family protein [Populus trichocarpa]
Length=456

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   EM   +K 
Sbjct  372  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQAEMMEIQKN  431

Query  712  EAFE  723
            +  E
Sbjct  432  QVAE  435



>ref|XP_008373133.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Malus 
domestica]
 ref|XP_008373134.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 [Malus 
domestica]
Length=431

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE N  L++  +E+   +K 
Sbjct  347  VEKVVERRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNEELQKKQEEIVEMQKD  406

Query  712  EAFEEVK  732
            +  E +K
Sbjct  407  QMLETMK  413



>gb|EEE57861.1| hypothetical protein OsJ_08504 [Oryza sativa Japonica Group]
Length=342

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSR RKQAY +ELEAE+ +LKE N  L++  DEM  ++K 
Sbjct  256  IEKVVERRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEMLEQQKN  315

Query  712  EAFEEV  729
            E  E +
Sbjct  316  EVLERM  321



>gb|EAY87653.1| hypothetical protein OsI_09065 [Oryza sativa Indica Group]
Length=360

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSR RKQAY +ELEAE+ +LKE N  L++  DEM  ++K 
Sbjct  274  IEKVVERRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEMLEQQKN  333

Query  712  EAFEEV  729
            E  E +
Sbjct  334  EVLERM  339



>ref|XP_006471287.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2-like [Citrus 
sinensis]
Length=317

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 103/234 (44%), Gaps = 56/234 (24%)
 Frame = +1

Query  28   RQVTFGEMTLEDFLVRAGVVREQGntaappparpqqyaaaamypnnntpaaIAPTYVARP  207
            RQ T GEMTLEDFLV+AGVV E                  +  P       + P +   P
Sbjct  120  RQPTLGEMTLEDFLVKAGVVAE------------ASSDKKSDGPVVGVDQNVVPQF---P  164

Query  208  VMGLGGGGAVPAYQALPQGGVVAEAPGYPKRGGGYAQPSPPVYGGRMGNGSAVGYAHMQG  387
              G       P YQ   Q  +    PG P       QP   V G  M     V +   Q 
Sbjct  165  QQGPWMPYPHPQYQHSQQSMMGVYMPGQP-----IPQPMNMVTGAVMD----VSFPENQ-  214

Query  388  LGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRRM  567
            +GL SP       G   +P   G  +    D                 +EK VERRQ+RM
Sbjct  215  VGLTSPSM-----GTLSDPQLLGRKRGASEDM----------------IEKTVERRQKRM  253

Query  568  IKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQEAFEEV  729
            IKNRESAARSRARKQAYT ELE ++++L+EEN          +R RKQ+  E++
Sbjct  254  IKNRESAARSRARKQAYTNELENKVSRLEEEN----------ERLRKQKELEKM  297



>ref|NP_001048225.1| Os02g0766700 [Oryza sativa Japonica Group]
 dbj|BAD17130.1| putative bZIP transcription factor ABI5 [Oryza sativa Japonica 
Group]
 dbj|BAD17318.1| putative bZIP transcription factor ABI5 [Oryza sativa Japonica 
Group]
 dbj|BAF10139.1| Os02g0766700 [Oryza sativa Japonica Group]
 dbj|BAG92808.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSR RKQAY +ELEAE+ +LKE N  L++  DEM  ++K 
Sbjct  271  IEKVVERRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEMLEQQKN  330

Query  712  EAFEEV  729
            E  E +
Sbjct  331  EVLERM  336



>ref|XP_009406635.1| PREDICTED: bZIP transcription factor TRAB1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            +EKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE+N  L++   EM   +K 
Sbjct  314  LEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEQNQELQEKQAEMMEMQKN  373

Query  712  EAFEEVK  732
            +  + + 
Sbjct  374  QVLQMIN  380



>ref|XP_002510209.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52396.1| DNA binding protein, putative [Ricinus communis]
Length=422

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  532  VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENASLKQALDEMDRKRKQ  711
            VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKEEN  L++   E+   +K 
Sbjct  339  VEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKQAEIMEMQKN  398

Query  712  EAFE  723
            +  E
Sbjct  399  QVME  402



>gb|KCW68739.1| hypothetical protein EUGRSUZ_F02337 [Eucalyptus grandis]
Length=415

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 67/106 (63%), Gaps = 7/106 (7%)
 Frame = +1

Query  385  GLGLGSPVSPVSPDGLCVNPGGDGGNQHYGLDTgirgggggrkriidgPVEKVVERRQRR  564
            G+  GSP +PVS DG+     G        +        G  +R  +  VEKVVERRQRR
Sbjct  309  GMPTGSPANPVSSDGM-----GRSNGDTSSVSPVPYVFNGSVRRKCNSAVEKVVERRQRR  363

Query  565  MIKNRESAARSRARKQAYTVELEAELNQLKEENASL--KQALDEMD  696
            MIKNRESAARSRARKQAYT+ELEAE+ +LK+EN  L  KQ L  +D
Sbjct  364  MIKNRESAARSRARKQAYTMELEAEVAKLKDENEELRKKQVLLCLD  409



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2809052750556