BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30459_g1_i1 len=976 path=[954:0-975]

Length=976
                                                                      Score     E

ref|XP_009626653.1|  PREDICTED: CASP-like protein 1F2                   203   1e-60   
ref|XP_009760374.1|  PREDICTED: CASP-like protein 1F2                   200   2e-59   
ref|XP_009766471.1|  PREDICTED: CASP-like protein 1F2                   185   3e-53   
ref|XP_004241458.1|  PREDICTED: CASP-like protein 1F1                   183   5e-53   
ref|XP_009591667.1|  PREDICTED: CASP-like protein 1F2                   183   7e-53   
ref|XP_006347352.1|  PREDICTED: CASP-like protein VIT_17s0000g005...    182   2e-52   
ref|XP_006347351.1|  PREDICTED: CASP-like protein VIT_17s0000g005...    181   3e-52   
ref|XP_004241459.1|  PREDICTED: CASP-like protein 1F1                   175   1e-49   
ref|XP_009618377.1|  PREDICTED: CASP-like protein 1F1                   160   5e-44   
ref|XP_011083382.1|  PREDICTED: CASP-like protein 1F1                   160   5e-44   
ref|XP_008374192.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430     158   3e-43   
ref|XP_008386322.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430     157   5e-43   
ref|XP_010678315.1|  PREDICTED: CASP-like protein 1F2 isoform X1        157   8e-43   
ref|XP_009589659.1|  PREDICTED: CASP-like protein 1F1                   157   9e-43   
ref|XP_007209668.1|  hypothetical protein PRUPE_ppa012166mg             156   2e-42   
ref|XP_011073119.1|  PREDICTED: CASP-like protein 1F1                   155   3e-42   
ref|XP_006363994.1|  PREDICTED: CASP-like protein VIT_17s0000g005...    153   2e-41   
gb|EYU32920.1|  hypothetical protein MIMGU_mgv1a014795mg                152   3e-41   
ref|XP_002280714.1|  PREDICTED: CASP-like protein 1F1                   152   3e-41   Vitis vinifera
sp|B9IFI5.1|CSPLH_POPTR  RecName: Full=CASP-like protein 1F1; Sho...    152   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_004235355.1|  PREDICTED: CASP-like protein 1F1 isoform X1        152   5e-41   
ref|XP_011002112.1|  PREDICTED: CASP-like protein 1F1                   152   7e-41   
sp|A7PHN8.2|CSPL4_VITVI  RecName: Full=CASP-like protein 1F1; Sho...    152   7e-41   Vitis vinifera
gb|EYU43016.1|  hypothetical protein MIMGU_mgv1a014654mg                149   5e-40   
ref|XP_009618375.1|  PREDICTED: CASP-like protein 1F1                   149   9e-40   
emb|CDO98667.1|  unnamed protein product                                151   1e-39   
ref|XP_009766722.1|  PREDICTED: CASP-like protein 1F1                   149   1e-39   
ref|XP_009337529.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430     148   2e-39   
ref|XP_004297505.1|  PREDICTED: CASP-like protein VIT_17s0000g005...    147   6e-39   
ref|XP_002511115.1|  conserved hypothetical protein                     145   3e-38   Ricinus communis
ref|XP_011042940.1|  PREDICTED: CASP-like protein 1F2 isoform X1        145   3e-38   
ref|XP_002318159.1|  hypothetical protein POPTR_0012s10610g             145   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010318325.1|  PREDICTED: CASP-like protein 1F1                   144   4e-38   
ref|XP_006436922.1|  hypothetical protein CICLE_v10032880mg             139   3e-36   
gb|KDO44503.1|  hypothetical protein CISIN_1g039472mg                   140   6e-36   
ref|XP_006485175.1|  PREDICTED: CASP-like protein RCOM_1504680-like     139   6e-36   
ref|XP_010249455.1|  PREDICTED: CASP-like protein 1F1                   136   2e-35   
ref|XP_009777999.1|  PREDICTED: CASP-like protein 1F1                   137   2e-35   
ref|XP_008239536.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430     137   4e-35   
ref|XP_010678316.1|  PREDICTED: CASP-like protein 1F1 isoform X2        135   1e-34   
ref|XP_011098938.1|  PREDICTED: CASP-like protein 1F1                   135   3e-34   
ref|XP_007038092.1|  CASP-like protein GSVIVT01008618001                134   4e-34   
ref|XP_003548964.1|  PREDICTED: CASP-like protein RCOM_1446020-like     129   2e-32   
ref|XP_006844552.1|  hypothetical protein AMTR_s00016p00178190          129   3e-32   
ref|XP_010682994.1|  PREDICTED: CASP-like protein 1F2                   127   1e-31   
ref|XP_010093945.1|  hypothetical protein L484_008838                   125   5e-31   
gb|AFK47640.1|  unknown                                                 125   9e-31   
ref|XP_007161657.1|  hypothetical protein PHAVU_001G087600g             125   1e-30   
ref|XP_006604179.1|  PREDICTED: CASP-like protein RCOM_1446020-like     125   1e-30   
gb|EYU31861.1|  hypothetical protein MIMGU_mgv1a019527mg                124   2e-30   
ref|XP_010028955.1|  PREDICTED: CASP-like protein 1F2                   123   6e-30   
ref|XP_008379068.1|  PREDICTED: CASP-like protein RCOM_1446020          121   3e-29   
ref|XP_011042941.1|  PREDICTED: CASP-like protein 1F2 isoform X2        119   6e-29   
ref|XP_010096062.1|  hypothetical protein L484_008718                   120   9e-29   
ref|XP_006446979.1|  hypothetical protein CICLE_v10016868mg             119   1e-28   
emb|CBI21300.3|  unnamed protein product                                117   2e-28   
ref|XP_009352297.1|  PREDICTED: CASP-like protein RCOM_1446020          119   2e-28   
ref|XP_008341274.1|  PREDICTED: CASP-like protein RCOM_1446020          119   2e-28   
ref|XP_009378018.1|  PREDICTED: CASP-like protein RCOM_1446020          119   3e-28   
ref|XP_002274297.1|  PREDICTED: CASP-like protein 1F2                   118   5e-28   Vitis vinifera
gb|KDO46460.1|  hypothetical protein CISIN_1g030053mg                   117   7e-28   
emb|CAN77740.1|  hypothetical protein VITISV_043317                     116   3e-27   Vitis vinifera
gb|KHG12313.1|  CASP-like protein                                       115   4e-27   
ref|XP_009783527.1|  PREDICTED: CASP-like protein 1F1                   112   4e-27   
gb|KHF99186.1|  CASP-like protein                                       115   6e-27   
ref|XP_007031972.1|  CASP-like protein RCOM_1446020, putative           113   3e-26   
gb|KDP22559.1|  hypothetical protein JCGZ_26390                         112   3e-26   
ref|XP_004492988.1|  PREDICTED: CASP-like protein RCOM_1446020-like     111   2e-25   
ref|XP_007217365.1|  hypothetical protein PRUPE_ppa022990mg             110   2e-25   
ref|XP_008231051.1|  PREDICTED: CASP-like protein RCOM_1446020          110   5e-25   
ref|XP_004304550.1|  PREDICTED: CASP-like protein RCOM_1446020-like     108   2e-24   
ref|XP_002512876.1|  conserved hypothetical protein                     107   6e-24   Ricinus communis
ref|XP_006373121.1|  hypothetical protein POPTR_0017s08910g             105   1e-23   
ref|XP_011045779.1|  PREDICTED: CASP-like protein 1F3                   105   3e-23   
ref|XP_002298661.1|  hypothetical protein POPTR_0001s33100g             104   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006844549.1|  hypothetical protein AMTR_s00016p00177260          104   5e-23   
ref|XP_011005490.1|  PREDICTED: CASP-like protein 1F3                   103   1e-22   
ref|XP_003624429.1|  hypothetical protein MTR_7g083120                  102   3e-22   
gb|EPS58442.1|  hypothetical protein M569_16372                       99.4    4e-22   
ref|XP_008464379.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430     101   4e-22   
gb|KCW88131.1|  hypothetical protein EUGRSUZ_A00525                   99.4    8e-22   
ref|XP_004138247.1|  PREDICTED: CASP-like protein POPTRDRAFT_8234...  97.4    2e-20   
ref|XP_006844548.1|  hypothetical protein AMTR_s00016p00176090        95.5    6e-20   
ref|XP_006282498.1|  hypothetical protein CARUB_v10006640mg           94.0    1e-19   
emb|CDX92668.1|  BnaC07g39260D                                        89.4    6e-18   
ref|XP_009137491.1|  PREDICTED: CASP-like protein At4g25040           89.0    8e-18   
emb|CDY11050.1|  BnaA03g47090D                                        88.2    9e-18   
ref|XP_002321739.2|  hypothetical protein POPTR_0015s11480g           85.1    2e-17   Populus trichocarpa [western balsam poplar]
emb|CDP16726.1|  unnamed protein product                              88.6    3e-17   
ref|XP_010448483.1|  PREDICTED: CASP-like protein 1F1                 86.7    5e-17   
ref|XP_006413351.1|  hypothetical protein EUTSA_v10026410mg           86.3    7e-17   
emb|CDY03385.1|  BnaC01g16970D                                        84.3    4e-16   
ref|XP_009138787.1|  PREDICTED: CASP-like protein At4g25040           84.3    4e-16   
gb|KDP20967.1|  hypothetical protein JCGZ_21438                       83.6    6e-16   
gb|AAM63685.1|  unknown                                               83.6    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194234.1|  CASP-like protein                                   83.6    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531853.1|  PREDICTED: CASP-like protein 1F1                 82.4    1e-15   
ref|XP_010438928.1|  PREDICTED: CASP-like protein 1F1                 82.4    2e-15   
ref|XP_002869692.1|  integral membrane family protein                 82.0    2e-15   
ref|XP_010433695.1|  PREDICTED: CASP-like protein 1F1                 81.3    4e-15   
ref|XP_009109230.1|  PREDICTED: CASP-like protein At4g25040           80.1    1e-14   
gb|KFK28997.1|  hypothetical protein AALP_AA7G075900                  80.1    1e-14   
ref|XP_007043593.1|  CASP-like protein POPTRDRAFT_270504              79.7    1e-14   
ref|XP_004506615.1|  PREDICTED: CASP-like protein RCOM_1174750-like   78.6    4e-14   
gb|KDP24131.1|  hypothetical protein JCGZ_25788                       78.6    4e-14   
ref|XP_006371562.1|  integral membrane family protein                 76.6    2e-13   
ref|XP_006376496.1|  integral membrane family protein                 76.6    2e-13   
ref|XP_007198888.1|  hypothetical protein PRUPE_ppa020481mg           75.9    3e-13   
emb|CDO99544.1|  unnamed protein product                              75.9    3e-13   
ref|XP_010925917.1|  PREDICTED: CASP-like protein 1F2                 76.6    4e-13   
ref|XP_011037328.1|  PREDICTED: CASP-like protein 1C3                 75.9    4e-13   
ref|XP_003528452.1|  PREDICTED: CASP-like protein POPTRDRAFT_7589...  75.5    5e-13   
sp|A7PJ32.1|CSPL2_VITVI  RecName: Full=CASP-like protein 1C2; Sho...  75.1    6e-13   Vitis vinifera
ref|XP_002272783.1|  PREDICTED: CASP-like protein 1C2                 75.1    7e-13   Vitis vinifera
ref|XP_008229156.1|  PREDICTED: CASP-like protein RCOM_1174750        74.7    1e-12   
gb|KHG04935.1|  CASP-like protein                                     74.3    1e-12   
ref|XP_007132660.1|  hypothetical protein PHAVU_011G114000g           73.9    2e-12   
gb|EYU43392.1|  hypothetical protein MIMGU_mgv1a026498mg              73.9    2e-12   
ref|XP_006467803.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  73.6    2e-12   
gb|KDO75960.1|  hypothetical protein CISIN_1g047574mg                 73.6    2e-12   
ref|XP_011086074.1|  PREDICTED: CASP-like protein 1C1 isoform X1      73.2    3e-12   
ref|XP_007025630.1|  CASP-like protein POPTRDRAFT_758901              73.6    3e-12   
ref|XP_002517919.1|  conserved hypothetical protein                   73.2    3e-12   Ricinus communis
ref|XP_010110215.1|  hypothetical protein L484_009820                 73.2    3e-12   
gb|KEH17619.1|  CASP POPTRDRAFT-like protein                          73.2    3e-12   
ref|XP_010915912.1|  PREDICTED: CASP-like protein 1F2                 72.8    5e-12   
ref|XP_004295628.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  72.4    6e-12   
ref|XP_009402195.1|  PREDICTED: CASP-like protein VIT_17s0000g00560   73.6    8e-12   
ref|XP_008783145.1|  PREDICTED: CASP-like protein RCOM_1174750        72.0    9e-12   
ref|XP_008381244.1|  PREDICTED: CASP-like protein RCOM_1174750        71.6    1e-11   
ref|XP_011002897.1|  PREDICTED: CASP-like protein 1C2                 71.6    1e-11   
gb|EYU27969.1|  hypothetical protein MIMGU_mgv1a015260mg              71.6    1e-11   
gb|KFK42715.1|  hypothetical protein AALP_AA1G030500                  71.2    2e-11   
ref|XP_009341975.1|  PREDICTED: CASP-like protein RCOM_1174750        70.9    2e-11   
ref|XP_003539921.1|  PREDICTED: CASP-like protein RCOM_1174750-like   70.5    3e-11   
ref|XP_011043373.1|  PREDICTED: CASP-like protein 1C2                 70.1    4e-11   
ref|XP_008353784.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  70.1    4e-11   
ref|XP_004494327.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  70.5    4e-11   
gb|EPS70445.1|  hypothetical protein M569_04316                       71.2    5e-11   
ref|XP_006377352.1|  hypothetical protein POPTR_0011s05180g           69.7    5e-11   
ref|XP_010457381.1|  PREDICTED: CASP-like protein 1C2                 69.7    6e-11   
ref|XP_008368681.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  70.1    6e-11   
ref|XP_008371694.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   69.3    7e-11   
ref|XP_003527478.1|  PREDICTED: CASP-like protein POPTRDRAFT_2705...  69.3    7e-11   
ref|XP_006468217.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  69.7    7e-11   
ref|XP_009357855.1|  PREDICTED: CASP-like protein RCOM_1174750        69.3    8e-11   
ref|XP_010916001.1|  PREDICTED: CASP-like protein 1C1                 69.3    8e-11   
ref|NP_563689.1|  uncharacterized protein                             69.3    9e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMT01166.1|  hypothetical protein F775_04463                       68.9    1e-10   
ref|XP_002305799.1|  hypothetical protein POPTR_0004s04330g           68.9    1e-10   Populus trichocarpa [western balsam poplar]
dbj|BAN18425.1|  putative integral membrane family protein            67.0    1e-10   
dbj|BAN18428.1|  putative integral membrane family protein            67.0    1e-10   
dbj|BAN18440.1|  putative integral membrane family protein            67.0    1e-10   
emb|CDY18177.1|  BnaC05g02000D                                        68.9    1e-10   
ref|XP_009336197.1|  PREDICTED: CASP-like protein RCOM_1174750        68.6    1e-10   
gb|AEI28611.1|  hypothetical protein                                  68.6    1e-10   
ref|XP_010686498.1|  PREDICTED: CASP-like protein 1C1                 68.6    2e-10   
ref|XP_008225093.1|  PREDICTED: CASP-like protein POPTRDRAFT_758901   68.6    2e-10   
ref|XP_006418212.1|  hypothetical protein EUTSA_v10009824mg           68.2    2e-10   
ref|XP_009339377.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   67.8    2e-10   
ref|NP_001055014.1|  Os05g0245300                                     68.2    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306319.1|  hypothetical protein CARUB_v10012189mg           68.2    2e-10   
ref|XP_010482422.1|  PREDICTED: CASP-like protein 1C2                 68.2    2e-10   
ref|XP_010474998.1|  PREDICTED: CASP-like protein 1C2                 68.2    2e-10   
ref|XP_003566190.1|  PREDICTED: CASP-like protein 1C1-1               67.8    2e-10   
ref|XP_009385516.1|  PREDICTED: CASP-like protein VIT_17s0000g00560   68.2    3e-10   
dbj|BAN18439.1|  putative integral membrane family protein            65.9    3e-10   
dbj|BAN18429.1|  putative integral membrane family protein            65.5    4e-10   
ref|XP_009352921.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   66.6    5e-10   
ref|XP_009121772.1|  PREDICTED: CASP-like protein ARALYDRAFT_327471   67.0    5e-10   
ref|XP_010431136.1|  PREDICTED: CASP-like protein 1C1                 67.0    5e-10   
ref|XP_010272470.1|  PREDICTED: CASP-like protein 1C1                 67.0    5e-10   
dbj|BAN18447.1|  putative integral membrane family protein            65.1    7e-10   
ref|XP_002519061.1|  conserved hypothetical protein                   66.6    7e-10   Ricinus communis
ref|XP_002874862.1|  integral membrane family protein                 66.2    9e-10   
ref|XP_006396581.1|  hypothetical protein EUTSA_v10029027mg           66.2    1e-09   
ref|XP_010242914.1|  PREDICTED: CASP-like protein 1C2                 66.2    1e-09   
ref|XP_003568713.1|  PREDICTED: CASP-like protein 1C1                 65.9    1e-09   
sp|A9P0A6.1|CSPL5_PICSI  RecName: Full=CASP-like protein 1U1; Sho...  66.2    1e-09   Picea sitchensis
ref|XP_007213108.1|  hypothetical protein PRUPE_ppa023491mg           65.5    2e-09   
ref|XP_010036846.1|  PREDICTED: CASP-like protein 1E1                 65.9    2e-09   
ref|XP_007159387.1|  hypothetical protein PHAVU_002G234000g           65.5    2e-09   
gb|KHN35254.1|  CASP-like protein                                     65.1    2e-09   
ref|XP_006664182.1|  PREDICTED: CASP-like protein Os12g0610800-like   65.9    2e-09   
ref|XP_009401560.1|  PREDICTED: CASP-like protein MA4_106O17.50       65.9    2e-09   
ref|XP_008383741.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   64.7    2e-09   
ref|XP_009404424.1|  PREDICTED: CASP-like protein Sb09g008190         65.5    2e-09   
ref|XP_008790715.1|  PREDICTED: CASP-like protein VIT_17s0000g00560   65.1    3e-09   
ref|XP_009362157.1|  PREDICTED: CASP-like protein 9                   65.1    3e-09   
ref|XP_004136057.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  65.5    3e-09   
ref|NP_192263.1|  uncharacterized protein                             64.7    4e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30943.1|  hypothetical protein AALP_AA6G047600                  64.7    4e-09   
ref|XP_008451440.1|  PREDICTED: CASP-like protein VIT_07s0104g01350   65.1    4e-09   
gb|KGN43614.1|  hypothetical protein Csa_7G047980                     64.3    4e-09   
ref|XP_004137023.1|  PREDICTED: CASP-like protein RCOM_1174750-like   64.3    5e-09   
ref|XP_003625864.1|  hypothetical protein MTR_7g108130                64.7    5e-09   
gb|AFK37260.1|  unknown                                               64.7    6e-09   
ref|XP_004155522.1|  PREDICTED: CASP-like protein RCOM_1174750-like   63.9    6e-09   
ref|XP_009782616.1|  PREDICTED: CASP-like protein 1C2                 63.9    6e-09   
ref|XP_002440850.1|  hypothetical protein SORBIDRAFT_09g008190        63.9    6e-09   Sorghum bicolor [broomcorn]
ref|XP_006857311.1|  hypothetical protein AMTR_s00067p00068460        63.9    7e-09   
ref|XP_010035749.1|  PREDICTED: CASP-like protein 1C1                 63.5    7e-09   
ref|XP_006347042.1|  PREDICTED: CASP-like protein RCOM_0936380-like   63.5    9e-09   
ref|XP_006288774.1|  hypothetical protein CARUB_v10002095mg           63.5    1e-08   
ref|XP_004232873.1|  PREDICTED: CASP-like protein 1C1                 63.2    1e-08   
ref|XP_004298101.1|  PREDICTED: CASP-like protein 6-like              62.8    1e-08   
ref|XP_009393233.1|  PREDICTED: CASP-like protein 5                   63.5    1e-08   
ref|XP_009769324.1|  PREDICTED: CASP-like protein 1C2                 62.8    1e-08   
emb|CAB36746.1|  putative protein                                     62.4    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009605282.1|  PREDICTED: CASP-like protein 1C2                 62.8    2e-08   
ref|NP_001067249.1|  Os12g0610800                                     63.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002870225.1|  integral membrane family protein                 62.8    2e-08   
ref|NP_001148274.1|  CASP-like protein 1C2                            62.4    2e-08   Zea mays [maize]
sp|A2ZMM4.1|CSPL5_ORYSI  RecName: Full=CASP-like protein 1B1; Sho...  62.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010036836.1|  PREDICTED: CASP-like protein 1E1                 62.8    2e-08   
ref|XP_011086075.1|  PREDICTED: CASP-like protein 1C1 isoform X2      61.6    3e-08   
ref|XP_006338436.1|  PREDICTED: casparian strip membrane protein ...  62.4    3e-08   
ref|XP_010904769.1|  PREDICTED: CASP-like protein 1E1                 62.4    3e-08   
emb|CDY09075.1|  BnaC08g10290D                                        62.0    4e-08   
gb|EEE53590.1|  hypothetical protein OsJ_36834                        62.8    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516873.1|  conserved hypothetical protein                   62.0    5e-08   Ricinus communis
ref|XP_004960681.1|  PREDICTED: CASP-like protein Sb09g008190-like    61.2    5e-08   
gb|ABA99368.1|  plant integral membrane protein TIGR01569 contain...  63.2    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002268702.1|  PREDICTED: CASP-like protein 1E1                 61.6    6e-08   Vitis vinifera
emb|CDM82549.1|  unnamed protein product                              61.2    6e-08   
sp|A7R333.1|CSPLB_VITVI  RecName: Full=CASP-like protein 1C1; Sho...  60.8    7e-08   Vitis vinifera
emb|CAN69352.1|  hypothetical protein VITISV_023954                   61.6    7e-08   Vitis vinifera
ref|XP_010666393.1|  PREDICTED: CASP-like protein 1E1                 61.2    8e-08   
ref|XP_008351606.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   61.2    8e-08   
emb|CDY22743.1|  BnaA08g05730D                                        61.2    9e-08   
ref|XP_009107849.1|  PREDICTED: CASP-like protein At4g15630           61.2    9e-08   
ref|XP_006414479.1|  hypothetical protein EUTSA_v10026349mg           60.8    9e-08   
ref|XP_007050797.1|  CASP protein GSVIVT01010992001, putative         60.8    1e-07   
ref|XP_006855416.1|  hypothetical protein AMTR_s00057p00159510        60.8    1e-07   
ref|XP_007035490.1|  CASP-like protein, putative                      62.0    1e-07   
ref|XP_004233179.1|  PREDICTED: CASP-like protein 1B2                 60.5    1e-07   
ref|NP_193297.1|  uncharacterized protein                             60.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036826.1|  PREDICTED: CASP-like protein 1E1                 60.5    1e-07   
gb|AAM67044.1|  unknown                                               60.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136705.1|  PREDICTED: CASP-like protein At4g15630           60.1    2e-07   
emb|CDX90578.1|  BnaA03g42030D                                        60.1    2e-07   
ref|XP_006654178.1|  PREDICTED: CASP-like protein BLE3-like           59.7    2e-07   
emb|CDY70062.1|  BnaAnng32480D                                        58.9    2e-07   
gb|EYU43899.1|  hypothetical protein MIMGU_mgv1a014325mg              59.7    2e-07   
ref|XP_009763947.1|  PREDICTED: casparian strip membrane protein 1    59.7    3e-07   
ref|XP_006342777.1|  PREDICTED: CASP-like protein 5-like              59.7    3e-07   
ref|XP_004304287.1|  PREDICTED: CASP-like protein 1-like              59.7    3e-07   
gb|KHN25032.1|  CASP-like protein 2                                   59.3    3e-07   
ref|XP_004503085.1|  PREDICTED: CASP-like protein 10-like             59.7    3e-07   
ref|XP_010449916.1|  PREDICTED: CASP-like protein 1E1                 59.3    4e-07   
ref|XP_010904767.1|  PREDICTED: CASP-like protein 1E1                 59.3    4e-07   
ref|XP_009390722.1|  PREDICTED: CASP-like protein RCOM_1174750        58.5    4e-07   
ref|XP_010440273.1|  PREDICTED: CASP-like protein 1E1                 58.9    5e-07   
ref|XP_010434939.1|  PREDICTED: CASP-like protein 1E1                 58.9    5e-07   
emb|CDY09749.1|  BnaC07g33120D                                        58.9    5e-07   
ref|XP_003556790.1|  PREDICTED: CASP-like protein 2-like              58.9    5e-07   
ref|XP_010542892.1|  PREDICTED: CASP-like protein 1C1                 58.5    5e-07   
ref|XP_003531310.1|  PREDICTED: CASP-like protein 9-like              58.9    5e-07   
gb|AAV43976.1|  unknown protein                                       58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40019.1|  hypothetical protein JCGZ_02017                       58.5    6e-07   
gb|KDO75081.1|  hypothetical protein CISIN_1g029843mg                 58.5    6e-07   
ref|XP_010245385.1|  PREDICTED: CASP-like protein 1E2                 58.9    6e-07   
ref|XP_010318323.1|  PREDICTED: CASP-like protein 1F1 isoform X2      57.4    6e-07   
ref|XP_008799288.1|  PREDICTED: CASP-like protein MA4_106O17.50       58.5    7e-07   
ref|XP_004490091.1|  PREDICTED: CASP-like protein MTR_5g041900-like   58.5    7e-07   
ref|XP_010434940.1|  PREDICTED: CASP-like protein 1E2                 58.5    7e-07   
ref|XP_010440274.1|  PREDICTED: CASP-like protein 1E2                 58.2    7e-07   
ref|NP_567473.1|  uncharacterized protein                             58.2    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449918.1|  PREDICTED: CASP-like protein 1E2                 58.2    9e-07   
ref|XP_009803956.1|  PREDICTED: CASP-like protein 1E1                 58.2    1e-06   
gb|KHN29787.1|  CASP-like protein 9                                   57.4    1e-06   
ref|XP_002870224.1|  integral membrane family protein                 57.8    1e-06   
ref|XP_004956013.1|  PREDICTED: CASP-like protein Sb02g009660-like    57.8    1e-06   
ref|XP_004297290.1|  PREDICTED: CASP-like protein 2-like              57.8    1e-06   
sp|D2KQI6.1|CSPL1_BETVM  RecName: Full=CASP-like protein Ni6; Alt...  57.8    1e-06   Beta vulgaris subsp. maritima [sea beet]
ref|NP_001235823.1|  CASP-like protein 6                              57.4    1e-06   
sp|B9S8Z3.2|CASP4_RICCO  RecName: Full=Casparian strip membrane p...  57.8    1e-06   Ricinus communis
emb|CBI32262.3|  unnamed protein product                              56.6    1e-06   
emb|CDY21972.1|  BnaC09g00780D                                        57.0    2e-06   
ref|XP_001779272.1|  predicted protein                                57.8    2e-06   
ref|XP_010548921.1|  PREDICTED: CASP-like protein 1E2                 57.4    2e-06   
gb|EYU34055.1|  hypothetical protein MIMGU_mgv1a020210mg              57.4    2e-06   
ref|XP_004134189.1|  PREDICTED: CASP-like protein 6-like              57.0    2e-06   
ref|XP_009369107.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   57.4    2e-06   
gb|AIC33063.1|  integral membrane family protein                      57.4    2e-06   
ref|XP_006643970.1|  PREDICTED: CASP-like protein OsI_01069-like      56.6    2e-06   
ref|NP_001241476.1|  CASP-like protein 1B1                            57.0    2e-06   
ref|XP_007022941.1|  CASP-like protein, putative                      57.0    2e-06   
ref|XP_006285126.1|  hypothetical protein CARUB_v10006465mg           57.0    2e-06   
gb|KDO82981.1|  hypothetical protein CISIN_1g044764mg                 56.6    2e-06   
ref|XP_004488207.1|  PREDICTED: CASP-like protein 9-like              57.0    3e-06   
ref|XP_009352216.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   56.6    3e-06   
ref|XP_006438724.1|  hypothetical protein CICLE_v10033634mg           56.6    3e-06   
ref|XP_008383356.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   56.6    3e-06   
ref|XP_008340843.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   56.6    3e-06   
emb|CBI26107.3|  unnamed protein product                              55.5    4e-06   
gb|KHN48115.1|  CASP-like protein 9                                   56.2    4e-06   
gb|AFK39780.1|  unknown                                               56.2    4e-06   
ref|XP_009119375.1|  PREDICTED: CASP-like protein At1g03700           55.8    4e-06   
ref|XP_003613862.1|  hypothetical protein MTR_5g041900                55.8    4e-06   
tpg|DAA39419.1|  TPA: membrane protein 4                              56.2    4e-06   
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                 56.2    5e-06   
ref|XP_006353028.1|  PREDICTED: CASP-like protein POPTRDRAFT_7982...  56.2    5e-06   
ref|XP_007163061.1|  hypothetical protein PHAVU_001G202900g           55.8    5e-06   
gb|AFK45120.1|  unknown                                               55.8    5e-06   
ref|XP_003607732.1|  hypothetical protein MTR_4g081880                55.8    5e-06   
ref|XP_010052312.1|  PREDICTED: CASP-like protein 1C3                 54.3    5e-06   
ref|XP_008339880.1|  PREDICTED: CASP-like protein 1                   55.8    5e-06   
ref|XP_006284585.1|  hypothetical protein CARUB_v10005811mg           55.8    5e-06   
ref|NP_180305.1|  uncharacterized protein                             56.2    6e-06   
ref|XP_010683571.1|  PREDICTED: CASP-like protein 1E1                 55.8    6e-06   
ref|XP_008225695.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   55.8    6e-06   
ref|XP_010245386.1|  PREDICTED: CASP-like protein 1D1                 55.8    6e-06   
gb|EAZ03696.1|  hypothetical protein OsI_25828                        55.8    7e-06   
ref|XP_010105029.1|  hypothetical protein L484_008470                 55.5    7e-06   
ref|XP_009353886.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   55.5    7e-06   
emb|CDP12619.1|  unnamed protein product                              56.6    7e-06   
ref|NP_001059526.1|  Os07g0442900                                     55.8    7e-06   
ref|XP_002317067.1|  integral membrane family protein                 55.5    8e-06   
gb|KHN45566.1|  CASP-like protein 9                                   55.5    8e-06   
ref|XP_010941794.1|  PREDICTED: CASP-like protein 1E2                 55.5    8e-06   
ref|XP_010904770.1|  PREDICTED: CASP-like protein 1E1                 55.5    9e-06   
ref|XP_003609584.1|  hypothetical protein MTR_4g118810                55.5    9e-06   
gb|AEJ82303.1|  casparian strip protein 3                             55.8    9e-06   
ref|XP_008438806.1|  PREDICTED: CASP-like protein 6                   55.1    9e-06   
ref|XP_006363407.1|  PREDICTED: casparian strip membrane protein ...  55.1    9e-06   
ref|XP_008455324.1|  PREDICTED: CASP-like protein RCOM_1174750        54.7    1e-05   
gb|KCW76245.1|  hypothetical protein EUGRSUZ_D00625                   54.3    1e-05   
sp|Q1EPG6.2|CSPL2_MUSAC  RecName: Full=CASP-like protein 1D1; Sho...  55.1    1e-05   
ref|XP_009419511.1|  PREDICTED: CASP-like protein MA4_106O17.52       55.1    1e-05   
gb|KDP40020.1|  hypothetical protein JCGZ_02018                       55.1    1e-05   
ref|XP_009630064.1|  PREDICTED: CASP-like protein 1E2 isoform X1      54.7    1e-05   
ref|XP_002882736.1|  integral membrane family protein                 55.1    1e-05   
gb|KEH16769.1|  CASP POPTRDRAFT-like protein                          55.1    1e-05   
gb|KFK36497.1|  hypothetical protein AALP_AA4G132200                  55.1    1e-05   
ref|XP_002312755.2|  hypothetical protein POPTR_0008s20950g           54.7    1e-05   
ref|XP_009794323.1|  PREDICTED: casparian strip membrane protein ...  54.3    2e-05   
ref|XP_007214738.1|  hypothetical protein PRUPE_ppa025143mg           54.3    2e-05   
ref|XP_004498223.1|  PREDICTED: CASP-like protein ARALYDRAFT_3274...  53.9    2e-05   
ref|XP_009609035.1|  PREDICTED: casparian strip membrane protein ...  54.3    2e-05   
sp|P0DI58.1|CSPL2_LOTJA  RecName: Full=CASP-like protein 2; Short...  54.3    2e-05   
gb|KDP41223.1|  hypothetical protein JCGZ_15630                       53.9    2e-05   
ref|XP_004229217.1|  PREDICTED: CASP-like protein 1E2                 54.3    2e-05   
ref|XP_006419657.1|  hypothetical protein CICLE_v10005989mg           54.3    2e-05   
ref|XP_010026145.1|  PREDICTED: CASP-like protein 1E1                 53.5    2e-05   
gb|KDP34883.1|  hypothetical protein JCGZ_09171                       54.3    2e-05   
ref|XP_006407435.1|  hypothetical protein EUTSA_v10021542mg           54.3    2e-05   
ref|XP_004486055.1|  PREDICTED: CASP-like protein 5-like              54.3    2e-05   
ref|XP_006836401.1|  hypothetical protein AMTR_s00092p00142720        54.3    2e-05   
ref|XP_010666392.1|  PREDICTED: CASP-like protein Ni6                 53.9    2e-05   
gb|KFK38524.1|  hypothetical protein AALP_AA3G125100                  53.9    3e-05   
emb|CDO98909.1|  unnamed protein product                              53.9    3e-05   
ref|NP_001151672.1|  CASP-like protein 1D1                            53.9    3e-05   
ref|XP_003546558.1|  PREDICTED: CASP-like protein 9-like              53.9    3e-05   
ref|XP_010497100.1|  PREDICTED: casparian strip membrane protein ...  53.9    3e-05   
ref|XP_003553094.1|  PREDICTED: CASP-like protein 10-like             53.9    3e-05   
ref|XP_006299322.1|  hypothetical protein CARUB_v10015479mg           53.9    3e-05   
ref|XP_010066899.1|  PREDICTED: casparian strip membrane protein ...  53.1    4e-05   
ref|XP_008390727.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   53.5    4e-05   
ref|XP_010042237.1|  PREDICTED: casparian strip membrane protein ...  53.1    4e-05   
tpg|DAA39418.1|  TPA: hypothetical protein ZEAMMB73_672916            53.5    4e-05   
ref|XP_006645889.1|  PREDICTED: CASP-like protein Os01g0363300-like   53.1    4e-05   
emb|CBI26108.3|  unnamed protein product                              52.8    4e-05   
ref|XP_010241324.1|  PREDICTED: CASP-like protein 1E1                 53.5    4e-05   
gb|KHN14990.1|  CASP-like protein 10                                  53.5    4e-05   
ref|NP_001239767.1|  CASP-like protein 2A2                            53.5    4e-05   
ref|XP_007138545.1|  hypothetical protein PHAVU_009G218200g           53.5    4e-05   
gb|EYU34054.1|  hypothetical protein MIMGU_mgv1a026542mg              52.8    4e-05   
ref|XP_009624212.1|  PREDICTED: CASP-like protein 1B2                 53.5    4e-05   
ref|XP_006410783.1|  hypothetical protein EUTSA_v10017240mg           53.5    5e-05   
gb|AFK37802.1|  unknown                                               53.1    5e-05   
gb|KHN08760.1|  CASP-like protein 10                                  53.1    5e-05   
ref|XP_006374567.1|  hypothetical protein POPTR_0015s11475g           52.0    5e-05   
dbj|BAK00793.1|  predicted protein                                    53.1    5e-05   
ref|XP_011011053.1|  PREDICTED: CASP-like protein 1B2                 53.1    5e-05   
gb|KCW55785.1|  hypothetical protein EUGRSUZ_I01612                   52.0    5e-05   
gb|KDP28089.1|  hypothetical protein JCGZ_13860                       52.8    5e-05   
ref|XP_006410782.1|  hypothetical protein EUTSA_v10017241mg           53.1    5e-05   
ref|XP_010524513.1|  PREDICTED: CASP-like protein 1E2                 52.8    5e-05   
sp|P0DI44.1|CASP1_SOLTU  RecName: Full=Casparian strip membrane p...  52.8    6e-05   
ref|XP_008229074.1|  PREDICTED: casparian strip membrane protein ...  53.1    6e-05   
ref|XP_004233369.1|  PREDICTED: casparian strip membrane protein 1    52.4    6e-05   
dbj|BAJ98797.1|  predicted protein                                    52.8    6e-05   
gb|KHG06274.1|  CASP-like protein F16                                 53.1    6e-05   
ref|XP_002300491.2|  hypothetical protein POPTR_0001s43290g           52.8    6e-05   
gb|KDO87387.1|  hypothetical protein CISIN_1g036940mg                 52.8    7e-05   
ref|XP_003542918.1|  PREDICTED: CASP-like protein 7-like isoform X1   52.4    7e-05   
gb|AAK52925.1|  salicylic acid-induced fragment 1 protein             52.0    7e-05   
ref|XP_007046042.1|  Casparian strip membrane protein 5, putative...  52.8    7e-05   
ref|XP_006444237.1|  hypothetical protein CICLE_v10023477mg           52.8    8e-05   
ref|XP_009369105.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   52.8    8e-05   
ref|XP_004141446.1|  PREDICTED: casparian strip membrane protein ...  52.4    8e-05   
ref|XP_002276229.1|  PREDICTED: CASP-like protein 1D1                 52.8    8e-05   
sp|P0DI21.1|CSPL2_OSMLA  RecName: Full=CASP-like protein 2U1; Sho...  52.0    8e-05   
ref|XP_011040570.1|  PREDICTED: CASP-like protein 1B1                 52.4    8e-05   
sp|Q8W4Z5.1|CSPL1_GOSHI  RecName: Full=CASP-like protein F16; Alt...  52.4    9e-05   
ref|XP_003630011.1|  hypothetical protein MTR_8g089300                52.4    9e-05   
gb|KCW58540.1|  hypothetical protein EUGRSUZ_H01205                   52.4    1e-04   
ref|XP_006417050.1|  hypothetical protein EUTSA_v10008800mg           52.0    1e-04   
ref|XP_007154229.1|  hypothetical protein PHAVU_003G101100g           52.0    1e-04   
ref|XP_008438805.1|  PREDICTED: CASP-like protein 5                   52.0    1e-04   
ref|XP_007046043.1|  Casparian strip membrane protein 5, putative...  52.4    1e-04   
ref|XP_007015764.1|  Casparian strip membrane protein 3, putative     52.0    1e-04   
ref|XP_008459331.1|  PREDICTED: CASP-like protein 1                   52.4    1e-04   
gb|AES70869.2|  CASP POPTRDRAFT-like protein                          52.4    1e-04   
ref|XP_011090846.1|  PREDICTED: CASP-like protein 1E2                 52.8    1e-04   
ref|XP_004303525.1|  PREDICTED: casparian strip membrane protein ...  52.0    1e-04   
ref|XP_003567679.1|  PREDICTED: CASP-like protein 1E1                 52.0    1e-04   
ref|XP_003600618.1|  hypothetical protein MTR_3g064310                52.0    1e-04   
ref|XP_004233676.1|  PREDICTED: casparian strip membrane protein ...  51.6    1e-04   
ref|XP_003571714.1|  PREDICTED: CASP-like protein 2D1                 51.6    1e-04   
ref|XP_009399244.1|  PREDICTED: CASP-like protein MA4_106O17.50       52.0    1e-04   
ref|XP_010241335.1|  PREDICTED: CASP-like protein 1D1                 52.0    1e-04   
emb|CDX83921.1|  BnaC08g17240D                                        51.6    2e-04   
ref|XP_011071479.1|  PREDICTED: CASP-like protein 1                   52.0    2e-04   
ref|XP_006659729.1|  PREDICTED: CASP-like protein OsI_27482-like      51.6    2e-04   
ref|XP_003521533.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  51.6    2e-04   
ref|XP_004134188.1|  PREDICTED: CASP-like protein 6-like              51.2    2e-04   
ref|XP_003616135.1|  hypothetical protein MTR_5g076480                51.6    2e-04   
ref|XP_003555157.1|  PREDICTED: casparian strip membrane protein ...  51.6    2e-04   
sp|E6Y2A0.1|CASP1_WHEAT  RecName: Full=Casparian strip membrane p...  52.0    2e-04   
gb|KGN57071.1|  hypothetical protein Csa_3G151490                     51.2    2e-04   
ref|NP_001239666.1|  CASP-like protein 1E1                            51.2    2e-04   
ref|XP_007147869.1|  hypothetical protein PHAVU_006G161700g           51.6    2e-04   
ref|XP_007206803.1|  hypothetical protein PRUPE_ppa025691mg           51.6    2e-04   
ref|XP_010675484.1|  PREDICTED: CASP-like protein 1B2                 51.2    2e-04   
ref|XP_010904771.1|  PREDICTED: CASP-like protein 1D1                 51.2    2e-04   
ref|XP_010551838.1|  PREDICTED: casparian strip membrane protein ...  50.8    2e-04   
sp|P0DH83.1|CSPL2_MARPO  RecName: Full=CASP-like protein 1U1; Sho...  50.8    2e-04   
ref|XP_009399245.1|  PREDICTED: CASP-like protein MA4_106O17.52       50.8    2e-04   
ref|XP_009121585.1|  PREDICTED: casparian strip membrane protein ...  50.8    2e-04   
ref|XP_002529882.1|  conserved hypothetical protein                   51.2    3e-04   
ref|XP_009149166.1|  PREDICTED: CASP-like protein At1g17200 isofo...  51.2    3e-04   
ref|XP_010476448.1|  PREDICTED: casparian strip membrane protein ...  51.2    3e-04   
ref|XP_009758573.1|  PREDICTED: CASP-like protein 1B2                 51.2    3e-04   
ref|XP_008223106.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   50.8    3e-04   
ref|NP_001236009.1|  CASP-like protein 1E2                            50.8    3e-04   
ref|XP_007154230.1|  hypothetical protein PHAVU_003G101200g           50.8    3e-04   
ref|XP_009610092.1|  PREDICTED: casparian strip membrane protein 1    50.8    3e-04   
ref|XP_006408711.1|  hypothetical protein EUTSA_v10002094mg           51.2    3e-04   
ref|NP_001042532.1|  Os01g0237000                                     50.1    3e-04   
ref|XP_002273638.1|  PREDICTED: casparian strip membrane protein 2    50.8    3e-04   
ref|XP_010495793.1|  PREDICTED: casparian strip membrane protein ...  51.2    3e-04   
gb|EMS67341.1|  hypothetical protein TRIUR3_17102                     50.4    3e-04   
ref|XP_010458896.1|  PREDICTED: casparian strip membrane protein 6    51.2    3e-04   
ref|XP_003544303.1|  PREDICTED: CASP-like protein RCOM_1174750-like   50.1    3e-04   
gb|EMS45442.1|  hypothetical protein TRIUR3_26513                     49.7    3e-04   
ref|XP_008361038.1|  PREDICTED: casparian strip membrane protein ...  50.8    4e-04   
ref|XP_001764924.1|  predicted protein                                50.4    4e-04   
gb|KFK24376.1|  hypothetical protein AALP_AAs45452U000200             50.4    4e-04   
ref|XP_004490772.1|  PREDICTED: CASP-like protein 10-like             50.8    4e-04   
ref|XP_009602468.1|  PREDICTED: casparian strip membrane protein ...  50.4    4e-04   
ref|XP_010036808.1|  PREDICTED: CASP-like protein 1D1                 50.8    4e-04   
ref|XP_003554500.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  50.1    5e-04   
ref|XP_007225850.1|  hypothetical protein PRUPE_ppa011684mg           50.1    5e-04   
sp|P0DH82.1|CSPL1_MARPO  RecName: Full=CASP-like protein 2U1; Sho...  50.4    5e-04   
ref|XP_010105026.1|  hypothetical protein L484_008467                 50.1    6e-04   
gb|AFK48170.1|  unknown                                               50.1    6e-04   
ref|XP_006844551.1|  hypothetical protein AMTR_s00016p00177940        48.1    6e-04   
ref|XP_008804584.1|  PREDICTED: CASP-like protein 6                   50.1    6e-04   
gb|KHN43548.1|  CASP-like protein                                     49.7    6e-04   
ref|XP_010667641.1|  PREDICTED: CASP-like protein 1B2                 49.7    6e-04   
emb|CDY43748.1|  BnaAnng07630D                                        50.1    6e-04   
gb|KHN03390.1|  CASP-like protein 8                                   49.7    6e-04   
gb|KHG20748.1|  CASP-like protein                                     50.1    6e-04   
ref|XP_010105028.1|  hypothetical protein L484_008469                 50.1    7e-04   
ref|XP_010492362.1|  PREDICTED: casparian strip membrane protein ...  49.7    7e-04   
ref|XP_010245394.1|  PREDICTED: CASP-like protein 1E1                 49.7    7e-04   
ref|NP_172868.1|  uncharacterized protein                             50.1    7e-04   
sp|P0DI25.1|CSPL4_PTEAA  RecName: Full=CASP-like protein 2U3; Sho...  49.3    7e-04   
ref|NP_001236648.1|  CASP-like protein 7                              49.7    7e-04   
sp|Q1EPG7.1|CSPL1_MUSAC  RecName: Full=CASP-like protein 1E1; Sho...  49.7    7e-04   
ref|XP_003621263.1|  hypothetical protein MTR_7g011090                49.3    8e-04   
gb|KDP39843.1|  hypothetical protein JCGZ_04188                       50.1    8e-04   
dbj|BAJ88632.1|  predicted protein                                    49.3    8e-04   
ref|XP_002443527.1|  hypothetical protein SORBIDRAFT_08g021090        49.7    8e-04   
gb|KHN12189.1|  CASP-like protein 1                                   49.3    8e-04   
ref|NP_564017.1|  uncharacterized protein                             49.7    8e-04   
ref|XP_007153553.1|  hypothetical protein PHAVU_003G045200g           49.3    9e-04   
gb|EYU19080.1|  hypothetical protein MIMGU_mgv1a024780mg              48.9    9e-04   
emb|CDY26265.1|  BnaA06g11520D                                        49.7    9e-04   
gb|KDO75080.1|  hypothetical protein CISIN_1g029779mg                 49.3    9e-04   
gb|AAL36294.1|  unknown protein                                       49.7    9e-04   
ref|XP_002892791.1|  integral membrane family protein                 49.7    0.001   
ref|XP_009606201.1|  PREDICTED: casparian strip membrane protein 2    49.3    0.001   
ref|XP_010271592.1|  PREDICTED: casparian strip membrane protein ...  49.7    0.001   
ref|XP_007035489.1|  CASP-like protein RCOM_0679870, putative         49.3    0.001   



>ref|XP_009626653.1| PREDICTED: CASP-like protein 1F2 [Nicotiana tomentosiformis]
Length=181

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            MESF  K+   Q PP K+       Q+ LR+  TA TLA+   +LTSKQTV+VFGI+MDA
Sbjct  1    MESFSVKN--MQSPPRKSHTCLLGTQIFLRILATAFTLASTLIILTSKQTVTVFGIEMDA  58

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RYSYSP FKF A+ANII   FS+LS+F+ F+L     DPKHYFY+FLHDLIVMA++L+GC
Sbjct  59   RYSYSPTFKFFALANIIGCAFSVLSLFLAFVLGHKGFDPKHYFYIFLHDLIVMAVMLAGC  118

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+ATAIGYVGK GE HSGWMP+CD+VSKFCHK+T  + LSY AVI YL+LT++SANQSR+
Sbjct  119  AAATAIGYVGKHGEMHSGWMPICDHVSKFCHKITNSVMLSYFAVICYLVLTIISANQSRR  178



>ref|XP_009760374.1| PREDICTED: CASP-like protein 1F2 [Nicotiana sylvestris]
Length=181

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            MESF  K+   Q PP K+       Q+ LR+  TA TLA+   +LTSKQTV+VFGI+MDA
Sbjct  1    MESFSVKN--LQSPPRKSDTCLLGTQIFLRILATAFTLASTLIILTSKQTVTVFGIEMDA  58

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RYSYSP FKF A+ANII   FS+LS+F+ F+L     DPKHYFY+FLHDLIVMA++L+GC
Sbjct  59   RYSYSPTFKFFALANIIGCAFSVLSLFLAFVLGHKGFDPKHYFYIFLHDLIVMAVMLAGC  118

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+ATAIGYVGK GE HSGWMP+CD+VSKFCHKVT  + LSY +VI YL+LT++SANQS++
Sbjct  119  AAATAIGYVGKHGEMHSGWMPICDHVSKFCHKVTNSVMLSYFSVICYLVLTIISANQSKR  178



>ref|XP_009766471.1| PREDICTED: CASP-like protein 1F2 [Nicotiana sylvestris]
Length=211

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = -3

Query  911  FSSFLLPKMESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVS  732
            F  F +PKMES  +K+   Q PPLK  K     Q+ LR+  TA TLA+ W +LTSKQTV+
Sbjct  23   FYYFGIPKMESLDAKN--MQSPPLKPYKCLLKTQIFLRILATAFTLASTWIILTSKQTVT  80

Query  731  VFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIV  552
            VFG++MDARYSYSP FKF A ANII   FS+LS+F+  +L     DPK+YF MFLHDLIV
Sbjct  81   VFGLEMDARYSYSPIFKFFAFANIIGCAFSVLSLFLASVLSHKCLDPKNYFCMFLHDLIV  140

Query  551  MALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTV  372
            MALLL+GCA+ATAIGYVGK+GESHSGWMP+CD+VSKFCHKVT  + LSY AV+FYL L V
Sbjct  141  MALLLAGCAAATAIGYVGKYGESHSGWMPICDHVSKFCHKVTDSVMLSYFAVLFYLCLAV  200

Query  371  LSANQSRK  348
            +SANQSR+
Sbjct  201  ISANQSRE  208



>ref|XP_004241458.1| PREDICTED: CASP-like protein 1F1 [Solanum lycopersicum]
Length=178

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 130/173 (75%), Gaps = 0/173 (0%)
 Frame = -3

Query  869  KDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSP  690
            + +  Q  PLK  K     Q++LR   T  TLA+   +LTSKQTV++FG++MDARYSYS 
Sbjct  2    EPKNMQSSPLKPYKYLLGTQILLRFLATIFTLASTLIILTSKQTVTIFGLEMDARYSYSS  61

Query  689  AFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAI  510
            AFKF A AN+I   FS+LS+F+  +L      PK+ FYMFLHDLIVMA+LL+GCA+ATA+
Sbjct  62   AFKFFAFANMIGCAFSVLSLFLASVLGHKGLVPKNSFYMFLHDLIVMAVLLAGCAAATAV  121

Query  509  GYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            GY+GK+GE HSGWMP+C++V KFCHKVT  + LSY AV FYL LT++SANQSR
Sbjct  122  GYIGKYGEMHSGWMPICEHVDKFCHKVTNSVILSYFAVFFYLCLTIISANQSR  174



>ref|XP_009591667.1| PREDICTED: CASP-like protein 1F2 [Nicotiana tomentosiformis]
Length=181

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            ++  Q PPLK  K     Q+ LR+  TA TLA+ W +LTSKQTV+VFG++MDARYSYSP+
Sbjct  2    EKNMQSPPLKPYKCLLRTQIFLRILATAFTLASTWIILTSKQTVTVFGLEMDARYSYSPS  61

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            FKF  +ANII   FS+LS+F+  +L     DPK+YFYMFLHDLIVMALLL+GCA+ATAIG
Sbjct  62   FKFFVIANIIGCAFSVLSLFLASVLSHKCLDPKNYFYMFLHDLIVMALLLAGCAAATAIG  121

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            YVGK+GESHSGWMP+CD+VSKFCHKVT  + LSY AV+FYL LT++SANQSR+
Sbjct  122  YVGKYGESHSGWMPICDHVSKFCHKVTDSVMLSYFAVLFYLCLTIISANQSRQ  174



>ref|XP_006347352.1| PREDICTED: CASP-like protein VIT_17s0000g00560-like [Solanum 
tuberosum]
Length=186

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = -3

Query  887  MESFGSKDEQKQQ---PPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQ  717
            ME+FG+K+ Q Q    PP+K+ K   + Q++LR+   A TLAA   +LTSKQ V+VFGI+
Sbjct  1    MENFGAKNRQNQNTQNPPMKSDKCLLSTQILLRILAIAFTLAATSMILTSKQAVTVFGIE  60

Query  716  MDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLL  537
            MDARYSYS AFKF A+AN+I   FS+LS+ +  +L     DPK+YFYMF+HDLI MALLL
Sbjct  61   MDARYSYSSAFKFFAIANMIGCAFSVLSLILASVLGHKTPDPKNYFYMFIHDLITMALLL  120

Query  536  SGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQ  357
            +GCA+ATA+GYVGK+GESHSGWMP+CD+V KFC KV+  I LSY+A+I YL LT++SANQ
Sbjct  121  AGCAAATAVGYVGKYGESHSGWMPICDHVDKFCRKVSHSIMLSYVAMILYLCLTIISANQ  180

Query  356  SRK  348
            SRK
Sbjct  181  SRK  183



>ref|XP_006347351.1| PREDICTED: CASP-like protein VIT_17s0000g00560-like [Solanum 
tuberosum]
Length=178

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -3

Query  869  KDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSP  690
            + +  Q  PLK  K     Q++LR+  T  TLA+ W +LTSKQTV++FG++MDARYSYS 
Sbjct  2    EPKNMQSSPLKPYKYLLGTQILLRILATIFTLASTWIILTSKQTVTIFGLEMDARYSYSS  61

Query  689  AFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAI  510
            AFKF A AN+I   FS+LS+F+  +L      PK+ FYMFLHDLIVMA+LL+GCA+ATA+
Sbjct  62   AFKFFAFANMIGCAFSVLSLFLASVLGHKGLVPKNSFYMFLHDLIVMAVLLAGCAAATAV  121

Query  509  GYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            GYVGK+GE HSGWMP+C++V KFCHKVT  + LSY AV FYL LT++SANQS +
Sbjct  122  GYVGKYGEMHSGWMPICEHVDKFCHKVTNSVMLSYFAVFFYLCLTIISANQSTQ  175



>ref|XP_004241459.1| PREDICTED: CASP-like protein 1F1 [Solanum lycopersicum]
Length=186

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -3

Query  887  MESFGSKDEQKQQ---PPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQ  717
            ME+FG+K+ Q Q    P +K+ K   + Q++LR+   A TLAA   +LTSKQ V+VFGI+
Sbjct  1    MENFGAKNRQNQNLQNPAMKSDKCLLSTQILLRILAIAFTLAATSIILTSKQAVTVFGIE  60

Query  716  MDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLL  537
            MDARYSYS AFKF A+ N++   FS+LS+ V  +L   + DPK+YFYMF+HDLI MALLL
Sbjct  61   MDARYSYSSAFKFFAITNMVGCAFSVLSLIVASVLAHKSSDPKNYFYMFIHDLITMALLL  120

Query  536  SGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQ  357
            +GCA+ATA+GYVGK+G++HSGW+P+CD+V KFC KV+  I LSYIA+I YL LT++SANQ
Sbjct  121  AGCAAATAVGYVGKYGQTHSGWLPICDHVDKFCRKVSHSIMLSYIAMILYLCLTIISANQ  180

Query  356  SRK  348
            SRK
Sbjct  181  SRK  183



>ref|XP_009618377.1| PREDICTED: CASP-like protein 1F1 [Nicotiana tomentosiformis]
Length=181

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            M SFG+K+   + PPLK+ K F   Q++LR+   A TLAAA ++ TSK+TV+VF  QMDA
Sbjct  1    MYSFGAKN--IENPPLKSDKCFIITQILLRILAAAFTLAAACSMFTSKETVNVFNTQMDA  58

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RYSYSPA KF A ANII   FS+LS+F+  I  +    PK+YFY+FLHD+++MALLL+G 
Sbjct  59   RYSYSPALKFFAFANIIGCAFSILSLFLASIFCRKGLHPKNYFYVFLHDMMLMALLLAGT  118

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+AT IGYVGK+GE+ SGWMP+CD+V KFCHKV   I   Y  VIFYL LT++SANQS K
Sbjct  119  AAATTIGYVGKYGENQSGWMPICDSVPKFCHKVIESIIFGYFGVIFYLCLTIISANQSGK  178



>ref|XP_011083382.1| PREDICTED: CASP-like protein 1F1 [Sesamum indicum]
Length=181

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 125/173 (72%), Gaps = 0/173 (0%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D+    PP K  KL  A Q+ LRL   A TLAAA  +LT+ QT  V+GIQ+DARYSYSPA
Sbjct  6    DKSLHTPPSKTQKLAFATQVFLRLLAIAATLAAACVMLTTTQTNVVYGIQVDARYSYSPA  65

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            FKF A AN++    SLLS+F+ F+L K A    H+FY FLHDLI+  LL++GC++ATAI 
Sbjct  66   FKFFAYANVVASVVSLLSLFLAFVLAKTALHSTHFFYFFLHDLIMTVLLIAGCSAATAIA  125

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            YVGK+G +H+GWMPVCDN +KFC+++ +   LSY+    YLILT++SA +S++
Sbjct  126  YVGKYGNTHTGWMPVCDNFAKFCNRIIISGFLSYMGFAVYLILTIISAKKSQQ  178



>ref|XP_008374192.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Malus domestica]
Length=181

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -3

Query  875  GSKDEQKQQ-PPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYS  699
             S D + QQ PPLK  K+F  +Q+ +R      TLAA W ++T+KQ+  + GI+ DARY 
Sbjct  2    ASTDSKFQQNPPLKTQKIFLGVQIFMRTVTMTATLAATWVMVTNKQSSQIIGIEFDARYY  61

Query  698  YSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASA  519
            YSP FKF A AN +V  F LLS+F++F++ +   +P +YF +FLHDL+++ LL++GC++A
Sbjct  62   YSPTFKFFAYANAVVSAFCLLSLFLLFLIHRHGSNPTNYFILFLHDLVMLCLLMAGCSAA  121

Query  518  TAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            TAIGYVG++G SHSGW P+CD+  KFC + T  + LSY++++F L+LT+ SA +SRK
Sbjct  122  TAIGYVGQYGNSHSGWAPICDHFGKFCKRGTDSVVLSYLSLVFLLMLTISSATKSRK  178



>ref|XP_008386322.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Malus domestica]
 ref|XP_008392722.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Malus domestica]
 ref|XP_008360736.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Malus domestica]
Length=179

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -3

Query  872  SKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYS  693
            ++ + +Q PPLK  K+F  +Q+ +R    A TLAA W ++T+KQT  + GI+ DARY YS
Sbjct  4    TESKFQQNPPLKTQKIFLGVQIFMRTVTVAATLAATWLMVTNKQTSQIIGIEFDARYYYS  63

Query  692  PAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATA  513
            P FKF A AN +V  F LLS+F+VF++ +   +P +YF +FLHDL+++ LL++GC++ATA
Sbjct  64   PTFKFFAYANAVVSAFCLLSLFLVFLIHRNGXNPANYFILFLHDLVMLCLLMAGCSAATA  123

Query  512  IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            IGYVG++G SHSGW P+CD+  KFC + T  + LSY++VIF L LT+ SA +S K
Sbjct  124  IGYVGQYGNSHSGWAPICDHFGKFCKRGTDSVVLSYLSVIFLLTLTISSATKSGK  178



>ref|XP_010678315.1| PREDICTED: CASP-like protein 1F2 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=192

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 124/179 (69%), Gaps = 1/179 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            M+S+    E++     KA K+   IQ+ LR++    ++AA   + TSKQT  VFGIQMDA
Sbjct  1    MQSYAEGKEEESHLETKAKKMVEFIQIGLRVSALVTSIAATSIVFTSKQTTLVFGIQMDA  60

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKM-AGDPKHYFYMFLHDLIVMALLLSG  531
            +Y+YS AFKF A    I   FS LS+   FIL ++ +   K++F+ F+HDL++M++LL+G
Sbjct  61   KYTYSSAFKFFAFTTAIASLFSFLSLGFTFILRRVVSSKTKYHFFFFMHDLVIMSVLLAG  120

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQS  354
            CA+ATAIGYVG++G  H+GWMP+CD+   FCHKVT  + L+Y ++IF+  LT++SA +S
Sbjct  121  CAAATAIGYVGQYGYEHAGWMPICDHFPTFCHKVTASVVLAYFSLIFFFFLTIISATKS  179



>ref|XP_009589659.1| PREDICTED: CASP-like protein 1F1 [Nicotiana tomentosiformis]
Length=180

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 125/182 (69%), Gaps = 3/182 (2%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQT-VSVFGIQMD  711
            ME FG+     Q   LK+ K F   Q++LR+     T+AA W +LTSK T VSVF IQ++
Sbjct  1    MECFGTNATHNQS--LKSQKYFLGAQILLRILGIIFTVAATWIILTSKHTTVSVFDIQIN  58

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A  SY P  KF A ANII  GFS+LS+ +  IL     DP + F+MF+HDLIVM LLL+G
Sbjct  59   AHISYPPTLKFFAYANIIGCGFSVLSLLITSILGHKVLDPNNLFHMFIHDLIVMGLLLAG  118

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            CA+ATAIG+VGK+G   +GWMP+CD+V KFCH+V   + LSY+ V+FYL LT++S N+S 
Sbjct  119  CAAATAIGFVGKYGVRQAGWMPICDHVPKFCHRVADSVMLSYLGVLFYLCLTIISVNRST  178

Query  350  KS  345
             S
Sbjct  179  HS  180



>ref|XP_007209668.1| hypothetical protein PRUPE_ppa012166mg [Prunus persica]
 gb|EMJ10867.1| hypothetical protein PRUPE_ppa012166mg [Prunus persica]
Length=181

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = -3

Query  857  KQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKF  678
            +Q PP K   +F   Q+ +R      TLAA W  +T+KQT  + GI+ DARY+YSPAF F
Sbjct  9    QQNPPQKTQNVFLGTQIFMRTFTMTATLAATWVTVTNKQTAQIVGIEFDARYNYSPAFTF  68

Query  677  LAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVG  498
             A AN +V  FSLLS+F+VF+  +   +P +YF +FLHDL+++ LLL+GC++ATAIGYVG
Sbjct  69   FAYANAVVSAFSLLSLFLVFLFHRKGSNPANYFILFLHDLMMLCLLLAGCSAATAIGYVG  128

Query  497  KFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            K+G SHSGW P+CD+  KFC + T  + LSY++VIF L+LT+ SA +SR+
Sbjct  129  KYGNSHSGWAPICDHFGKFCKRGTNSMVLSYLSVIFLLMLTISSATKSRQ  178



>ref|XP_011073119.1| PREDICTED: CASP-like protein 1F1 [Sesamum indicum]
Length=181

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 124/175 (71%), Gaps = 0/175 (0%)
 Frame = -3

Query  872  SKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYS  693
            S D+    P  K+ KLF   Q+ LR+   A+TLAA    LT+KQT  ++GIQ+DARYSYS
Sbjct  4    SVDKTYHIPSSKSQKLFILTQIPLRILAAAVTLAATSITLTNKQTAVIYGIQIDARYSYS  63

Query  692  PAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATA  513
            PA KF A AN+I   F++L +F+  IL   A D  +YFYMFLHDL++  LL++GCA+ATA
Sbjct  64   PALKFFAYANLIACAFTVLLLFLALILRNKAVDSTYYFYMFLHDLVMTILLMAGCAAATA  123

Query  512  IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            +GYVGK+G+ H+GWM VC   ++FC++ T   +LSY   +FY ILT++SAN+SR+
Sbjct  124  VGYVGKYGDRHAGWMAVCGYFAEFCNRGTAASSLSYFGFLFYFILTIVSANRSRQ  178



>ref|XP_006363994.1| PREDICTED: CASP-like protein VIT_17s0000g00560-like [Solanum 
tuberosum]
Length=181

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 115/169 (68%), Gaps = 0/169 (0%)
 Frame = -3

Query  854  QQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFL  675
            + P +K+ K F   Q++LR+  TA TL AA     S QT+ +F ++ DARY+YSPA KF 
Sbjct  10   ETPSVKSEKHFIFAQILLRILATAFTLTAACITFKSTQTLIIFNVETDARYTYSPALKFF  69

Query  674  AVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGK  495
              AN+I   FS  S+F+     +    P  YFY+F+HD+I+MALLLS C++A  IGYVGK
Sbjct  70   VYANVIGCAFSFFSLFLASAFGRTNLHPHKYFYLFIHDMIMMALLLSACSAAATIGYVGK  129

Query  494  FGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            +G+  SGWMP+CD+V+KFCHK+T  +  S   VIFYL LT++SA QSRK
Sbjct  130  YGQIRSGWMPICDSVTKFCHKMTASVIFSIFGVIFYLCLTIISAYQSRK  178



>gb|EYU32920.1| hypothetical protein MIMGU_mgv1a014795mg [Erythranthe guttata]
Length=178

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFIL-DKMAGDPKHYFYM  573
            SKQT  VFGIQ+DARYSYSP FKF A AN+I   F+ LS+F VF+L +K A DP HYFY+
Sbjct  41   SKQTTLVFGIQIDARYSYSPTFKFFAYANLIASAFTFLSLFFVFVLGNKPAVDPTHYFYI  100

Query  572  FLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            FLHDLI+  LL+ GCA+ATAIGYVGK+G SHSGW+ +C    KFC+++T    LSY   +
Sbjct  101  FLHDLIMTVLLMGGCAAATAIGYVGKYGNSHSGWVAICGYFGKFCNRITAASLLSYFGFL  160

Query  392  FYLILTVLSANQSRK  348
             YL+LTV+SAN+SR+
Sbjct  161  LYLLLTVISANKSRQ  175



>ref|XP_002280714.1| PREDICTED: CASP-like protein 1F1 [Vitis vinifera]
Length=181

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -3

Query  875  GSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSY  696
            G + + +Q PPL   KLF    + LR+     TL AAW ++TSKQTV V+GIQ++A+YSY
Sbjct  3    GIEAKFQQNPPLGTHKLFLGAHICLRILTVTATLTAAWMMITSKQTVEVYGIQVEAKYSY  62

Query  695  SPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASAT  516
            S AFKF + AN I  G S+L++F  F L      P  +F++FLHDL +M+L+L+GCA+AT
Sbjct  63   SSAFKFFSYANAIACGCSVLTLFPAFSLFYRGSTPMKFFFLFLHDLCMMSLVLAGCAAAT  122

Query  515  AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            AIGYVG++G +H+GWM +CD   ++C+++ + +  SY+A +F L+LT++SAN+SR+
Sbjct  123  AIGYVGRYGNNHAGWMAICDQFDEYCNRIRLSLMFSYLAFVFILMLTIMSANKSRE  178



>sp|B9IFI5.1|CSPLH_POPTR RecName: Full=CASP-like protein 1F1; Short=PtCASPL1F1 [Populus 
trichocarpa]
Length=181

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = -3

Query  845  PLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFLAVA  666
            PLK  KLF  +Q+  R+   A ++A++W ++TSKQ + + GI +DARYSYSP FKFLA  
Sbjct  13   PLKTQKLFIGVQIFFRIVAIAASVASSWLMITSKQVIDIGGIVLDARYSYSPEFKFLAFT  72

Query  665  NIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGKFGE  486
            NI+V  FSLLS+  + ++ +   +P HYF++FLHDL +M+L++ GCA+AT +G++GK G 
Sbjct  73   NIVVGCFSLLSLLFLVLVVRQGSNPNHYFFLFLHDLAMMSLVVGGCAAATTVGFLGKHGN  132

Query  485  SHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            SH+GWM +CDN  KFC++    +T+SY+ +I   ILT+ SA++SRK
Sbjct  133  SHTGWMQICDNFGKFCNRAQTSVTISYLNLICLSILTITSASKSRK  178



>ref|XP_004235355.1| PREDICTED: CASP-like protein 1F1 isoform X1 [Solanum lycopersicum]
Length=181

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 0/169 (0%)
 Frame = -3

Query  854  QQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFL  675
            + P +K+ K F   Q++LR+  TA TL AA     S QT+SVF ++ DARY+YSPA KF 
Sbjct  10   ETPSMKSEKHFIFAQILLRILATAFTLTAACITFKSAQTLSVFNVETDARYTYSPALKFF  69

Query  674  AVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGK  495
              AN+I   FS  S+F+  I          YFY+F+HD+I+M LLLS C++A  IGYVGK
Sbjct  70   VYANVIGCAFSFFSLFLASIFGCTNLHKHKYFYLFIHDMIMMDLLLSACSAAATIGYVGK  129

Query  494  FGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            +G+  SGWMP+CD+V+KFCHK+T  +  S   VIFYL LT+LSA QSRK
Sbjct  130  YGQIRSGWMPICDSVTKFCHKMTASVIFSIFGVIFYLCLTILSAYQSRK  178



>ref|XP_011002112.1| PREDICTED: CASP-like protein 1F1 [Populus euphratica]
Length=181

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = -3

Query  872  SKDEQK--QQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYS  699
            + +E K  +  P K  KLF   Q+ LR+     ++A++W ++TSKQ + + GI +DARYS
Sbjct  2    ANNEAKFSENQPSKTQKLFIGGQIFLRIVAIVASVASSWLMITSKQVIDIGGIVLDARYS  61

Query  698  YSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASA  519
            YSP FKFLA  NI+V  FSLLS+  + ++ +    P HYF++FLHDL +M+L++ GCA+A
Sbjct  62   YSPEFKFLAFTNIVVGCFSLLSLLFLVLVVRQGSHPNHYFFLFLHDLGMMSLVVGGCAAA  121

Query  518  TAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            T +G++GK G SH+GWM +CDN  KFC++ T  +T+SY+ +I  LILT+ SA++SRK
Sbjct  122  TTVGFLGKHGNSHTGWMQICDNFGKFCNRATTSVTISYLNLICLLILTITSASKSRK  178



>sp|A7PHN8.2|CSPL4_VITVI RecName: Full=CASP-like protein 1F1; Short=VvCASPL1F1 [Vitis 
vinifera]
 emb|CBI15732.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -3

Query  875  GSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSY  696
            G + + +Q PPL   KLF    + LR+     TL AAW ++TSKQTV V+GIQ++A+YSY
Sbjct  28   GIEAKFQQNPPLGTHKLFLGAHICLRILTVTATLTAAWMMITSKQTVEVYGIQVEAKYSY  87

Query  695  SPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASAT  516
            S AFKF + AN I  G S+L++F  F L      P  +F++FLHDL +M+L+L+GCA+AT
Sbjct  88   SSAFKFFSYANAIACGCSVLTLFPAFSLFYRGSTPMKFFFLFLHDLCMMSLVLAGCAAAT  147

Query  515  AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            AIGYVG++G +H+GWM +CD   ++C+++ + +  SY+A +F L+LT++SAN+SR+
Sbjct  148  AIGYVGRYGNNHAGWMAICDQFDEYCNRIRLSLMFSYLAFVFILMLTIMSANKSRE  203



>gb|EYU43016.1| hypothetical protein MIMGU_mgv1a014654mg [Erythranthe guttata]
Length=182

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  851  QPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFLA  672
              PLK  KL+ A Q+ LR+   A TLAAA  +++SK+T  ++ I +D++YSYSPAFKFLA
Sbjct  12   SSPLKNKKLYLATQISLRVLAVAFTLAAALLMISSKETKVLYSISVDSKYSYSPAFKFLA  71

Query  671  VANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGKF  492
             AN + FGFS+LS+ V F L K   +  +YFY+FLHDLI+  LL++ CA+ TA+GY+GK+
Sbjct  72   YANFVAFGFSILSLIVAFGLGKREVNSTNYFYLFLHDLIMNVLLMAACAATTAVGYIGKY  131

Query  491  GESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            G SH+GW+ +CD+  KFC++VT   T+SY+  I Y ILT++SA QSR+
Sbjct  132  GNSHTGWIAICDHFPKFCNRVTTAATMSYLGFIVYFILTIISAKQSRQ  179



>ref|XP_009618375.1| PREDICTED: CASP-like protein 1F1 [Nicotiana tomentosiformis]
Length=178

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 123/180 (68%), Gaps = 5/180 (3%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            M+SF +K      PPLK  ++   +Q++LR+   A TL A   + TSKQ   V  +  DA
Sbjct  1    MDSFEAKTNH--DPPLKTQRVMLILQILLRILAFAFTLGAVLRIKTSKQ---VLFLGFDA  55

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RY+YSP+ KF A AN+     S++S+F+  +  +   D   YFY+FLHDL V  +L++G 
Sbjct  56   RYTYSPSMKFFAYANVSGCALSVVSLFLALMCCQKPRDSNKYFYLFLHDLFVFGVLVAGS  115

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+ATAIGYVGK+G+ HSGW P+C  V+KFCHKVTV +TLSYIA+I YL LT++SANQSR+
Sbjct  116  AAATAIGYVGKYGQKHSGWEPICIFVTKFCHKVTVSLTLSYIAIIIYLCLTIISANQSRQ  175



>emb|CDO98667.1| unnamed protein product [Coffea canephora]
Length=253

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            SKQTV+VFG+ +DARYSYSPAFKF A AN+IV   S LS+ ++ ++   +     +FY F
Sbjct  45   SKQTVAVFGMVVDARYSYSPAFKFFAYANVIVCAVSALSLLLLLVISYKSLVGMKFFYFF  104

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHDL+V+ LL++GCA+ATAIGYVG+ G SH+GWMP+CD+  KFC KV + + LSY  V+ 
Sbjct  105  LHDLMVVTLLMAGCAAATAIGYVGQHGNSHTGWMPICDDFGKFCRKVAISVALSYFGVMV  164

Query  389  YLILTVLSANQSR  351
            YL+LT++SA  SR
Sbjct  165  YLLLTIISAVNSR  177


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -3

Query  557  IVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            I+  LL++GCA+ATAIG+VGK+G +H GW  VCD+   +C++    +  SY AVI YL+L
Sbjct  181  IMSTLLMAGCAAATAIGWVGKYGNNHIGWTAVCDHFKNYCNRTAYSVVCSYAAVILYLLL  240

Query  377  TVLSANQSRK  348
            T++SA +SR 
Sbjct  241  TIISAKKSRN  250



>ref|XP_009766722.1| PREDICTED: CASP-like protein 1F1 [Nicotiana sylvestris]
Length=181

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 129/180 (72%), Gaps = 2/180 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            M SFG+K    + PPL + K F   Q++LR+   A TLAAA ++ TSK+TV VF  +MDA
Sbjct  1    MNSFGTKT--IENPPLISDKCFIRTQILLRILAAAFTLAAACSMFTSKETVHVFNTEMDA  58

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RYSYS A KF A AN+I   FS+L +F+V I  +    PK+YFY+FLHD+I+ ALLL+G 
Sbjct  59   RYSYSSALKFFAYANVIGCAFSILLLFLVSIFCRKGLHPKNYFYVFLHDMILTALLLAGT  118

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+AT IG+VGK+GE+ SGWMP+CD+V KFC KV   I   Y  VIFYL LT++SANQSRK
Sbjct  119  AAATTIGFVGKYGENQSGWMPICDSVPKFCQKVIKSIIFGYFGVIFYLCLTIISANQSRK  178



>ref|XP_009337529.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Pyrus x bretschneideri]
Length=183

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 127/182 (70%), Gaps = 2/182 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQ--QPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQM  714
            M S  SK +Q    + PLK  K+F  +Q+ +R    A TLAA W ++T+KQT  + GI+ 
Sbjct  1    MASTESKFQQNPPLKTPLKTQKIFLGVQIFMRTVTVAATLAATWLMVTNKQTSQIIGIEF  60

Query  713  DARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLS  534
            DA Y YSP FKF A AN +V  F LLS+F+VF++     +P +YF +FLHDL+++ LL++
Sbjct  61   DAHYYYSPTFKFFAYANAVVSAFCLLSLFLVFLIHHNGSNPANYFVLFLHDLVMLCLLMA  120

Query  533  GCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQS  354
            GC++ATAIGYVG++G SHSGW P+CD+  KFC + T  + LSY++V+F L+LT+ SA +S
Sbjct  121  GCSAATAIGYVGQYGNSHSGWAPICDHFGKFCKRGTDSVVLSYLSVVFLLMLTISSAAKS  180

Query  353  RK  348
             K
Sbjct  181  GK  182



>ref|XP_004297505.1| PREDICTED: CASP-like protein VIT_17s0000g00560-like [Fragaria 
vesca subsp. vesca]
Length=182

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = -3

Query  860  QKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFK  681
            Q   P +K+ KLF  +Q+ LR    A TLAA W  +TSKQ+  + GI  DARYSYS AFK
Sbjct  9    QPNPPVMKSQKLFLGVQIWLRTFAMATTLAATWITITSKQSTEIVGITFDARYSYSSAFK  68

Query  680  FLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYV  501
            FLA AN +V    L+S+ +VF+L     +P HYF++FLHDL +M L+L+GCA+ATAIG+V
Sbjct  69   FLAFANAVVSACCLVSLLLVFLLHLQGSNPNHYFFLFLHDLFIMCLVLAGCAAATAIGFV  128

Query  500  GKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            G++G SH+GW P+CD+  KFCH+V++ + LSY+++I  L+LTV SA +SR+
Sbjct  129  GRYGNSHTGWSPICDHFDKFCHRVSISVILSYLSLIILLMLTVGSAIKSRQ  179



>ref|XP_002511115.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RA90.1|CSPL8_RICCO RecName: Full=CASP-like protein 1F1; Short=RcCASPL1F1 [Ricinus 
communis]
 gb|EEF51717.1| conserved hypothetical protein [Ricinus communis]
Length=179

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 121/172 (70%), Gaps = 0/172 (0%)
 Frame = -3

Query  863  EQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAF  684
            E K   PLK+ KLF   Q+ LR+     TLAA W ++T KQ+++     M A+Y+YS AF
Sbjct  5    EDKYNSPLKSQKLFIGAQICLRIVTIGATLAATWIMVTDKQSITFGDFVMVAKYNYSSAF  64

Query  683  KFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGY  504
            KF  +AN+I    S++S+  +  L + + +P H F +FLHDL++M+L+L+GC++ATAIG+
Sbjct  65   KFFVLANVIACACSVVSLLFLCALGRYSSNPGHVFLLFLHDLLMMSLVLAGCSAATAIGF  124

Query  503  VGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            +GK+G + SGWMP+CD   +FC++ T+ + LSY++++  LILTV SAN+SR+
Sbjct  125  LGKYGNTKSGWMPICDQFGQFCNRGTISMMLSYLSMVCLLILTVTSANKSRQ  176



>ref|XP_011042940.1| PREDICTED: CASP-like protein 1F2 isoform X1 [Populus euphratica]
Length=181

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 120/169 (71%), Gaps = 0/169 (0%)
 Frame = -3

Query  854  QQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFL  675
            Q  PLK  K+F   Q+ LR+ + A + A+ W +LT+KQT+ + G  +DA+YSYSP FKFL
Sbjct  10   QNQPLKTQKIFIGAQIFLRIVVIAASFASTWLMLTNKQTIDIGGFVLDAKYSYSPEFKFL  69

Query  674  AVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGK  495
            + ANI+V  FS LS+  + ++ + + +P +YF +FLHDL +M+L+L GCA+AT IG +GK
Sbjct  70   SYANIVVGAFSFLSLLFLVLVGRRSSNPNYYFILFLHDLALMSLVLGGCAAATVIGSLGK  129

Query  494  FGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
             G SH+GWM +CD+  KFC + T  +T SY +++  LILT+ SA++SR+
Sbjct  130  NGNSHTGWMQICDHFGKFCKRATTSVTFSYFSLVCLLILTITSASKSRQ  178



>ref|XP_002318159.1| hypothetical protein POPTR_0012s10610g [Populus trichocarpa]
 sp|B9I3X5.1|CSPL3_POPTR RecName: Full=CASP-like protein 1F2; Short=PtCASPL1F2 [Populus 
trichocarpa]
 gb|EEE96379.1| hypothetical protein POPTR_0012s10610g [Populus trichocarpa]
Length=181

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 120/174 (69%), Gaps = 0/174 (0%)
 Frame = -3

Query  869  KDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSP  690
            + +  Q  PLK   +F   Q+ LR+ + A + A+ W +LT+KQT+ + G  +DA YSYSP
Sbjct  5    ETKSSQNQPLKTQNIFIGAQIFLRIVVIAASFASTWLMLTNKQTIDIGGFVLDANYSYSP  64

Query  689  AFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAI  510
             FKFL+ ANI+V  FS +S+  + ++ + + +P +YF +FLHDL +M+L+L GCA+AT I
Sbjct  65   EFKFLSYANIVVGAFSFVSLLFLVLVGRRSSNPTYYFILFLHDLALMSLVLGGCAAATVI  124

Query  509  GYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            G +GK+G SH+GWM +CD+  KFC + T  +  SY +++  LILT+ SA++SR+
Sbjct  125  GSLGKYGNSHTGWMQICDHFGKFCKRATTSVAFSYFSLVCLLILTITSASKSRQ  178



>ref|XP_010318325.1| PREDICTED: CASP-like protein 1F1 [Solanum lycopersicum]
Length=178

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 121/179 (68%), Gaps = 7/179 (4%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            ME FG K   K  P LK  K+    Q++LR+      L A W ++TSKQ V V GI  +A
Sbjct  1    MEIFGGKI--KHDPSLKTQKVMLIFQIILRILGFTFCLGAVWRIMTSKQ-VLVLGI--EA  55

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFIL--DKMAGDPKHYFYMFLHDLIVMALLLS  534
             Y+YSP  KF A AN+I    S++++F++ +    K     K+ FY+FLHDLIV  LL++
Sbjct  56   NYTYSPTMKFFAYANMIGCASSIVALFLLLVCCYKKYLNSNKYLFYLFLHDLIVFGLLVA  115

Query  533  GCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQ  357
            GCASAT+IGYV K+G+ +SGW PVC+ V+K CHK TV +TLSYIA+IFYL LT++SANQ
Sbjct  116  GCASATSIGYVAKYGQKYSGWNPVCNYVTKLCHKATVSVTLSYIAIIFYLCLTIISANQ  174



>ref|XP_006436922.1| hypothetical protein CICLE_v10032880mg [Citrus clementina]
 gb|ESR50162.1| hypothetical protein CICLE_v10032880mg [Citrus clementina]
Length=180

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 115/173 (66%), Gaps = 6/173 (3%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
              Q    PLK  K F   Q+ LR+   A  LAA W +LTSKQ + +FGI  DARYSYS A
Sbjct  11   QSQPHHQPLKYQKRFHVAQICLRILAIATALAATWVILTSKQHLVIFGIPFDARYSYSSA  70

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            FKF A AN+    FSLLS+  + I+      P  YF +FLHDL  M+LLL+GCA+ATA+G
Sbjct  71   FKFFAFANVAASAFSLLSLLYLLIV------PASYFLLFLHDLFTMSLLLAGCAAATAVG  124

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            Y+G++G  H GWM +C+   KFC+KVT  + LSY++ +  L+LT++SA++SR+
Sbjct  125  YIGRYGNEHIGWMAICEQFGKFCNKVTASVMLSYLSFLCLLVLTIISASRSRQ  177



>gb|KDO44503.1| hypothetical protein CISIN_1g039472mg, partial [Citrus sinensis]
Length=221

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 122/184 (66%), Gaps = 9/184 (5%)
 Frame = -3

Query  890  KMESFGSKDEQKQQP---PLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGI  720
             MES  +    + QP   PLK  K F   Q+ LR+   A  LAA W +LTSKQ + +FGI
Sbjct  41   NMESSQAIKFPQSQPHHQPLKYQKRFHVAQICLRILAIATALAATWVILTSKQHLVIFGI  100

Query  719  QMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALL  540
              DARYSYS AFKF A AN+    FSLLS+  + I+      P +YF +FLHDL  M+LL
Sbjct  101  PFDARYSYSSAFKFFAFANVAASAFSLLSLLYLLIV------PANYFLLFLHDLFTMSLL  154

Query  539  LSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSAN  360
            L+GCA+ATA+GY+G++G  H GWM +C+   KFC+KVT  + LSY++ +  L+LT++SA+
Sbjct  155  LAGCAAATAVGYIGRYGNEHIGWMAICEQFGKFCNKVTASVILSYLSFLCLLVLTIISAS  214

Query  359  QSRK  348
            +SR+
Sbjct  215  RSRQ  218



>ref|XP_006485175.1| PREDICTED: CASP-like protein RCOM_1504680-like [Citrus sinensis]
Length=180

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 114/173 (66%), Gaps = 6/173 (3%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
              Q    PLK  K F   Q+ LR+   A  LAA W +LTSKQ + +FGI  DARYSYS A
Sbjct  11   QSQPHHQPLKYQKRFHVAQICLRILAIATALAATWVILTSKQHLVIFGIPFDARYSYSSA  70

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            FKF A AN+    FSLLS+  + I+      P  YF +FLHDL  M+LLL+GCA+ATA+G
Sbjct  71   FKFFAFANVAASAFSLLSLLYLLIV------PASYFLLFLHDLFTMSLLLAGCAAATAVG  124

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            Y+G++G  H GWM +C+   KFC+KVT  + LSY + +  L+LT++SA++SR+
Sbjct  125  YIGRYGNEHIGWMAICEQFGKFCNKVTASVMLSYFSFLCLLVLTIISASRSRQ  177



>ref|XP_010249455.1| PREDICTED: CASP-like protein 1F1 [Nelumbo nucifera]
Length=146

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            SKQ+   FGIQ+ A YS SP FKF   AN I    SL+S+  V++L +   +P +YFY+F
Sbjct  10   SKQSTEFFGIQIRAVYSDSPDFKFFVYANGIACVSSLVSLLTVYVLYRKGSNPSNYFYVF  69

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHDLI+MAL+++   +A+AIGYVG +G +H+GWM +CD V KFCH+ +  I  SY+A   
Sbjct  70   LHDLIIMALVMAASVAASAIGYVGAYGNTHTGWMSICDQVDKFCHRASDSIIFSYLAFFI  129

Query  389  YLILTVLSANQSRK  348
            YLILTVLSAN+SR+
Sbjct  130  YLILTVLSANESRQ  143



>ref|XP_009777999.1| PREDICTED: CASP-like protein 1F1 [Nicotiana sylvestris]
Length=178

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 123/181 (68%), Gaps = 5/181 (3%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            M+SF +K      PPLK  ++   +Q++LR+   A TL AA  ++TSKQ   V  +  DA
Sbjct  1    MDSFETKTNH--DPPLKTQRVMLILQILLRILAFAFTLGAALRIMTSKQ---VLFLGFDA  55

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RY+YSP+ KF A +N I    S++S+F+V +  +   D   YFY+FL+DL     L++G 
Sbjct  56   RYTYSPSMKFFAFSNAIGCATSVVSLFLVLMSCQKPRDSNKYFYLFLNDLFTFGGLVAGS  115

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+ATAIGYVGK+G+ HSGW P+C  V++FCHKVTV +TLSYIA I  L LT++SANQSR+
Sbjct  116  AAATAIGYVGKYGQKHSGWEPICVFVTQFCHKVTVSLTLSYIASIICLCLTIISANQSRQ  175

Query  347  S  345
            +
Sbjct  176  T  176



>ref|XP_008239536.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Prunus mume]
Length=181

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = -3

Query  857  KQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKF  678
            +Q PP K   +F   Q+ +R      TLAA W  +T+KQT  + GI+ DARY+YSPAF F
Sbjct  9    QQNPPQKTQNVFLGTQIFMRTFTMTATLAATWVTVTNKQTAQIVGIEFDARYNYSPAFTF  68

Query  677  LAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVG  498
             A AN +V  FSLLS+F+VF+  +   +P +YF +FLHDL+V+ LLL+GC++ATAIGYVG
Sbjct  69   FAYANAVVSAFSLLSLFLVFLFHRKGSNPTNYFILFLHDLLVLCLLLAGCSAATAIGYVG  128

Query  497  KFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            ++G SHSGW P+CD+  KFC + T  + LSY++VIF L+LT+ SA +SR+
Sbjct  129  QYGNSHSGWAPICDHFGKFCKRGTNSVVLSYLSVIFLLMLTISSATKSRQ  178



>ref|XP_010678316.1| PREDICTED: CASP-like protein 1F1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=176

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 113/178 (63%), Gaps = 15/178 (8%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            M+S+    E++     KA K+   IQ+ LR++    ++AA   + TSKQT  VFGIQMDA
Sbjct  1    MQSYAEGKEEESHLETKAKKMVEFIQIGLRVSALVTSIAATSIVFTSKQTTLVFGIQMDA  60

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            +Y+YS AFKF A    I   FS LS+   FIL +               +++M++LL+GC
Sbjct  61   KYTYSSAFKFFAFTTAIASLFSFLSLGFTFILRR---------------VVIMSVLLAGC  105

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQS  354
            A+ATAIGYVG++G  H+GWMP+CD+   FCHKVT  + L+Y ++IF+  LT++SA +S
Sbjct  106  AAATAIGYVGQYGYEHAGWMPICDHFPTFCHKVTASVVLAYFSLIFFFFLTIISATKS  163



>ref|XP_011098938.1| PREDICTED: CASP-like protein 1F1 [Sesamum indicum]
Length=194

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q+V+ FGI MDARY+YS +F+F  VA+ +  G SLLSV  +  L++   +P +YFY+F
Sbjct  54   SHQSVTFFGIVMDARYTYSSSFRFKMVADSLACGLSLLSVIHLLSLNRPKSNPNNYFYLF  113

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHDL+   LLLSGC++A AIGYVG+FG+  +GW+ +CD V KFC K+ V I  S++AVI 
Sbjct  114  LHDLVSAVLLLSGCSAAMAIGYVGRFGQPQTGWIAICDRVPKFCDKILVSIVSSFLAVIC  173

Query  389  YLILTVLSANQ  357
             L+LT++SA++
Sbjct  174  LLVLTIMSAHK  184



>ref|XP_007038092.1| CASP-like protein GSVIVT01008618001 [Theobroma cacao]
 gb|EOY22593.1| CASP-like protein GSVIVT01008618001 [Theobroma cacao]
Length=181

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 123/180 (68%), Gaps = 2/180 (1%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            MES  +K  +   P LK  KL    Q+ LR+   A  LAA W +LTSKQTV VFGI  DA
Sbjct  1    MESIEAKFPE--NPSLKTHKLVLGAQICLRIVAIATALAATWVMLTSKQTVMVFGIPFDA  58

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            RYSYS AFKF A AN    GF++LS+  VF   +    P +YF +FLHDL++M+L LSG 
Sbjct  59   RYSYSSAFKFFAFANAFACGFTVLSLLFVFFFSRRGLTPANYFLLFLHDLLMMSLALSGV  118

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            A+ TAIGYVG+FG  H+GW+ +CD + KFCHKVT  +  SY++V+  L+LT++SA++SR+
Sbjct  119  AAGTAIGYVGRFGNIHAGWLQICDRLGKFCHKVTASLIFSYLSVLCLLVLTIISASKSRQ  178



>ref|XP_003548964.1| PREDICTED: CASP-like protein RCOM_1446020-like [Glycine max]
 gb|KHM99236.1| CASP-like protein [Glycine soja]
Length=161

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + QTV +F I+  A + YSP+FKF   AN +V   SLL++ + F++ + A  P+++F++F
Sbjct  24   NNQTVLIFAIRFQAHFYYSPSFKFFVAANGVVVALSLLTLVLNFLMKRQA-SPRYHFFLF  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++M LL++GCA+ATAIGYVG+FGE H GW P+CD+V KFC    V + LSY A I 
Sbjct  83   LHDIVMMVLLIAGCAAATAIGYVGQFGEDHVGWQPICDHVRKFCTTNLVSLLLSYFAFIS  142

Query  389  YLILTVLSA  363
            Y  +T+LSA
Sbjct  143  YFGITLLSA  151



>ref|XP_006844552.1| hypothetical protein AMTR_s00016p00178190 [Amborella trichopoda]
 gb|ERN06227.1| hypothetical protein AMTR_s00016p00178190 [Amborella trichopoda]
Length=179

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 117/170 (69%), Gaps = 0/170 (0%)
 Frame = -3

Query  854  QQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFL  675
            QQ P K  KLF   Q+ LRL     +L+A   + TSKQ++ ++ + + A+YSYSPAF F 
Sbjct  9    QQGPNKPNKLFLISQIFLRLIALGASLSATIVMATSKQSIIIYNMPITAKYSYSPAFSFF  68

Query  674  AVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGK  495
             +AN +  G++ LS+  VFIL+  + DP+++F+MF+ DLI++ +++SG ++ATA+GY+G+
Sbjct  69   VIANGLAAGYAALSIPFVFILNNPSVDPRNHFFMFMFDLIMVCVVISGSSAATAVGYIGR  128

Query  494  FGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRKS  345
            +G  HSGW  +CD+ + FC++V + +  SY A + +++LT+L  N+ R S
Sbjct  129  YGNDHSGWGAICDHFTTFCNQVNLALIFSYTAFLVFILLTILYTNRMRAS  178



>ref|XP_010682994.1| PREDICTED: CASP-like protein 1F2 [Beta vulgaris subsp. vulgaris]
Length=183

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S+Q+  VFGI + A+YSYS AF+FL   NI +  FS+ S+       +   + K YF +F
Sbjct  49   SRQSTEVFGIVLQAKYSYSSAFRFLLGTNIAICAFSVFSLITTCAFYRPKSNCKSYFSVF  108

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L DLI M L+++GCA+ATAIGYVGKFG+S +GW  +CDNV+KFC+ +T+ I  SY+A   
Sbjct  109  LQDLIAMVLMMAGCAAATAIGYVGKFGQSQTGWTKICDNVNKFCNYITISIAFSYLAFFC  168

Query  389  YLILTVLSANQSRKS  345
               LT+++  +++++
Sbjct  169  LFALTIMAFKRAQQA  183



>ref|XP_010093945.1| hypothetical protein L484_008838 [Morus notabilis]
 gb|EXB54908.1| hypothetical protein L484_008838 [Morus notabilis]
Length=181

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = -3

Query  857  KQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKF  678
            +Q PP K   LF   Q+ LR+   A TLAA W +LTSKQ++ + GI  +ARYSYSPAFKF
Sbjct  9    QQNPPQKTQNLFFGAQICLRILAVASTLAATWIILTSKQSIEIIGITFEARYSYSPAFKF  68

Query  677  LAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVG  498
             A+AN +    S  ++F+VF   ++  +P +YF +FLHDL +++L+LSGCA+ATA+GYVG
Sbjct  69   FALANALACALSATTLFLVFFFRRIFLNPANYFILFLHDLSLLSLVLSGCAAATAVGYVG  128

Query  497  KFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            ++G SH+GW  +CD+  K+C +VT     SY+AV+F+L+LT+LSA++SR+
Sbjct  129  QYGNSHAGWSRICDHFEKYCKRVTTSAAFSYLAVLFFLVLTILSASKSRQ  178



>gb|AFK47640.1| unknown [Lotus japonicus]
Length=203

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVAN-IIvfgfsllsvfvvFILDKMAGDPK--HYF  579
            + QTVS+F I+++A + YS + KFL  AN ++     L  + V ++L + A   K  HYF
Sbjct  49   NNQTVSIFSIRLEAHFYYSTSLKFLVAANGVVCIMSVLTLMIVNYLLRQQAPQQKVYHYF  108

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++F+HD+++  LL++GCA+ATAIGYVG++GE H GW+P+CD+V KFC    V + LSY+A
Sbjct  109  FLFVHDMVMTLLLMAGCAAATAIGYVGQYGEQHMGWLPMCDHVRKFCKTNLVSLLLSYLA  168

Query  398  VIFYLILTVLSANQS  354
               YL LT+L+ ++S
Sbjct  169  FFAYLGLTILTVHRS  183



>ref|XP_007161657.1| hypothetical protein PHAVU_001G087600g [Phaseolus vulgaris]
 gb|ESW33651.1| hypothetical protein PHAVU_001G087600g [Phaseolus vulgaris]
Length=198

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + QTV +F ++ +A + YSP+ KF   AN +V   SLL++ + F++ +    PK+YF+M 
Sbjct  61   NHQTVFIFSLRFEAHFYYSPSLKFFVAANSVVAAMSLLTLILNFLMKRQP-SPKYYFFML  119

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  +L+ GCA+AT+IGYVG+FGE H GW P+CD+V KFC    V + LSY A I 
Sbjct  120  LHDIVMTVVLIGGCAAATSIGYVGQFGEEHVGWQPICDHVRKFCTTNLVSLLLSYFAFIA  179

Query  389  YLILTVLSANQS  354
            Y  LT+LSA  S
Sbjct  180  YFALTILSAYNS  191



>ref|XP_006604179.1| PREDICTED: CASP-like protein RCOM_1446020-like [Glycine max]
 gb|KHN28555.1| CASP-like protein [Glycine soja]
Length=197

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + QTV +F I+  A + YSP+FKF   AN +V   SLL++ + F++ K    P ++F++F
Sbjct  60   NNQTVLIFAIRFQAHFYYSPSFKFFVAANGVVVAMSLLTIILNFLM-KHQASPIYHFFLF  118

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  LL++GCA+ATAIGYVGKFGE H GW P+CD+V KFC    V + LSY A I 
Sbjct  119  LHDIVMTVLLIAGCAAATAIGYVGKFGEEHVGWQPICDHVRKFCTTNLVSLLLSYFAFIA  178

Query  389  YLILTVLSA  363
            Y  +T+LSA
Sbjct  179  YFGITILSA  187



>gb|EYU31861.1| hypothetical protein MIMGU_mgv1a019527mg [Erythranthe guttata]
Length=192

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q+V+VFGI MDARY++S +F+F  VA+ +V G S+LSV VV  L++   + K+YFY+ 
Sbjct  47   SAQSVTVFGIVMDARYTFSSSFRFKLVADSVVCGLSVLSVVVVISLNRPKSNSKNYFYLL  106

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L D++ + LL+SGC++A AIGYVG+FG++ +GW+ +CD V  FC+K+ V I  S++AVI 
Sbjct  107  LLDMVSVLLLVSGCSAAMAIGYVGRFGQAQTGWIAICDRVEIFCYKILVSIASSFLAVIC  166

Query  389  YLILTVLSANQ  357
             ++LTV+SA++
Sbjct  167  LVLLTVMSAHK  177



>ref|XP_010028955.1| PREDICTED: CASP-like protein 1F2 [Eucalyptus grandis]
 gb|KCW55784.1| hypothetical protein EUGRSUZ_I01612 [Eucalyptus grandis]
Length=189

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T+ +FGI+  A YSY+ AF+FL  A+ +V GFSLLS+ ++  + +    P++YF++F
Sbjct  52   SDETIVLFGIKFRAYYSYASAFRFLLGADAVVGGFSLLSLILLRFISRSGSTPRNYFFLF  111

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHDL +M L++S CA+ TAIG VG++GE   GW+ +C+ V+KFC++V V +  SY+A   
Sbjct  112  LHDLAMMVLMISACAAGTAIGNVGRYGEEKMGWVALCNRVTKFCNQVMVSVVFSYLAFFC  171

Query  389  YLILTVLSANQ  357
            YL LT+ SAN 
Sbjct  172  YLALTITSANN  182



>ref|XP_008379068.1| PREDICTED: CASP-like protein RCOM_1446020 [Malus domestica]
Length=187

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMA-GDPKHYFYMFL  567
            Q+V VFG++  A YSYS AF+FL  AN++V  FS+LS+  V  L + A    K+YF++FL
Sbjct  51   QSVVVFGLEFKAHYSYSTAFRFLVGANVVVCTFSVLSLIFVSFLSRPAYQHLKNYFFLFL  110

Query  566  HDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFY  387
            HD  +M L++SGCA+ATAIGYVGK+GE    W P C  V +FC+K+TV +  SY+A   Y
Sbjct  111  HDTALMVLMISGCAAATAIGYVGKYGEKKMTWQPTCGYVKEFCNKMTVSLVFSYLAFSAY  170

Query  386  LILTVLSANQ  357
            L+LT++ A+ 
Sbjct  171  LLLTLMGAHN  180



>ref|XP_011042941.1| PREDICTED: CASP-like protein 1F2 isoform X2 [Populus euphratica]
Length=160

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = -3

Query  854  QQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPAFKFL  675
            Q  PLK  K+F   Q+ LR+ + A + A+ W +LT+KQT+ + G  +DA+YSYSP FKFL
Sbjct  10   QNQPLKTQKIFIGAQIFLRIVVIAASFASTWLMLTNKQTIDIGGFVLDAKYSYSPEFKFL  69

Query  674  AVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGK  495
            + ANI+V  FS LS+  + ++ + + +P +YF +FLHDL +M+L+L GCA+AT IG +GK
Sbjct  70   SYANIVVGAFSFLSLLFLVLVGRRSSNPNYYFILFLHDLALMSLVLGGCAAATVIGSLGK  129

Query  494  FGESHSGWMPVCDNVSKFC  438
             G SH+GWM +CD+  KFC
Sbjct  130  NGNSHTGWMQICDHFGKFC  148



>ref|XP_010096062.1| hypothetical protein L484_008718 [Morus notabilis]
 gb|EXB62868.1| hypothetical protein L484_008718 [Morus notabilis]
Length=211

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 8/136 (6%)
 Frame = -3

Query  746  KQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFIL-------DKMAGDPK  588
            KQ+V+VFG Q  ARYSYS AF+FL  A+ +V   S LS+  +++L       D  A   +
Sbjct  67   KQSVTVFGFQFKARYSYSSAFRFLVGADSVVCSCSALSLAFLYLLRLSESITDSQA-QLR  125

Query  587  HYFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLS  408
             YF++FLHD +++ L +SGCA+ATAIGYVG+ GE H  W  VCD V KFC+K+ +G  LS
Sbjct  126  KYFFLFLHDTVMLVLGVSGCAAATAIGYVGRHGEDHMSWQKVCDQVPKFCNKMLIGSILS  185

Query  407  YIAVIFYLILTVLSAN  360
            Y+A   Y  LT++SA+
Sbjct  186  YLAFFAYFALTIISAH  201



>ref|XP_006446979.1| hypothetical protein CICLE_v10016868mg [Citrus clementina]
 ref|XP_006468862.1| PREDICTED: CASP-like protein RCOM_1446020-like [Citrus sinensis]
 gb|ESR60219.1| hypothetical protein CICLE_v10016868mg [Citrus clementina]
Length=183

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLH  564
            QTV VF +QM   YS S A++FL  ANI+    S+LS+  V ++ + A   K YF +FLH
Sbjct  49   QTVLVFLVQMKVTYSSSSAWRFLFGANIVTCILSVLSLIFVCLISRSASHMK-YFLLFLH  107

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            D++ M LL+SGCA+A+AIGYVGK+GE   GW PVC    KFC++ T+ + LSY+A + Y+
Sbjct  108  DMVTMVLLISGCAAASAIGYVGKYGELKMGWGPVCGFAPKFCNRSTISLVLSYLAFLCYM  167

Query  383  ILTVLSANQ  357
             LT+LSA++
Sbjct  168  GLTILSAHK  176



>emb|CBI21300.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 2/135 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+TV VF I    RYSY  AFKFL  A+ +V GFS+LS+  V I +K  G   HYF+++
Sbjct  4    AKETVEVFSISFTVRYSYLSAFKFLVGADAVVCGFSMLSLIFVSIFNK--GKSNHYFFLY  61

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
             HDLI+M L +S CA+ATA+GYVG++G+  + WM VC NV  FC K    I LS I  I 
Sbjct  62   FHDLILMVLSMSACAAATAVGYVGRYGQDKAAWMAVCGNVKMFCDKALASILLSLIGFIC  121

Query  389  YLILTVLSANQSRKS  345
              +LT+++A   R S
Sbjct  122  LFLLTIMAARNLRVS  136



>ref|XP_009352297.1| PREDICTED: CASP-like protein RCOM_1446020 [Pyrus x bretschneideri]
 ref|XP_009344201.1| PREDICTED: CASP-like protein RCOM_1446020 [Pyrus x bretschneideri]
Length=188

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 112/181 (62%), Gaps = 3/181 (2%)
 Frame = -3

Query  893  PKMESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQM  714
            PK  SF          P + + L +A Q+ LR++    TL A    +T+ Q+V VFG + 
Sbjct  6    PKENSFSVLHVNSSGVPRRRMSLLTA-QVALRISAFVFTLIAISVTVTNSQSVVVFGFKF  64

Query  713  DARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDP--KHYFYMFLHDLIVMALL  540
            +A YSYS AFKFL  AN++V  FS+LS+  +    + +     K+YF +F+HD ++M ++
Sbjct  65   EAHYSYSTAFKFLVGANVVVCAFSVLSLIFLSFFLRRSPSQHLKNYFVLFMHDTVMMVMM  124

Query  539  LSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSAN  360
            +SGCA+ATAIGYVGK+GE    W P C  V +FC+K+T+ +  SY+A   YL+LT+ +A+
Sbjct  125  ISGCAAATAIGYVGKYGEKKMTWQPTCGYVKEFCNKMTISLAFSYLAFSAYLLLTLTAAH  184

Query  359  Q  357
             
Sbjct  185  N  185



>ref|XP_008341274.1| PREDICTED: CASP-like protein RCOM_1446020 [Malus domestica]
Length=192

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDP--KHYFY  576
            + Q+V VFG + +A YSYS AFKFL  AN++V  FS+LS+  +    + +     K+YF 
Sbjct  53   NSQSVVVFGFKFEAHYSYSTAFKFLVGANVVVCAFSVLSLIFLSFFLRRSPSQHLKNYFV  112

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            +FLHD+++M +++SGCA+ATAIGYVGK+GE    W P C  V +FC+K+T+ +  SY+A 
Sbjct  113  LFLHDMVMMVMMISGCAAATAIGYVGKYGEKKMTWQPTCGYVKEFCNKMTISLAFSYLAF  172

Query  395  IFYLILTVLSANQ  357
              YL LT+++A+ 
Sbjct  173  SAYLFLTLIAAHN  185



>ref|XP_009378018.1| PREDICTED: CASP-like protein RCOM_1446020 [Pyrus x bretschneideri]
Length=188

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 112/181 (62%), Gaps = 3/181 (2%)
 Frame = -3

Query  893  PKMESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQM  714
            PK  SF          P + + L +A Q+ LR++    TL A    +T+ Q+V VFG + 
Sbjct  6    PKENSFSVLRVTSSGVPRRRMSLLTA-QVALRISAFVFTLIAISVTVTNSQSVVVFGFKF  64

Query  713  DARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDP--KHYFYMFLHDLIVMALL  540
            +A YSYS AFKFL  AN++V  FS+LS+  +    + +     K+YF +F+HD ++M ++
Sbjct  65   EAHYSYSTAFKFLVGANVVVCAFSVLSLIFLSFFLRRSPSQHLKNYFVLFMHDTVMMVMM  124

Query  539  LSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSAN  360
            +SGCA+ATAIGYVGK+GE    W P C  V +FC+K+T+ +  SY+A   YL+LT+ +A+
Sbjct  125  ISGCAAATAIGYVGKYGEKKMTWQPTCGYVKEFCNKMTISLAFSYLAFSAYLLLTLTAAH  184

Query  359  Q  357
             
Sbjct  185  N  185



>ref|XP_002274297.1| PREDICTED: CASP-like protein 1F2 [Vitis vinifera]
 sp|A7PA04.1|CSPL6_VITVI RecName: Full=CASP-like protein 1F2; Short=VvCASPL1F2 [Vitis 
vinifera]
Length=189

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 2/135 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+TV VF I    RYSY  AFKFL  A+ +V GFS+LS+  V I +K  G   HYF+++
Sbjct  53   AKETVEVFSISFTVRYSYLSAFKFLVGADAVVCGFSMLSLIFVSIFNK--GKSNHYFFLY  110

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
             HDLI+M L +S CA+ATA+GYVG++G+  + WM VC NV  FC K    I LS I  I 
Sbjct  111  FHDLILMVLSMSACAAATAVGYVGRYGQDKAAWMAVCGNVKMFCDKALASILLSLIGFIC  170

Query  389  YLILTVLSANQSRKS  345
              +LT+++A   R S
Sbjct  171  LFLLTIMAARNLRVS  185



>gb|KDO46460.1| hypothetical protein CISIN_1g030053mg [Citrus sinensis]
Length=183

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLH  564
            QTV VF +QM   YS S A++FL  ANI+    S+LS+  V ++   A   K YF +FLH
Sbjct  49   QTVLVFLVQMKVTYSSSSAWRFLFGANIVTCILSVLSLIFVCLISLSASHMK-YFLLFLH  107

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            D++ M LL+SGCA+A+AIGYVGK+GE   GW PVC    KFC++ T+ + LSY+A + Y+
Sbjct  108  DMVTMVLLISGCAAASAIGYVGKYGELKMGWGPVCGFAPKFCNRSTISLVLSYLAFLCYM  167

Query  383  ILTVLSANQ  357
             LT+LSA++
Sbjct  168  GLTILSAHK  176



>emb|CAN77740.1| hypothetical protein VITISV_043317 [Vitis vinifera]
Length=189

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+TV VF I    RYSY  AFKFL  A+ +V GFS+LS+  V I +K  G   HYF+++
Sbjct  53   AKETVEVFSISFTVRYSYLSAFKFLVGADAVVCGFSMLSLIFVSIFNK--GKSNHYFFLY  110

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
             HDLI+M L +S CA+ATA+GYVG++G+  + WM VC NV  FC K    I LS I    
Sbjct  111  FHDLILMVLSMSACAAATAVGYVGRYGQDKAAWMAVCGNVKMFCDKALASILLSLIGFXC  170

Query  389  YLILTVLSANQSRKS  345
              +LT+++A   R S
Sbjct  171  LFLLTIMAARNLRVS  185



>gb|KHG12313.1| CASP-like protein [Gossypium arboreum]
Length=195

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q+  + G  + A YS S A +FL V + IV  FS+LSV  V+ L +   D K+ FY+F
Sbjct  57   SSQSFPLLGFTIKAHYSDSSAMRFLLVTDAIVCAFSVLSVLFVYRLSRSGSDLKYCFYLF  116

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++M L  SGC++ATA+GY+G++GE   GWM VC++  KFC+++T+ + LSY+A   
Sbjct  117  LHDMVIMGLATSGCSAATAVGYIGRYGEEKMGWMAVCNHARKFCNQMTISMVLSYLAFCS  176

Query  389  YLILTVLSANQSRKSMFQ  336
            Y  L+V+S N   K M+Q
Sbjct  177  YFALSVMSGN---KVMYQ  191



>ref|XP_009783527.1| PREDICTED: CASP-like protein 1F1 [Nicotiana sylvestris]
 ref|XP_009783528.1| PREDICTED: CASP-like protein 1F1 [Nicotiana sylvestris]
 ref|XP_009783529.1| PREDICTED: CASP-like protein 1F1 [Nicotiana sylvestris]
 ref|XP_009783530.1| PREDICTED: CASP-like protein 1F1 [Nicotiana sylvestris]
Length=79

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            MF+HDL++M LLL+GCA+AT+IG+VGK+G   +GWMP+CD+VSKFCH+V   + LSY+ V
Sbjct  1    MFIHDLMMMVLLLAGCAAATSIGFVGKYGVRQAGWMPICDHVSKFCHRVADSVMLSYLGV  60

Query  395  IFYLILTVLSANQSR  351
             FYL LT++SAN+SR
Sbjct  61   FFYLCLTIISANRSR  75



>gb|KHF99186.1| CASP-like protein [Gossypium arboreum]
Length=204

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S QT  +FG  + A YSYS A +FL V + IV   SLLS+  V+ L     + K  FY+F
Sbjct  56   SSQTTVLFGFTIRAHYSYSSAMRFLFVTDAIVCASSLLSLIFVYHLSHSGSNLKTCFYLF  115

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  L +SGCA+ TA+GY+ ++GE   GWM +C+ V  FC+ +T+ + LSY+A + 
Sbjct  116  LHDMVITVLAISGCAAGTAVGYISRYGEEKMGWMAICNRVKSFCNHMTISMVLSYVAFLS  175

Query  389  YLILTVLSANQ  357
            YL L V+S+N+
Sbjct  176  YLALAVMSSNK  186



>ref|XP_007031972.1| CASP-like protein RCOM_1446020, putative [Theobroma cacao]
 gb|EOY02898.1| CASP-like protein RCOM_1446020, putative [Theobroma cacao]
Length=193

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 89/138 (64%), Gaps = 3/138 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q++ + G  + A+YSYS A +FL V + +V  FS LS+ +V  L +     K  FY+ 
Sbjct  56   SSQSIILLGFSIRAQYSYSSAMRFLLVTDAVVCAFSALSLILVCRLSRSGSYLKSCFYLL  115

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            +HD+++M L +SGCA+ATA+GYV ++GE   GWM +CD V KFC+++ + +  SY+A   
Sbjct  116  MHDMVIMVLAVSGCAAATAVGYVSRYGEEKMGWMAICDRVGKFCNQMMIALVFSYLAFFS  175

Query  389  YLILTVLSANQSRKSMFQ  336
            Y  L V+S+N   K M+Q
Sbjct  176  YFALAVMSSN---KVMYQ  190



>gb|KDP22559.1| hypothetical protein JCGZ_26390 [Jatropha curcas]
Length=178

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 121/173 (70%), Gaps = 0/173 (0%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            +++    P+K  K+F AIQ + RL +   T AAA+ + T+KQ+V++     DA+YSY P+
Sbjct  5    EDKFPNSPVKHNKVFVAIQFLFRLLVVGTTFAAAYLMATNKQSVTIDSFYFDAKYSYIPS  64

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            FKF A+ANII  G S++S  ++ I  +    P H+F++FLHDL ++ L+L GC++A AIG
Sbjct  65   FKFFALANIIACGCSVVSFLLLCIFSRHGCSPAHFFFLFLHDLFMLCLVLGGCSAAMAIG  124

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            Y+GK+G  HSGWMP+CD V+KFC++  +    S++AVI  LILT+ SA++SRK
Sbjct  125  YLGKYGNDHSGWMPICDQVTKFCNRTQMAFICSFLAVILLLILTLTSASKSRK  177



>ref|XP_004492988.1| PREDICTED: CASP-like protein RCOM_1446020-like [Cicer arietinum]
Length=188

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVAN-IIvfgfsllsvfvvFILDKMAGDPKHYFYM  573
            + QTV +F I  +A + Y  +FKF   AN ++ F   L  +  + +  +     ++YF++
Sbjct  54   NNQTVMLFSIAFEAHFYYMSSFKFFVAANGVVCFVSLLTLLINLLMKQQTPRRKEYYFFL  113

Query  572  FLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            FL DL++  LL++GCA+ATA+GYVG+FGE H+GW+P+CD+V KFC+   V + LSY+A  
Sbjct  114  FLFDLVMTVLLIAGCAAATAVGYVGQFGEEHAGWVPICDHVRKFCNTNLVSLLLSYLAFF  173

Query  392  FYLILTVLSA  363
              L LT+L A
Sbjct  174  ANLGLTILIA  183



>ref|XP_007217365.1| hypothetical protein PRUPE_ppa022990mg [Prunus persica]
 gb|EMJ18564.1| hypothetical protein PRUPE_ppa022990mg [Prunus persica]
Length=191

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 89/138 (64%), Gaps = 9/138 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMA---------G  597
            + Q+V VFG + +A Y+YS AFKFL  AN +V  FS LS+  + +    +          
Sbjct  44   NTQSVIVFGFKFEAHYTYSTAFKFLVGANAVVCAFSALSLIFLSLFVSRSVPQQQQQQQQ  103

Query  596  DPKHYFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGI  417
              K+YF++ LHD+++M L++SGCA+ATAIGYVG++GE    W P C  VSK+C+++++ +
Sbjct  104  QLKNYFFLLLHDVVMMVLIISGCAAATAIGYVGRYGEKKMTWQPTCGYVSKYCNRMSISL  163

Query  416  TLSYIAVIFYLILTVLSA  363
              SY+A   YL+LT  SA
Sbjct  164  AFSYLAFFAYLLLTFTSA  181



>ref|XP_008231051.1| PREDICTED: CASP-like protein RCOM_1446020 [Prunus mume]
Length=203

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 89/134 (66%), Gaps = 5/134 (4%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFI-----LDKMAGDPKH  585
            + Q+V VFG + +A Y+YS AF+FL  AN +V  FS LS+  + +     + +     K+
Sbjct  60   NTQSVIVFGFKFEAHYTYSTAFRFLVGANAVVCAFSALSLIFLSLFLSRSVPQQQRQFKN  119

Query  584  YFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSY  405
            YF++ +HD+++M L++SGCA+ATAIGYVG++GE    W P C  VSK+C ++++ +  SY
Sbjct  120  YFFLLVHDVVMMVLIISGCAAATAIGYVGRYGEKKMTWQPTCGYVSKYCDRMSISLAFSY  179

Query  404  IAVIFYLILTVLSA  363
            +A   YL+LT  SA
Sbjct  180  LAFFAYLLLTFTSA  193



>ref|XP_004304550.1| PREDICTED: CASP-like protein RCOM_1446020-like [Fragaria vesca 
subsp. vesca]
Length=200

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDP---KHYF  579
            ++Q+V +FG+   A Y+YS A KFL  A+ ++  FS +S+  ++ L +        K YF
Sbjct  58   NRQSVVIFGMNFQAHYTYSSALKFLVAADAVLCSFSAVSLVFIYSLSRSGSTNSPLKKYF  117

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++FL D ++M L+++GCA+ATAIGYVGK+GE H  W   C  VSKFC+++++ +  SY+A
Sbjct  118  FLFLLDTVMMVLIIAGCAAATAIGYVGKYGEEHMTWQATCGYVSKFCNRMSISLAFSYLA  177

Query  398  VIFYLILTVLSAN  360
             +  L+L  +SA+
Sbjct  178  FVASLLLNFMSAH  190



>ref|XP_002512876.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RH17.1|CSPLA_RICCO RecName: Full=CASP-like protein 1F2; Short=RcCASPL1F2 [Ricinus 
communis]
 gb|EEF49379.1| conserved hypothetical protein [Ricinus communis]
Length=201

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGD--PKHYFY  576
            S Q V VFG+   ARYSYS AF+FL  AN +V GFS+LS+  V ++ + +     K+Y Y
Sbjct  56   SDQNVIVFGMDTAARYSYSSAFRFLVGANAVVCGFSVLSLIFVCLMSRRSEAILEKNY-Y  114

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            +FLHD+++M +++SGC++ATAIGYVG++GE    W  VCD V KFC++  V I L+Y+A+
Sbjct  115  LFLHDMVMMVMMVSGCSAATAIGYVGRYGEKEITWTAVCDFVGKFCNQALVSIVLAYLAL  174

Query  395  IFYLILTVLSANQ  357
              Y+ LT L+A++
Sbjct  175  FCYVALTTLAAHK  187



>ref|XP_006373121.1| hypothetical protein POPTR_0017s08910g [Populus trichocarpa]
 gb|ERP50918.1| hypothetical protein POPTR_0017s08910g [Populus trichocarpa]
Length=193

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+ VS  G+ +  RYS SPA KFL  A+  V  FS+LS+  ++ L +       YF ++
Sbjct  56   AKEPVSFIGLTIAPRYSQSPAMKFLLGADATVCAFSVLSLLYLWALSRSGSQTTSYFLLY  115

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  L++SGCA+ATA+GY+ K+G+  + W P C  V+KFCH++ +   LSY+A   
Sbjct  116  LHDMVMTVLMISGCAAATAVGYLSKYGQREAFWNPFCSYVTKFCHQMLISTVLSYLAFFC  175

Query  389  YLILTVLSA  363
            YL L +L+A
Sbjct  176  YLALNILAA  184



>ref|XP_011045779.1| PREDICTED: CASP-like protein 1F3 [Populus euphratica]
Length=193

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+ VS+ G+ +   Y  S A KFL   N  VF F++LS+  V+ L +    P +YF++ 
Sbjct  56   AKEPVSLLGLAITPSYKQSSAMKFLLGVNATVFAFTVLSMLFVWPLRRSGSKPINYFFLH  115

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  LL+SGCA+ATA+GY+ ++G+  + W P+CD V KFCH++ +   LSY+A   
Sbjct  116  LHDMVMTLLLISGCAAATAVGYLSQYGQPETYWSPICDIVKKFCHQILISTVLSYLAFFC  175

Query  389  YLILTVLSANQ  357
            YL L +LS ++
Sbjct  176  YLALNILSVHK  186



>ref|XP_002298661.1| hypothetical protein POPTR_0001s33100g [Populus trichocarpa]
 sp|B9GFG6.1|CSPLF_POPTR RecName: Full=CASP-like protein 1F3; Short=PtCASPL1F3 [Populus 
trichocarpa]
 gb|EEE83466.1| hypothetical protein POPTR_0001s33100g [Populus trichocarpa]
Length=193

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+ VS+ G+ +   Y  S A KFL   N  VF F+ LS+  V+ L +    P +YF++ 
Sbjct  56   AKEPVSLLGLAITPSYKQSSAMKFLLGVNATVFAFTALSMLFVWPLRRSGSKPINYFFLH  115

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  LL+SGCA+ATA+GY+ ++G+  + W P+CD V KFCH++ +   LSY+A   
Sbjct  116  LHDMVMTLLLISGCAAATAVGYLSQYGQPETYWSPICDIVKKFCHQMLISTVLSYLAFFC  175

Query  389  YLILTVLSANQ  357
            YL L +LS ++
Sbjct  176  YLALNILSVHK  186



>ref|XP_006844549.1| hypothetical protein AMTR_s00016p00177260 [Amborella trichopoda]
 gb|ERN06224.1| hypothetical protein AMTR_s00016p00177260 [Amborella trichopoda]
Length=183

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 85/133 (64%), Gaps = 0/133 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            SKQT+++FG    A+YSYS A +F  VAN I   +SL+S+  V +L     +P+ +F+++
Sbjct  50   SKQTITLFGAPFTAKYSYSSALRFFVVANGIAAAYSLISLPFVCLLKYPRCNPRFHFFVY  109

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+++ LL++G ++ATAI YV K G+ HSGW+P+C+   +FC +  V +  SY +   
Sbjct  110  TIDLMMLCLLMAGLSAATAISYVAKNGDEHSGWLPICNTFHRFCSRTGVALVFSYGSFAV  169

Query  389  YLILTVLSANQSR  351
              +L +L  N+ R
Sbjct  170  SFLLMLLFTNRQR  182



>ref|XP_011005490.1| PREDICTED: CASP-like protein 1F3 [Populus euphratica]
 ref|XP_011015801.1| PREDICTED: CASP-like protein 1F3 [Populus euphratica]
Length=193

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+ VS+ G+ +  RYS S A KFL  A+  V  FS+LS+  ++ L +       YF +F
Sbjct  56   AKEPVSLIGLSIAPRYSQSLAMKFLLGADATVCAFSVLSLLFLWPLSRSGSQTTSYFLLF  115

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHD+++  L++SGCA+ATA+GY+ K+G+  + W P C  V+KFCH++ +   LSY+A   
Sbjct  116  LHDMVMTVLMISGCAAATAVGYLSKYGQREAFWNPFCSYVTKFCHQLLISTVLSYLAFFC  175

Query  389  YLILTVLSA  363
            YL L +L+A
Sbjct  176  YLALNILAA  184



>ref|XP_003624429.1| hypothetical protein MTR_7g083120 [Medicago truncatula]
 gb|AES80647.1| plant integral membrane protein [Medicago truncatula]
Length=186

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 84/130 (65%), Gaps = 1/130 (1%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPK-HYFYM  573
            + Q+V +F I+ +A + Y+ +FKF   AN +V   S+L++    ++ +     K +YF +
Sbjct  52   NNQSVMLFSIRFEAHFYYTSSFKFFVAANGVVCFMSVLTLIFNLLMRQQTPQRKDYYFLL  111

Query  572  FLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            FL DL++  LL++GC++ATA+GYVG++GE H GW  +CD+V KFC    + + LSY+A  
Sbjct  112  FLVDLVMTVLLIAGCSAATAVGYVGQYGEKHVGWTAICDHVQKFCKTNLISLLLSYLAFF  171

Query  392  FYLILTVLSA  363
              L LT+L A
Sbjct  172  ANLGLTILIA  181



>gb|EPS58442.1| hypothetical protein M569_16372, partial [Genlisea aurea]
Length=112

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            ++F  +AN I  GFS+ ++ +V +L   +     YF++FL DLIV  +LL GCA+AT+IG
Sbjct  1    YRFFVIANFIATGFSVTTLLLVVVLRNKSPGSNSYFFLFLLDLIVGDILLGGCAAATSIG  60

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            Y+GK+G  H+GW+PVCD+ +KFC + T+ I +SY  V+FYLIL   SA+ SR
Sbjct  61   YLGKYGNDHTGWLPVCDHFAKFCDRGTISIAVSYACVVFYLILASASASASR  112



>ref|XP_008464379.1| PREDICTED: CASP-like protein POPTRDRAFT_823430 [Cucumis melo]
Length=191

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 114/188 (61%), Gaps = 24/188 (13%)
 Frame = -3

Query  890  KMESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMD  711
            ++ES  S   +  QP +  + L S  Q++LR+ + + TLAA W +LT+KQ+V VFGI  D
Sbjct  10   ELES-KSCSHRHDQPTITNLHLCS--QIILRVLVISSTLAATWIILTAKQSVLVFGIPFD  66

Query  710  ARYSYSPAFK-------------FLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            ARY+YS AF+             FL++  +I       S            +    F+  
Sbjct  67   ARYNYSSAFEFFAFANAIASAFCFLSLCFLIFSSTRPSS--------STPPNFYILFFFR  118

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            LHDL++M L+LSGC++ATAIGYVGK+G +H+GW P+C++   FC++VT  I +SY++VI 
Sbjct  119  LHDLLMMGLVLSGCSAATAIGYVGKYGNTHAGWSPICNHFPSFCNRVTASIAISYLSVIC  178

Query  389  YLILTVLS  366
             LILT+LS
Sbjct  179  LLILTILS  186



>gb|KCW88131.1| hypothetical protein EUGRSUZ_A00525 [Eucalyptus grandis]
Length=127

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 83/139 (60%), Gaps = 27/139 (19%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            SK++++VFGI +DA+Y+YS AFK    A  +                  A  P    Y F
Sbjct  3    SKRSLTVFGILVDAQYTYSVAFKLFGYAKFV----------------ACACYPC---YSF  43

Query  569  LHD-------LIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITL  411
            L         L+VM L+ +GCA+ TAIGYVGK G +H GWMP+ D++ KFC+KVT+ IT+
Sbjct  44   LQSSDEETTVLVVMTLVTAGCAATTAIGYVGKHGNAHIGWMPIYDHLDKFCNKVTISITI  103

Query  410  SYIAVIFYLILTVLSANQS  354
            SY++ +  +I+TV+SA  S
Sbjct  104  SYVSFLL-MIVTVISACNS  121



>ref|XP_004138247.1| PREDICTED: CASP-like protein POPTRDRAFT_823430-like [Cucumis 
sativus]
 gb|KGN63449.1| hypothetical protein Csa_1G000725 [Cucumis sativus]
Length=201

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 87/135 (64%), Gaps = 7/135 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH-----  585
            +KQ+V +FGI  DARY+ S AF+F A AN I   F  LS+  +  L              
Sbjct  62   AKQSVLIFGIPFDARYNDSSAFQFFAFANAIASAFCFLSLCFLIFLSTRPSSNTSTPLNF  121

Query  584  --YFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITL  411
              +F+  LHDL++M L+LSGC++ATAIG+VGK+G +H+GW P+C++   FC++VT  I +
Sbjct  122  YIFFFFRLHDLLMMGLVLSGCSAATAIGFVGKYGNTHTGWSPICNHFPSFCNRVTASIAI  181

Query  410  SYIAVIFYLILTVLS  366
            SY +VI  LILT LS
Sbjct  182  SYFSVICLLILTTLS  196



>ref|XP_006844548.1| hypothetical protein AMTR_s00016p00176090 [Amborella trichopoda]
 gb|ERN06223.1| hypothetical protein AMTR_s00016p00176090 [Amborella trichopoda]
Length=181

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 87/133 (65%), Gaps = 0/133 (0%)
 Frame = -3

Query  746  KQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFL  567
            KQ++S+FG+ + A+Y+Y+PAF+F   +N I F +S+LS+  + +        K  F++FL
Sbjct  49   KQSISLFGLPITAKYTYAPAFRFFTASNSIAFAYSVLSLTYLLLKKAQGSGQKIGFFVFL  108

Query  566  HDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFY  387
             DLI++ ++++G + ATA+ ++GK+G  H+GW+P+C     FC +    ++LSY++    
Sbjct  109  LDLIMVVVVMAGSSGATAMAWLGKYGNPHTGWLPICGTFKSFCFRAAFSLSLSYVSFFAL  168

Query  386  LILTVLSANQSRK  348
             +L +LS N++ +
Sbjct  169  FLLILLSRNKNTQ  181



>ref|XP_006282498.1| hypothetical protein CARUB_v10006640mg [Capsella rubella]
 gb|EOA15396.1| hypothetical protein CARUB_v10006640mg [Capsella rubella]
Length=171

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 101/175 (58%), Gaps = 8/175 (5%)
 Frame = -3

Query  875  GSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSY  696
            G  +E ++ P L        +Q+ +R+      +A+ W ++T+++  SV+GI  +A+YSY
Sbjct  3    GDNNEGRRTPLLNL-----GVQVSMRVLAFGAAMASMWVMITNREVASVYGIAFEAKYSY  57

Query  695  SPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASAT  516
            + AFK+L  A I +   +  S+    +  +  G     F +F  DL+     +S  ++A 
Sbjct  58   ASAFKYLVYAQIAICAATFFSLIWACLAVRRRGLI---FALFFFDLLTTMTAISAFSAAL  114

Query  515  AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            A G++GK+G   +GW+P+CD V ++C++VT+ + LS+ + +   ILT+L+A+ SR
Sbjct  115  AEGHIGKYGNKQAGWLPICDYVHRYCNRVTISLALSFASFVLLFILTILTASASR  169



>emb|CDX92668.1| BnaC07g39260D [Brassica napus]
Length=170

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 102/175 (58%), Gaps = 9/175 (5%)
 Frame = -3

Query  875  GSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSY  696
            G+ DE++   PL  +     +Q+ +R+      LA+    +T+ +  SV+GI  +A+Y Y
Sbjct  3    GANDERR--TPLMNL----GVQVSMRVLAIGTALASMGLTITNHEVASVYGINFEAKYDY  56

Query  695  SPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASAT  516
            S AF++L  A I + G +L ++   ++  +  G     F +F  DL+     +S  ++A 
Sbjct  57   SSAFRYLVYAEIAIAGMTLFTLVWAYLAVRRRGLV---FALFFFDLLTTLTAISAFSAAM  113

Query  515  AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            + GY+GK+G +H+GW+P+C  V  +C++VT+ + L++ + +   ILTVL+A+ +R
Sbjct  114  SDGYIGKYGNTHAGWLPICGYVHNYCNRVTLSLALAFASFLLLFILTVLTASAAR  168



>ref|XP_009137491.1| PREDICTED: CASP-like protein At4g25040 [Brassica rapa]
Length=170

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 101/175 (58%), Gaps = 9/175 (5%)
 Frame = -3

Query  875  GSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSY  696
            G+ DE++   PL  +     +Q+ +R+      LA+    +T+ +  SV+GI  +A+Y Y
Sbjct  3    GANDERR--TPLMNL----GVQVSMRVLAIGTALASMGLTITNHEVASVYGINFEAKYDY  56

Query  695  SPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASAT  516
            S AF++L  A I + G +L ++    +  +  G     F +F  DL+     +S  ++A 
Sbjct  57   SSAFRYLVYAEIAIAGMTLFTLVWACLAVRRRGLV---FALFFFDLLTTLTAISAFSAAM  113

Query  515  AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            + GY+GK+G +H+GW+P+C  V  +C++VT+ + L++ + +   ILTVL+A+ +R
Sbjct  114  SDGYIGKYGNTHAGWLPICGYVHNYCNRVTLSLALAFASFLLLFILTVLTASAAR  168



>emb|CDY11050.1| BnaA03g47090D [Brassica napus]
Length=138

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + +  SV+GI  +A+Y YS AF++L  A I + G +L ++    +  +  G     F +F
Sbjct  7    NHEVASVYGINFEAKYDYSSAFRYLVYAEIAIAGMTLFTLVWACLAVRRRGLV---FALF  63

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+     +S  ++A + GY+GK+G +H+GW+P+C  V  +C++VT+ + L++ + + 
Sbjct  64   FFDLLTTLTAISAFSAAMSDGYIGKYGNTHAGWLPICGYVHNYCNRVTLSLALAFASFLL  123

Query  389  YLILTVLSANQSR  351
              ILTVL+A+ +R
Sbjct  124  LFILTVLTASAAR  136



>ref|XP_002321739.2| hypothetical protein POPTR_0015s11480g [Populus trichocarpa]
 gb|EEF05866.2| hypothetical protein POPTR_0015s11480g [Populus trichocarpa]
Length=72

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  554  VMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILT  375
            +M+L++ GCA+AT +G++GK G SH+GWM +CDN  KFC++    +T+SY+ +I   ILT
Sbjct  1    MMSLVVGGCAAATTVGFLGKHGNSHTGWMQICDNFGKFCNRAQTSVTISYLNLICLSILT  60

Query  374  VLSANQSRK  348
            + SA++SRK
Sbjct  61   ITSASKSRK  69



>emb|CDP16726.1| unnamed protein product [Coffea canephora]
Length=222

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMA----GDPKHY  582
            +KQTV+V  +   ARY+YS A +F   AN +V   S LS+ +  +  + A      P +Y
Sbjct  77   AKQTVNVGMLTFTARYNYSSAMRFQLGANSVVCALSFLSMLLFVLPLRSAHPQSEPPGNY  136

Query  581  FYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYI  402
            FY+ LHD+++  L++SGCA+ + +GY+ K+G+   GW+  C  + +FC+++   +  +Y 
Sbjct  137  FYLLLHDMVLTMLVISGCAAGSTVGYLAKYGQEQGGWIAFCTYLHRFCNQLQAALAFAYS  196

Query  401  AVIFYLILTVLSANQ  357
            A     +LT+++A++
Sbjct  197  AFFCMFVLTIVAASE  211



>ref|XP_010448483.1| PREDICTED: CASP-like protein 1F1 [Camelina sativa]
Length=170

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 99/173 (57%), Gaps = 7/173 (4%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL  +     +Q+ +R+      +A+   ++T+++  SV+GI  +A+YSYS A
Sbjct  4    DNEGRRTPLMNL----GVQVSMRVLAFGAAMASLLVMITNREVASVYGIAFEAKYSYSSA  59

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I + G +  ++    +  +  G     F +F  DL+     +S  ++A + G
Sbjct  60   FRYLVYAQIAICGATFFTLVWACLAVRRRGLV---FALFFFDLLTTITAISAFSAAFSEG  116

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            Y+GK+G   +GW+P+C  V  +C++VT+ + LS+ + +   +LTV++A+ +R 
Sbjct  117  YIGKYGNKEAGWLPICHYVHHYCNRVTISLALSFASFVLLFLLTVITASAARN  169



>ref|XP_006413351.1| hypothetical protein EUTSA_v10026410mg [Eutrema salsugineum]
 gb|ESQ54804.1| hypothetical protein EUTSA_v10026410mg [Eutrema salsugineum]
Length=169

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 79/133 (59%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +++  SV+GI  +ARYS S +F++L  A I +     LS+    +  +  G     F +F
Sbjct  38   NREVASVYGISFEARYSDSSSFRYLVYAQIAICAAIFLSLAWACLAVRRGGLV---FALF  94

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+     +S  ++A + GY+GK+G +H+GW+P+C  V  +C +VT+ + +S+ + + 
Sbjct  95   FFDLLATMTEISAFSAAMSEGYIGKYGNTHAGWLPICRYVHGYCSRVTLSLAMSFASFLL  154

Query  389  YLILTVLSANQSR  351
              ILTVL+A+ +R
Sbjct  155  LFILTVLTASAAR  167



>emb|CDY03385.1| BnaC01g16970D [Brassica napus]
Length=169

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + +  SV+GI  +A+YS S AF++L  A+I +   +L ++    +  +  G     F +F
Sbjct  38   NHEVASVYGIAFEAKYSDSSAFRYLVYADIAISALTLFTLVWACLAVRKRGLV---FALF  94

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+     +S  ++AT+ GY+GK+G +H+GW+P+C  V  +C++ T+ +  S+ + + 
Sbjct  95   FFDLLATLTAMSAFSAATSEGYIGKYGNTHAGWLPICGYVHGYCNRGTLSLAFSFASFLL  154

Query  389  YLILTVLSANQSR  351
              ILTVL+A+ +R
Sbjct  155  LFILTVLNASAAR  167



>ref|XP_009138787.1| PREDICTED: CASP-like protein At4g25040 [Brassica rapa]
 emb|CDY34336.1| BnaA01g14390D [Brassica napus]
Length=169

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + +  SV+GI  +A+YS S AF++L  A+I +   +L ++    +  +  G     F +F
Sbjct  38   NHEVASVYGIAFEAKYSDSSAFRYLVYADIAISALTLFTLVWACLAVRNRGLV---FALF  94

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+     +S  ++AT+ GY+GK+G +H+GW+P+C  V  +C++ T+ +  S+ + + 
Sbjct  95   FFDLLATLTAMSAFSAATSEGYIGKYGNTHAGWLPICGYVHGYCNRGTLSLAFSFASFLL  154

Query  389  YLILTVLSANQSR  351
              ILTVL+A+ +R
Sbjct  155  LFILTVLTASAAR  167



>gb|KDP20967.1| hypothetical protein JCGZ_21438 [Jatropha curcas]
Length=165

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 77/137 (56%), Gaps = 5/137 (4%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S+ +  V  +   A+YS +PAFK+  +A  I   ++++ + ++   + + G       + 
Sbjct  30   SRDSTQVLNLTFTAKYSNTPAFKYFVIAEAIASVYTIIVILLILCSESLLGR-----LIV  84

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  LL +   +A AI  VGK G SH+GW+P+C  V KFC +VTV +   ++A +F
Sbjct  85   ILDMVITVLLSTSITAALAIAQVGKKGNSHAGWLPICGQVPKFCDQVTVSLICGFVAAVF  144

Query  389  YLILTVLSANQSRKSMF  339
            Y +L ++S +     +F
Sbjct  145  YFVLLLISLHAVLSPIF  161



>gb|AAM63685.1| unknown [Arabidopsis thaliana]
Length=169

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL    L   +Q+ +R+      +A+ W ++T+++  SV+GI  +A+YSYS A
Sbjct  3    DNEGRRTPL----LNLGVQVSMRVLTIGAAMASMWVMITNREVASVYGIAFEAKYSYSSA  58

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I V   +L ++    +  +  G     F +F  DL+     +S  ++A A G
Sbjct  59   FRYLVYAQIAVCAATLFTLVWACLAVRRRGLV---FALFFFDLLTTLTAISAFSAAFAEG  115

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            YVGK+G   +GW+P+C  V  +C +VT+ + +S+ + I   ILTVL+A+ +R
Sbjct  116  YVGKYGNKQAGWLPICGYVHGYCSRVTISLAMSFASFILLFILTVLTASAAR  167



>ref|NP_194234.1| CASP-like protein [Arabidopsis thaliana]
 sp|Q9M0L3.1|CSPLR_ARATH RecName: Full=CASP-like protein 1F1; Short=AtCASPL1F1 [Arabidopsis 
thaliana]
 emb|CAB79413.1| putative protein [Arabidopsis thaliana]
 gb|AEE84995.1| CASP-like protein [Arabidopsis thaliana]
Length=170

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL    L   +Q+ +R+      +A+ W ++T+++  SV+GI  +A+YSYS A
Sbjct  4    DNEGRRTPL----LNLGVQVSMRVLTIGAAMASMWVMITNREVASVYGIAFEAKYSYSSA  59

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I V   +L ++    +  +  G     F +F  DL+     +S  ++A A G
Sbjct  60   FRYLVYAQIAVCAATLFTLVWACLAVRRRGLV---FALFFFDLLTTLTAISAFSAAFAEG  116

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            YVGK+G   +GW+P+C  V  +C +VT+ + +S+ + I   ILTVL+A+ +R
Sbjct  117  YVGKYGNKQAGWLPICGYVHGYCSRVTISLAMSFASFILLFILTVLTASAAR  168



>ref|XP_010531853.1| PREDICTED: CASP-like protein 1F1 [Tarenaya hassleriana]
Length=157

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLH  564
            +  S++G    A+YSYSP+FK+ A ANI +   +L+S+       K  G     F +FL+
Sbjct  29   EIASLYGFSFAAKYSYSPSFKYFAYANIAIAAATLVSLICACSSRKAGGG----FALFLY  84

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            DL V  + ++  ++ATA GY+GK+G SH+GW+P+C  V  +C +VT+ + LS +A +  L
Sbjct  85   DLCVTVVAITAFSAATAEGYIGKYGNSHTGWIPICGYVGNYCRRVTISLALSLVASVLLL  144

Query  383  ILTVLSANQSR  351
            +LT+LSA+ SR
Sbjct  145  LLTILSASASR  155



>ref|XP_010438928.1| PREDICTED: CASP-like protein 1F1 [Camelina sativa]
Length=170

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 100/173 (58%), Gaps = 7/173 (4%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL  +     +Q+ +R+      +A+   ++T+++  SV+GI  +A+YSYS A
Sbjct  4    DNEGRRTPLMNL----GVQVSMRVLAFGAAMASLLVMITNREVASVYGIAFEAKYSYSSA  59

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I + G +  ++    +  +  G     F +FL DL+     +S  ++A A G
Sbjct  60   FRYLVYAQIAICGATFFTLVWACLAVRRRGLV---FALFLFDLLTTITAISAFSAAFAEG  116

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            Y+GK+G   +GW+P+C  V  +C++VT+ + LS+ + +   +LTV++A+ +R 
Sbjct  117  YIGKYGNKEAGWLPICHYVHHYCNRVTISLALSFSSFVLLFLLTVITASAARN  169



>ref|XP_002869692.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MGK0.1|CSPL5_ARALL RecName: Full=CASP-like protein 1F1; Short=AlCASPL1F1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45951.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 100/172 (58%), Gaps = 7/172 (4%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL    L   +Q+ +R+ I    +A+ W ++T+++  SV+GI  +A+YSYS A
Sbjct  4    DNEGRRTPL----LNLGVQVSMRVLIIGAAMASMWVMITNREVASVYGIAFEAKYSYSSA  59

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I V   +L ++    +  +  G     F +F  DL+     +S  ++A A G
Sbjct  60   FRYLVYAQIAVCAATLFTLVWACLAVRRRGLV---FALFFFDLLTTLTAISAFSAAFAEG  116

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSR  351
            YVGK+G   +GW+P+C  V  +C +VT+ + +S+ + +   ILTVL+A+ +R
Sbjct  117  YVGKYGNKQAGWLPICGYVHVYCSRVTISLAMSFASFVLLFILTVLTASSAR  168



>ref|XP_010433695.1| PREDICTED: CASP-like protein 1F1 [Camelina sativa]
Length=170

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 99/173 (57%), Gaps = 7/173 (4%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL  +     +Q+ +R+      +A+   ++T+++  SV+GI  +A+YSYS A
Sbjct  4    DNEGRRTPLMNL----GVQVSMRVLAFGAAMASLLVMITNREVASVYGIAFEAKYSYSSA  59

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I + G +  ++    +  +  G     F +F  DL+     +S  ++A A G
Sbjct  60   FRYLVYAQIAICGATFFTLVWACLAVRRRGLV---FALFFFDLLTTITAISAFSAAFAEG  116

Query  506  YVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSANQSRK  348
            Y+GK+G   +GW+P+C  V  +C++VT+ + LS+ + +   +LTV++A+ +R 
Sbjct  117  YIGKYGNKEAGWLPICHYVHHYCNRVTISLALSFASFVLLFLLTVITASAARN  169



>ref|XP_009109230.1| PREDICTED: CASP-like protein At4g25040 [Brassica rapa]
Length=168

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +++  SV+GI  +A+YS S AF++L  A I +   +L ++    +  +  G     F +F
Sbjct  37   NREVASVYGIAFEAKYSDSSAFRYLVFAYIAISAVTLFTLAWACLAVRRGG---FIFALF  93

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL++    LS  ++A + GY+GK+G +H+GW+P+C  V  +C++ T+ + LS+++ + 
Sbjct  94   FFDLLMTLTALSAFSAAMSEGYIGKYGNTHAGWLPICGYVHNYCNRTTLSLALSFVSFLL  153

Query  389  YLILTVLSANQSRKS  345
              +LTVL+A+ +R+S
Sbjct  154  LFVLTVLTASAARRS  168



>gb|KFK28997.1| hypothetical protein AALP_AA7G075900 [Arabis alpina]
Length=167

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 78/133 (59%), Gaps = 3/133 (2%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            + +  +V+G+   A+YS S +F++L  A+I +   +L ++       +  G     F +F
Sbjct  36   NHEVATVYGLAFSAKYSDSKSFRYLVYADIAICAVTLFTLLWACFAVRRTGLV---FALF  92

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+V    +S  ++AT+ GY+GK+G + +GW+P+C  V  +C + T+ + LS+ + I 
Sbjct  93   FFDLLVTVTAISAFSAATSEGYIGKYGNNAAGWLPICRYVHGYCTRSTISLALSFASFIL  152

Query  389  YLILTVLSANQSR  351
              +LTVLSA+ +R
Sbjct  153  LFLLTVLSASAAR  165



>ref|XP_007043593.1| CASP-like protein POPTRDRAFT_270504 [Theobroma cacao]
 gb|EOX99424.1| CASP-like protein POPTRDRAFT_270504 [Theobroma cacao]
Length=163

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 77/131 (59%), Gaps = 7/131 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  +V  +  +A+YS +PAFK+  +AN IV  +         +L  +  +   +  + 
Sbjct  30   SRERTTVLTLSFEAKYSDAPAFKYFVIANAIVSIYGF-------LLLFLPSESLLWRLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D++   LL S  ++A AI YVGK G  ++GW+P+CD V+K+C++V   + + +I+VI 
Sbjct  83   ALDVVFTMLLTSSISAALAIAYVGKKGNPNAGWLPICDQVTKYCNQVKGALVVGFISVII  142

Query  389  YLILTVLSANQ  357
            Y++L + S ++
Sbjct  143  YMLLLLYSIHR  153



>ref|XP_004506615.1| PREDICTED: CASP-like protein RCOM_1174750-like [Cicer arietinum]
Length=163

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 77/128 (60%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S + VS+F +  +A+Y+ SPA K+  +AN IV  +  L +F       +  +   + ++ 
Sbjct  30   SHERVSLFTVSFEAKYTNSPALKYFVIANSIVTVYGFLVLF-------LPSESLLWRFVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  LL+S  ++A AI  V K G +++ W+P+CD+VSKFC+ +T  +  S I VI 
Sbjct  83   VVDMVLTMLLISSISAALAIAQVAKKGNNYAAWLPICDSVSKFCNHMTGALIASVIGVII  142

Query  389  YLILTVLS  366
            Y+IL + S
Sbjct  143  YMILLLYS  150



>gb|KDP24131.1| hypothetical protein JCGZ_25788 [Jatropha curcas]
Length=163

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 74/133 (56%), Gaps = 11/133 (8%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T S+FG+ ++A+Y+ +P+FK+  + N IV  +  L +F+          P+   +  
Sbjct  30   SHETGSLFGLSVEAKYTDTPSFKYFVIVNSIVTVYGFLVLFL---------PPQSLLWRL  80

Query  569  L--HDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            +   D++   LL S  ++A AI  VGK G SH+GW P C  V KFC +VT  +   +IAV
Sbjct  81   VVAMDVVFTMLLTSSISAALAIAQVGKNGNSHAGWFPTCGRVPKFCDQVTGALVAGFIAV  140

Query  395  IFYLILTVLSANQ  357
            I Y IL + + N 
Sbjct  141  IIYAILLLYAINN  153



>ref|XP_006371562.1| integral membrane family protein [Populus trichocarpa]
 sp|B9N2D0.1|CSPLK_POPTR RecName: Full=CASP-like protein 1C2; Short=PtCASPL1C2 [Populus 
trichocarpa]
 gb|ERP49359.1| integral membrane family protein [Populus trichocarpa]
Length=162

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  + F +  +A+Y+ +PAFK+  +AN IV  +  L      +L    G P     + 
Sbjct  30   SHEKGTFFAVSYEAKYTDTPAFKYFVIANAIVTVYGFL------VLFHPPGSPLWRLVLA  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L DL+   LL+S  ++A A+  VGK G S +GW+PVC  V+K+C++VT  +    IA+I 
Sbjct  84   L-DLVFTMLLISSISAALAVAQVGKNGNSRAGWLPVCGQVTKYCNQVTGALVAGLIALIT  142

Query  389  YLIL  378
            Y+IL
Sbjct  143  YIIL  146



>ref|XP_006376496.1| integral membrane family protein [Populus trichocarpa]
 sp|B9N5U6.2|CSPL4_POPTR RecName: Full=CASP-like protein 1C3; Short=PtCASPL1C3 [Populus 
trichocarpa]
 gb|ERP54293.1| integral membrane family protein [Populus trichocarpa]
Length=171

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 75/128 (59%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  S F +  +A+YS +PAFK+  +AN IV  +  L++F       +  +   +  + 
Sbjct  30   SHEKGSFFALSYEAKYSDTPAFKYFVIANAIVTVYGFLALF-------IPSESPLWRLVL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+   LL+S  ++A A+  VGK G S +GW+PVC  V+K+C++VT  +   +IA+I 
Sbjct  83   ALDLVFTMLLISSISAALAVAQVGKKGNSSAGWLPVCGQVTKYCNQVTGALVAGFIAIIT  142

Query  389  YLILTVLS  366
            Y+IL + S
Sbjct  143  YIILLLYS  150



>ref|XP_007198888.1| hypothetical protein PRUPE_ppa020481mg [Prunus persica]
 gb|EMJ00087.1| hypothetical protein PRUPE_ppa020481mg [Prunus persica]
Length=163

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 79/137 (58%), Gaps = 7/137 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  +V G+  +A+Y+++PAF++  +AN IV  +  L +F       +    + +  + 
Sbjct  30   SHERSNVLGLSFEAKYNHTPAFRYFVIANAIVTVYGFLVLF-------LPSKSQLWRLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+++  LL SG ++A AIG VG+ G S++GW+P+C  V K+C +V   +  S++ ++ 
Sbjct  83   ALDMVLTILLTSGISAALAIGSVGRHGNSYAGWLPICGQVPKYCDQVKGALIASFVGLLI  142

Query  389  YLILTVLSANQSRKSMF  339
            Y +L + + + +   +F
Sbjct  143  YAVLLLYAIHNALDPLF  159



>emb|CDO99544.1| unnamed protein product [Coffea canephora]
Length=160

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 72/128 (56%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            ++ +  VF +  +A Y+ SP FK+  + N +  G++L       I+         + ++ 
Sbjct  30   ARDSAQVFNMTFEANYTNSPTFKYFVIINAVAGGYTL-------IVLFCPSKVSLFRFLL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DLIV  LL S  ++  AIG VGK G SH+GW+P+C+ V KFC+ V   +  +++A + 
Sbjct  83   VSDLIVTLLLDSSVSANIAIGQVGKHGNSHAGWLPICNQVPKFCNHVAGALIANFVASLA  142

Query  389  YLILTVLS  366
            YL++ + S
Sbjct  143  YLVILLYS  150



>ref|XP_010925917.1| PREDICTED: CASP-like protein 1F2 [Elaeis guineensis]
Length=221

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 8/135 (6%)
 Frame = -3

Query  746  KQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFL  567
            +QT  + G  M A Y  SP ++F  + N +  G+ +L++    I+    G   H+   F+
Sbjct  92   EQTTDIAGFAMHASYKSSPTYRFFMIGNFVATGYEMLAL----IVVSYTGT--HFLVNFM  145

Query  566  HDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFY  387
             DL+ M+L+++  A+ATAIG+VGK G SH+GWMPVC+   KFC++V   +  SY+  +  
Sbjct  146  -DLMAMSLVMASAAAATAIGHVGKKGNSHTGWMPVCNYFEKFCNRVEYSVACSYVGFLCL  204

Query  386  LIL-TVLSANQSRKS  345
            L++ ++++  +SR S
Sbjct  205  LVVCSLIAIPKSRTS  219



>ref|XP_011037328.1| PREDICTED: CASP-like protein 1C3 [Populus euphratica]
Length=171

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 72/124 (58%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  S F +  +A+YS +PAFK+  +AN IV  +  L+      L   +  P     + 
Sbjct  30   SHEKGSFFALSYEAKYSDTPAFKYFVIANAIVTVYGFLA------LFIPSESPLRRLVLA  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L DL+   LL+S  ++A A+  VGK G S +GW+PVC  V+K+C++VT  +   +IA+I 
Sbjct  84   L-DLVFTMLLISSISAALAVAQVGKKGNSSAGWLPVCGQVAKYCNQVTGALVAGFIAIIT  142

Query  389  YLIL  378
            Y+IL
Sbjct  143  YIIL  146



>ref|XP_003528452.1| PREDICTED: CASP-like protein POPTRDRAFT_758901-like [Glycine 
max]
 gb|KHN07261.1| CASP-like protein [Glycine soja]
Length=160

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++  VF +   A+YS  PAFK+  VA  I  G+SL       IL            + 
Sbjct  30   SHESTEVFNLTFTAKYSNDPAFKYFVVAEAIACGYSL-------ILLFTCSQTSLGRLVL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  LL S  ++A AI +VGK G +H+GW+P+C  V KFC  VT  +   + A I 
Sbjct  83   ILDVVIAMLLTSSVSAALAIAHVGKKGNTHAGWLPICGQVPKFCDHVTGALVAGFAAAII  142

Query  389  YLIL  378
            YLIL
Sbjct  143  YLIL  146



>sp|A7PJ32.1|CSPL2_VITVI RecName: Full=CASP-like protein 1C2; Short=VvCASPL1C2 [Vitis 
vinifera]
 emb|CBI21849.3| unnamed protein product [Vitis vinifera]
Length=161

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 70/124 (56%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  +   + ++A+YS++PAFK+  +AN I   +SL       +L  +      +  + 
Sbjct  31   SHERTTYLSLSIEAKYSHTPAFKYFVIANAIGSAYSL-------LLLFLPSHGSLWPLVI  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+++   L S  ++A +I YVGK G S++GW+P+CD V  +C+ VT  +   +I V+ 
Sbjct  84   ASDVVITMFLTSSISAALSIAYVGKKGNSYAGWLPICDQVPNYCNHVTGALAAGFIGVVL  143

Query  389  YLIL  378
            Y++L
Sbjct  144  YMVL  147



>ref|XP_002272783.1| PREDICTED: CASP-like protein 1C2 [Vitis vinifera]
Length=162

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 70/124 (56%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  +   + ++A+YS++PAFK+  +AN I   +SL       +L  +      +  + 
Sbjct  32   SHERTTYLSLSIEAKYSHTPAFKYFVIANAIGSAYSL-------LLLFLPSHGSLWPLVI  84

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+++   L S  ++A +I YVGK G S++GW+P+CD V  +C+ VT  +   +I V+ 
Sbjct  85   ASDVVITMFLTSSISAALSIAYVGKKGNSYAGWLPICDQVPNYCNHVTGALAAGFIGVVL  144

Query  389  YLIL  378
            Y++L
Sbjct  145  YMVL  148



>ref|XP_008229156.1| PREDICTED: CASP-like protein RCOM_1174750 [Prunus mume]
Length=163

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 73/124 (59%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  +V G+  +A+Y+++PAF++  +AN IV  +  L +F       +    + +  + 
Sbjct  30   SHERSNVLGLSFEAKYNHTPAFRYFVIANAIVTVYGFLVLF-------LPSKSQLWRLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+++  LL SG ++A AIG VG+ G S++GW+P+C  V K+C +V   +  S++ ++ 
Sbjct  83   ALDMVLTMLLTSGISAALAIGSVGRHGNSYAGWLPICGQVPKYCDQVKGALIASFVGLLI  142

Query  389  YLIL  378
            Y +L
Sbjct  143  YAVL  146



>gb|KHG04935.1| CASP-like protein [Gossypium arboreum]
Length=162

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 70/128 (55%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++  V  I+  A+YS SP FKF   A  I  G+ L       I+  ++        + 
Sbjct  31   SHESAEVMNIKFSAKYSNSPTFKFYVTAEAIATGYGL-------IVLFLSSRRSFDRLIV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  +L S  ++A A+  +GK G++H+GW+PVC+ V KFC  VT  +   ++A I 
Sbjct  84   ILDVVIALILTSSISAALAVAQIGKKGDTHAGWLPVCNQVPKFCDHVTGALIAGFVAAIV  143

Query  389  YLILTVLS  366
            YL+L + S
Sbjct  144  YLVLNLYS  151



>ref|XP_007132660.1| hypothetical protein PHAVU_011G114000g [Phaseolus vulgaris]
 gb|ESW04654.1| hypothetical protein PHAVU_011G114000g [Phaseolus vulgaris]
Length=163

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  TV++F +  +A+Y+ SPAFK+  +A  ++  +    +F       +      +  + 
Sbjct  30   SHDTVTIFTVSFEAKYTNSPAFKYFVIAYSVITVYGFFVLF-------LPAKSLLWQLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+   LL+S  ++A AI  VGK G +++GW+P+CD+V K+C + T  +   +IA+I 
Sbjct  83   ALDLVFTILLVSSLSAAVAIAQVGKKGNNYAGWLPICDSVPKYCDEATRALIAGFIAMII  142

Query  389  YLIL  378
            Y+IL
Sbjct  143  YIIL  146



>gb|EYU43392.1| hypothetical protein MIMGU_mgv1a026498mg [Erythranthe guttata]
Length=162

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S+ +  VF ++ +A+Y+ SP F +  + N I  G++L       IL            + 
Sbjct  30   SRDSAQVFNVKFEAKYTNSPTFTYFVLMNAIASGYTL-------ILLFFPTKCSFGHLIL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DLIV  LL S  ++  AIG VGK G SH+GW+P+C  V +FC  VT  I   ++A + 
Sbjct  83   IFDLIVALLLDSSISACIAIGQVGKKGNSHAGWLPICGQVPRFCDHVTGAIIAGFVAALV  142

Query  389  YLILTVLS  366
            Y ++ V S
Sbjct  143  YFLILVYS  150



>ref|XP_006467803.1| PREDICTED: CASP-like protein POPTRDRAFT_810994-like [Citrus sinensis]
Length=161

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q+  VF +   A++S  P FK+  VA  I  G++L       ++  ++     +  + 
Sbjct  28   SHQSAEVFNLTFTAKFSNEPVFKYFVVAEAIACGYTL-------VVLILSSRSLLWRLIV  80

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D ++ A+L S  ++A AI  VGK G SH+GW+P+C  V KFC  VT  +   ++A I 
Sbjct  81   ILDAVMTAVLTSSISAALAIARVGKKGNSHAGWLPICGQVPKFCDHVTGALVCGFVAAIV  140

Query  389  YLILTVLS  366
            Y +L V S
Sbjct  141  YALLLVFS  148



>gb|KDO75960.1| hypothetical protein CISIN_1g047574mg [Citrus sinensis]
Length=163

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q+  VF +   A++S  P FK+  VA  I  G++L       ++  ++     +  + 
Sbjct  30   SHQSAEVFNLTFTAKFSNEPVFKYFVVAEAIACGYTL-------VVLILSSRSLLWRLIV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D ++ A+L S  ++A AI  VGK G SH+GW+P+C  V KFC  VT  +   ++A I 
Sbjct  83   ILDAVMTAVLTSSISAALAIARVGKKGNSHAGWLPICGQVPKFCDHVTGALVCGFVAAIV  142

Query  389  YLILTVLS  366
            Y +L V S
Sbjct  143  YALLLVFS  150



>ref|XP_011086074.1| PREDICTED: CASP-like protein 1C1 isoform X1 [Sesamum indicum]
Length=162

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  +F ++ +A+Y+ SP FK+  + N I  G++L       IL   +    +   + 
Sbjct  30   SHDSAQLFNMKFEAKYTNSPTFKYFVLMNAIASGYTL-------ILLFFSSKSSYGHLIL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DL++  LL S  ++  AIG VGK G SH+GW+P+C  V KFC  VT  +   ++A I 
Sbjct  83   ILDLVMALLLDSSISACLAIGQVGKNGNSHAGWLPICGQVPKFCDHVTGALVAGFVAAIV  142

Query  389  YLILTVLSANQSRKSMF  339
            Y ++ + S +      F
Sbjct  143  YFLILLYSLHNVMNLFF  159



>ref|XP_007025630.1| CASP-like protein POPTRDRAFT_758901 [Theobroma cacao]
 gb|EOY28252.1| CASP-like protein POPTRDRAFT_758901 [Theobroma cacao]
Length=163

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 7/137 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V  ++  A+Y+ SP FK+  +A  I  G+SL       I+  ++     +  + 
Sbjct  30   SHDSADVLNLKFSAKYTNSPTFKYYVIAEAIATGYSL-------IVLFLSSKSLVWRLIV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  LL S  ++A AI  +GK G SH+GW+P+C  V KFC  VT  +   ++A I 
Sbjct  83   ILDVVIAMLLTSSISAALAIAQIGKKGNSHAGWLPICGQVPKFCDHVTGALIAGFVAAIV  142

Query  389  YLILTVLSANQSRKSMF  339
            YL+L + S +     +F
Sbjct  143  YLVLNLYSLHAVLSPLF  159



>ref|XP_002517919.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RW00.1|CSPL6_RICCO RecName: Full=CASP-like protein 1C1; Short=RcCASPL1C1 [Ricinus 
communis]
 gb|EEF44437.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 75/128 (59%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++ S F +  +A+YS +PAFK+  + N IV  +S L++F       +  +   +  + 
Sbjct  30   SHESGSFFTVSYEAKYSDTPAFKYFVIVNAIVTVYSFLALF-------LPSESLLWRLVI  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   L+ S  ++A A+  VGK G SH+GW+P+C  V KFC +VT  +  ++I++I 
Sbjct  83   VTDVVFTMLVTSSISAAVAVAQVGKKGNSHAGWLPICGQVPKFCDQVTGALAAAFISLIT  142

Query  389  YLILTVLS  366
            Y IL + S
Sbjct  143  YAILLLYS  150



>ref|XP_010110215.1| hypothetical protein L484_009820 [Morus notabilis]
 gb|EXC25512.1| hypothetical protein L484_009820 [Morus notabilis]
Length=163

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  S+F I  +A+YS +PAFK+  +AN IV  + +L +F       +  +   +  + 
Sbjct  30   SHEKASLFTISFEAKYSQTPAFKYFVIANAIVSVYGILVLF-------LPSESLLWRLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+   LL S  ++A AI YVGK G +++GW+P+C  V ++C +V   +   +IA+I 
Sbjct  83   AFDLVFTMLLNSSISAALAIAYVGKKGNTYAGWLPICGQVPRYCGQVKGALIAGFIALII  142

Query  389  YLIL  378
            Y+ L
Sbjct  143  YMAL  146



>gb|KEH17619.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=163

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  S F +  +A+Y+ SPAFK+  +AN IV  +    +F       +  +   +  + 
Sbjct  30   SHEKASFFTVSFEAKYTNSPAFKYFVIANSIVTVYGFFVLF-------LPAESLLWRLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+++  LL+S  ++A AI  V K G +++ W+P+C +V KFC+ +T  +  S+I VI 
Sbjct  83   AMDMVLTMLLISSISAALAIAQVAKNGNNYAAWLPICGSVPKFCNHMTGALVASFIGVII  142

Query  389  YLIL  378
            YLIL
Sbjct  143  YLIL  146



>ref|XP_010915912.1| PREDICTED: CASP-like protein 1F2 [Elaeis guineensis]
 ref|XP_010915913.1| PREDICTED: CASP-like protein 1F2 [Elaeis guineensis]
Length=177

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 75/128 (59%), Gaps = 7/128 (5%)
 Frame = -3

Query  746  KQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFL  567
            +QT  + G  M A Y  SPAF+F  + N +  G+ +L++    IL    G   ++   F+
Sbjct  49   EQTTDIAGFTMHADYKSSPAFRFFMIGNFVAAGYGMLAL----ILVSYTGT--NWLVSFM  102

Query  566  HDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFY  387
             DL+ M+L+++  A+ATAIG+VGK G SH+GWM VC+   KFC+++   I  SY   +  
Sbjct  103  -DLMSMSLVMASAAAATAIGHVGKKGNSHTGWMRVCNYFEKFCNRIEYSIACSYAGFLCL  161

Query  386  LILTVLSA  363
            L++  LS 
Sbjct  162  LVVCALSG  169



>ref|XP_004295628.1| PREDICTED: CASP-like protein POPTRDRAFT_810994-like [Fragaria 
vesca subsp. vesca]
Length=163

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 67/126 (53%), Gaps = 7/126 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  + +V  +   A++S +PAFK+  V   I   +SL       ++  ++     +  + 
Sbjct  30   SHDSTNVLNLTFKAKFSNAPAFKYFVVVEAIACAYSL-------VIMFLSSKGSLWRLVI  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++V  LL S  +SA AI  VGK G  H+GW+P+C  V KFC+ VT  +   ++A I 
Sbjct  83   ILDVVVAVLLASSVSSALAIASVGKKGNMHAGWLPICGQVPKFCNHVTAALVAGFVAAIL  142

Query  389  YLILTV  372
            Y +L +
Sbjct  143  YFLLVI  148



>ref|XP_009402195.1| PREDICTED: CASP-like protein VIT_17s0000g00560 [Musa acuminata 
subsp. malaccensis]
Length=257

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 93/175 (53%), Gaps = 7/175 (4%)
 Frame = -3

Query  887  MESFGSKDEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDA  708
            MES   K EQK++   +A   +  I +V + +    TL AA  +  +KQ  +V G ++ A
Sbjct  80   MESAALKREQKEEATKRARGKYLKIHVVCKASAALATLVAAALMGFNKQISNVAGFEIKA  139

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
             Y+ SPAFKF  + N I  G+S+LS+         A      + + L DL+ + L+++  
Sbjct  140  TYNSSPAFKFFVIGNAIACGYSVLSL-------PFAAHMVEGWMLNLFDLMNLGLVMAAA  192

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            ++A AIGYVGK+G    GW  VC    KFC +  + I  SY+  + +L +  +S+
Sbjct  193  SAAAAIGYVGKYGNDEIGWTKVCPYYEKFCGRTEISIACSYVGFLLFLFVCAMSS  247



>ref|XP_008783145.1| PREDICTED: CASP-like protein RCOM_1174750 [Phoenix dactylifera]
Length=160

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 72/124 (58%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++ +VFG+ +DA++ Y+P+FKF  +AN I  G++LL      +L         +  M 
Sbjct  30   SHESTTVFGLTLDAKFQYTPSFKFFVIANAIGCGYTLLV-----LLVPPTSSLSTFVVML  84

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+I+  LL +  A+A AI  VGK G SHSGW+P+C  + KFC  V   +  ++  V+ 
Sbjct  85   --DVIIAMLLTAAIAAAGAISEVGKKGNSHSGWLPICGQIPKFCDHVMGALICAFCGVVI  142

Query  389  YLIL  378
            YL++
Sbjct  143  YLLI  146



>ref|XP_008381244.1| PREDICTED: CASP-like protein RCOM_1174750 [Malus domestica]
Length=164

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 66/117 (56%), Gaps = 7/117 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q  S+FG+  + +Y+++PAF++  +AN I   +  L +F       +  + + +  + 
Sbjct  31   SHQRTSIFGVSFEVKYNHTPAFQYFVIANAIATVYGFLVLF-------LPSESQLWRLVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
              D+++  LL S  ++A AIG VGK G S++GW P+C  V K+C +V   +  S++ 
Sbjct  84   ALDVVITVLLSSSISAALAIGDVGKHGNSYAGWQPICGQVPKYCDQVKAALISSFVG  140



>ref|XP_011002897.1| PREDICTED: CASP-like protein 1C2 [Populus euphratica]
Length=162

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 70/124 (56%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  + F +  +A+Y+ +P+FK+  +AN IV  +  L      +L    G P     + 
Sbjct  30   SHEKGTFFTVSYEAKYTDTPSFKYFVIANAIVTVYGFL------VLFHPPGSPLWRLVVA  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L DL+   LL+S  ++A A+  VGK G S +GW+PVC  V+K+C++VT  +    I +I 
Sbjct  84   L-DLVFTMLLISSLSAALAVAQVGKNGNSRAGWLPVCGQVTKYCNQVTGALVAGSIGLIT  142

Query  389  YLIL  378
            Y+I+
Sbjct  143  YIIM  146



>gb|EYU27969.1| hypothetical protein MIMGU_mgv1a015260mg [Erythranthe guttata]
Length=163

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (53%), Gaps = 7/131 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  VF I+ +A+Y+ SP FK+  + N I  G++L       IL  ++        + 
Sbjct  31   SHDSALVFNIKFEAKYTNSPTFKYFILINAIASGYTL-------ILLFLSCKSSFGHLIL  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DLIV  LL S  ++  AIG VGK G SH+GW+P+C  V KFC  VT  +   + A + 
Sbjct  84   ALDLIVTLLLESSISACIAIGQVGKKGNSHAGWLPICGQVPKFCDHVTGAMIAGFAAALA  143

Query  389  YLILTVLSANQ  357
            Y ++ V S + 
Sbjct  144  YFLILVYSLHN  154



>gb|KFK42715.1| hypothetical protein AALP_AA1G030500 [Arabis alpina]
Length=164

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S F + + ARYS   AFK+  +AN IV  +S L +F       +  +   + ++ 
Sbjct  31   SRERSSFFVLSLVARYSDLAAFKYFVIANAIVSVYSFLVLF-------LPKESLLWKFVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    IA+I 
Sbjct  84   VLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLIALIL  143

Query  389  YLILTVLS  366
            Y+ L + S
Sbjct  144  YVFLLIFS  151



>ref|XP_009341975.1| PREDICTED: CASP-like protein RCOM_1174750 [Pyrus x bretschneideri]
Length=164

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 66/117 (56%), Gaps = 7/117 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q  S+FGI  + +Y+++PAF++  +AN I   +  L +F       +    + +  + 
Sbjct  31   SHQRTSIFGISFEVKYNHTPAFRYFVIANAIATVYGFLVIF-------LPSKSQLWRLVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
              D+++  LL S  ++A AIG +GK G S++GW+P+C  V K+C +V   +  S++ 
Sbjct  84   ALDVVITILLSSSISAALAIGTLGKNGNSYAGWLPICGQVPKYCDRVKGALISSFVG  140



>ref|XP_003539921.1| PREDICTED: CASP-like protein RCOM_1174750-like [Glycine max]
 gb|KHN31987.1| CASP-like protein [Glycine soja]
Length=163

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (55%), Gaps = 13/141 (9%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T ++F +  +A+Y+ SPAFK+  +A  ++  +  L +F       +      +  + 
Sbjct  30   SHETATIFTVSFEAKYTNSPAFKYFVIAYSVITVYGFLVLF-------LPAKSLLWQLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+   L++S  +++ AI  VGK G S +GW+P+CD+V K+C + T  +   +IA+I 
Sbjct  83   ALDLVFTMLVVSSFSASLAIAQVGKKGNSDAGWLPICDSVPKYCDQATRALIAGFIAMII  142

Query  389  YLIL------TVLSANQSRKS  345
            Y+IL      TV+     RKS
Sbjct  143  YIILLLHSIHTVIDPLLLRKS  163



>ref|XP_011043373.1| PREDICTED: CASP-like protein 1C2 [Populus euphratica]
Length=163

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 69/128 (54%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++  V  +   A+YS +PAFK+L +   I  G++++S     IL    G    +  + 
Sbjct  30   SHESAQVLNLTFTAKYSNTPAFKYLVIGEAIAGGYTVIS-----ILLSFKG--LFWRLIV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   LL S  ++A AI  VGK G +H+GW+P+C  V  FC  VT+ +   + A I 
Sbjct  83   ILDMVTTVLLTSSISAAVAIAQVGKKGNTHAGWLPICGQVPDFCDNVTIALIAGFAAAII  142

Query  389  YLILTVLS  366
            Y +L + S
Sbjct  143  YSVLLLCS  150



>ref|XP_008353784.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein RCOM_1174750 
[Malus domestica]
Length=164

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 67/117 (57%), Gaps = 7/117 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q  S+FGI  + +Y+++PAF++  +AN I   +  L +F       +  + + +  + 
Sbjct  31   SHQRTSIFGISFEVKYNHTPAFQYFVIANAIATVYGFLVIF-------LPSESQLWRLVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
              D+++  LL +  ++A AIG +GK G S++GW+P+C  V K+C +V   +  S++ 
Sbjct  84   ALDVVITVLLSTSISAALAIGTLGKNGNSYAGWLPICGQVPKYCDQVKGALISSFVG  140



>ref|XP_004494327.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cicer arietinum]
Length=186

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 1/121 (1%)
 Frame = -3

Query  728  FGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVM  549
            F  +  A++ Y  A  FL VAN I   ++ +S+ V   + +  G+    F + + DLI++
Sbjct  58   FQFKATAKWEYMSATVFLLVANAIGCSYAAISLVVST-MARSNGNKMKLFMITVLDLIIV  116

Query  548  ALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVL  369
            ALL S   +A+A+G +G  G SH  WM VC+    +CH +TV +  S+IA   +L+L V 
Sbjct  117  ALLFSANGAASAVGVIGMKGNSHVQWMKVCNVFDAYCHYMTVSVVFSFIASTVFLLLVVH  176

Query  368  S  366
            S
Sbjct  177  S  177



>gb|EPS70445.1| hypothetical protein M569_04316 [Genlisea aurea]
Length=237

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 78/137 (57%), Gaps = 8/137 (6%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPK-HYFYMFL  567
            +T+ VFG ++D +YS +P  KF    N+I  G S L+  +V  +   + +P  HYF +F+
Sbjct  43   ETIVVFGFKIDVKYSLNPTLKFYVYENMIASGLSFLTSILVVAIAMASSNPTGHYFVLFI  102

Query  566  HDLIVMALLLSGCASATAIGYVGKFG---ESHSGWMPV--CDNVSKFCHKVTVGITLSYI  402
            HDL++  LL SG A+  AIG +G  G    + +   PV  C   SK C++  V +  S+ 
Sbjct  103  HDLMMSVLLSSGVAATAAIGNMGNTGGRKTTAAAADPVALCRYTSKMCNRGEVSVVFSFA  162

Query  401  AVIFYLILTVLSANQSR  351
             ++  +ILT++ ++ SR
Sbjct  163  GML--IILTLIDSSISR  177



>ref|XP_006377352.1| hypothetical protein POPTR_0011s05180g [Populus trichocarpa]
 sp|B9N3F4.2|CSPL9_POPTR RecName: Full=CASP-like protein 1C2; Short=PtCASPL1C2 [Populus 
trichocarpa]
 gb|ERP55149.1| hypothetical protein POPTR_0011s05180g [Populus trichocarpa]
Length=163

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V  +   A+YS +PAFKFL +   I  G++++S     IL    G    +  + 
Sbjct  30   SHDSAQVLNLTFTAKYSNTPAFKFLVIGEAIAGGYTVIS-----ILLSFKG--LFWRLIV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   LL S  ++A AI  VGK G +H+GW+P+C  V  FC  VT+ +   + A I 
Sbjct  83   ILDMVTTVLLTSSISAALAIAQVGKKGNTHAGWLPICGQVPDFCDYVTIALIAGFAAAII  142

Query  389  YLILTVLS  366
            Y +L + S
Sbjct  143  YFVLLLCS  150



>ref|XP_010457381.1| PREDICTED: CASP-like protein 1C2 [Camelina sativa]
Length=164

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 74/128 (58%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S F + + A+YS   AFK+  +AN IV  +S L +F       +  +   + ++ 
Sbjct  31   SRERSSFFVLSLVAKYSDLAAFKYFVIANAIVSVYSFLVLF-------LPKESLLWKFVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DLIV  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A++ 
Sbjct  84   VLDLIVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVALVL  143

Query  389  YLILTVLS  366
            Y+ L ++S
Sbjct  144  YVFLLIVS  151



>ref|XP_008368681.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein RCOM_1174750 
[Malus domestica]
Length=186

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 67/116 (58%), Gaps = 7/116 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q  S+FGI  + +Y+++PAF++  +AN I   +  L +F       +  + + +  + 
Sbjct  31   SHQRTSIFGISFEVKYNHTPAFQYFVIANAIATVYGFLVIF-------LPSESQLWRLVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYI  402
              D+++  LL +  ++A AIG +GK G S++GW+P+C  V K+C +V   +  S++
Sbjct  84   ALDVVITVLLSTSISAALAIGTLGKNGNSYAGWLPICGQVPKYCDQVKGALISSFV  139



>ref|XP_008371694.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Malus domestica]
Length=164

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 70/128 (55%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  + +V  +   A+Y++SPAF +  + + I+ G++L       I+  ++     +  + 
Sbjct  30   SHDSTNVLNLTFKAKYNHSPAFTYFVIVDAIISGYNL-------IILLLSSKGSLWRXVI  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   LL S  ++A AI  VGK G  H+GW+P+C  VSKFC+  T  +    +A +F
Sbjct  83   ILDVVAALLLTSSMSAALAIAQVGKKGNXHAGWLPICGQVSKFCNHXTGALVAGILAAMF  142

Query  389  YLILTVLS  366
            Y +L + +
Sbjct  143  YFVLNLFT  150



>ref|XP_003527478.1| PREDICTED: CASP-like protein POPTRDRAFT_270504-like [Glycine 
max]
Length=163

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 73/130 (56%), Gaps = 7/130 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T ++F +  +A+Y+ SPAFK+   A  ++  +  L +F       +      +  + 
Sbjct  30   SHETATIFTVTFEAKYTNSPAFKYFVTAYSVITVYGFLVLF-------LPAKSLLWKLVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              DL+   L++S  +++ AI  VGK G S +GW+P+C +V K+C +VT  +   +IA+I 
Sbjct  83   ALDLLFTMLVVSSFSASLAIAQVGKKGNSDAGWLPICGSVPKYCDQVTRALIAGFIAMII  142

Query  389  YLILTVLSAN  360
            Y+IL + S N
Sbjct  143  YIILLLHSIN  152



>ref|XP_006468217.1| PREDICTED: CASP-like protein POPTRDRAFT_810994-like [Citrus sinensis]
Length=189

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  734  SVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLI  555
             VF +   A++S  P FK+  VA  I  G++L       ++  ++     +  + + D +
Sbjct  61   EVFNLTFTAKFSNEPVFKYFVVAEAIACGYTL-------VVLILSSRSLLWRLIVILDAV  113

Query  554  VMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILT  375
            + A+L S  ++A AI  VGK G SH+GW+P+C  V KFC  VT  +   ++A I Y +L 
Sbjct  114  MTAVLTSSISAALAIARVGKKGNSHAGWLPICGQVPKFCDHVTGALVCGFVAAIVYALLL  173

Query  374  VLS  366
            V S
Sbjct  174  VFS  176



>ref|XP_009357855.1| PREDICTED: CASP-like protein RCOM_1174750 [Pyrus x bretschneideri]
 ref|XP_009357878.1| PREDICTED: CASP-like protein RCOM_1174750 [Pyrus x bretschneideri]
Length=164

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q  S FGI  + +Y+++PAF++ A+AN I   +  L +F       +  + + +  + 
Sbjct  31   SHQRTSNFGISFEVKYNHTPAFQYFAIANAIATVYGFLVLF-------LPSESQLWRLVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYI  402
              D+++  LL S  ++A AIG VGK G S++GW P+C  V K+C  V   +  S++
Sbjct  84   ALDVVITVLLSSSFSAALAIGDVGKHGNSYAGWPPICGQVPKYCDHVKAALISSFV  139



>ref|XP_010916001.1| PREDICTED: CASP-like protein 1C1 [Elaeis guineensis]
Length=160

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++ ++FG+ ++A++ Y+P+FKF  +AN I  G+SLL      +L         +  M 
Sbjct  30   SHESTTLFGLTLEAKFQYTPSFKFFVIANAIGCGYSLLV-----LLIPPTSSLSRFVVML  84

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+I+  LL +  ++A AI  VGK G SHSGW+P+C  + KFC  V   +  ++  V+ 
Sbjct  85   --DVIIAMLLTAAISAAGAISEVGKKGNSHSGWLPICGQIPKFCDHVKGAMICAFCGVVI  142

Query  389  YLIL  378
            YL++
Sbjct  143  YLVI  146



>ref|NP_563689.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002889467.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|Q9LR57.1|CSPL1_ARATH RecName: Full=CASP-like protein 1C2; Short=AtCASPL1C2 [Arabidopsis 
thaliana]
 sp|D7KCH2.1|CSPLE_ARALL RecName: Full=CASP-like protein 1C2; Short=AlCASPL1C2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|AAF86520.1|AC002560_13 F21B7.30 [Arabidopsis thaliana]
 gb|EFH65726.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27599.1| uncharacterized protein AT1G03700 [Arabidopsis thaliana]
Length=164

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S F I + A+YS   AFK+  +AN IV  +S L +F       +  +   + ++ 
Sbjct  31   SRERSSFFVISLVAKYSDLAAFKYFVIANAIVTVYSFLVLF-------LPKESLLWKFVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A++ 
Sbjct  84   VLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVALVL  143

Query  389  YLILTVLS  366
            Y+ L + S
Sbjct  144  YVFLLIFS  151



>gb|EMT01166.1| hypothetical protein F775_04463 [Aegilops tauschii]
Length=162

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 78/137 (57%), Gaps = 9/137 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++T S+FG++++A++S+ P+F F  VA  +   +SLL  FV        G       M 
Sbjct  30   SRETTSLFGLEIEAKFSHIPSFIFFVVAYAVACVYSLLVAFV-----PPGGAASRLVVM-  83

Query  569  LHDLIVMALLLSGCASAT-AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
                +VM ++L+G  +AT AI  VG+ G  H+GW+P+C+ V  +C++V   +   ++A++
Sbjct  84   --TDVVMGMVLTGAVAATGAIAEVGRNGNEHAGWLPICEQVHGYCNQVMGALIAGFVALV  141

Query  392  FYLILTVLSANQSRKSM  342
             Y ++ + S +    +M
Sbjct  142  VYFLIIMHSLHAVTDTM  158



>ref|XP_002305799.1| hypothetical protein POPTR_0004s04330g [Populus trichocarpa]
 sp|B9H2V1.1|CSPL6_POPTR RecName: Full=CASP-like protein 1C3; Short=PtCASPL1C3 [Populus 
trichocarpa]
 gb|EEE86310.1| hypothetical protein POPTR_0004s04330g [Populus trichocarpa]
Length=163

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V  +    +YS +P FK+  +A  I  G+         I+  +    K  F+  
Sbjct  30   SHDSAQVLNLTFTVKYSNTPVFKYFVIAEAIAGGY---------IVISILLSFKSLFWRL  80

Query  569  L--HDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            L   D++   LL S  ++A AI  VGK G +H+GW+PVC+ V  FC +VT+ +   + A 
Sbjct  81   LVILDMVTAVLLTSSISAALAIAQVGKKGNTHAGWLPVCEQVPDFCDQVTIALIAGFAAA  140

Query  395  IFYLILTVLS  366
            I Y +L + S
Sbjct  141  IIYFVLLLCS  150



>dbj|BAN18425.1| putative integral membrane family protein, partial [Schiedea 
spergulina]
 dbj|BAN18426.1| putative integral membrane family protein, partial [Schiedea 
pentandra]
 dbj|BAN18427.1| putative integral membrane family protein, partial [Schiedea 
apokremnos]
 dbj|BAN18431.1| putative integral membrane family protein, partial [Schiedea 
jacobii]
 dbj|BAN18433.1| putative integral membrane family protein, partial [Schiedea 
kauaiensis]
 dbj|BAN18435.1| putative integral membrane family protein, partial [Schiedea 
perlmanii]
 dbj|BAN18442.1| putative integral membrane family protein, partial [Schiedea 
nuttallii]
 dbj|BAN18445.1| putative integral membrane family protein, partial [Schiedea 
membranacea]
Length=81

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  554  VMALLLSGCASATA-IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            VM + L G  +A   IGYVGK+G  H+GW+P+CD+   FC K  + ITL +IAV  +L L
Sbjct  1    VMTVFLVGATAAATAIGYVGKYGNDHAGWVPICDSFHAFCRKGLIAITLGFIAVFCFLAL  60

Query  377  TVLSANQS  354
            T++SA +S
Sbjct  61   TLISATKS  68



>dbj|BAN18428.1| putative integral membrane family protein, partial [Schiedea 
kealiae]
 dbj|BAN18432.1| putative integral membrane family protein, partial [Schiedea 
mannii]
 dbj|BAN18436.1| putative integral membrane family protein, partial [Schiedea 
adamantis]
 dbj|BAN18437.1| putative integral membrane family protein, partial [Schiedea 
menziesii]
 dbj|BAN18438.1| putative integral membrane family protein, partial [Schiedea 
hookeri]
 dbj|BAN18441.1| putative integral membrane family protein, partial [Schiedea 
lydgatei]
 dbj|BAN18443.1| putative integral membrane family protein, partial [Schiedea 
haleakalensis]
 dbj|BAN18444.1| putative integral membrane family protein, partial [Schiedea 
ligustrina]
 dbj|BAN18446.1| putative integral membrane family protein, partial [Schiedea 
salicaria]
Length=81

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  554  VMALLLSGCASATA-IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            VM + L G  +A   IGYVGK+G  H+GW+P+CD+   FC K  + ITL +IAV  +L L
Sbjct  1    VMTVFLVGATAAATAIGYVGKYGNDHAGWVPICDSFHAFCRKGLIAITLGFIAVFCFLAL  60

Query  377  TVLSANQS  354
            T++SA +S
Sbjct  61   TLISATKS  68



>dbj|BAN18440.1| putative integral membrane family protein, partial [Schiedea 
sarmentosa]
Length=81

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  557  IVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            ++   L+   A+ATAIGYVGK+G  H+GW+P+CD+   FC K  + ITL +IAV  +L L
Sbjct  1    VITVFLVGATAAATAIGYVGKYGNDHAGWVPICDSFHAFCRKGLIAITLGFIAVFCFLAL  60

Query  377  TVLSANQS  354
            T++SA +S
Sbjct  61   TLISATKS  68



>emb|CDY18177.1| BnaC05g02000D [Brassica napus]
 emb|CDX89875.1| BnaA10g02070D [Brassica napus]
Length=164

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 74/131 (56%), Gaps = 13/131 (10%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S F + + A+YS   AFK+  +AN IV  +S L +F+          PK    + 
Sbjct  31   SRERSSFFVLSLVAKYSDLAAFKYFVIANAIVSVYSFLVLFL----------PKESLLWK  80

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A
Sbjct  81   FVVVLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVA  140

Query  398  VIFYLILTVLS  366
            +I Y+ L + S
Sbjct  141  LILYVFLLIFS  151



>ref|XP_009336197.1| PREDICTED: CASP-like protein RCOM_1174750 [Pyrus x bretschneideri]
Length=164

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 67/117 (57%), Gaps = 7/117 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S Q  S+FGI  + +Y+++PAF++  +AN I   +  L +F       +    + +  + 
Sbjct  31   SHQRTSIFGISFEVKYNHTPAFQYFVIANAIATVYGFLVIF-------LPSKSQLWRLVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
              D+++  +L S  ++A AIG +GK G+S++GW+P+C  V K+C +V   +  S++ 
Sbjct  84   ALDVVITIVLSSSISAALAIGTLGKNGDSYAGWLPICGQVPKYCDQVKGALISSFVG  140



>gb|AEI28611.1| hypothetical protein [Triticum aestivum]
Length=162

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++T S+FG++++A++S+ P+F F  VA  +   +SLL      IL    G       M 
Sbjct  30   SRETTSLFGLEIEAKFSHIPSFIFFVVAYAVACVYSLLV-----ILVPPGGAASRLVVM-  83

Query  569  LHDLIVMALLLSGCASAT-AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
                +VM ++L+G  +AT AI  VG+ G  H+GW+ +C+ V  +C++V   +   ++A++
Sbjct  84   --TDVVMGMVLTGAVAATGAIAEVGRNGNEHAGWLAICEQVHGYCNQVMGALIAGFVALV  141

Query  392  FYLILTVLSANQSRKSM  342
             Y ++ + S +    +M
Sbjct  142  VYFLIIMHSLHAVTDTM  158



>ref|XP_010686498.1| PREDICTED: CASP-like protein 1C1 [Beta vulgaris subsp. vulgaris]
Length=163

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 73/137 (53%), Gaps = 7/137 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +  + SV   + +A+++ SP+FK+  +   IV  +SL  +        +      + ++ 
Sbjct  30   AHDSASVLNFKFEAKFTNSPSFKYYVIIYAIVSCYSLAVLL-------LPSKSLLWRFIL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  L+ S  +++ A+ Y+GK G SH+GW P+C  V KFC + T  +   ++A I 
Sbjct  83   VLDMVMTLLMTSSLSASMAVAYIGKKGNSHAGWFPICGQVPKFCDQTTGALAAGFVAAII  142

Query  389  YLILTVLSANQSRKSMF  339
            YL+L   S + +   +F
Sbjct  143  YLVLLFYSLHAALSPLF  159



>ref|XP_008225093.1| PREDICTED: CASP-like protein POPTRDRAFT_758901 [Prunus mume]
Length=163

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +V+V  +   A+YS SPAF +  +   IV G++L+ +F       +A     +  + 
Sbjct  30   SHDSVNVLNLTFKAKYSNSPAFMYFVIVEAIVSGYNLMILF-------LASKGSLWRMVI  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++V  LL S  ++A AI  VGK G +H+GW+P+C  V KFC+ VT  +    IA   
Sbjct  83   ILDVVVALLLTSSMSAALAIAQVGKKGNTHAGWLPICGQVHKFCNHVTGALVAGIIAAAL  142

Query  389  YLIL  378
            Y +L
Sbjct  143  YFLL  146



>ref|XP_006418212.1| hypothetical protein EUTSA_v10009824mg [Eutrema salsugineum]
 gb|ESQ36565.1| hypothetical protein EUTSA_v10009824mg [Eutrema salsugineum]
Length=163

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 74/131 (56%), Gaps = 13/131 (10%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S F + + A+YS   AFK+  +AN IV  +S L +F+          PK    + 
Sbjct  30   SRERSSFFVLSLVAKYSDLAAFKYFVIANAIVTVYSFLVLFL----------PKESLLWK  79

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A
Sbjct  80   FVVVLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVA  139

Query  398  VIFYLILTVLS  366
            ++ Y+ L + S
Sbjct  140  LVLYVFLLIFS  150



>ref|XP_009339377.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Pyrus x bretschneideri]
Length=138

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 71/128 (55%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  + +V  +   A+Y++SPAF +  +   IV G++L       I+  ++     +  + 
Sbjct  4    SHDSTNVLNLTFKAKYNHSPAFTYFVIVEAIVSGYNL-------IILLLSSKGSLWRMVI  56

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   LL S  ++A AI  VGK G +H+GW+P+C  VS+FC+ VT  +    +A +F
Sbjct  57   ILDVVAALLLTSSMSAALAIAQVGKKGNTHAGWLPICGQVSRFCNHVTGALAAGILAAMF  116

Query  389  YLILTVLS  366
            Y +L + +
Sbjct  117  YFVLNLFT  124



>ref|NP_001055014.1| Os05g0245300 [Oryza sativa Japonica Group]
 sp|Q84UT5.1|BLE3_ORYSJ RecName: Full=CASP-like protein BLE3; AltName: Full=CASP-like 
protein 1C2; Short=OsCASPL1C2; AltName: Full=Protein brassinolide-enhanced 
3; Short=OsBLE3; Short=Protein BL-enhanced 3 
[Oryza sativa Japonica Group]
 sp|A2Y2B7.1|BLE3_ORYSI RecName: Full=CASP-like protein BLE3; AltName: Full=CASP-like 
protein 1C2; Short=OsCASPL1C2; AltName: Full=Protein brassinolide-enhanced 
BLE3; Short=OsBLE3; Short=Protein BL-enhanced 
3 [Oryza sativa Indica Group]
 dbj|BAC66619.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF16928.1| Os05g0245300 [Oryza sativa Japonica Group]
 gb|EAY97227.1| hypothetical protein OsI_19146 [Oryza sativa Indica Group]
 dbj|BAH01572.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62975.1| hypothetical protein OsJ_17782 [Oryza sativa Japonica Group]
Length=162

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++T S FGIQM+A+YSY+P+F F  VA      +++ + + + +L   AG       + 
Sbjct  30   SRETTSFFGIQMEAKYSYTPSFIFFVVA------YAVAAAYSLLVLAVPAGSA--LSRLA  81

Query  569  LHDLIVMALLLSGC-ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            L   +V+ ++L+G  ASA AI  + K G SH+GW+PVC  +  +C+ V   +   ++A+ 
Sbjct  82   LTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCGQIHAYCNHVMAALIAGFVALA  141

Query  392  FYLILTVLS  366
             + ++ + S
Sbjct  142  VHFVVVMYS  150



>ref|XP_006306319.1| hypothetical protein CARUB_v10012189mg [Capsella rubella]
 gb|EOA39217.1| hypothetical protein CARUB_v10012189mg [Capsella rubella]
Length=163

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S F + + A+YS   AFK+  +AN IV  +S L +F       +  +   + ++ 
Sbjct  31   SRERSSFFVLSLVAKYSDLAAFKYFVIANAIVSVYSFLVLF-------LPKESLLWKFVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A++ 
Sbjct  84   VLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVALVL  143

Query  389  YLILTVLS  366
            Y+ L + S
Sbjct  144  YVFLLIFS  151



>ref|XP_010482422.1| PREDICTED: CASP-like protein 1C2 [Camelina sativa]
Length=164

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S F + + A+YS   AFK+  +AN IV  +S L +F       +  +   + ++ 
Sbjct  31   SRERSSFFVLSLVAKYSDLAAFKYFVIANAIVSVYSFLVLF-------LPKESLLWKFVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A++ 
Sbjct  84   VLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVALVL  143

Query  389  YLILTVLS  366
            Y+ L + S
Sbjct  144  YVFLLIFS  151



>ref|XP_010474998.1| PREDICTED: CASP-like protein 1C2 [Camelina sativa]
Length=164

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S F + + A+YS   AFK+  +AN IV  +S L +F       +  +   + ++ 
Sbjct  31   SRERSSFFVLSLVAKYSDLAAFKYFVIANAIVSVYSFLVLF-------LPKESLLWKFVV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A++ 
Sbjct  84   VLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVALVL  143

Query  389  YLILTVLS  366
            Y+ L + S
Sbjct  144  YVFLLIFS  151



>ref|XP_003566190.1| PREDICTED: CASP-like protein 1C1-1 [Brachypodium distachyon]
Length=157

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T +VFG+Q++A++ Y+P+  F   AN I   +SLL      +L   A  P     + 
Sbjct  30   SHETTTVFGMQVEAKFQYTPSLVFFVSANAIACAYSLLV-----LLVPPATSPAAKLVLV  84

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
               +I M +L    A+ATA+  +GK G S + W+P+C  +  FC  VT  +   ++AV+ 
Sbjct  85   ADAMIGM-VLTGAVAAATAMSDLGKNGNSQARWLPICGQIPSFCDHVTGALACGFVAVVL  143

Query  389  YLI  381
            + I
Sbjct  144  HFI  146



>ref|XP_009385516.1| PREDICTED: CASP-like protein VIT_17s0000g00560 [Musa acuminata 
subsp. malaccensis]
Length=176

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +KQT  V G  ++A Y +SPAFKF  V N I  G+S++S+  V  L +          + 
Sbjct  45   NKQTSVVAGFAIEASYRFSPAFKFFVVGNAIACGYSVVSLPFVSNLVEGC-------TLN  97

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L DL+ + LL++  A+A+A+GYVGK G    GW  VC    +FC +  + +  SY+A + 
Sbjct  98   LFDLMNLGLLMAAAAAASAVGYVGKHGNDEIGWAKVCPYYERFCGRTEIALGCSYVAFLL  157

Query  389  YLILTVL-SANQSRK  348
            +L +  L S  +SR+
Sbjct  158  FLFVCALFSVYKSRQ  172



>dbj|BAN18439.1| putative integral membrane family protein, partial [Schiedea 
verticillata]
Length=81

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  554  VMALLLSGCASATA-IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            VM + L G  +A   IGYVGK+G  H+GW+P+CD+   FC K  + ITL +IAV  +L L
Sbjct  1    VMTVFLVGATAAATAIGYVGKYGNDHAGWVPICDSFHAFCRKGLIAITLGFIAVFCFLAL  60

Query  377  TVLSANQS  354
            T++SA +S
Sbjct  61   TLISAIKS  68



>dbj|BAN18429.1| putative integral membrane family protein, partial [Schiedea 
viscosa]
 dbj|BAN18430.1| putative integral membrane family protein, partial [Schiedea 
trinervis]
 dbj|BAN18434.1| putative integral membrane family protein, partial [Schiedea 
obovata]
Length=81

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -3

Query  554  VMALLLSGCASATA-IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            VM + L G  +A   IGYVGK+G  H+GW+P+CD+   FC K  + ITL +IAV  +L L
Sbjct  1    VMTVFLVGATAAATAIGYVGKYGNDHAGWVPICDSFHAFCRKGLIAITLGFIAVFCFLAL  60

Query  377  TVLSANQ  357
            T++SA +
Sbjct  61   TLISATK  67



>ref|XP_009352921.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Pyrus x bretschneideri]
Length=138

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 70/137 (51%), Gaps = 7/137 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V  +   A++S SP F +  +   IV G++L       I+  ++     +  + 
Sbjct  4    SHDSTRVLNLTFKAKFSDSPTFMYFVIVEAIVSGYNL-------IILLLSSKGSLWRIVI  56

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   LL S  ++A AIG V K G +H+GW+P+C  VSKFC+ V   +    +A IF
Sbjct  57   ILDVVAALLLTSSMSAALAIGQVAKKGNTHAGWLPICGQVSKFCNHVNGALVAGILAAIF  116

Query  389  YLILTVLSANQSRKSMF  339
            Y +L + +   +   +F
Sbjct  117  YYVLNLFTLYNALNPLF  133



>ref|XP_009121772.1| PREDICTED: CASP-like protein ARALYDRAFT_327471 [Brassica rapa]
 emb|CDY48566.1| BnaA09g01620D [Brassica napus]
Length=164

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 69/120 (58%), Gaps = 13/120 (11%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S F + ++A+Y+   AFK+  +AN +V  +S L +F+          PK    + 
Sbjct  31   SRERASFFAVSLEAKYTDMAAFKYFVIANAVVSVYSFLVLFL----------PKESLLWK  80

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL++  LL S  ++A A+  VGK G +++GW+P+C  V KFC +VT  +   ++A
Sbjct  81   FVVVLDLVMTMLLTSSISAALAVAQVGKKGNANAGWLPICGQVPKFCDQVTGALIAGFVA  140



>ref|XP_010431136.1| PREDICTED: CASP-like protein 1C1 [Camelina sativa]
 ref|XP_010422453.1| PREDICTED: CASP-like protein 1C1 [Camelina sativa]
 ref|XP_010455883.1| PREDICTED: CASP-like protein 1C1 [Camelina sativa]
Length=164

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 69/120 (58%), Gaps = 13/120 (11%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S F + ++A+Y+   AFK+  +AN +V  +S L +F+          PK    + 
Sbjct  31   SRERASFFAVSLEAKYTDMAAFKYFVIANAVVSVYSFLVLFL----------PKESLLWK  80

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL++  LL S  ++A A+  VGK G +++GW+P+C  V KFC +VT  +   ++A
Sbjct  81   FVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPICGQVPKFCDQVTGALIAGFVA  140



>ref|XP_010272470.1| PREDICTED: CASP-like protein 1C1 [Nelumbo nucifera]
Length=162

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +    +GI+++A Y+ SPA  +  +A  IV  +         +L  +    K + ++ 
Sbjct  30   SNENAFFYGIELEASYNNSPALTYFVIAYSIVTVYGF-------LLLFLPPSSKLWQFVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D+I   L+ S  ++A A+ YVGK G S +GW+P+CD VS FC ++   +   + A+I 
Sbjct  83   AVDVIATVLVTSSFSAALAVAYVGKQGNSSAGWLPICDQVSDFCKQIAGALVAGFAAMII  142

Query  389  Y  387
            Y
Sbjct  143  Y  143



>dbj|BAN18447.1| putative integral membrane family protein, partial [Schiedea 
globosa]
Length=81

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  554  VMALLLSGCASATA-IGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
            VM + L G  +A   IGYVGK+G  H+GW+P+CD+   FC K  + ITL +IAV  +L L
Sbjct  1    VMTVFLVGATAAATAIGYVGKYGNDHAGWVPICDSFHAFCRKGLIAITLGFIAVFCFLAL  60

Query  377  TVLSANQS  354
             ++SA +S
Sbjct  61   ILISATKS  68



>ref|XP_002519061.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RZ92.1|CSPL2_RICCO RecName: Full=CASP-like protein 1C2; Short=RcCASPL1C2 [Ricinus 
communis]
 gb|EEF43272.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 73/139 (53%), Gaps = 11/139 (8%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvF--ILDKMAGDPKHYFY  576
            S  +  V  +   A+Y+ +PAFK+  +A  I   ++++ +F+    +L ++         
Sbjct  31   SHDSAIVLNLTFSAKYNNTPAFKYFVIAEGIASVYTIIVIFLWSKGLLGRL---------  81

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            + + D++   LL S  ++A AI  VGK G SH+GW+PVC  V KFC +  + +   ++A 
Sbjct  82   IVILDMVTTVLLTSSISAALAIAQVGKKGNSHAGWLPVCGQVPKFCDQAIIALVAGFVAA  141

Query  395  IFYLILTVLSANQSRKSMF  339
            I Y +L + S +     +F
Sbjct  142  IVYFMLLLCSLHAVLTPIF  160



>ref|XP_002874862.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7M2M8.1|CSPLF_ARALL RecName: Full=CASP-like protein 1C1; Short=AlCASPL1C1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51121.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 69/120 (58%), Gaps = 13/120 (11%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S F + ++A+Y+   AFK+  +AN +V  +S L +F+          PK    + 
Sbjct  31   SRERASFFAVSLEAKYTDMAAFKYFVIANAVVSVYSFLVLFL----------PKESLLWK  80

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL++  LL S  ++A A+  VGK G +++GW+P+C  V KFC ++T  +   ++A
Sbjct  81   FVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPICGQVPKFCDQITGALIAGFVA  140



>ref|XP_006396581.1| hypothetical protein EUTSA_v10029027mg [Eutrema salsugineum]
 gb|ESQ38034.1| hypothetical protein EUTSA_v10029027mg [Eutrema salsugineum]
Length=164

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 69/120 (58%), Gaps = 13/120 (11%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S F + ++A+Y+   AFK+  +AN +V  +S L +F+          PK    + 
Sbjct  31   SRERASFFAVSLEAKYTDMAAFKYFVIANAVVSVYSFLVLFL----------PKESLLWK  80

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL++  LL S  ++A A+  VGK G +++GW+P+C  V KFC ++T  +   ++A
Sbjct  81   FVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPICGQVPKFCDQITGALIAGFVA  140



>ref|XP_010242914.1| PREDICTED: CASP-like protein 1C2 [Nelumbo nucifera]
Length=160

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 74/124 (60%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            SK+    +G++++A+Y++SPA  +  +AN I   +         +L  +      + ++ 
Sbjct  30   SKEENYFYGVELEAKYTHSPALTYFVIANSIGAVYGF-------LLLFLPPASMLWRFVV  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D++V+ LL S  ++A AI YVGK G  ++GW+PVCD +S FCH VT  +T +++A++ 
Sbjct  83   AVDVVVVLLLSSSFSAAMAIAYVGKEGNYYAGWLPVCDQISDFCHHVTGALTAAFVALVI  142

Query  389  YLIL  378
            Y +L
Sbjct  143  YTVL  146



>ref|XP_003568713.1| PREDICTED: CASP-like protein 1C1 [Brachypodium distachyon]
Length=162

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T  +FG++++A+YS++PAF F   A  +         + + +L    G       + 
Sbjct  30   SHETTYLFGLELEAKYSHTPAFIFFVAAYGV------ACAYSLLVLPVRPGSAGARL-VV  82

Query  569  LHDLIVMALLLSGCASAT-AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            + D ++M ++L+G  +AT AI  VG+ G SH+GW+P+C  V  +C  V   +   ++A++
Sbjct  83   MAD-VIMGMVLTGAVAATGAIAEVGRNGNSHAGWLPICGQVQDYCSHVMGALIAGFVALV  141

Query  392  FYLILTVLS  366
             Y ++ + S
Sbjct  142  VYFLVIMYS  150



>sp|A9P0A6.1|CSPL5_PICSI RecName: Full=CASP-like protein 1U1; Short=PsCASPL1U1 [Picea 
sitchensis]
 gb|ABK26317.1| unknown [Picea sitchensis]
Length=201

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = -3

Query  716  MDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLL  537
            + A+Y YSPAF F  +AN +  G++LLS+    I  K    P   F + + DL+++AL+ 
Sbjct  74   LSAKYQYSPAFVFFVIANAVACGYTLLSLIFS-ITGKFTSTPLSVFLLSVTDLVMVALVS  132

Query  536  SGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
            +G ++A AI YVG  G SH+ W  VC    +FCH     I  S++++I +++LTV+S
Sbjct  133  AGVSAAAAIAYVGYKGNSHTQWGKVCGIYDRFCHHGAGAIVASFVSLIIFMVLTVMS  189



>ref|XP_007213108.1| hypothetical protein PRUPE_ppa023491mg [Prunus persica]
 gb|EMJ14307.1| hypothetical protein PRUPE_ppa023491mg [Prunus persica]
Length=163

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 67/124 (54%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  + +V  +   A+YS SPAF +  +   IV G++L+ +F       +A     +  + 
Sbjct  30   SHDSTNVLNLTFKAKYSNSPAFMYFVIVEAIVSGYNLMILF-------LALKGSLWRMVI  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++V  LL S  ++A AI  VGK G +H+GW+P+C  V KFC+ VT  +    IA   
Sbjct  83   ILDVVVALLLTSSMSAALAIAQVGKKGNTHAGWLPICGQVHKFCNHVTGALVAGIIAAAL  142

Query  389  YLIL  378
            Y +L
Sbjct  143  YFLL  146



>ref|XP_010036846.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=182

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            + + A++ Y  AF +  VAN I  G+S LS+ ++ + +K          + + D+I++AL
Sbjct  62   VPVTAKWHYQSAFVYFVVANAIACGYSALSLLLL-LANKAGKSRTLASAVAILDIIMVAL  120

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
            L SGC +ATA+G +G+ G SH  W  VC+   KFC +V V I LS    + ++I+  L+
Sbjct  121  LFSGCGAATAVGVIGREGNSHVKWGKVCNVFDKFCDRVAVAIGLSLFGSLAFVIMGGLA  179



>ref|XP_007159387.1| hypothetical protein PHAVU_002G234000g [Phaseolus vulgaris]
 gb|ESW31381.1| hypothetical protein PHAVU_002G234000g [Phaseolus vulgaris]
Length=160

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 66/137 (48%), Gaps = 7/137 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S ++  V  +    +YS    FKF  +A  I  G+S+       IL            + 
Sbjct  30   SHESTQVLNLTFSVKYSNDQTFKFFVIAEAIACGYSI-------ILLFTCSQTSLRRLVL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  LL S  ++A AI +VGK G +H+GW+P+C  V KFC  VT  +   + A I 
Sbjct  83   ILDVVIAMLLSSSVSAAVAIAHVGKKGTTHAGWLPICGQVPKFCDHVTGALVAGFAAAII  142

Query  389  YLILTVLSANQSRKSMF  339
            Y +L   S    + ++F
Sbjct  143  YFLLIFSSIYSVQNTLF  159



>gb|KHN35254.1| CASP-like protein [Glycine soja]
Length=150

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 70/126 (56%), Gaps = 7/126 (6%)
 Frame = -3

Query  734  SVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLI  555
            ++F +  +A+Y+ SPAFK+   A  ++  +  L +F       +      +  +   DL+
Sbjct  22   TIFTVTFEAKYTNSPAFKYFVTAYSVITVYGFLVLF-------LPAKSLLWKLVVALDLL  74

Query  554  VMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILT  375
               L++S  +++ AI  VGK G S +GW+P+C +V K+C +VT  +   +IA+I Y+IL 
Sbjct  75   FTMLVVSSFSASLAIAQVGKKGNSDAGWLPICGSVPKYCDQVTRALIAGFIAMIIYIILL  134

Query  374  VLSANQ  357
            + S N 
Sbjct  135  LHSINT  140



>ref|XP_006664182.1| PREDICTED: CASP-like protein Os12g0610800-like [Oryza brachyantha]
Length=195

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 65/114 (57%), Gaps = 4/114 (4%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++  +PAF F  +AN IV G++L+ + +  ++ + A        + L D++++ LL +G
Sbjct  72   AQFKDTPAFVFFVIANAIVSGYNLVVMVMRRLMQRRA----QSLIVHLLDMVILTLLATG  127

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVL  369
             A+A ++  +GK G  H+ W P+CD    FC++  + +  S+I V   L L +L
Sbjct  128  SATAASMAQLGKNGNLHARWNPICDKFGSFCNRGGIALVSSFIGVALMLALNLL  181



>ref|XP_009401560.1| PREDICTED: CASP-like protein MA4_106O17.50 [Musa acuminata subsp. 
malaccensis]
Length=193

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = -3

Query  608  KMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGKFG-ESHSGWMPVCDNVSKFCHK  432
            K AG     F + + DL+++ LL SG  +ATAI  V + G E+ +GW  +CD  SKFC +
Sbjct  103  KRAGSGGTLFALSVADLVMLVLLFSGNGAATAISVVAENGQENLAGWDRICDTASKFCAR  162

Query  431  VTVGITLSYIAVIFYLILTVLSANQSRK  348
            V   I +S +A + YL+L +L     R+
Sbjct  163  VNAAIAMSMLASVAYLLLVLLGMIALRR  190



>ref|XP_008383741.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Malus domestica]
Length=138

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 67/128 (52%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V  +   A++S SP F +  +   IV G++L       I+  ++     +  + 
Sbjct  4    SHDSTRVLNLTFKAKFSDSPTFTYFVIVEAIVSGYNL-------IILLLSSKGSLWRIVI  56

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D++   LL S  ++A  I  VGK G +H+GW+P+C  VSKFC+ V+  +    +A IF
Sbjct  57   ILDVVAALLLTSSMSAALTIAQVGKKGNTHAGWLPICGQVSKFCNHVSGALVAGILAAIF  116

Query  389  YLILTVLS  366
            Y +L + +
Sbjct  117  YYVLNLFT  124



>ref|XP_009404424.1| PREDICTED: CASP-like protein Sb09g008190 [Musa acuminata subsp. 
malaccensis]
Length=185

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 70/126 (56%), Gaps = 11/126 (9%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvf--gfsllsvfvvFILDKMAGDPKHYFY  576
            S+ + ++FG+ +DA++ Y+P+F+F  VAN +       +L V     L ++         
Sbjct  55   SRDSTTIFGLTLDAKFQYTPSFEFFVVANAVGCGYTLLVLFVPPTTSLSRL---------  105

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            + + D+ V  LL +  A+A A+  VGK G SH+GWMP+C  V  FC  VT  +  +++ V
Sbjct  106  VIVFDVTVAMLLTAATAAAGAMAQVGKKGNSHAGWMPICGQVPSFCDHVTGALICAFVGV  165

Query  395  IFYLIL  378
            I Y ++
Sbjct  166  IAYFLI  171



>ref|XP_008790715.1| PREDICTED: CASP-like protein VIT_17s0000g00560 [Phoenix dactylifera]
Length=171

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 81/139 (58%), Gaps = 11/139 (8%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            +K+T S+ G QM A Y  SPAF+F  V N I  G+++ S+  V  L +        + + 
Sbjct  40   NKETKSIAGYQMVASYKTSPAFEFFLVGNAITCGYTIASLPFVSKLVEG-------YLLD  92

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L DL+ + LL++  ++ATAIGY+GK G    GWM VC    KFC+ V + +  SY+ ++F
Sbjct  93   LLDLVSLVLLMASASAATAIGYLGKEGNDQIGWMKVCPYYEKFCNGVAISLVFSYVGLLF  152

Query  389  YLILTVLSA----NQSRKS  345
             L++ VLS+     QS KS
Sbjct  153  LLLICVLSSVYKTRQSNKS  171



>ref|XP_009362157.1| PREDICTED: CASP-like protein 9 [Pyrus x bretschneideri]
Length=185

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 0/119 (0%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            + + A++ ++PA  +  +AN I    ++  + V F  DK          + + D++++AL
Sbjct  59   VTLTAKFQHNPANVYFVIANGIASLHNVFMIVVHFFGDKFKDKGLQLVMVAVLDMMIVAL  118

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
            + SG  +AT +  +GK G SH+ W  +CD   K+C +    I  SYI ++F L++TVLS
Sbjct  119  VSSGDGAATFMAELGKKGNSHARWDKICDKFEKYCDRGGGAIISSYIGLLFLLVITVLS  177



>ref|XP_004136057.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cucumis 
sativus]
 ref|XP_004160534.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cucumis 
sativus]
 gb|KGN44880.1| hypothetical protein Csa_7G394000 [Cucumis sativus]
Length=211

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++ Y  AFK+  V+N I  G++ +S+           DP     +   DLI++ LL S 
Sbjct  90   AKWQYMSAFKYFVVSNCIACGYAAVSLVYSMTTKGYKDDPTRSMLLISLDLIMVGLLFSA  149

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
              +A AIG +G+ G SH  W+ VC     +CH  T  + +S    + +L L VLS
Sbjct  150  DGAAAAIGVIGRDGNSHMHWIKVCGFFEGYCHHFTAALVISIAGSVMFLCLVVLS  204



>ref|NP_192263.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9ZT81.1|CSPLK_ARATH RecName: Full=CASP-like protein 1C1; Short=AtCASPL1C1 [Arabidopsis 
thaliana]
 gb|AAD11596.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAD15310.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77839.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82335.1| uncharacterized protein AT4G03540 [Arabidopsis thaliana]
Length=164

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 68/120 (57%), Gaps = 13/120 (11%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S++  S   I ++A+Y+   AFK+  +AN +V  +S L +F+          PK    + 
Sbjct  31   SRERASFLAISLEAKYTDMAAFKYFVIANAVVSVYSFLVLFL----------PKESLLWK  80

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL++  LL S  ++A A+  VGK G +++GW+P+C  V KFC ++T  +   ++A
Sbjct  81   FVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPICGQVPKFCDQITGALIAGFVA  140



>gb|KFK30943.1| hypothetical protein AALP_AA6G047600 [Arabis alpina]
Length=164

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 66/117 (56%), Gaps = 7/117 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++  S   + ++ARY+   AFK+  +AN +V  +S L +F       +      + ++ 
Sbjct  31   SRERASFLALSLEARYTDMAAFKYFVIANAVVSVYSFLVLF-------LPEKSLLWKFIV  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            + DL++  LL S  ++A A+  +GK G +++GW+P+C  V KFC +VT  +   ++A
Sbjct  84   VLDLVMTMLLTSSLSAALAVALIGKKGNANAGWLPICGQVPKFCDQVTGALIAGFVA  140



>ref|XP_008451440.1| PREDICTED: CASP-like protein VIT_07s0104g01350 [Cucumis melo]
Length=211

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 0/115 (0%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++ Y  AFK+  V+N I   ++ +S+           DP     +   DLI++ LL S 
Sbjct  90   AKWQYMSAFKYFVVSNCIACAYAAVSLVYSLTTRGYKDDPMRSMLLISLDLIMVGLLFSA  149

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
              +A AIG +G+ G SH  W+ VC     +CH  T  + +S    + +L L VLS
Sbjct  150  DGAAAAIGVIGRDGNSHMHWIKVCGFFEGYCHHFTAALVISIAGSVMFLCLVVLS  204



>gb|KGN43614.1| hypothetical protein Csa_7G047980 [Cucumis sativus]
Length=163

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +    F +  +A+Y+++P+FK+  +AN +   +  L +F       +  +   +  + 
Sbjct  30   SHEEARFFTLSFEAKYTHTPSFKYFVIANSVASVYGFLVLF-------LPAESLLWRLVL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVT  426
              D+I+  LL S  A+A A+  +GK G S++GW+P+CD V+ +C +VT
Sbjct  83   CFDVIMTMLLTSSIAAALAVAQIGKDGNSYAGWLPICDQVANYCSQVT  130



>ref|XP_004137023.1| PREDICTED: CASP-like protein RCOM_1174750-like [Cucumis sativus]
Length=164

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +    F +  +A+Y+++P+FK+  +AN +   +  L +F       +  +   +  + 
Sbjct  31   SHEEARFFTLSFEAKYTHTPSFKYFVIANSVASVYGFLVLF-------LPAESLLWRLVL  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVT  426
              D+I+  LL S  A+A A+  +GK G S++GW+P+CD V+ +C +VT
Sbjct  84   CFDVIMTMLLTSSIAAALAVAQIGKDGNSYAGWLPICDQVANYCSQVT  131



>ref|XP_003625864.1| hypothetical protein MTR_7g108130 [Medicago truncatula]
 gb|AES82082.1| plant integral membrane protein [Medicago truncatula]
Length=191

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = -3

Query  719  QMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALL  540
            ++ A++ Y  A  F  V N I   ++ +S+ V  I  + +G+      + L DL++MALL
Sbjct  65   KVTAKWEYMSAIVFFLVTNAIGCSYAAISMVVSTI-ARTSGNKTALLMITLLDLVIMALL  123

Query  539  LSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
             S   +A A+G +G+ G SH  WM VC+    +C  +TV + LS I    +L+L
Sbjct  124  FSANGAAGAVGVLGQKGNSHVQWMKVCNVFDAYCRHMTVALVLSIIGSTVFLLL  177



>gb|AFK37260.1| unknown [Medicago truncatula]
Length=191

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = -3

Query  719  QMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALL  540
            ++ A++ Y  A  F  V N I   ++ +S+ V  I  + +G+      + L DL++MALL
Sbjct  65   KVTAKWEYMSAIVFFLVTNAIGCSYAAISMVVSTI-ARTSGNKTALLIITLLDLVIMALL  123

Query  539  LSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLIL  378
             S   +A A+G +G+ G SH  WM VC+    +C  +TV + LS I    +L+L
Sbjct  124  FSANGAAGAVGVLGQKGNSHVQWMKVCNVFDAYCRHMTVALVLSIIGSTVFLLL  177



>ref|XP_004155522.1| PREDICTED: CASP-like protein RCOM_1174750-like [Cucumis sativus]
Length=164

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +    F +  +A+Y+++P+FK+  +AN +   +  L +F       +  +   +  + 
Sbjct  31   SHEEARFFTLSFEAKYTHTPSFKYFVIANSVASVYGFLVLF-------LPAESLLWRLVL  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVT  426
              D+I+  LL S  A+A A+  +GK G S++GW+P+CD V+ +C +VT
Sbjct  84   CFDVIMTMLLTSSMAAALAVAQIGKDGNSYAGWLPICDQVANYCSQVT  131



>ref|XP_009782616.1| PREDICTED: CASP-like protein 1C2 [Nicotiana sylvestris]
Length=164

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 60/107 (56%), Gaps = 7/107 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S + +++F +  +A YS +PAFK+  VANI       +   VV  L +     +    + 
Sbjct  38   SHEKITIFSVSFEANYSRTPAFKYFFVANI----GGSVYSIVVLFLPRKTSLSR---LIL  90

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKV  429
            + DL+V  +L S  ++A A+ +VGK G SH+G +P+C  +  FC++V
Sbjct  91   ISDLVVTMVLTSSVSAALAVAHVGKKGNSHAGRLPICAQLHNFCNQV  137



>ref|XP_002440850.1| hypothetical protein SORBIDRAFT_09g008190 [Sorghum bicolor]
 sp|C5YVA2.1|CSPLL_SORBI RecName: Full=CASP-like protein 1C1; Short=SbCASPL1C1 [Sorghum 
bicolor]
 gb|EES19280.1| hypothetical protein SORBIDRAFT_09g008190 [Sorghum bicolor]
Length=162

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T S FGI+M+A+YSY+P+F F  VA  + F +S        +L  +A        + 
Sbjct  30   SHETTSFFGIEMEAKYSYTPSFVFFVVAFAVAFAYS--------LLALLARPGSTASRLL  81

Query  569  LHDLIVMALLLSGCASAT-AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            L   +++ +LL+G  +AT AI  VGK G  H+GW+P+C  V  +C  V   +   +++++
Sbjct  82   LLSDVMVGMLLTGAVAATGAISQVGKSGNEHAGWLPICAQVQAYCSHVMGALIAGFVSLL  141

Query  392  FYLILTVLS  366
             Y ++ + S
Sbjct  142  LYFLIIMYS  150



>ref|XP_006857311.1| hypothetical protein AMTR_s00067p00068460 [Amborella trichopoda]
 gb|ERN18778.1| hypothetical protein AMTR_s00067p00068460 [Amborella trichopoda]
Length=185

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -3

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            D+++M  L+ G ++ATAI YVG+ G  H+ W+P+C   S+FC  V   + +SY+  + +L
Sbjct  104  DVVLMGSLIGGASAATAIAYVGRKGNKHANWLPICKLFSRFCDHVAGALLVSYVGALCFL  163

Query  383  ILTVLSA  363
            +L + SA
Sbjct  164  LLVLTSA  170



>ref|XP_010035749.1| PREDICTED: CASP-like protein 1C1 [Eucalyptus grandis]
 gb|KCW47208.1| hypothetical protein EUGRSUZ_K01023 [Eucalyptus grandis]
Length=160

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 67/124 (54%), Gaps = 7/124 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +  SVF I  +A+YS  P+FK+  +AN +V  +S        ++  +  +   +  + 
Sbjct  30   SHERASVFAISFEAKYSDIPSFKYFMIANAVVSVYSF-------LVIFLPAETLLWRLVA  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
              D++V  LL S  ++A A+  VGK G   +GW+P+C  V K+C+ V+  +   +  +I 
Sbjct  83   AFDMVVTLLLTSSVSAALAVAQVGKDGNVRAGWLPICGQVPKYCNHVSGALGAGFAGLIL  142

Query  389  YLIL  378
            Y+++
Sbjct  143  YVMI  146



>ref|XP_006347042.1| PREDICTED: CASP-like protein RCOM_0936380-like [Solanum tuberosum]
Length=162

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 64/119 (54%), Gaps = 7/119 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V G+  +A+++ +P FK+    NI+   +SL+ +F      KM G       + 
Sbjct  30   SHDSAQVLGMTFEAKFANTPTFKYFVGVNILASAYSLIVLFFPT--KKMLGR-----ILL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            + D+++  LL S  ++  AI  VGK G +H+GW+P+C  V KFC +VT  +   + A I
Sbjct  83   ITDILMTLLLDSSISACLAIAQVGKKGNTHAGWLPICGQVPKFCDRVTGSLIAGFAAAI  141



>ref|XP_006288774.1| hypothetical protein CARUB_v10002095mg, partial [Capsella rubella]
 gb|EOA21672.1| hypothetical protein CARUB_v10002095mg, partial [Capsella rubella]
Length=174

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 68/120 (57%), Gaps = 13/120 (11%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH---YF  579
            S +  S F + ++A+Y+   +FK+  +AN +V  +S L +F+          PK    + 
Sbjct  41   SHERASFFAVSLEAKYTDMASFKYFVIANAVVTVYSFLVLFL----------PKESLLWK  90

Query  578  YMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            ++ + DL++  LL S  ++A A+  VGK G +++GW+P+C  V KFC ++T  +   ++A
Sbjct  91   FVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPICGQVPKFCDQITGALIAGFVA  150



>ref|XP_004232873.1| PREDICTED: CASP-like protein 1C1 [Solanum lycopersicum]
Length=162

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 65/119 (55%), Gaps = 7/119 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V G+  +A+++ +P FK+    NI+  G+SL+ +F      KM G       + 
Sbjct  30   SHDSAQVLGMTFEAKFANTPTFKYFVGVNILASGYSLIVLFFPT--KKMLGR-----ILL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
            + D+++  LL S  ++  AI  VGK G +H+GW+P+C  V KFC +VT  +   + A I
Sbjct  83   ITDILMTLLLDSSISACLAIAQVGKKGNTHAGWLPICGQVPKFCDRVTGSLIAGFAAAI  141



>ref|XP_004298101.1| PREDICTED: CASP-like protein 6-like [Fragaria vesca subsp. vesca]
Length=134

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 68/131 (52%), Gaps = 1/131 (1%)
 Frame = -3

Query  740  TVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHD  561
            +V+V  + +   +   P  K+L  ANII   ++  S+ +    ++         ++ + D
Sbjct  2    SVTVVSVTLKRLFQMQPKTKYLVAANIIACVYAAFSLVLS-FANRGTKKSSLEVFIIVLD  60

Query  560  LIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLI  381
            ++++ LL SG  +ATAIG +G  G SH  W  VC    +FCH+V   + L+ +  + ++ 
Sbjct  61   MLMVGLLFSGIGAATAIGLIGYNGNSHVKWDKVCYVFGRFCHQVIAAVVLTQLGALAFIF  120

Query  380  LTVLSANQSRK  348
            L VL+ ++  K
Sbjct  121  LVVLAVSRLNK  131



>ref|XP_009393233.1| PREDICTED: CASP-like protein 5 [Musa acuminata subsp. malaccensis]
Length=197

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A+ SYS AF +  VAN I F +S  S+ V  ++ K          + + D +++ LL SG
Sbjct  75   AKASYSSAFVYFIVANAIAFAYSAWSLAV--VVLKRRSTRGSILPISILDAVMVGLLFSG  132

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
              +A A G +GK+G SH GW  VC+   +FC + +  I +S IA +  L L +LS
Sbjct  133  NGAAAAFGVLGKYGNSHVGWTKVCNVFGRFCAQASASIVVSLIASVNLLALVILS  187



>ref|XP_009769324.1| PREDICTED: CASP-like protein 1C2 [Nicotiana sylvestris]
Length=162

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 68/130 (52%), Gaps = 11/130 (8%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvf--vvFILDKMAGDPKHYFY  576
            S  +  V G+  +A+++ +P FK+    NI+   +SL+ +F     +L ++         
Sbjct  30   SHDSAQVLGMTFEAKFANTPTFKYFVGVNILAGAYSLIVLFFPTKNLLGRI---------  80

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            + + D+I+  LL S  ++  AI  VGK G SH+GW+P+C  V KFC  V   +   + A 
Sbjct  81   ILISDIIMTLLLDSSISACLAIAQVGKKGNSHAGWLPICGQVPKFCDHVAGSLIAGFAAA  140

Query  395  IFYLILTVLS  366
            I Y +L + S
Sbjct  141  ILYFLLLLCS  150



>emb|CAB36746.1| putative protein [Arabidopsis thaliana]
Length=140

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  866  DEQKQQPPLKAVKLFSAIQlvlrlaitaltlaaawtllTSKQTVSVFGIQMDARYSYSPA  687
            D + ++ PL    L   +Q+ +R+      +A+ W ++T+++  SV+GI  +A+YSYS A
Sbjct  3    DNEGRRTPL----LNLGVQVSMRVLTIGAAMASMWVMITNREVASVYGIAFEAKYSYSSA  58

Query  686  FKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIG  507
            F++L  A I V   +L ++    +  +  G     F +F  DL+     +S  ++A A G
Sbjct  59   FRYLVYAQIAVCAATLFTLVWACLAVRRRGLV---FALFFFDLLTTLTAISAFSAAFAEG  115

Query  506  YVGKFGESHSGWMPVCDNVSKFCHK  432
            YVGK+G   +GW+P+C  V  +C +
Sbjct  116  YVGKYGNKQAGWLPICGYVHGYCSR  140



>ref|XP_009605282.1| PREDICTED: CASP-like protein 1C2 [Nicotiana tomentosiformis]
Length=162

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (52%), Gaps = 7/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V G+  +A+++ +P FK+    NI+   +SL+ +F       + G       + 
Sbjct  30   SHDSAQVLGMTFEAKFANTPTFKYFVGVNILASAYSLIVLFSPT--KNLLGR-----IIL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+I+  LL S  ++  AI  VGK G SH+GW+P+C  V KFC  V   +   + A I 
Sbjct  83   ISDIIMTLLLDSSISACLAIAQVGKKGNSHAGWLPICGQVPKFCDHVAGSLIAGFAASIL  142

Query  389  YLILTVLS  366
            Y +L + S
Sbjct  143  YFLLLLCS  150



>ref|NP_001067249.1| Os12g0610800 [Oryza sativa Japonica Group]
 sp|Q0ILZ7.1|CSPL6_ORYSJ RecName: Full=CASP-like protein 1B1; Short=OsCASPL1B1 [Oryza 
sativa Japonica Group]
 sp|B8BMY7.1|CSPL6_ORYSI RecName: Full=CASP-like protein 1B2; Short=OsCASPL1B2 [Oryza 
sativa Indica Group]
 dbj|BAF30268.1| Os12g0610800 [Oryza sativa Japonica Group]
 gb|EEC69658.1| hypothetical protein OsI_39071 [Oryza sativa Indica Group]
Length=195

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++  +PAF F  +AN I  G++L+ +    IL + A        + L D++++ LL +G
Sbjct  72   AKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRA----QSLSVHLLDMVILTLLATG  127

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
             A+A ++  +GK G  H+ W P+CD    FC+   + +  S+I V
Sbjct  128  SATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALVSSFIGV  172



>ref|XP_002870225.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MAF6.1|CSPL9_ARALL RecName: Full=CASP-like protein 1E2; Short=AlCASPL1E2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46484.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            I   A+ SY  AF +   AN I  G++ +S+ ++ I  +     K    + L DL+++AL
Sbjct  68   ITTTAKASYLSAFVYNISANAIACGYTAISIAILMI-SRGRRSKKLLMAVLLGDLVMVAL  126

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L SG  +A+AIG +G  G  H  W  VC    KFCH+    + L+++A + ++ L VL A
Sbjct  127  LFSGTGAASAIGLMGLQGNKHVMWNKVCGVFGKFCHRAAPSLPLTFLAAVVFMFLVVLDA  186



>ref|NP_001148274.1| CASP-like protein 1C2 [Zea mays]
 sp|B6SZU6.1|CSPL5_MAIZE RecName: Full=CASP-like protein 1C2; Short=ZmCASPL1C2 [Zea mays]
 gb|ACG30379.1| plant integral membrane protein TIGR01569 containing protein 
[Zea mays]
 gb|AFW81666.1| membrane protein 6 [Zea mays]
Length=163

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 71/128 (55%), Gaps = 6/128 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T S+FGI+M+A+YSY+P+F F  VA  + F +SLL+     +L +          + 
Sbjct  30   SHETTSLFGIEMEAKYSYTPSFVFFVVAFAVTFAYSLLAA----VLVRPGTTASRL--VL  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L D+ V  LL    A+  AI  VGK G  H+GW+P+C  V  +C  V   +   +++++ 
Sbjct  84   LSDVTVGMLLTGAVAATGAISQVGKSGNEHAGWLPICAQVQAYCGHVMGALIAGFVSLLL  143

Query  389  YLILTVLS  366
            Y ++ + S
Sbjct  144  YFLIIMYS  151



>sp|A2ZMM4.1|CSPL5_ORYSI RecName: Full=CASP-like protein 1B1; Short=OsCASPL1B1 [Oryza 
sativa Indica Group]
 gb|EAY83858.1| hypothetical protein OsI_39078 [Oryza sativa Indica Group]
Length=195

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++  +PAF F  +AN I  G++L+ +    IL + A        + L D++++ LL +G
Sbjct  72   AKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRA----QSLSVHLLDMVILTLLATG  127

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
             A+A ++  +GK G  H+ W P+CD    FC+   + +  S+I V
Sbjct  128  SATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALMSSFIGV  172



>ref|XP_010036836.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=196

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            + + A++ Y  AF +  VAN I  G+S LS+ ++ + +K          + + D+I++AL
Sbjct  76   VPVTAKWHYLSAFVYFVVANAIACGYSALSLLLL-LANKAGKSRTLASAVAILDIIMVAL  134

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLS-YIAVIFYL  384
            L SGC +ATA+G +G+ G SH  W  VC+   KFC +V V I LS ++++ F L
Sbjct  135  LFSGCGAATAVGVIGREGNSHVQWGKVCNVFDKFCDRVAVAIGLSLFVSLAFVL  188



>ref|XP_011086075.1| PREDICTED: CASP-like protein 1C1 isoform X2 [Sesamum indicum]
Length=128

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  557  IVMALLLSGCASAT-AIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLI  381
            +VMALLL    SA  AIG VGK G SH+GW+P+C  V KFC  VT  +   ++A I Y +
Sbjct  52   LVMALLLDSSISACLAIGQVGKNGNSHAGWLPICGQVPKFCDHVTGALVAGFVAAIVYFL  111

Query  380  LTVLSANQSRKSMF  339
            + + S +      F
Sbjct  112  ILLYSLHNVMNLFF  125



>ref|XP_006338436.1| PREDICTED: casparian strip membrane protein VIT_14s0108g01050-like 
[Solanum tuberosum]
Length=179

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            I+  A Y   P F F  VAN IV  +  +S+ +  +   M+G       +   D ++MA 
Sbjct  54   IRFKAEYKNLPTFTFFVVANGIVSAYLAVSLVLSILHIVMSGARITRVVLIFFDTVMMAF  113

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L SG ++A AI Y+   G + + W+ +C   + FC + +  +  S+I V+ +L++ +LSA
Sbjct  114  LTSGASAAAAIVYLAHKGNASANWIAICQQYNSFCDRASGSLVGSFIGVLVFLLIIILSA  173



>ref|XP_010904769.1| PREDICTED: CASP-like protein 1E1 [Elaeis guineensis]
Length=200

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 2/114 (2%)
 Frame = -3

Query  707  RYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSGC  528
            + +YS A+ +  VAN++VF ++L+S+ +   L   +G       + + D++++ LL S  
Sbjct  80   KSTYSAAYVYFIVANVLVFFYTLISLVIS--LANRSGSSIMQLPLNIADILMVVLLFSSN  137

Query  527  ASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
             +A AI  V + G+SH GW   CD+  KFC ++T  I LS IA + Y IL +L+
Sbjct  138  GAAIAIDIVAEHGQSHFGWAKFCDDFYKFCSRITASIVLSMIASLAYTILIILT  191



>emb|CDY09075.1| BnaC08g10290D [Brassica napus]
Length=190

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            +   A+ SY  AF F   AN I  G++ +S+ ++ +  K          + + DL++MAL
Sbjct  68   VSATAKASYLSAFVFNISANAIACGYTAISIAILMV-SKGRRSKGLIMAVLIGDLVMMAL  126

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L S   +A AIG +G  G  H  W  VC+ + KFCH+    + ++ +A I +++L VL A
Sbjct  127  LFSSTGAAGAIGLMGVQGNKHVMWKKVCNVLGKFCHQTAASVAITLLAAIMFMVLVVLDA  186



>gb|EEE53590.1| hypothetical protein OsJ_36834 [Oryza sativa Japonica Group]
Length=255

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++  +PAF F  +AN I  G++L+ +    IL + A        + L D++++ LL +G
Sbjct  132  AKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRA----QSLSVHLLDMVILTLLATG  187

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
             A+A ++  +GK G  H+ W P+CD    FC+   + +  S+I V
Sbjct  188  SATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALVSSFIGV  232



>ref|XP_002516873.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RT04.1|CSPL9_RICCO RecName: Full=CASP-like protein 1E1; Short=RcCASPL1E1 [Ricinus 
communis]
 gb|EEF45487.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++ Y  AF F  V+N I   ++ +S     ++    G       +   DL+++ALL S 
Sbjct  74   AKWHYLSAFVFFVVSNAIACSYAAIS-----VMLSFCGKKSMVPIILTLDLLMVALLFSS  128

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
              +ATAIG +G  G SH  W  VC+   KFC++V   + LS I  I +++L +L+A
Sbjct  129  NGAATAIGVMGYKGNSHVKWNKVCNVFGKFCNQVAASVVLSLIGSIVFVLLVMLTA  184



>ref|XP_004960681.1| PREDICTED: CASP-like protein Sb09g008190-like [Setaria italica]
Length=162

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T + FGI+M+A+YSY+P+F F  VA       ++ S + + +L    G       + 
Sbjct  30   SHETATFFGIEMEAKYSYTPSFVFFVVAF------AVASAYSLLVLLVRPGSTVSRL-VL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            L D+IV  LL    A+  AI  VGK G +H+GW+P+C  V  +C  V   +   +++++ 
Sbjct  83   LTDVIVGMLLTGAVAATGAISDVGKNGNAHAGWLPICAQVQAYCGHVAGALISGFVSLVV  142

Query  389  YLILTVLSANQSRKSM  342
            Y ++ + S +   + M
Sbjct  143  YFLIIMYSLHAVAEPM  158



>gb|ABA99368.1| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=278

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -3

Query  710  ARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLLSG  531
            A++  +PAF F  +AN I  G++L+ +    IL + A        + L D++++ LL +G
Sbjct  155  AKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRA----QSLSVHLLDMVILTLLATG  210

Query  530  CASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
             A+A ++  +GK G  H+ W P+CD    FC+   + +  S+I V
Sbjct  211  SATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALVSSFIGV  255



>ref|XP_002268702.1| PREDICTED: CASP-like protein 1E1 [Vitis vinifera]
 sp|A7PTY8.1|CSPL8_VITVI RecName: Full=CASP-like protein 1E1; Short=VvCASPL1E1 [Vitis 
vinifera]
Length=202

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLH  564
            +T+    + + A++S   AF +L V+N I   ++ +S+ +V +L +  G       + + 
Sbjct  67   KTLPSLHVPVTAKWSDMSAFVYLVVSNAIACSYAAISLVLVTMLGRR-GKGGRVLAVIVL  125

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            DL ++ LL S   +ATA+G +G++G SH  W  VC+    FCH +   + LS++  + +L
Sbjct  126  DLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHLVASLALSFLGSLSFL  185

Query  383  ILTVLSA-NQSRKS  345
             L +L+  N  +KS
Sbjct  186  GLVLLAILNLHKKS  199



>emb|CDM82549.1| unnamed protein product [Triticum aestivum]
Length=156

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 66/117 (56%), Gaps = 7/117 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S +T +VFG+Q+ A++ Y+P+F F   AN++   +SLL++    ++   +   +H   + 
Sbjct  30   SHKTTTVFGVQVQAKFQYTPSFVFFVAANVVACAYSLLAL----LVPPASPAARH---VL  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIA  399
            + D  +  +L    A+A AI  +GK G SH+GW P+C  V  FC  VT  +   ++A
Sbjct  83   VADAALGMVLTGAAAAAAAISALGKNGNSHAGWQPICGLVPTFCDHVTGALACGFVA  139



>sp|A7R333.1|CSPLB_VITVI RecName: Full=CASP-like protein 1C1; Short=VvCASPL1C1 [Vitis 
vinifera]
Length=159

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S  +  V  +  DA+Y+ + AF + A+ N I  G+S +++F       ++     +  +F
Sbjct  30   SHDSAEVLNLSFDAKYTNARAFVYFAITNAIASGYSFIALF-------LSFSTPLWHLVF  82

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVT  426
            L D+ +  LL S  + A AI  VGK G SH+GW+PVC  V +FC  VT
Sbjct  83   LLDVFMTLLLTSSISVALAIADVGKKGNSHAGWLPVCGQVPEFCDHVT  130



>emb|CAN69352.1| hypothetical protein VITISV_023954 [Vitis vinifera]
Length=202

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLH  564
            +T+    + + A++S   AF +L V+N I   ++ +S+ +V +L +  G       + + 
Sbjct  67   KTLPSLHVPVTAKWSDMSAFVYLVVSNAIXCSYAAISLVLVTMLGRR-GKGGRVLAVIVL  125

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            DL ++ LL S   +ATA+G +G++G SH  W  VC+    FCH +   + LS++  + +L
Sbjct  126  DLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHLVASLALSFLGSLSFL  185

Query  383  ILTVLSA-NQSRKS  345
             L +L+  N  +KS
Sbjct  186  GLVLLAILNLHKKS  199



>ref|XP_010666393.1| PREDICTED: CASP-like protein 1E1 [Beta vulgaris subsp. vulgaris]
Length=193

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 67/124 (54%), Gaps = 1/124 (1%)
 Frame = -3

Query  728  FGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVM  549
            F + + A+ SY  AF +  VAN I   F+ LS+ + F + K  G       + + DL+++
Sbjct  66   FNVPVTAKSSYVSAFVYFVVANSIACAFAALSLALAF-MRKGGGKGIIRLIIIVVDLMMI  124

Query  548  ALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVL  369
            ALL SG  +  A+G +G  G SH  W  VC+   KFCH+V   + LS    I +++L  L
Sbjct  125  ALLFSGIGATGAVGLIGFKGNSHLMWNKVCNVYGKFCHQVMGSLALSLFGAIAFVLLVSL  184

Query  368  SANQ  357
            S ++
Sbjct  185  SVSK  188



>ref|XP_008351606.1| PREDICTED: CASP-like protein POPTRDRAFT_823125 [Malus domestica]
Length=187

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            + + A++ ++PA  +  +AN I    ++  + V F  DK          + + D++++AL
Sbjct  61   VTLTAKFQHNPANVYFVIANGIASLHNVFMIVVHFFGDKFKDKGLQLVMVAVLDMMIVAL  120

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
            + SG  +AT +  +GK G SH+ W  +CD   K+C +    I  SYI ++  L++TVLS
Sbjct  121  VSSGDGAATFMAELGKKGNSHARWNKICDKFEKYCDRAGGAIIASYIGLLXLLVITVLS  179



>emb|CDY22743.1| BnaA08g05730D [Brassica napus]
Length=190

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            +   A+ SY  AF F   AN I  G++ +S+ ++ +  K          + + DL++MAL
Sbjct  68   VSATAKASYLSAFVFNISANAIACGYTAISIAILMV-SKGRRSKGLIMAVLIGDLVMMAL  126

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L S   +A AIG +G  G  H  W  VC+   KFCH+    + ++ +A I +++L VL A
Sbjct  127  LFSSTGAAGAIGLMGVQGNKHVMWKKVCNVFGKFCHQTAASVAITLLAAIMFMVLVVLDA  186



>ref|XP_009107849.1| PREDICTED: CASP-like protein At4g15630 [Brassica rapa]
Length=193

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            +   A+ SY  AF F   AN I  G++ +S+ ++ +  K          + + DL++MAL
Sbjct  68   VSATAKASYLSAFVFNISANAIACGYTAISIAILMV-SKGRRSKGLIMAVLIGDLVMMAL  126

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L S   +A AIG +G  G  H  W  VC+   KFCH+    + ++ +A I +++L VL A
Sbjct  127  LFSSTGAAGAIGLMGVQGNKHVMWKKVCNVFGKFCHQTAASVAITLLAAIMFMVLVVLDA  186



>ref|XP_006414479.1| hypothetical protein EUTSA_v10026349mg [Eutrema salsugineum]
 gb|ESQ55932.1| hypothetical protein EUTSA_v10026349mg [Eutrema salsugineum]
Length=182

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            +   A+ +Y  AF +   AN I  G++ +S+ ++ I+ K          + L DL+++AL
Sbjct  60   VSTTAKSTYLSAFVYNISANAIACGYTAISIVIL-IISKGRRSKGLLMAVLLGDLVMVAL  118

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L SG  +A AIG +G  G  H  W  VC+   KFCH+    + +++++ + +++L VL A
Sbjct  119  LFSGTGAAGAIGLMGLKGNKHVMWKKVCNVFGKFCHQAAASVAITFLSAVVFMVLVVLDA  178



>ref|XP_007050797.1| CASP protein GSVIVT01010992001, putative [Theobroma cacao]
 gb|EOX94954.1| CASP protein GSVIVT01010992001, putative [Theobroma cacao]
Length=186

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = -3

Query  743  QTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLH  564
            +T+    + + A++ Y  AF +  ++N +   ++  S+     +       K    + + 
Sbjct  54   KTLPTLHVPVTAKWHYMSAFVYFLISNAVASLYAAASLVASMAVRT--SKEKAAMALVIL  111

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYI-AVIFY  387
            D+ +M LL S   +A A+G +G++G SH+ W  VC+    FCH++T  I LS + +++F+
Sbjct  112  DMTIMGLLFSSNGAAIAVGVLGQYGNSHARWNKVCELFGGFCHEMTAAIILSLVGSLVFF  171

Query  386  LILTVLSANQSRKS  345
             ++ +   N  +KS
Sbjct  172  WLVALAILNLHKKS  185



>ref|XP_006855416.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
 gb|ERN16883.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
Length=184

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 73/142 (51%), Gaps = 9/142 (6%)
 Frame = -3

Query  746  KQTVSV------FGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKH  585
            K+T++V      F I  +A+++ SPAF +  VAN +   +S+ +  V  +  K   D K 
Sbjct  42   KETITVVSPLLPFPITQEAKFNQSPAFIYFVVANAVACAYSIFTAVVSGVSKKSPSD-KL  100

Query  584  YFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSY  405
             F++   D +   ++ S   ++ AI YVG  G SH+ W  +C    KFC  V     +S 
Sbjct  101  LFHLPFFDAVFAGIVGSATGASAAIAYVGLKGNSHAMWPAICPVFGKFCRYVGGSTAVSL  160

Query  404  IAVIFYLILTVLSANQ--SRKS  345
            +A I +++L  LS++    R+S
Sbjct  161  VASIAFVLLVGLSSHSLYRRRS  182



>ref|XP_007035490.1| CASP-like protein, putative [Theobroma cacao]
 gb|EOY06416.1| CASP-like protein, putative [Theobroma cacao]
Length=272

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (56%), Gaps = 1/126 (1%)
 Frame = -3

Query  740  TVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHD  561
            T+    I+  AR+ Y  AF +  V+NII   ++ +S+ +V +  + A        + L D
Sbjct  140  TLPPLNIEAQARWHYLSAFVYAMVSNIIACSYAAISILMV-MGTRNAKKGLAQTVILLLD  198

Query  560  LIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLI  381
            L+++ALL S   +A AIG +G  G SH  W  VC+   KFC++V V + LS +  + +++
Sbjct  199  LVMVALLFSANGAAFAIGLMGYKGNSHVRWNKVCNVFDKFCNQVAVFVVLSMLGSVAFML  258

Query  380  LTVLSA  363
            L  L+A
Sbjct  259  LVALAA  264



>ref|XP_004233179.1| PREDICTED: CASP-like protein 1B2 [Solanum lycopersicum]
Length=195

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 66/117 (56%), Gaps = 0/117 (0%)
 Frame = -3

Query  716  MDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMALLL  537
            ++A++ ++PAF F  +AN +V   +LL +   FI +K       ++ + + D+I +AL+ 
Sbjct  64   LNAKFQHTPAFVFFVIANGLVSLHNLLMLAFCFIGNKYDYKGLRFYVIGILDMINVALIS  123

Query  536  SGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
             G +SA  +G +G+ G SH+ W  +CD    FC+     I  S+I ++  +I T ++
Sbjct  124  GGASSAAFMGQLGRNGNSHARWNKICDKFYTFCNHGEGAIIASFIGLLLMIITTAIN  180



>ref|NP_193297.1| uncharacterized protein [Arabidopsis thaliana]
 sp|O23413.1|CSPLN_ARATH RecName: Full=CASP-like protein 1E2; Short=AtCASPL1E2 [Arabidopsis 
thaliana]
 emb|CAB10340.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78604.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAO22783.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42449.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83629.1| uncharacterized protein AT4G15620 [Arabidopsis thaliana]
Length=190

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 1/126 (1%)
 Frame = -3

Query  740  TVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHD  561
            T+    I   A+ SY  AF +    N I  G++ +S+ ++ I  +     K    + L D
Sbjct  62   TLPPLDITTTAKASYLSAFVYNISVNAIACGYTAISIAILMI-SRGRRSKKLLMVVLLGD  120

Query  560  LIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLI  381
            L+++ALL SG  +A+AIG +G  G  H  W  VC    KFCH+    + L+ +A + ++ 
Sbjct  121  LVMVALLFSGTGAASAIGLMGLHGNKHVMWKKVCGVFGKFCHRAAPSLPLTLLAAVVFMF  180

Query  380  LTVLSA  363
            L VL A
Sbjct  181  LVVLDA  186



>ref|XP_010036826.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=196

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            + + A++ Y  AF +  VAN I  G+S LS+ ++ + +K          + + D+I++AL
Sbjct  76   VPVTAKWRYLSAFVYFVVANAIACGYSALSLLLL-LANKAGKSRTLASAVAILDIIMVAL  134

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLS  366
            L S C +ATA+G +G+ G SH  W  VC+   KFC +V V I LS    + ++++  L+
Sbjct  135  LFSSCGAATAVGVLGREGNSHVQWGKVCNVFDKFCDRVAVAIGLSLFGSLAFVLMGGLA  193



>gb|AAM67044.1| unknown [Arabidopsis thaliana]
Length=190

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 1/126 (1%)
 Frame = -3

Query  740  TVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHD  561
            T+    +   A+ SY  AF +   AN I  G++ +S+ +V I  K          + + D
Sbjct  62   TLPPLNVSTTAKASYLSAFVYNISANAIACGYTAISIVIVMI-SKGKRSKSLLMTVLIGD  120

Query  560  LIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLI  381
            L++MALL S   +A AIG +G+ G  H  W  VC    KFC++  V + ++ IA + +++
Sbjct  121  LMMMALLFSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQAAVSVAITLIASVVFML  180

Query  380  LTVLSA  363
            L VL A
Sbjct  181  LVVLDA  186



>ref|XP_009136705.1| PREDICTED: CASP-like protein At4g15630 [Brassica rapa]
Length=190

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -3

Query  572  FLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
             + DL+++ LL SG  +A AIG +G  G  H  W  VC+   KFCH+    + ++ IA I
Sbjct  117  LIGDLVMVGLLFSGTGAAGAIGLMGSQGNKHVMWKKVCNVFGKFCHQAAASVAITLIASI  176

Query  392  FYLILTVLSA  363
             +++L VL A
Sbjct  177  VFMLLVVLDA  186



>emb|CDX90578.1| BnaA03g42030D [Brassica napus]
Length=190

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -3

Query  572  FLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVI  393
             + DL+++ LL SG  +A AIG +G  G  H  W  VC+   KFCH+    + ++ IA I
Sbjct  117  LIGDLVMVGLLFSGTGAAGAIGLMGSQGNKHVMWKKVCNVFGKFCHQAAASVAITLIASI  176

Query  392  FYLILTVLSA  363
             +++L VL A
Sbjct  177  VFMLLVVLDA  186



>ref|XP_006654178.1| PREDICTED: CASP-like protein BLE3-like [Oryza brachyantha]
Length=162

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 69/121 (57%), Gaps = 7/121 (6%)
 Frame = -3

Query  749  SKQTVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMF  570
            S++T S FGIQM+A+YSY+P+F F  VA      +++ + + + +L   AG       + 
Sbjct  30   SRETTSFFGIQMEAKYSYTPSFIFFVVA------YAVAAAYSLLVLAVPAGSALSRLALT  83

Query  569  LHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIF  390
            + D+++  +L    A+  A+  + K G SH+GW+PVC  +  +C+ V   +   ++A++ 
Sbjct  84   I-DVMLGMVLAGAVAATGAVSDIAKNGNSHAGWLPVCGQIHAYCNHVMAALIAGFVALVL  142

Query  389  Y  387
            +
Sbjct  143  H  143



>emb|CDY70062.1| BnaAnng32480D, partial [Brassica napus]
Length=120

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  563  DLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            DL+V  LL S  ++A A+  VGK G +++GW+P+C  V +FC ++T  +    +A+I Y+
Sbjct  42   DLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPICGQVPRFCDQITGALIAGLVALILYV  101

Query  383  ILTVLS  366
             L + S
Sbjct  102  FLLIFS  107



>gb|EYU43899.1| hypothetical protein MIMGU_mgv1a014325mg [Erythranthe guttata]
Length=193

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -3

Query  614  LDKMAGDPKHYFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCH  435
            L   +G       + L DL+++ALL SG  +A +IG +G  G SH  W  VC+   KFCH
Sbjct  103  LANRSGKKGITMIVVLFDLVMVALLFSGVGAAASIGVMGFEGNSHVQWKKVCNVFGKFCH  162

Query  434  KVTVGITLSYI-AVIFYLILTVLSANQSRK  348
            +    I LS + A++F+L++ + + N  +K
Sbjct  163  QAAAAIGLSGVAALVFFLLVALATWNLHKK  192



>ref|XP_009763947.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana sylvestris]
Length=184

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            ++  A+YS  P F F  VAN IV  + +LS+ +       +        +   D  +MAL
Sbjct  59   VRFRAKYSDLPTFTFFVVANAIVSAYLVLSLGMSIFHIMRSRAQASRIALIFFDAAMMAL  118

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYL  384
            L +G +++ AI Y+   G + + W P+C     FCH+ +  +  S+I +IF++
Sbjct  119  LTAGASASAAIVYLAHKGNTKTNWFPICQQYDSFCHRTSGSLVGSFIGIIFFI  171



>ref|XP_006342777.1| PREDICTED: CASP-like protein 5-like [Solanum tuberosum]
Length=194

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 69/134 (51%), Gaps = 5/134 (4%)
 Frame = -3

Query  740  TVSVFGIQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHD  561
            T+    +   A++S+  AF +  + N I   ++++S+ +   L            + L D
Sbjct  62   TLPPINVPASAKWSHMSAFVYFVIVNAIACAYAVISLVLS--LANRGKAKGLSLTIILFD  119

Query  560  LIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLI  381
            LI+MALL S   +A A+G +G  G +H  W  VCD   KFC +V   I +S +  I +L+
Sbjct  120  LIMMALLYSSVGAAAAVGLIGYKGNTHVRWNKVCDVFGKFCGQVAAAIAISLVGSILFLL  179

Query  380  LTV---LSANQSRK  348
            L +   L+ +++R+
Sbjct  180  LVLFAMLNLHKNRR  193



>ref|XP_004304287.1| PREDICTED: CASP-like protein 1-like [Fragaria vesca subsp. vesca]
Length=187

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = -3

Query  722  IQMDARYSYSPAFKFLAVANIIvfgfsllsvfvvF--ILDKMAGDPKHYFYMFLHDLIVM  549
            +Q  A Y   P F F  VAN IV  + + S+ +    IL   A + +     F  D  ++
Sbjct  62   LQFRAEYDDLPTFTFFVVANSIVCVYLMFSLALSIFHILRSHAKNSRIILIFF--DTGML  119

Query  548  ALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVL  369
            ALL SG ++ATAI Y+   G + + W  +C   + FC +++  +  S++A++ +++L ++
Sbjct  120  ALLTSGASAATAIVYLAHKGNAKANWFAICQQFNSFCERISGSLIGSFVAIVIFILLILM  179

Query  368  SA  363
            SA
Sbjct  180  SA  181



>gb|KHN25032.1| CASP-like protein 2 [Glycine soja]
Length=186

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 93/180 (52%), Gaps = 5/180 (3%)
 Frame = -3

Query  890  KMESFGSKDEQKQQPPLKA-VKLFSAIQlvlrlaitaltlaaawtllTSKQTV--SVFGI  720
            K  +  S +  K  PP K  ++  S +  +LR+     TL +A  + T++QT+  S   +
Sbjct  2    KASAVESSEISKGAPPRKGLIRGLSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQFV  61

Query  719  QMDARYSYSPAFKFLAVAN-IIvfgfsllsvfvvFILDKMAGDPKHYFYMFLHDLIVMAL  543
            +  A +S  P F F   +N I+     L  V   F + + A        +FL D ++  L
Sbjct  62   KFRAVFSDLPTFVFFVTSNSIVCGYLVLSLVLSFFHIVRSAAVKSRVLQVFL-DTVMYGL  120

Query  542  LLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAVIFYLILTVLSA  363
            L +G ++ATAI Y   +G S++ W P C   ++FC +++  +  S+IAV+ ++IL ++SA
Sbjct  121  LTTGASAATAIVYEAHYGNSNTNWFPFCRQYNRFCKQISGSLIGSFIAVVLFIILILMSA  180



>ref|XP_004503085.1| PREDICTED: CASP-like protein 10-like [Cicer arietinum]
Length=216

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  593  PKHYFYMFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGIT  414
            P  + + FL D ++  ++LS  AS+  + Y+ + G+  + WM  C+   +FCHKVT  IT
Sbjct  110  PPAWTFFFL-DQVLTYIMLSAGASSAEVVYLAENGDDATLWMSACEPFGRFCHKVTASIT  168

Query  413  LSYIAVIFYLILTVLSA  363
            ++++A+I Y++L+++S+
Sbjct  169  ITFVALICYVLLSLISS  185



>ref|XP_010449916.1| PREDICTED: CASP-like protein 1E1 [Camelina sativa]
Length=191

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  575  MFLHDLIVMALLLSGCASATAIGYVGKFGESHSGWMPVCDNVSKFCHKVTVGITLSYIAV  396
            + + DL+++ALL SG  ++  IG +GK G  H  W  VC    KFC++V V + ++ +A 
Sbjct  117  ILIGDLVMVALLFSGTGASGGIGLMGKQGNKHVMWKKVCGVFDKFCNQVAVSVAITLLAS  176

Query  395  IFYLILTVLSA  363
            I ++++ VL A
Sbjct  177  IVFMVIVVLDA  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2133155381984