BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30322_g1_i1 len=1966 path=[1944:0-1965]

Length=1966
                                                                      Score     E

ref|XP_002272134.1|  PREDICTED: uncharacterized protein LOC100243523    300   4e-89   Vitis vinifera
ref|XP_010279178.1|  PREDICTED: uncharacterized protein LOC104613162    291   1e-85   
ref|XP_008225191.1|  PREDICTED: uncharacterized protein LOC103324855    289   6e-85   
ref|XP_010279180.1|  PREDICTED: uncharacterized protein LOC104613163    289   7e-85   
ref|XP_010276580.1|  PREDICTED: uncharacterized protein LOC104611295    289   1e-84   
ref|XP_010915578.1|  PREDICTED: uncharacterized protein LOC105040648    289   1e-84   
ref|XP_007214217.1|  hypothetical protein PRUPE_ppa023212mg             283   3e-83   
ref|XP_009340381.1|  PREDICTED: uncharacterized protein LOC103932481    285   4e-83   
ref|XP_007025465.1|  Sodium/calcium exchanger family protein / ca...    284   7e-83   
ref|XP_006451747.1|  hypothetical protein CICLE_v10007809mg             283   1e-82   
ref|XP_008383659.1|  PREDICTED: uncharacterized protein LOC103446347    282   2e-82   
ref|XP_007149412.1|  hypothetical protein PHAVU_005G068100g             282   3e-82   
ref|XP_009352959.1|  PREDICTED: uncharacterized protein LOC103944258    281   4e-82   
gb|KDP36271.1|  hypothetical protein JCGZ_09836                         281   7e-82   
ref|XP_004951320.1|  PREDICTED: uncharacterized protein LOC101782315    280   1e-81   
ref|XP_010098421.1|  hypothetical protein L484_012136                   280   2e-81   
ref|XP_011082732.1|  PREDICTED: uncharacterized protein LOC105165426    279   4e-81   
ref|XP_008367781.1|  PREDICTED: uncharacterized protein LOC103431400    280   6e-81   
ref|XP_007021648.1|  Sodium/calcium exchanger family protein / ca...    278   7e-81   
emb|CAN78275.1|  hypothetical protein VITISV_037788                     276   1e-80   Vitis vinifera
gb|KHG29939.1|  Vacuolar calcium ion transporter                        277   3e-80   
ref|XP_010101519.1|  hypothetical protein L484_008850                   275   4e-80   
gb|EEE56655.1|  hypothetical protein OsJ_06069                          276   4e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000241.1|  PREDICTED: uncharacterized protein LOC105107868    276   5e-80   
ref|XP_009352820.1|  PREDICTED: uncharacterized protein LOC103944133    274   2e-79   
ref|XP_008386231.1|  PREDICTED: uncharacterized protein LOC103448741    274   3e-79   
ref|XP_008226455.1|  PREDICTED: uncharacterized protein LOC103326029    274   4e-79   
ref|XP_002282948.1|  PREDICTED: uncharacterized protein LOC100252144    273   6e-79   Vitis vinifera
ref|XP_004294083.1|  PREDICTED: uncharacterized protein LOC101314065    273   7e-79   
ref|XP_009405607.1|  PREDICTED: uncharacterized protein LOC103988717    273   8e-79   
ref|XP_008367769.1|  PREDICTED: uncharacterized protein LOC103431392    273   1e-78   
ref|XP_010675392.1|  PREDICTED: uncharacterized protein LOC104891403    272   2e-78   
ref|XP_009348415.1|  PREDICTED: uncharacterized protein LOC103940069    271   3e-78   
gb|EPS64918.1|  sodium/calcium exchanger family protein                 270   4e-78   
ref|XP_009380498.1|  PREDICTED: uncharacterized protein LOC103968880    271   4e-78   
ref|XP_008645573.1|  PREDICTED: uncharacterized protein LOC103626994    271   5e-78   
ref|XP_009352958.1|  PREDICTED: uncharacterized protein LOC103944256    271   7e-78   
ref|XP_008226453.1|  PREDICTED: uncharacterized protein LOC103326027    270   8e-78   
ref|XP_009348414.1|  PREDICTED: uncharacterized protein LOC103940068    268   2e-77   
ref|XP_008783929.1|  PREDICTED: uncharacterized protein LOC103703017    270   3e-77   
ref|XP_002525142.1|  calcium ion binding protein, putative              268   3e-77   Ricinus communis
ref|XP_003543222.1|  PREDICTED: uncharacterized protein LOC100809896    267   1e-76   
ref|XP_004489056.1|  PREDICTED: uncharacterized protein LOC101505490    267   1e-76   
ref|XP_010519243.1|  PREDICTED: uncharacterized protein LOC104798750    267   2e-76   
gb|KDP31770.1|  hypothetical protein JCGZ_12231                         266   3e-76   
dbj|BAD19956.1|  putative drought-induced protein RDI                   266   3e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002522155.1|  calcium ion binding protein, putative              265   3e-76   Ricinus communis
ref|XP_003571165.2|  PREDICTED: uncharacterized protein LOC100833...    267   4e-76   
ref|XP_011098256.1|  PREDICTED: uncharacterized protein LOC105176...    266   4e-76   
ref|XP_009409407.1|  PREDICTED: uncharacterized protein LOC103991626    266   4e-76   
ref|XP_010060650.1|  PREDICTED: uncharacterized protein LOC104448506    266   4e-76   
ref|XP_002298903.2|  sodium/calcium exchanger family protein            265   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_009593456.1|  PREDICTED: uncharacterized protein LOC104090114    264   1e-75   
ref|XP_004294082.1|  PREDICTED: uncharacterized protein LOC101313777    264   3e-75   
ref|XP_002279120.1|  PREDICTED: uncharacterized protein LOC100253888    262   1e-74   Vitis vinifera
ref|XP_008383883.1|  PREDICTED: uncharacterized protein LOC103446524    262   1e-74   
ref|XP_010535054.1|  PREDICTED: uncharacterized protein LOC104810447    261   2e-74   
ref|XP_004244257.1|  PREDICTED: uncharacterized protein LOC101263533    261   4e-74   
ref|NP_001042378.1|  Os01g0212400                                       260   4e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011096403.1|  PREDICTED: uncharacterized protein LOC105175606    263   5e-74   
ref|XP_009767335.1|  PREDICTED: uncharacterized protein LOC104218515    260   5e-74   
ref|XP_006643900.1|  PREDICTED: uncharacterized protein LOC102712578    259   8e-74   
emb|CDM82192.1|  unnamed protein product                                259   1e-73   
ref|XP_003565462.1|  PREDICTED: uncharacterized protein LOC100838274    258   4e-73   
ref|XP_008371442.1|  PREDICTED: uncharacterized protein LOC103434855    257   5e-73   
ref|XP_010062838.1|  PREDICTED: uncharacterized protein LOC104450104    257   5e-73   
gb|KHG25681.1|  Vacuolar calcium ion transporter                        257   6e-73   
dbj|BAJ93500.1|  predicted protein                                      257   6e-73   
ref|XP_006348283.1|  PREDICTED: uncharacterized protein LOC102600810    257   1e-72   
ref|XP_011096402.1|  PREDICTED: uncharacterized protein LOC105175...    256   1e-72   
ref|XP_007050029.1|  Sodium/calcium exchanger family protein / ca...    256   1e-72   
ref|XP_011096401.1|  PREDICTED: uncharacterized protein LOC105175...    255   3e-72   
gb|ACY66874.1|  P20Sh095F0                                              255   4e-72   Saccharum hybrid cultivar R570
dbj|BAI94501.1|  sodium/calcium exchanger protein                       255   4e-72   
ref|XP_010549555.1|  PREDICTED: uncharacterized protein LOC104820693    254   6e-72   
ref|XP_004305436.1|  PREDICTED: uncharacterized protein LOC101295737    253   2e-71   
ref|XP_002451861.1|  hypothetical protein SORBIDRAFT_04g008850          253   2e-71   Sorghum bicolor [broomcorn]
ref|XP_008463718.1|  PREDICTED: uncharacterized protein LOC103501799    253   3e-71   
ref|XP_008673552.1|  PREDICTED: uncharacterized protein LOC103649588    252   6e-71   
gb|EYU44997.1|  hypothetical protein MIMGU_mgv1a003664mg                251   6e-71   
ref|XP_006358955.1|  PREDICTED: uncharacterized protein LOC102579474    251   7e-71   
ref|XP_009353170.1|  PREDICTED: uncharacterized protein LOC103944425    253   8e-71   
ref|XP_010234099.1|  PREDICTED: uncharacterized protein LOC100833...    254   8e-71   
gb|ACY66868.1|  P20Sh148J07                                             251   1e-70   Saccharum hybrid cultivar R570
ref|XP_009604315.1|  PREDICTED: uncharacterized protein LOC104099119    251   1e-70   
ref|XP_004293919.1|  PREDICTED: uncharacterized protein LOC101312324    250   2e-70   
ref|XP_009803286.1|  PREDICTED: uncharacterized protein LOC104248681    253   2e-70   
ref|XP_009605371.1|  PREDICTED: uncharacterized protein LOC104099939    253   2e-70   
ref|XP_004146032.1|  PREDICTED: uncharacterized protein LOC101209...    250   3e-70   
ref|XP_004251882.1|  PREDICTED: uncharacterized protein LOC101257045    250   4e-70   
ref|XP_006392816.1|  hypothetical protein EUTSA_v10011341mg             250   4e-70   
emb|CDY25725.1|  BnaC03g69500D                                          249   4e-70   
gb|KDP21052.1|  hypothetical protein JCGZ_21523                         249   8e-70   
emb|CDY25869.1|  BnaA05g14600D                                          249   8e-70   
ref|XP_009144785.1|  PREDICTED: uncharacterized protein LOC103868446    249   8e-70   
ref|XP_009147618.1|  PREDICTED: uncharacterized protein LOC103871140    249   9e-70   
emb|CDY55841.1|  BnaCnng29300D                                          249   9e-70   
ref|NP_564623.2|  Na+/Ca 2+ exchanger-like protein                      249   9e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354324.1|  PREDICTED: uncharacterized protein LOC103945475    248   1e-69   
ref|XP_009106991.1|  PREDICTED: uncharacterized protein LOC103832685    248   2e-69   
gb|EMS61578.1|  hypothetical protein TRIUR3_22187                       245   2e-69   
ref|XP_010478257.1|  PREDICTED: uncharacterized protein LOC104757229    248   2e-69   
ref|XP_004233846.1|  PREDICTED: uncharacterized protein LOC101251749    251   2e-69   
emb|CDY24108.1|  BnaA06g01060D                                          249   4e-69   
ref|XP_008362437.1|  PREDICTED: uncharacterized protein LOC103426126    246   5e-69   
ref|XP_006852513.1|  hypothetical protein AMTR_s00021p00164610          246   7e-69   
emb|CDY26003.1|  BnaC06g06210D                                          246   1e-68   
ref|XP_008368645.1|  PREDICTED: uncharacterized protein LOC103432241    246   1e-68   
gb|ADN33808.1|  sodium/calcium exchanger family protein                 246   1e-68   
ref|XP_011027724.1|  PREDICTED: uncharacterized protein LOC105127...    245   1e-68   
ref|XP_003634635.1|  PREDICTED: uncharacterized protein LOC100264164    245   2e-68   
ref|XP_010052481.1|  PREDICTED: uncharacterized protein LOC104441...    244   3e-68   
gb|EYU28049.1|  hypothetical protein MIMGU_mgv1a003825mg                243   7e-68   
ref|XP_010041151.1|  PREDICTED: uncharacterized protein LOC104430086    243   8e-68   
emb|CDY37675.1|  BnaA04g19930D                                          243   9e-68   
ref|NP_174197.2|  EF-hand, calcium binding motif-containing protein     243   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146033.1|  PREDICTED: uncharacterized protein LOC101209...    243   1e-67   
gb|EMT26919.1|  hypothetical protein F775_25869                         239   3e-67   
ref|XP_004968611.1|  PREDICTED: uncharacterized protein LOC101771765    241   4e-67   
ref|XP_007021639.1|  Sodium/calcium exchanger family protein / ca...    244   6e-67   
ref|XP_009141357.1|  PREDICTED: uncharacterized protein LOC103865312    240   6e-67   
emb|CAN78652.1|  hypothetical protein VITISV_033128                     241   1e-66   Vitis vinifera
emb|CDP05978.1|  unnamed protein product                                238   1e-66   
emb|CBI20223.3|  unnamed protein product                                237   2e-66   
ref|XP_007212014.1|  hypothetical protein PRUPE_ppa004833mg             237   2e-66   
gb|KCW89606.1|  hypothetical protein EUGRSUZ_A01890                     239   2e-66   
ref|XP_009766997.1|  PREDICTED: uncharacterized protein LOC104218248    239   2e-66   
ref|XP_007213956.1|  hypothetical protein PRUPE_ppa004823mg             237   3e-66   
ref|XP_006415620.1|  hypothetical protein EUTSA_v10007172mg             239   4e-66   
ref|NP_001151543.1|  LOC100285177 precursor                             238   8e-66   Zea mays [maize]
ref|XP_011098255.1|  PREDICTED: uncharacterized protein LOC105176...    238   1e-65   
gb|AAF69532.1|AC008007_7  F12M16.12                                     237   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305761.1|  hypothetical protein POPTR_0004s05210g             237   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010509800.1|  PREDICTED: uncharacterized protein LOC104786159    237   4e-65   
ref|NP_001185109.1|  Calcium-binding EF-hand family protein             236   4e-65   
ref|XP_006469050.1|  PREDICTED: uncharacterized protein LOC102616350    235   9e-65   
dbj|BAF00582.1|  hypothetical protein                                   234   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004234097.2|  PREDICTED: uncharacterized protein LOC101254...    237   2e-64   
gb|EMS45634.1|  hypothetical protein TRIUR3_11261                       230   2e-64   
ref|XP_006446746.1|  hypothetical protein CICLE_v10018123mg             233   4e-64   
gb|EYU28050.1|  hypothetical protein MIMGU_mgv1a023246mg                235   4e-64   
gb|EMT05376.1|  hypothetical protein F775_06447                         231   4e-64   
ref|XP_006410547.1|  hypothetical protein EUTSA_v10016396mg             234   5e-64   
ref|XP_010317432.1|  PREDICTED: uncharacterized protein LOC101254...    235   6e-64   
ref|XP_010499420.1|  PREDICTED: uncharacterized protein LOC104776935    233   7e-64   
ref|NP_180949.2|  calcium-binding EF-hand-containing protein            233   8e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343216.1|  PREDICTED: uncharacterized protein LOC102593213    234   9e-64   
emb|CDX84660.1|  BnaA03g15700D                                          231   2e-63   
ref|XP_010500958.1|  PREDICTED: uncharacterized protein LOC104778258    231   3e-63   
ref|XP_006295951.1|  hypothetical protein CARUB_v10025093mg             231   4e-63   
ref|XP_010479874.1|  PREDICTED: uncharacterized protein LOC104758667    230   6e-63   
ref|XP_006307086.1|  hypothetical protein CARUB_v10008672mg             229   1e-62   
ref|XP_002881319.1|  calcium ion binding protein                        229   1e-62   
ref|XP_011096404.1|  PREDICTED: uncharacterized protein LOC105175608    230   4e-62   
gb|KFK23894.1|  hypothetical protein AALP_AAs69390U000200               228   4e-62   
ref|XP_010462200.1|  PREDICTED: uncharacterized protein LOC104742841    228   5e-62   
emb|CDX79552.1|  BnaC03g18880D                                          228   6e-62   
ref|XP_008229131.1|  PREDICTED: uncharacterized protein LOC103328510    227   6e-62   
emb|CDY34082.1|  BnaA09g27080D                                          227   1e-61   
ref|XP_010058976.1|  PREDICTED: uncharacterized protein LOC104446874    226   1e-61   
ref|XP_009132970.1|  PREDICTED: uncharacterized protein LOC103857518    226   2e-61   
ref|XP_009113633.1|  PREDICTED: uncharacterized protein LOC103838933    226   2e-61   
ref|XP_007213018.1|  hypothetical protein PRUPE_ppa023026mg             225   3e-61   
gb|AAK32813.1|AF361800_1  At1g53210/F12M16_12                           222   8e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAF24539.2|AC007508_2  F1K23.2                                       229   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655084.1|  PREDICTED: LOC100285177 isoform X1                 223   4e-60   
ref|NP_180950.2|  Calcium-binding EF-hand family protein                222   5e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDY64851.1|  BnaCnng45370D                                          221   1e-59   
ref|XP_008358657.1|  PREDICTED: uncharacterized protein LOC103422380    216   1e-59   
ref|XP_010460672.1|  PREDICTED: uncharacterized protein LOC104741492    220   2e-59   
ref|XP_002992821.1|  hypothetical protein SELMODRAFT_42349              218   4e-59   
ref|XP_010058975.1|  PREDICTED: uncharacterized protein LOC104446873    218   4e-59   
gb|EPS57671.1|  hypothetical protein M569_17145                         216   7e-59   
ref|XP_006304623.1|  hypothetical protein CARUB_v10011719mg             217   2e-58   
ref|XP_002987555.1|  hypothetical protein SELMODRAFT_42348              216   2e-58   
gb|ACN27225.1|  unknown                                                 214   6e-58   Zea mays [maize]
ref|XP_010052488.1|  PREDICTED: uncharacterized protein LOC104441...    214   7e-58   
gb|EYU43358.1|  hypothetical protein MIMGU_mgv1a003865mg                215   1e-57   
gb|KCW74041.1|  hypothetical protein EUGRSUZ_E02665                     212   2e-57   
gb|KFK23895.1|  hypothetical protein AALP_AAs69390U000300               214   2e-57   
ref|XP_002522156.1|  calcium ion binding protein, putative              213   8e-57   Ricinus communis
ref|XP_010058973.1|  PREDICTED: uncharacterized protein LOC104446871    211   3e-56   
gb|KCW74040.1|  hypothetical protein EUGRSUZ_E02663                     210   7e-56   
ref|XP_011027726.1|  PREDICTED: uncharacterized protein LOC105127...    208   9e-56   
gb|KCW67437.1|  hypothetical protein EUGRSUZ_F01191                     204   6e-55   
ref|XP_006340117.1|  PREDICTED: uncharacterized protein LOC102587762    210   6e-55   
ref|XP_009629500.1|  PREDICTED: uncharacterized protein LOC104119642    208   3e-54   
ref|XP_001762095.1|  predicted protein                                  206   3e-54   
ref|XP_002893543.1|  predicted protein                                  210   3e-54   
gb|KFK44728.1|  hypothetical protein AALP_AA1G295100                    204   4e-54   
ref|XP_002974272.1|  hypothetical protein SELMODRAFT_52345              204   7e-54   
ref|XP_002985644.1|  hypothetical protein SELMODRAFT_181929             201   9e-53   
gb|EAZ04370.1|  hypothetical protein OsI_26513                          198   4e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_002965139.1|  hypothetical protein SELMODRAFT_82683              197   3e-51   
ref|XP_001751608.1|  predicted protein                                  197   3e-51   
ref|XP_002962226.1|  hypothetical protein SELMODRAFT_76965              197   3e-51   
gb|KFK44727.1|  hypothetical protein AALP_AA1G295000                    197   3e-51   
ref|XP_002522529.1|  calmodulin, putative                               198   8e-51   Ricinus communis
ref|XP_010060649.1|  PREDICTED: uncharacterized protein LOC104448505    191   2e-48   
ref|XP_002275985.2|  PREDICTED: uncharacterized protein LOC100255777    187   4e-48   Vitis vinifera
gb|KDP21053.1|  hypothetical protein JCGZ_21524                         187   2e-47   
emb|CAN78650.1|  hypothetical protein VITISV_033126                     186   2e-47   Vitis vinifera
ref|XP_010277716.1|  PREDICTED: uncharacterized protein LOC104612096    187   3e-47   
ref|XP_001752917.1|  predicted protein                                  186   4e-47   
gb|KCW69971.1|  hypothetical protein EUGRSUZ_F03285                     184   5e-47   
ref|XP_009794964.1|  PREDICTED: uncharacterized protein LOC104241728    184   6e-47   
gb|ACN36915.1|  unknown                                                 182   9e-47   Zea mays [maize]
gb|KEH38643.1|  calcium-binding EF-hand protein                         181   2e-46   
ref|XP_009340418.1|  PREDICTED: uncharacterized protein LOC103932516    185   2e-46   
ref|XP_008386229.1|  PREDICTED: uncharacterized protein LOC103448738    184   2e-46   
ref|XP_007213499.1|  hypothetical protein PRUPE_ppa022096mg             182   6e-46   
gb|KCW44589.1|  hypothetical protein EUGRSUZ_L01893                     179   7e-46   
ref|XP_006370033.1|  hypothetical protein POPTR_0001s38420g             181   2e-45   
gb|KCW67430.1|  hypothetical protein EUGRSUZ_F01186                     180   4e-45   
ref|XP_008226451.1|  PREDICTED: uncharacterized protein LOC103326025    181   5e-45   
emb|CDP05977.1|  unnamed protein product                                180   7e-45   
gb|EYU26347.1|  hypothetical protein MIMGU_mgv1a002045mg                178   3e-44   
ref|XP_007021646.1|  Sodium/calcium exchanger family protein / ca...    178   3e-44   
ref|XP_006594741.1|  PREDICTED: uncharacterized protein LOC100798...    178   3e-44   
ref|XP_011000237.1|  PREDICTED: uncharacterized protein LOC105107...    176   1e-43   
ref|XP_009603995.1|  PREDICTED: uncharacterized protein LOC104098869    169   1e-43   
ref|XP_011000235.1|  PREDICTED: uncharacterized protein LOC105107...    176   1e-43   
ref|XP_011000236.1|  PREDICTED: uncharacterized protein LOC105107...    176   1e-43   
ref|XP_006370034.1|  hypothetical protein POPTR_0001s38430g             172   4e-43   
gb|KCW67438.1|  hypothetical protein EUGRSUZ_F01191                     167   9e-43   
gb|KDP36272.1|  hypothetical protein JCGZ_09837                         171   1e-42   
ref|XP_002298902.2|  hypothetical protein POPTR_0001s38430g             172   2e-42   Populus trichocarpa [western balsam poplar]
gb|KCW67433.1|  hypothetical protein EUGRSUZ_F01189                     170   3e-42   
emb|CBI20222.3|  unnamed protein product                                171   4e-42   
ref|XP_010644148.1|  PREDICTED: uncharacterized protein LOC100241883    171   7e-42   
ref|XP_011082730.1|  PREDICTED: uncharacterized protein LOC105165425    171   9e-42   
ref|XP_011083284.1|  PREDICTED: uncharacterized protein LOC105165819    169   2e-41   
gb|KCW67432.1|  hypothetical protein EUGRSUZ_F01188                     166   7e-41   
ref|XP_006594743.1|  PREDICTED: uncharacterized protein LOC100798...    167   7e-41   
gb|KCW67434.1|  hypothetical protein EUGRSUZ_F01190                     164   2e-40   
ref|XP_011000239.1|  PREDICTED: uncharacterized protein LOC105107...    164   7e-40   
gb|EYU44996.1|  hypothetical protein MIMGU_mgv1a025835mg                164   7e-40   
ref|XP_011000240.1|  PREDICTED: uncharacterized protein LOC105107...    164   8e-40   
ref|XP_006594742.1|  PREDICTED: uncharacterized protein LOC100798...    164   2e-39   
ref|XP_002275961.1|  PREDICTED: uncharacterized protein LOC100260847    161   3e-39   Vitis vinifera
ref|XP_002522528.1|  conserved hypothetical protein                     161   3e-39   Ricinus communis
ref|XP_001755925.1|  predicted protein                                  159   2e-38   
emb|CBI21945.3|  unnamed protein product                                161   4e-38   
ref|XP_002893544.1|  predicted protein                                  156   2e-37   
gb|KCW67441.1|  hypothetical protein EUGRSUZ_F011931                    148   4e-37   
ref|XP_004295570.1|  PREDICTED: uncharacterized protein LOC101307679    153   6e-37   
ref|XP_007021649.1|  Sodium/calcium exchanger family protein / ca...    152   2e-36   
ref|XP_006594744.1|  PREDICTED: uncharacterized protein LOC100799062    152   3e-36   
gb|KHN36865.1|  hypothetical protein glysoja_001596                     152   9e-36   
ref|XP_007149413.1|  hypothetical protein PHAVU_005G068200g             150   1e-35   
ref|XP_010042553.1|  PREDICTED: uncharacterized protein LOC104431654    144   4e-35   
ref|XP_007149414.1|  hypothetical protein PHAVU_005G068300g             150   9e-35   
gb|EYU44995.1|  hypothetical protein MIMGU_mgv1a002795mg                149   1e-34   
dbj|BAD43479.1|  unknown protein                                        137   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ACN35869.1|  unknown                                                 142   2e-33   Zea mays [maize]
ref|XP_006307087.1|  hypothetical protein CARUB_v10008672mg             140   2e-32   
ref|XP_002891737.1|  sodium/calcium exchanger family protein            141   3e-32   
gb|KFK35737.1|  hypothetical protein AALP_AA4G030000                    140   3e-32   
ref|XP_011027727.1|  PREDICTED: uncharacterized protein LOC105127...    139   4e-32   
ref|XP_003540477.1|  PREDICTED: uncharacterized protein LOC100800452    141   8e-32   
ref|XP_007050030.1|  Sodium/calcium exchanger family protein / ca...    138   1e-31   
gb|KHN28092.1|  hypothetical protein glysoja_007824                     140   2e-31   
emb|CAN76642.1|  hypothetical protein VITISV_042742                     129   3e-31   Vitis vinifera
gb|EYU43357.1|  hypothetical protein MIMGU_mgv1a003865mg                137   3e-31   
ref|XP_005839482.1|  hypothetical protein GUITHDRAFT_159252             130   8e-29   
gb|KDO45773.1|  hypothetical protein CISIN_1g0423001mg                  121   3e-28   
emb|CAN66793.1|  hypothetical protein VITISV_034151                     126   3e-28   Vitis vinifera
gb|ADM77131.1|  sodium/calcium exchanger family-like protein            122   5e-28   
gb|ADE75754.1|  unknown                                                 122   8e-28   
gb|ADM77106.1|  sodium/calcium exchanger family-like protein            122   9e-28   
gb|ADM77115.1|  sodium/calcium exchanger family-like protein            121   2e-27   
gb|EMS60383.1|  hypothetical protein TRIUR3_19685                       120   2e-26   
gb|KDO45772.1|  hypothetical protein CISIN_1g0423002mg                  120   4e-26   
ref|XP_004489085.1|  PREDICTED: uncharacterized protein LOC101490110    122   4e-26   
ref|XP_007021642.1|  Sodium/calcium exchanger family protein / ca...    121   5e-26   
emb|CBI21946.3|  unnamed protein product                                120   5e-25   
ref|XP_003288984.1|  hypothetical protein DICPUDRAFT_153287             117   3e-24   
gb|EPS70685.1|  hypothetical protein M569_04074                         109   4e-23   
ref|XP_006306439.1|  hypothetical protein CARUB_v10012381mg             112   1e-22   
ref|XP_004489086.1|  PREDICTED: uncharacterized protein LOC101490438    105   2e-22   
gb|ACU19365.1|  unknown                                                 103   2e-21   
gb|ABR26205.1|  sodium/calcium exchanger protein                        102   3e-20   
ref|XP_010277717.1|  PREDICTED: uncharacterized protein LOC104612...    100   3e-20   
ref|XP_004357876.1|  hypothetical protein DFA_00160                     104   5e-20   
ref|XP_010277718.1|  PREDICTED: uncharacterized protein LOC104612...  99.0    8e-20   
gb|EMT26602.1|  hypothetical protein F775_16567                       98.6    2e-19   
ref|XP_010657148.1|  PREDICTED: uncharacterized protein LOC100245468  99.4    2e-19   
dbj|GAM24777.1|  hypothetical protein SAMD00019534_079520               100   4e-19   
gb|AAB67620.1|  unknown protein                                         100   6e-19   
ref|XP_002500016.1|  Ca2+:Cation antiporter family                      100   6e-19   
ref|XP_002276006.2|  PREDICTED: uncharacterized protein LOC100250594    100   7e-19   
gb|AAB67621.1|  unknown protein                                       96.7    6e-18   
emb|CAN78651.1|  hypothetical protein VITISV_033127                   97.4    7e-18   
ref|XP_642144.1|  hypothetical protein DDB_G0278609                   97.4    9e-18   
ref|XP_002979757.1|  hypothetical protein SELMODRAFT_111442           90.9    2e-17   
ref|XP_002985423.1|  hypothetical protein SELMODRAFT_122258           90.5    2e-17   
ref|XP_006414715.1|  hypothetical protein EUTSA_v10027329mg           91.7    3e-17   
ref|XP_004361492.1|  hypothetical protein DFA_05775                   92.0    4e-16   
gb|KEH38650.1|  calcium-binding EF-hand protein                       90.5    1e-15   
gb|ABK93869.1|  unknown                                               83.6    1e-15   
ref|XP_005650712.1|  hypothetical protein COCSUDRAFT_61158            90.1    1e-15   
gb|EMT26603.1|  hypothetical protein F775_16568                       85.5    5e-15   
ref|XP_010319658.1|  PREDICTED: uncharacterized protein LOC101260716  83.6    6e-15   
gb|EWM24964.1|  ca2 :cation antiporter family                         87.8    9e-15   
ref|XP_008366059.1|  PREDICTED: uncharacterized protein LOC103429706  84.3    1e-14   
gb|KEH38649.1|  calcium-binding EF-hand protein                       85.9    2e-14   
ref|NP_001046432.2|  Os02g0247800                                     78.6    8e-14   
ref|XP_011087014.1|  PREDICTED: uncharacterized protein LOC105168577  82.4    2e-13   
emb|CBK20420.2|  unnamed protein product                              80.5    4e-13   
emb|CBN73858.1|  Putative sodium calcium exchanger                    80.1    2e-12   
ref|XP_001627159.1|  predicted protein                                81.3    2e-12   
dbj|GAM24148.1|  hypothetical protein SAMD00019534_073230             80.1    2e-12   
ref|XP_004963827.1|  PREDICTED: uncharacterized protein LOC101777425  75.1    7e-12   
ref|XP_010064464.1|  PREDICTED: uncharacterized protein LOC104451526  74.3    2e-11   
ref|XP_002907451.1|  Ca2 :Cation Antiporter (CaCA) Family             77.0    3e-11   
ref|XP_010089436.1|  hypothetical protein L484_002737                 72.8    4e-11   
emb|CCA15196.1|  Ca2 :Cation Antiporter (CaCA) Family putative        75.5    7e-11   
ref|XP_002113975.1|  hypothetical protein TRIADDRAFT_57950            74.7    1e-10   
ref|XP_003386706.1|  PREDICTED: hypothetical protein LOC100632705     73.6    3e-10   
gb|EPS70687.1|  hypothetical protein M569_04076                       67.4    5e-10   
ref|XP_005719417.1|  unnamed protein product                          72.4    7e-10   
gb|EFA85983.1|  hypothetical protein PPL_01216                        72.0    9e-10   
ref|XP_006415621.1|  hypothetical protein EUTSA_v10009350mg           70.9    1e-09   
gb|ETK74657.1|  hypothetical protein L915_18596                       71.6    1e-09   
ref|XP_008897040.1|  hypothetical protein PPTG_05278                  71.2    1e-09   
ref|XP_002185522.1|  predicted protein                                70.9    2e-09   
emb|CCI40171.1|  unnamed protein product                              70.9    3e-09   
gb|AAL32034.1|AF439275_1  drought-induced protein RDI                 66.2    4e-09   
ref|XP_002979758.1|  hypothetical protein SELMODRAFT_177778           68.2    5e-09   
emb|CAN66796.1|  hypothetical protein VITISV_034154                   66.2    1e-08   
ref|XP_009517896.1|  hypothetical protein PHYSODRAFT_349569           68.2    1e-08   
ref|XP_003057911.1|  predicted protein                                67.8    2e-08   
ref|XP_009032349.1|  hypothetical protein AURANDRAFT_19015            64.3    2e-08   
gb|EJK62281.1|  hypothetical protein THAOC_17107                      66.6    4e-08   
ref|XP_002296137.1|  EF containing protein                            64.3    1e-07   
ref|XP_009032139.1|  hypothetical protein AURANDRAFT_8067             60.5    3e-07   
gb|AFW71107.1|  hypothetical protein ZEAMMB73_054247                  59.7    7e-07   
gb|EFA82832.1|  hypothetical protein PPL_04527                        62.4    1e-06   
gb|KEH38644.1|  calcium ion-binding protein, putative                 56.2    7e-06   
gb|KCW67440.1|  hypothetical protein EUGRSUZ_F011933                  55.5    1e-05   
gb|AFK39630.1|  unknown                                               55.5    1e-05   
ref|XP_009762341.1|  PREDICTED: uncharacterized protein LOC104214380  55.8    1e-05   
ref|XP_009033565.1|  hypothetical protein AURANDRAFT_8128             53.5    6e-05   
gb|EPS72526.1|  sodium/calcium exchanger protein                      53.1    7e-05   
ref|XP_001742689.1|  hypothetical protein                             53.1    8e-05   
gb|AFW71108.1|  hypothetical protein ZEAMMB73_635590                  52.8    1e-04   
ref|XP_002781327.1|  conserved hypothetical protein                   49.7    8e-04   
gb|ETO25801.1|  hypothetical protein RFI_11337                        52.0    0.001   



>ref|XP_002272134.1| PREDICTED: uncharacterized protein LOC100243523 [Vitis vinifera]
 emb|CBI30651.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   300 bits (768),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 190/515 (37%), Positives = 300/515 (58%), Gaps = 20/515 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF IV++++L+S+ EQ VS+ S   F   GTGIFGA++F IL
Sbjct  53    TCEPTYGFLPCTTVVWGELFLIVVYEFLLSLGEQYVSAGSDLFFQIFGTGIFGASLFHIL  112

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P + M + +G+  S + A++     + + AG+ +  LTV+WG CV  G  D +    
Sbjct  113   GSIPEVAMILVTGLSGSTDTAESMATMSMAMLAGSAVMQLTVIWGSCVFFGNYDISDSST  172

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S  + + + F      +L   G+ TD +T +TA +M+LS++PF++++L  +++S+SG R
Sbjct  173   SSALENNKKPF------SLTGYGVRTDDATRYTARIMILSMIPFLILQLAKLINSSSGIR  226

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
             +V+L++L++T+ FL  Y  YQ+  P IQ+R L Y        +   +LLT  G+P+ SRI
Sbjct  227   VVILISLLVTLVFLFLYCFYQVFQPWIQERRLAYVLRNFVKNNLVASLLTAAGEPDESRI  286

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNSRITEQEF  827
             R  FH  D + +  +S  EL  FL  I  +E  ++    V+ +M+D D  GN++I E EF
Sbjct  287   REVFHEIDQNKDASISDAELRAFLLGIKLEEAGLRNEDFVEKVMEDFDASGNAQIDETEF  346

Query  826   LNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DFI  650
               GI   L   +  DN              Q  S E+ +  A + +Q       +W ++ 
Sbjct  347   HRGISKWLYEANHPDNNQYDERPKLFSRSAQ--SEEQQSLLAKKAKQQSQTAQNSWFNYF  404

Query  649   VTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPAS  470
                  +I+G A+++  AQPL+  + +FS AV +P+FIIS+V++P+ ++ R  + AI  A 
Sbjct  405   KAAFLLIIGTAVMSLLAQPLIQTINEFSSAVNIPSFIISYVIIPVAMSYRETLGAIKSAR  464

Query  469   QKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLA  290
              K+ +A SLTFSEIYN V M+N+ GL   L +VY R+L+WD SAE+LVV +I   +G L 
Sbjct  465   LKTKQAISLTFSEIYNAVFMNNMMGLAMFLLLVYIRDLSWDVSAEILVVLIICTLMGLLT  524

Query  289   YFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
                T + +WT+I A+ +YP SL L YVL ++LGW+
Sbjct  525   SCSTKFPIWTAIIAYLMYPISLGLLYVLTEVLGWS  559



>ref|XP_010279178.1| PREDICTED: uncharacterized protein LOC104613162 [Nelumbo nucifera]
Length=577

 Score =   291 bits (746),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 190/525 (36%), Positives = 294/525 (56%), Gaps = 30/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C++ YGF PC   + G LF I+++ YLM +A   +S  S+ +   LG G+ G     IL
Sbjct  61    SCENTYGFLPCTTTVVGNLFLIIVYGYLMFLAASYLSDGSELLLAILGPGLIGGLFLPIL  120

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D   +E 
Sbjct  121   GALPDAMLILVSGLSGSKETAQSQVLVGMGLLAGSTVMLLTLLWGSCVVVGKCD--IEES  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+        +L   GISTD  TS+ A +M++S++PF++V+L  ++ S+SG+ 
Sbjct  179   IAVDSQDTKRL------SLVGSGISTDIWTSYAARIMVISVIPFIIVQLPQILHSSSGRH  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+A I++VA L++Y  YQ+  P IQ+R L Y++ ++                LL  +
Sbjct  233   LAVLIAFIVSVALLISYCLYQVFQPWIQQRRLEYAKHKHVISGILKYLKKHSLGKLLKDD  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+PN   I+  F   D+D +  +S  EL   +  I  +E+   R  A + +MKD D+  +
Sbjct  293   GEPNEDIIKRLFKQIDADKDGHLSIPELRALIIGIELEEIDLNRDDAAEKLMKDFDQSND  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDD---QEKSGEETNgaageveqag  680
             + + E+EF+ GI+  L     + +    + + T    D   ++   E         +   
Sbjct  353   NLLNEEEFVEGIKKWLYEAKRSTDYVPFSGSHTLRYIDGFHKQARQEHILLGDASDDVIE  412

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
             G +   W  I  VL ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+  N  
Sbjct  413   GVENPKWTSIKAVLMLLLGTAIAAAFADPLVDAVQNFSSATSIPSFFISFIALPLATNSS  472

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
              A++A+  AS+K  K ASLTFSEIY   TM+N+  L   LA+VY R LTWD+SAEVLV+ 
Sbjct  473   EAVSALIFASRKKKKTASLTFSEIYGAATMNNILCLSVFLALVYVRHLTWDFSAEVLVIL  532

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             ++ + +G  A F+TT+ LWT   AF LYPFSL L YVL  + GW+
Sbjct  533   IVCIVMGLFASFRTTFPLWTCSVAFVLYPFSLVLVYVLDYVFGWS  577



>ref|XP_008225191.1| PREDICTED: uncharacterized protein LOC103324855 [Prunus mume]
Length=563

 Score =   289 bits (739),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 187/516 (36%), Positives = 293/516 (57%), Gaps = 22/516 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA ++ G LF I++++ L+S+A+Q VS+ S+  F+  GTGIFGA+ F +L
Sbjct  57    TCEPVYGFLPCATSVWGLLFLIIVYEVLLSLADQYVSAGSELFFELFGTGIFGASAFHVL  116

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
              + P++ + + +G+  S E A+      + + AG+ I  LT++WG  V  G  D +  + 
Sbjct  117   GMIPQVGLVLVTGVTGSTETAEVMAEMSMGLLAGSAIMLLTLVWGSVVAFGSHDLSVSQT  176

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S ++        N +  L+  G++TD  T  TA +M++SL+PF+++++  ++SS+SG R
Sbjct  177   SSNTE--------NNMHALSGYGVTTDVETKATARIMMVSLIPFLVLQVAKMLSSSSGIR  228

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSL--------HYSRFENLLTQNGKPNVSRI  1001
             +V+LV+L+I  AFL+ Y  YQI+ P IQKR L        H +  ++LLT  G PNVS I
Sbjct  229   VVILVSLLIAFAFLVIYCIYQIMQPWIQKRRLDFVMRKYAHKNLLQSLLTVGGNPNVSII  288

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV---QRMVAVKTMMKDLDRDGNSRITEQE  830
             +  FH  D +NN  +SS EL   +  I  +EV       A K +M++ D  G+S+I E E
Sbjct  289   QGLFHRLDQNNNTYISSHELRALILGIQIEEVGLDDDDYAAK-VMEEFDISGDSQIVETE  347

Query  829   FLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DF  653
             F+NGI   +     + N  +         + + +  +E        ++       +W + 
Sbjct  348   FVNGISKWINPAKPSANGNSHEHKWFFRRNPKNEKTKEDQKMPVAKKKKAKGADKSWTNL  407

Query  652   IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPA  473
             +     +ILG  I    A PLM  + +FS A  +P+F+ S++++P   N R+A+ ++  A
Sbjct  408   VKAAYLLILGTGITVLLAVPLMETMQEFSTAASIPSFLTSYILIPWSTNYRLALRSVTSA  467

Query  472   SQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFL  293
              +K+  A SLT SEIYNGV M+N TGL+  LA+VY R L+W+ SAE LVV +I   +G  
Sbjct  468   REKTDNAISLTLSEIYNGVFMNNTTGLIIFLALVYIRNLSWEVSAECLVVLIICTVMGLS  527

Query  292   AYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
               F   +  WTSI A+ LYP SL L YVL    GW+
Sbjct  528   TSFSRKFPFWTSIIAYILYPVSLLLVYVLTTFFGWS  563



>ref|XP_010279180.1| PREDICTED: uncharacterized protein LOC104613163 [Nelumbo nucifera]
Length=565

 Score =   289 bits (739),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 196/537 (36%), Positives = 302/537 (56%), Gaps = 23/537 (4%)
 Frame = -1

Query  1765  NQSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVS  1586
             + + D S FLAL   RLSS    TC+  YGF PC  NI G LF IV+++YL+ + E  +S
Sbjct  39    DHASDGSPFLAL--KRLSSPV--TCEPEYGFLPCTTNIWGQLFIIVVYEYLLFLGENYIS  94

Query  1585  SSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATI  1406
             + ++ IF  LG GIFGA+ F IL   P  ++ + +G+  S E AQ Q   G+ + AG+T+
Sbjct  95    AGTELIFKLLGPGIFGASAFHILGSLPEAVLVLVAGVSGSIEIAQEQAVIGMALLAGSTV  154

Query  1405  FNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLM  1226
               LT+LWG  V VG+ D +   K +    + +S        L   G+ TD  T++TA +M
Sbjct  155   MLLTILWGSIVAVGKYDLSNDSKPTDISVTRRSH-------LTGFGVVTDLETNYTAKIM  207

Query  1225  LLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY---  1055
             LLSLVPF++V+L  +++  SG+RI ++++L++++  L++Y  YQ+  P IQ R L Y   
Sbjct  208   LLSLVPFIIVQLPKLLNMPSGERIAIIISLVVSLTLLVSYCFYQVFQPWIQNRRLEYLWH  267

Query  1054  -----SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA  890
                  +  + LLT +GKPN++ I+  F   D + +  +S  EL   +  I  +E+  +  
Sbjct  268   KYAQDNLLQKLLTNDGKPNMTVIKELFQKIDQNGDAYISPAELRALILGIQFEEIGLIKD  327

Query  889   VKTM--MKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEE  716
               T+  MK+ D  G++ I E EF+ GI   L  +       +    +      Q+ S EE
Sbjct  328   GFTVQVMKEFDTSGDAHIDEAEFVRGISKWLQESQQTTENQSHHRRNLSRKPSQKSSEEE  387

Query  715   TNgaageveqaggEKMGT-WDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFI  539
                     +++      + W +      ++LG  IL   ++PL+     FS A  +P+F 
Sbjct  388   QEKLVNRQDKSIAVDDKSLWSYAKAAFLLLLGTTILAVLSEPLLDAAQSFSTAANIPSFF  447

Query  538   ISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARE  359
             ISFV LP+ +N R A++AI  A QK  ++ASLTFSEIY+ V M+N+ G+   L +VY R 
Sbjct  448   ISFVFLPLAVNYREAVSAITAARQKKQRSASLTFSEIYSAVFMNNIVGISIFLVLVYIRG  507

Query  358   LTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGW  191
             L WD+SAEVLVV ++ + +G ++ F   + LWTSI A+ LYPFSL L ++L    GW
Sbjct  508   LAWDFSAEVLVVLIVCIVMGLVSGFCNVFPLWTSIVAYLLYPFSLLLVFILIYFFGW  564



>ref|XP_010276580.1| PREDICTED: uncharacterized protein LOC104611295 [Nelumbo nucifera]
Length=577

 Score =   289 bits (739),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 189/524 (36%), Positives = 290/524 (55%), Gaps = 27/524 (5%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G +F I+ + YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  60    TCEQTYGFLPCTTTVVGNIFLIIAYGYLMFLAATNLSNGSELLLEILGPGIIGGLFLPIL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
               FP  ++ + SG+  S + AQ+Q+  G+ + +G+T+  LT+LWG CV+VG+ D      
Sbjct  120   GSFPDAMLILVSGLSGSSQTAQSQILVGMGLLSGSTVLLLTLLWGSCVVVGKCDL-----  174

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             D  +    Q      +  L   G+STD  TS+ A +M +S++PF++V+L   + S+SG  
Sbjct  175   DGSTAVDLQDTEGLTIAALTGSGVSTDIWTSYAARIMCVSVIPFIIVQLPQFLQSSSGSH  234

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + +L+ALI ++A L++Y  YQ+  P IQ+R L Y++ +                 LL  +
Sbjct  235   LAILIALISSIALLISYCLYQVFQPWIQRRRLAYAKHKRVVSGILGNLKMRALGRLLKDD  294

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P++  IR  F   D + + ++S  EL+  +  I  DEV   +   V+ M+KD D   +
Sbjct  295   GQPDIDVIRKVFRQLDENLDNRLSVPELKALIMGIQFDEVDLDQDGFVEEMLKDFDTSHD  354

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaageveqagg  677
             S I E EF+ GI   L     +  +   + + +    N+ + K+ +E        E   G
Sbjct  355   SYIEESEFIEGISKWLNVAKHSVASHHNSTSDSVRFINELRNKAKKEEYLLGCSDETTEG  414

Query  676   EKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRM  497
              K   WD +  VL ++LG  I    A PL+  V  FS A  +P F +SF+VLP+  +   
Sbjct  415   VKNPKWDSVKAVLMLLLGTGIAAAFADPLVDAVDNFSNATSIPAFFVSFIVLPLATSSE-  473

Query  496   AIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFV  317
             A++A+  AS+K  K ASLTFS IY  VTMSN+  L   LAVVY R LTWD+S+EV ++F+
Sbjct  474   AVSALIFASRKKQKTASLTFSMIYGSVTMSNILSLAVFLAVVYIRNLTWDFSSEVFIIFI  533

Query  316   ISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             I   +G  A F+TT+ LWT + A+ LYP SL L YVL  +LGW+
Sbjct  534   ICTIMGLFASFRTTFPLWTCLVAYLLYPLSLVLVYVLDYVLGWS  577



>ref|XP_010915578.1| PREDICTED: uncharacterized protein LOC105040648 [Elaeis guineensis]
Length=590

 Score =   289 bits (739),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 196/522 (38%), Positives = 285/522 (55%), Gaps = 28/522 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G LF  + + +LM  A   +S+ S+ + + LG GI G     IL 
Sbjct  77    CEQTYGFLPCTTTVVGNLFLALAYGFLMFKAATYLSTGSEMLLEILGPGIVGGLFLPILG  136

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQNQV  G+ + AG+T+  LT+LWG CV+VG+ D +     
Sbjct  137   ALPDAMLILVSGLSGSKETAQNQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTS  196

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               SQ  T+SF      +L   G+STD  TS+ A +M +S+VPF++V+L  +    SGQR+
Sbjct  197   IDSQ-DTKSF------SLFGSGVSTDLQTSYAARIMAISIVPFIIVQLPKIFKFPSGQRL  249

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL AL+ +VA +L+Y  YQI  P IQ+R L Y++ ++                LL  NG
Sbjct  250   AVLFALVASVALVLSYCLYQIFQPWIQRRRLAYAKHKHVISGILRHAQMQSLGRLLDDNG  309

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
               N   IR  FH  D +++ ++SS EL   +  I  +E+   R  AV  +M + D   N+
Sbjct  310   NANEGVIRKLFHRLDLNSDGKISSHELRALIIGIQFEEIDLDRDDAVNKVMLEFDTSRNA  369

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqagg-EK  671
              I E EF+ GI+  L         + A       +D   K+ EE N    + ++      
Sbjct  370   CIEEDEFVGGIKQWLNEAKRTVVTSGAYSKKFL-HDFHMKTKEEHNMLIDKSDEVVENIN  428

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
               TW     VL ++LG  I    A PL+  V  FS A  +P+F ISF+ +P+  N   A+
Sbjct  429   NPTWICFKAVLLLLLGTVIAAVFADPLVDAVDNFSLATNIPSFFISFIAMPLATNSSEAV  488

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  + +SLTFSEIY GVTM+N   L   LA+VY R LTWD+SAEVL++ V+ 
Sbjct  489   SAIIFASRKKQRTSSLTFSEIYGGVTMNNTLCLAVFLALVYLRHLTWDFSAEVLIILVVC  548

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G    F+TT+ LWT   A+ LYP SL L YVL  + GW+
Sbjct  549   IVMGLFTSFRTTFPLWTCSIAYLLYPLSLVLVYVLDFVFGWS  590



>ref|XP_007214217.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
 gb|EMJ15416.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
Length=535

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 186/516 (36%), Positives = 294/516 (57%), Gaps = 21/516 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA ++ G LF I++++ L+S+A+Q VS+ S   F+  GTGIFGA+ F +L
Sbjct  28    TCEPIYGFLPCATSVWGLLFLIIVYEVLLSLADQYVSAGSDLFFELFGTGIFGASAFHML  87

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
              + P++ + + +G+  S E A+      + + AG+ I  LT++WG  V  G  D +  + 
Sbjct  88    GMIPQVGLVLVTGVTGSTETAEAMAEMSMGLLAGSAIMLLTLVWGSVVAFGSHDLSVSQT  147

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S ++ + +SF      +L   G++TD  T  TA +M+ SL+PF+++++  ++SS+SG R
Sbjct  148   SSNTE-NKKSF------SLTGYGVTTDVETKATARIMMFSLIPFLVLQVAKMLSSSSGIR  200

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
             +V+LV+L+I  AFL+ Y  YQI+ P IQKR L +        +  ++LLT  G PNVS I
Sbjct  201   VVILVSLLIAFAFLVIYCIYQIMQPWIQKRRLDFVMRKYVQKNLLQSLLTVGGNPNVSII  260

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV---QRMVAVKTMMKDLDRDGNSRITEQE  830
             +  FH  D +NN  +SS EL   +  I  +EV       A K +M++ D  G+S+I E E
Sbjct  261   QGLFHKLDQNNNTYISSHELRALILGIQIEEVGLDDDDYAAK-VMEEFDIPGDSQIVETE  319

Query  829   FLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DF  653
             F+NGI   +     + N ++         + +++  +E        ++       +W + 
Sbjct  320   FVNGISKWINPAKPSANGSSHEHKWFFRRNPKDEKTKEDQKRLVAKKKKAKGADKSWTNL  379

Query  652   IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPA  473
             +     +ILG  I    A PLM  + +FS A  +P+F+ S++++P   N R+A+ ++  A
Sbjct  380   VKAAYLLILGTGITVLLAVPLMQTMKEFSTAASIPSFLTSYILIPWATNYRLALRSVTSA  439

Query  472   SQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFL  293
              +K+  A SLT SEIYNGV M+N+ GL   LA+VY R L+W+ SAE LVV +I   +G  
Sbjct  440   REKTDNAISLTLSEIYNGVFMNNIMGLTIFLALVYIRNLSWEVSAESLVVLIICTAMGLS  499

Query  292   AYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
               F   +  WTSI A+ LYP SL L YVL    GW+
Sbjct  500   TSFSRKFPFWTSIIAYILYPVSLLLVYVLTTFFGWS  535



>ref|XP_009340381.1| PREDICTED: uncharacterized protein LOC103932481 [Pyrus x bretschneideri]
Length=585

 Score =   285 bits (729),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 192/527 (36%), Positives = 294/527 (56%), Gaps = 32/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  YGF PC   + G LF I+++ YLM +A   +S  S+ + + LG GI G     IL
Sbjct  67    TCDQTYGFLPCTTTVIGNLFLILVYGYLMYLAATYLSHGSELLLEILGPGIIGGLFLPIL  126

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  ++V+WG CV VG+ D   +E 
Sbjct  127   GALPDAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLISVIWGSCVFVGKCD--IEES  184

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      ++   G+STD  T++ A +M++S++PF++V+L  ++ S S +R
Sbjct  185   VAIDNRDTKGF------SITGSGVSTDIWTTYAAMIMIVSVIPFLIVQLPQLLDSTSARR  238

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL++LI++VA LL+Y  YQ+  P IQ+R + Y++ ++                LL   
Sbjct  239   LAVLISLIVSVALLLSYCLYQVFQPWIQRRKIAYAKHKHVISGVLQHLKKHALGKLLNDE  298

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   I+  F   D+D N+ +S+ EL+  +  I  DE+Q     AV  +M D D   +
Sbjct  299   GEPDEETIKTLFDTIDADKNEFLSASELKALIVGIRFDEIQFDNNDAVAKLMSDFDTSHD  358

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEET---Ngaageveq  686
             S+I+  EF  GI   L       + +  +   T +   D  +++ EE           E 
Sbjct  359   SQISFTEFYAGISKWLNEAKRHGDTSTDSGNHTMKFLTDFHKQTKEEHALLGANGQSDEV  418

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
               G +   W  I   L +++G  I    A PL+  V  FS A  +PTF ISF+ LP+  N
Sbjct  419   VEGVESVKWTSIKAGLMLLVGTLIAAAFADPLVDAVDDFSDATSIPTFFISFIALPLATN  478

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+K  + ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+SAEVLV
Sbjct  479   SSEAVSAIIFASRKKMRTASLTFSELYGAVTMNNLLCLAVFLALVYIRGLTWDFSAEVLV  538

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++ + +G L  F+T + LWTS  AF LYPFSLAL YVL  ++GW+
Sbjct  539   ILIVCIVMGLLGSFRTVFPLWTSSIAFLLYPFSLALVYVLDYVVGWS  585



>ref|XP_007025465.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY28087.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=574

 Score =   284 bits (726),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 190/548 (35%), Positives = 304/548 (55%), Gaps = 29/548 (5%)
 Frame = -1

Query  1765  NQSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVS  1586
             +  +DQ+S  ++    L  +++ TC+  YGF PC   + G LF +V+++YL+S++E+ +S
Sbjct  34    SDGMDQTSKSSVLELDLPITTTVTCEPIYGFLPCTTTLWGQLFLLVVYEYLLSLSEEFIS  93

Query  1585  SSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATI  1406
             S S   F   GTGIFGA++F IL + P++++ + SG   S E  + +   G+ + AG+ +
Sbjct  94    SGSNLFFQMFGTGIFGASLFHILGIIPQVMLVLVSGASASGETIEARATIGMGLLAGSAV  153

Query  1405  FNLTVLWGLCVIVGRRDRATQEKDSQSQP--STQSFASNWLK----TLNECGISTDASTS  1244
               LT++WG  +  G  D +     + S P  +  S +SN       +L   G+ TD  T 
Sbjct  154   LMLTLVWGSVIAFGSYDLSDTSSPNSSNPDNADTSISSNSKNKKPFSLTGYGVRTDIETR  213

Query  1243  FTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRS  1064
             ++A +M+LS+VPF++++L  ++SSA+  R+VVL++LI+T+A L  Y  YQ+ +P IQ R 
Sbjct  214   YSAIIMILSMVPFLILQLAKILSSATAVRVVVLISLIVTLALLGGYCTYQVFEPWIQDRR  273

Query  1063  LHY--------SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE  908
             L Y        +    L++ NG+ N   I+  F   D +NN ++S  EL  F+  I  +E
Sbjct  274   LEYLMRRYIQKNLLHRLVSGNGRANEFEIKKLFLKIDKNNNSRISPAELRAFILGIQIEE  333

Query  907   V---QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDD  737
             V   +     K +M++ D  G+S I E EF+ G+ N L   +              + +D
Sbjct  334   VGLDEEDFETK-VMEEFDFSGDSDINETEFVRGVSNWLNKVNDQAQGERRLFHVNAKKND  392

Query  736   QEKSGEETNgaageveqaggEKMGT----WDFIVTVLQVILGVAILTFCAQPLMTNVIQF  569
             +EK            ++    + GT    W++      + LG AI    A PLM  + +F
Sbjct  393   EEKRS------LLPAKKRSKARKGTDNPWWNYTKAFFLITLGTAITVLLANPLMITLQEF  446

Query  568   SGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLL  389
             S +  +P+F++S+VV+P  ++ R+A  AI  A QK+  AASLTFSE+Y  V M+N+ GL+
Sbjct  447   STSANIPSFLVSYVVIPWALSFRLAFRAISSARQKTENAASLTFSELYGAVFMNNVMGLV  506

Query  388   SLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
               L++VY R + W  SAEVLVV +I   +G  A F T  +LWT I  + LYP SL L YV
Sbjct  507   IFLSLVYIRNIPWGVSAEVLVVLLICTAMGLFATFSTKIELWTCILVYLLYPISLLLIYV  566

Query  208   L-QLLGWN  188
             L  +LGW+
Sbjct  567   LTNVLGWS  574



>ref|XP_006451747.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 ref|XP_006494847.1| PREDICTED: uncharacterized protein LOC102612450 [Citrus sinensis]
 gb|ESR64987.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 gb|KDO58493.1| hypothetical protein CISIN_1g048038mg [Citrus sinensis]
Length=591

 Score =   283 bits (725),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 191/527 (36%), Positives = 296/527 (56%), Gaps = 30/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF I+++ YLM VA   +S+ S+ + + LG G+ G     IL
Sbjct  71    TCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPIL  130

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  ++E AQ+QV  G+ + AG+T+   TV+WG CV+VG+ D    + 
Sbjct  131   GALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDS  190

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +    +T+ F       L   G+STD  T + A +M +S++PFV+V+L  +++S SG+ 
Sbjct  191   VAIDGQNTKGF------RLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRH  244

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI++V+ L++Y  YQ+  P IQKR L +++ ++                LLT +
Sbjct  245   LAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDS  304

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G+PN+  I+  F   D + ++++S+ EL+  +  I  +E+   +  AV  ++ D D   +
Sbjct  305   GEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSND  364

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE-NDDQEKSGEETNgaageveqaggE  674
             S I  +EF+NGIE  L     A   +A     T +  DD     +  +   G  E++   
Sbjct  365   SHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLGAEEESDEV  424

Query  673   KMGT----WDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
               G     W     VL +++G  I    A PL+  V  FS A  +P+F ISF+ LP   N
Sbjct  425   AEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATN  484

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+K  + ASLTFSE+Y  VTM+N+  L   LA+VYAR LTWD+S+EVLV
Sbjct  485   SSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLV  544

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++ L +G  A F+T + LWT   A+ LYPFSLAL YVL    GW+
Sbjct  545   ILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS  591



>ref|XP_008383659.1| PREDICTED: uncharacterized protein LOC103446347 [Malus domestica]
Length=563

 Score =   282 bits (722),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 182/516 (35%), Positives = 286/516 (55%), Gaps = 20/516 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA ++ G+LF I++++ L+S+A+  VS  S+  F+  GTGIFGA+ F +L
Sbjct  55    TCESIYGFLPCATSVWGFLFLIIVYEVLLSLADHYVSRGSEIFFELFGTGIFGASAFHLL  114

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
              + P++ + + +GI  + E A+      + + AG+TI  LT++WG  V  G  D      
Sbjct  115   GLIPQVGVVLVTGITATTETAEEMAKMNMSMLAGSTIMILTLIWGSVVAFGSSDL-----  169

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S SQ S+ S   N   +L   G+ TD  T  TA +M+LSL+P+++++L  +++S +  R
Sbjct  170   -SDSQTSSNSENKNPF-SLTGSGVRTDVETQDTARIMMLSLIPYLVLQLAKILTSTTAVR  227

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-------SRFENLLTQNGKPNVSRIR  998
             +V+L++L+I  A L  Y  YQ   P IQ R L Y           +LLT +G  N S I+
Sbjct  228   VVILISLLIASAILATYIIYQFFQPWIQSRRLEYLMRKYIPKILPSLLTVDGNANESSIK  287

Query  997   LFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEFL  824
               FH  D ++N  +S+ EL   +  I  +E+        + +MK  D  G+++I E EF+
Sbjct  288   ELFHRIDKNHNTYISADELRALILGIQIEEIGLDDDDYAEEVMKQFDLSGDAQIAETEFV  347

Query  823   NGIENLLannssad--naaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DF  653
             NGI   +  + +                +   E S E+        ++       +W + 
Sbjct  348   NGISKWINPDKTPANGKGNEHRSLFRRNHSKNETSMEDQQTPLISKKKKTRGADTSWMNL  407

Query  652   IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPA  473
             +     +ILG AI  F + PLM ++ +FS A  +P+F  S+VV+P+  N R+A+ ++  A
Sbjct  408   LKAAFLIILGTAITVFLSMPLMVSLQEFSTAASIPSFTTSYVVIPLATNYRLALMSVSSA  467

Query  472   SQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFL  293
              +K+  A SLT SEIYN   M+N+ GL+  LA+VY R L+WD +AEVLVV +IS+ +G  
Sbjct  468   KEKTENAISLTLSEIYNAAFMNNIVGLIIFLALVYIRNLSWDVAAEVLVVLIISIAVGLS  527

Query  292   AYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             A F   +  WTSI A+ LYP SL L YVL + +GW+
Sbjct  528   ASFSRKFPFWTSILAYILYPISLLLVYVLTIVIGWS  563



>ref|XP_007149412.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
 gb|ESW21406.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
Length=576

 Score =   282 bits (722),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 197/528 (37%), Positives = 295/528 (56%), Gaps = 34/528 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G LF I+I+ +LM  A   +S  S+ + + LG GI G     IL
Sbjct  58    SCEQTYGFLPCTTTVLGNLFLILIYGFLMFKAATFLSGGSELLLEILGPGIVGGLFLPIL  117

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
                P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   +  
Sbjct  118   GALPDAMLILVSGLSGSKETAQSQVSVGMGLLAGSTVLLLTIIWGTCVIVGKCDIEDSIA  177

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
              DSQ    T+ F      +L   G+STD  TS++A +M++S++PFV+V+L  +++S SG+
Sbjct  178   IDSQD---TRGF------SLTGSGVSTDIWTSYSARIMVISVLPFVIVQLPQILNSTSGR  228

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQ  1028
              + VL+ALI+++  L+AY  YQI  P IQ+R L Y + ++                LL  
Sbjct  229   HLAVLIALIVSLGLLVAYCLYQIFQPWIQRRKLEYIKHKHVILGFLTHLKKRALGRLLND  288

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDG  854
             NG+P+   IR  F   D + +  ++  EL   +  I  +E+      AV  +M D D  G
Sbjct  289   NGEPDKEVIRKLFTTIDENQDGSLTHNELRALVIGIQFEEIDLDHDDAVTRIMNDFDTSG  348

Query  853   NSRITEQEFLNGIENLLannssadnaaaatptstPE-----NDDQEKSGEETNgaageve  689
             N+ + E+EF+NG+   L     A  A+      T +     + + ++  +  +      E
Sbjct  349   NALVDEEEFVNGVCRWLQRAQRARVASGDAGPHTMKFLSDFHTETKREHDLLDVGDQSNE  408

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
             +  G +   W  I  VL ++LG  I    A PL+  V  FS A  +P F ISF+ LP+  
Sbjct  409   EVEGIENSKWISIKAVLFLLLGSIIAAAFADPLVDAVDNFSEATSIPAFFISFIFLPLAT  468

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N   A++AI  AS+   + ASLTFSEIY  VTM+N+  L   LA+VYAR LTWD+S+EVL
Sbjct  469   NSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVL  528

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             V+ V+ + +G  A F+T + LWTSI A  LYPFSLAL YVL  + GW+
Sbjct  529   VILVVCILLGVFASFRTVFPLWTSILAILLYPFSLALVYVLDYVFGWS  576



>ref|XP_009352959.1| PREDICTED: uncharacterized protein LOC103944258 [Pyrus x bretschneideri]
Length=564

 Score =   281 bits (720),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 179/517 (35%), Positives = 286/517 (55%), Gaps = 21/517 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA ++ G LF +++++ L+S+A+  VS  S   F+  GTG+FGA+ F +L
Sbjct  55    TCEPTYGFLPCATSVWGLLFLVIVYEVLLSLADHYVSRGSGIFFELFGTGVFGASAFHML  114

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
              + P++ M +  G+  + E A+      + + AG++I  LT++WG  V  G  D +  + 
Sbjct  115   SLIPQVGMVLVIGVTATTETAEEMAEMSMSMLAGSSIMILTIIWGSVVAFGSSDLSDSQT  174

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S  + + + F      +L + G+ TD     TA +M+LSL+P+++++L  +++S +  R
Sbjct  175   SSNPE-NKKPF------SLTDSGVRTDIEARDTARIMMLSLIPYLILQLAKILTSTTAVR  227

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
             +V+L++L+   AFL  YF YQ   P IQ R L Y        S   +L+   G PNVS I
Sbjct  228   VVILISLLTASAFLATYFIYQFFQPWIQSRRLEYLMRKYIPKSILASLMRVGGNPNVSSI  287

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEF  827
             +  FH  D +NN  +S  EL+  +  I  +++       V  +MK  D  G+++I E EF
Sbjct  288   KGLFHRIDKNNNAYISEDELKALILGIQINDIGLDDDDYVAEVMKQFDLSGDAQIDETEF  347

Query  826   LNGIENL--LannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-D  656
             +NGI     LA   +              N   EKS E+        ++       +W +
Sbjct  348   VNGISKWINLAKPPANGKGHEHRSLFRRNNSKNEKSIEDQLTPLISKKKETKGATTSWMN  407

Query  655   FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFP  476
              +     +ILG A+  F + PLM ++ +FS A  +P+F +S+VV+P+  N R+A+ ++  
Sbjct  408   LLKAAFLIILGTAMTVFLSTPLMESLQKFSTAASIPSFAVSYVVIPLATNYRLALMSVTS  467

Query  475   ASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGF  296
             A +K+  A SLT SEIYN   M+N+ GL+  LA+VY R L+WD +A+VLVV +IS  +G 
Sbjct  468   AKEKTENAISLTLSEIYNATFMNNIVGLVIFLALVYIRNLSWDVAADVLVVLLISTAVGL  527

Query  295   LAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
              A F   +  WTSI A+ LYP SL L YVL  ++GW+
Sbjct  528   SACFSRKFPFWTSILAYILYPLSLLLVYVLTTVIGWS  564



>gb|KDP36271.1| hypothetical protein JCGZ_09836 [Jatropha curcas]
Length=585

 Score =   281 bits (719),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 191/532 (36%), Positives = 291/532 (55%), Gaps = 33/532 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC     G LF I+++ YLM ++   +S+ S+ +   LG GI G     +L
Sbjct  58    SCEQTYGFLPCTTTAFGNLFLIIVYGYLMYLSATYLSAGSELLLAILGPGIVGGLFLPML  117

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SGI  S+E AQ+QV  G+ + AG+T+  +TV+WG CVIVG+ D     +
Sbjct  118   GALPDAMLILVSGISGSKETAQSQVSVGMGLLAGSTVMLITVIWGSCVIVGKCDI----R  173

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +S+  P T S  +    +L   G+STD  T + A +M +S++PF++V+L  +++S SG+ 
Sbjct  174   ESEIGPVTISGQNTKGFSLIGSGVSTDIWTCYAARIMAISVIPFIIVQLPQILNSTSGRH  233

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI ++  L++Y  YQ++ P IQ+R L +   ++                LLT +
Sbjct  234   LAVLIALIFSLLMLISYCIYQVVQPWIQQRRLAFVMHKHVISGILKHLRERSLGRLLTDD  293

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+PN+  I+  F   D + +  +S  EL+  +  I  +E+   +  AV  +MKD D   +
Sbjct  294   GQPNIDVIKRLFEAIDENKDGNLSRSELKALILGIRFEEIDFDKDNAVDKVMKDFDTSRD  353

Query  850   SRITEQEFLNGIENLLannssadnaaa----------atptstPENDDQEKSGEETNgaa  701
             + I   EF  GI   +     +   ++                 + +  +   EE     
Sbjct  354   NAIDVGEFCRGISKWIEEAKQSGAVSSDFGSRTSKFLHNFHLQTKREHAQLGAEEQGEDQ  413

Query  700   geveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
              + E   G +   W  I  VL ++LG  I    A PL+  V  FS A  +PTF ISF+ L
Sbjct  414   SDDEVVEGIENARWISIKAVLMLLLGAVIAAAFADPLVDAVDNFSDATSIPTFFISFIAL  473

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P   N   A++AI  AS+KS + ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S
Sbjct  474   PFATNSSEAVSAIIFASRKSKRTASLTFSELYGAVTMNNLLCLSVFLALVYLRGLTWDFS  533

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             AEVLV+ ++ + +G  A F TT++LWT   AF LYPFSLAL YVL  +LGW+
Sbjct  534   AEVLVILIVCIVMGAFASFSTTFRLWTCSVAFLLYPFSLALVYVLDYILGWS  585



>ref|XP_004951320.1| PREDICTED: uncharacterized protein LOC101782315 [Setaria italica]
Length=572

 Score =   280 bits (717),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 182/521 (35%), Positives = 278/521 (53%), Gaps = 26/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G LF ++ + +LM  A   +S+ S+ + + LG GI G     IL 
Sbjct  59    CEMTYGFLPCTDTALGNLFLVLAYGFLMFKAATYLSAGSELLLEILGPGIVGGLFLPILG  118

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D       
Sbjct  119   ALPDAMLILVSGLSGSKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLWENSTA  178

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + SQ  T+ F      +L   G+STD  TS+ A +M +S++PF++V++  +    SG R+
Sbjct  179   TDSQ-DTKRF------SLFGSGVSTDVQTSYAARIMAMSVLPFIIVQIPKIFKLHSGHRL  231

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQNG  1022
              VL+ LI+ V  +LAY  YQI  P IQ+R L Y+R                F  LL ++G
Sbjct  232   TVLLGLIVAVLLVLAYCLYQIFQPWIQRRRLEYARLKHVMSGLLRHAQMHVFGRLLDEDG  291

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PNV  I   FH  D DN+ ++   EL+ F+  +  +++     +A + +M D D   N 
Sbjct  292   RPNVPVIEKLFHKIDQDNDGKLERGELQAFIIGVKFEDIDLDSSLAAEQVMADFDTSQNY  351

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
              I + EF++GI   L     +  ++ A      ++       E       + E     + 
Sbjct  352   AIEKAEFVDGILRWLKEAKRSVASSGAYSKKFLQDFHTRTRDEHNLLLGKDDEDGEAIEY  411

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
              TW     +  ++LG A+    A PL+  V  FS A  +P+F +SF+ +P   N   A++
Sbjct  412   PTWTCFKAISLLLLGTAMAAAFADPLVDAVHNFSNATSIPSFFVSFIAMPFATNSSEAVS  471

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA+VY R LTWD+SAEVLV+F++  
Sbjct  472   AIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAVFLALVYVRGLTWDFSAEVLVIFLVCT  531

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              +G    F+T + LWT   A+ LYP SL + YVL    GW+
Sbjct  532   IMGLFTSFRTNFPLWTCFVAYLLYPLSLIIVYVLDFKFGWS  572



>ref|XP_010098421.1| hypothetical protein L484_012136 [Morus notabilis]
 gb|EXB75012.1| hypothetical protein L484_012136 [Morus notabilis]
Length=578

 Score =   280 bits (716),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 194/545 (36%), Positives = 301/545 (55%), Gaps = 33/545 (6%)
 Frame = -1

Query  1750  QSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKK  1571
             Q SFL L        + STC+ +YGF PC     G LF I+++ YLM  A   +S+ S+ 
Sbjct  43    QPSFLRLNAALSDFGAESTCEQSYGFLPCTTTALGNLFLILVYGYLMFTAATYLSNGSEL  102

Query  1570  IFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTV  1391
             + + LG GI G     +L   P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LTV
Sbjct  103   LLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSAETAQSQVSVGMGLLAGSTVLLLTV  162

Query  1390  LWGLCVIVGRRD-RATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSl  1214
             +WG C+IVG+ D   +  +D +    T+ F      +L   G+STD  TS+ A +M +S+
Sbjct  163   IWGTCIIVGKCDIEGSVARDGKD---TKGF------SLIGSGVSTDIWTSYAARIMAISV  213

Query  1213  vpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--  1040
             +PF++V+L  +++S SG+ + VL+ALI++V  L++Y  YQ+  P IQ+R L Y++ ++  
Sbjct  214   LPFLIVQLPQLLNSTSGRHLAVLIALIVSVLLLISYCLYQVFQPWIQRRRLDYAKHKHVI  273

Query  1039  --------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ  902
                           LL ++ +PN+  I   F   D +++  +S+ EL   +  I  DE+ 
Sbjct  274   SGILQHLHMHGLGKLLNEDEEPNIRVIEKLFEKIDENHDGHLSASELRALIIGIRFDEID  333

Query  901   --RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstP-ENDDQE  731
               +  AV+ +M+D D   +S+I   EF+ GI   L     A N+      +     D   
Sbjct  334   LDKDDAVEKLMRDFDTTSDSQIDGPEFVAGITKWLNEAKRAGNSYNGHGGTMKFLGDFHA  393

Query  730   KSGEETNgaageveqaggEK---MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGA  560
             ++ +E +      +     +      W  +   L +++G AI    A PL+  V  FS A
Sbjct  394   RTKQEHDLLGAGDQSEEATEGVANAKWTSLKAALMLLVGAAIAAAFADPLVDAVDNFSSA  453

Query  559   VGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLL  380
               +PTF ISF+ LP+  N   A++AI  A++K  + +SLTFSEIY  VTM+N+  L   L
Sbjct  454   TSIPTFFISFIALPLATNSSEAVSAIIFATRKKKRTSSLTFSEIYGAVTMNNVLCLSVFL  513

Query  379   AVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-  203
             A+VYAR LTWD+S+EVLV+ ++ + +G    F+TT+ LWTS  AF LYPFSLAL YVL  
Sbjct  514   ALVYARGLTWDFSSEVLVILIVCIVMGLFGSFRTTFPLWTSSVAFLLYPFSLALVYVLDY  573

Query  202   LLGWN  188
               GW+
Sbjct  574   FFGWS  578



>ref|XP_011082732.1| PREDICTED: uncharacterized protein LOC105165426 [Sesamum indicum]
Length=567

 Score =   279 bits (713),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 186/527 (35%), Positives = 292/527 (55%), Gaps = 39/527 (7%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC     G LF I+++ YLM +A   +S+ S+ + + LG GI G     +L
Sbjct  56    TCEQTYGFMPCTSTALGNLFLILVYGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPML  115

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ-E  1340
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LTV+WG CV+VG+ D      
Sbjct  116   GALPDAMLILVSGLSGSVETAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIVNHVA  175

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
              DSQ    T+ F      +L   GISTD  TS+   +M +S++PF++V+L  ++ S SG+
Sbjct  176   VDSQD---TKGF------SLTGSGISTDIWTSYAGIIMAISVLPFIIVQLPQILHSNSGR  226

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL----------------TQ  1028
              + VL+ LI++ + L++Y  YQ+  P +Q+R L Y++ ++++                T+
Sbjct  227   HLSVLIGLIVSASLLVSYCLYQVFQPWVQRRRLAYAKHKHVISGILKHLKMRALGRLSTE  286

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDG  854
             +G+PN   +   F   D + +  +S  EL   +  I  +E+   R  AV+ +MKD D   
Sbjct  287   DGRPNEEVLEKLFKAIDENEDGHLSHSELRALILGIQFNEINLDREDAVEKVMKDFDISL  346

Query  853   NSRITEQEFLNGIENLLannssadnaaaatpt----stPENDDQEKSGEETNgaageveq  686
             +SR+  +EF++G+   L    +  N A +             D +  G++++        
Sbjct  347   DSRVDLREFIHGVGRWLQEARAVSNYAGSMKYIDDFHMQTKRDHDLLGDQSDEIVEGF--  404

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 +   W+ I  VL ++LG AI    A PL+  V  FS A  +PTF ISF+ LP+  N
Sbjct  405   ----ENPRWNSIKAVLLLLLGTAIAAAFADPLVDAVDNFSDATKIPTFFISFIALPLATN  460

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  A++K  ++ASLTFSE+Y  VTM+N   L   LA+VY R L WD+S+EVLV
Sbjct  461   SSEAVSAIIFATRKKLRSASLTFSELYGAVTMNNALCLSVFLALVYVRGLVWDFSSEVLV  520

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++ + +G  A  +TT+ LWT+  AF LYPFSLAL YVL  + GW+
Sbjct  521   ILIVCIVMGVFASIRTTFPLWTAFLAFLLYPFSLALVYVLDYVFGWS  567



>ref|XP_008367781.1| PREDICTED: uncharacterized protein LOC103431400 [Malus domestica]
Length=609

 Score =   280 bits (715),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 189/521 (36%), Positives = 293/521 (56%), Gaps = 29/521 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +++ G LF I+++ YLM +A   +S+ S+ + + LG GI G     +L 
Sbjct  99    CEETYGFLPCTDSVLGNLFLILVYGYLMYLAATYLSNGSELLLEILGPGIVGGLFLPVLG  158

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEK  1337
               P  I+ + SG+  S+E AQ+QV  G+ + AG+T+  LT++WG CV+VG+ D R +   
Sbjct  159   SLPDAILILVSGLSGSKETAQSQVSVGMGLLAGSTVLILTLIWGSCVVVGKCDIRNSVAI  218

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             D++    T+ F      +L   G+STD  TS+ A +M +S++PF++V+L  V++S SG +
Sbjct  219   DNK---DTKGF------SLTGSGVSTDIWTSYAARIMTISILPFIIVQLPAVLNSKSGSQ  269

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS---------------RFENLLTQNG  1022
             I VLVAL+I+VA  ++Y  YQ+  P IQ+R + Y+               RF +LLT +G
Sbjct  270   IAVLVALVISVALFISYCLYQVFQPWIQRRRIAYAKHKHVISGILQHLKMRFGSLLTDDG  329

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PN   I   F+  D + +  +S  EL   +  +  DE++  +  AV+ +M D D   +S
Sbjct  330   EPNEENIIKLFYAMDQNGDGHISGNELRAMIVGLKFDEIELDKNDAVEKVMNDFDTSHDS  389

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
             +I + EFL GI   +     + +           +   +   E         E   G + 
Sbjct  390   QIDQNEFLFGISKWIHEAKRSGDDNDHRTMKFLFDFHSKTKQEHDLLGGQSDEIIEGVEN  449

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
               W     VL +++G  I    A PL+  V  FS A G+PTF ISF+ LP+  +   A++
Sbjct  450   PKWTSFKAVLMLLIGTLIAAAAADPLIDVVDNFSTATGIPTFFISFIALPLATSCE-AVS  508

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  + ASLTFS++Y   TM+N+  L   LA+VY RELTWD+SAEVL++ ++ +
Sbjct  509   AIMFASRKKIRTASLTFSQLYGSATMNNVMCLSVFLALVYFRELTWDFSAEVLIILIVCI  568

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              +G    F+T + LWTS  AF LYPFS+AL YVL  + GW+
Sbjct  569   VMGVFCSFRTVFPLWTSSIAFLLYPFSIALIYVLDYIXGWS  609



>ref|XP_007021648.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOY13173.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=578

 Score =   278 bits (712),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 188/527 (36%), Positives = 292/527 (55%), Gaps = 32/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC     G LF I+++  LM +A   +S+ S+ +   LG GI G     IL
Sbjct  60    SCEQTYGFLPCTTTALGNLFLIIVYGCLMFLAATYLSNGSELLLQILGPGIVGGLFLPIL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG CV+VGR D   ++ 
Sbjct  120   GALPDAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCD--LRDS  177

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L E G+STD  T + A +M +S++PF++V+L  ++SS SG+ 
Sbjct  178   VAVDGTITKGF------SLTETGVSTDIWTCYAARIMAISVIPFIIVQLPQILSSTSGRH  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI++++ L++Y  YQ+  P IQ+R L +++ ++                LL  N
Sbjct  232   LAVLIALIVSLSMLVSYCLYQVFQPWIQRRRLAFAKHKHVISGILRHLKKTALGKLLDDN  291

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G PN   IR  F   D +++  +S+ EL+ F+  I  +E+   R  AV+ +M D D   +
Sbjct  292   GDPNTEIIRKLFDTIDENHDGSLSNSELKAFIIGIRFEEIDLDRDDAVRKVMADFDTSHD  351

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQ-----EKSGEETNgaageveq  686
             S + E EF+ GI+  +            +   T +  D      ++  +         E 
Sbjct  352   SLVQEGEFVRGIQKWIIEAKRTGGTYLESNNGTFKFIDHFHQQTKREHDLLGLEEQSDEV  411

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
             A G +   W  +  VL ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N
Sbjct  412   AEGVENPGWTSLKAVLMLLLGTLIAAAFADPLVDAVDNFSDATSIPSFFISFIALPLATN  471

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+K  + ASLTFSE+Y  VTM+N+  L   LA+VY R LTWD+S+EVLV
Sbjct  472   SSEAVSAIIFASRKKKRTASLTFSELYGAVTMNNVLCLSVFLALVYVRGLTWDFSSEVLV  531

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++ + +G  A F+TT+ LWT   A+ LYPFSLAL YVL  + GW+
Sbjct  532   ILIVCIVMGAFASFRTTFPLWTCSVAYLLYPFSLALVYVLDYVFGWS  578



>emb|CAN78275.1| hypothetical protein VITISV_037788 [Vitis vinifera]
Length=529

 Score =   276 bits (707),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 182/515 (35%), Positives = 287/515 (56%), Gaps = 50/515 (10%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF IV++++L+S+ EQ VS+ S   F   GTGIFGA++F IL
Sbjct  53    TCEPTYGFLPCTTVVWGELFLIVVYEFLLSLGEQYVSAGSDLFFQIFGTGIFGASLFHIL  112

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P + M + +G+  S + A++     + + AG+ +  LTV+WG               
Sbjct  113   GSIPEVAMILVTGLSGSTDTAESMATMSMAMLAGSAVMQLTVIWGX--------------  158

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
                                   G+ TD +T +TA +M+LS++PF++++L  +++S+SG R
Sbjct  159   ----------------------GVRTDDATRYTARIMILSMIPFLILQLAKLINSSSGIR  196

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
             +V+L++L++T+ FL  Y  YQ+  P IQ+R L Y        +   +LLT  G+P+ SRI
Sbjct  197   VVILISLLVTLVFLFJYCFYQVFQPWIQERRLAYVXRNFVKNNLVASLLTAAGEPDESRI  256

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNSRITEQEF  827
             R  FH  D + +  +S  EL   L  I  +E  ++    V+ +M+D D  GN++I E EF
Sbjct  257   REVFHEIDQNKDXSISXAELRAXLLGIKLEEAGLRNEDFVEKVMEDFDASGNAQIDETEF  316

Query  826   LNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DFI  650
               GI   L   +  DN              Q  S E+ +  A + +Q       +W ++ 
Sbjct  317   HRGISKWLXEANHPDNNQYDERPKLFSRSAQ--SEEQQSLLAKKAKQQSQTAQNSWFNYF  374

Query  649   VTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPAS  470
                  +I+G A+++  AQPL+  + +FS AV +P+FIIS+V++P+ ++ R  + AI  A 
Sbjct  375   KAAFLLIIGTAVMSLLAQPLIQTINEFSSAVNIPSFIISYVIIPVAMSYRETLGAIKSAR  434

Query  469   QKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLA  290
              K+ +A SLTFSEIYN V M+N+ GL   L +VY R+L+WD SAE+LVV +I   +G L 
Sbjct  435   XKTKQAISLTFSEIYNAVFMNNMMGLAMFLLLVYIRDLSWDVSAEILVVLIICTLMGLLT  494

Query  289   YFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
                T + +WT+I A+ +YP SL L YVL ++LGW+
Sbjct  495   SCSTKFPIWTAIIAYLMYPISLGLLYVLTEVLGWS  529



>gb|KHG29939.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   277 bits (708),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 191/527 (36%), Positives = 290/527 (55%), Gaps = 32/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G LF I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  60    SCEQTYGFLPCTTTVLGNLFLIIVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPIL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG CV+VGR D     +
Sbjct  120   GALPDAMLILVSGLSGTAETAQDQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDI----R  175

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             DS +   T +   +    L E G+STD  T + A +M +S++PFV+V+L  V++S SG+ 
Sbjct  176   DSVAVDGTITKGFH----LTETGVSTDIWTCYAASIMAISVIPFVIVQLPQVLNSTSGRH  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQN  1025
             + VL+ALII+V+ L++Y  YQ+  P IQ+R L + +                F  LLT++
Sbjct  232   LAVLIALIISVSMLVSYCVYQVFQPWIQRRRLAFVKHKHVISGILRHLKKQAFGKLLTED  291

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+PN   IR  F   D + + ++S  EL+  +  I  +E+   +  AV  +M D D   +
Sbjct  292   GEPNTEIIRKLFETIDENGDGRLSPSELKALIIGIRFEEIDFDKDDAVMKVMADFDTSLD  351

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQ-----EKSGEETNgaageveq  686
             S I ++EF+ GI   +        A       T +  DQ     ++            E 
Sbjct  352   SYIQKEEFVRGITKWINEAKQTGGAYLEPNAGTFKFIDQFHQQTKREHALLGSEEQSDEV  411

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 +   W     VL ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N
Sbjct  412   VEHVENPRWISFKAVLMLLLGTLIAAAFADPLVDAVDNFSTATSIPSFFISFIALPLATN  471

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  A++K  + ASLTFSE+Y  VTM+N+  L   LA+VY R LTWD+S+EVLV
Sbjct  472   SSEAVSAIIFATRKKQRTASLTFSELYGAVTMNNVLCLSVFLALVYVRGLTWDFSSEVLV  531

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++ + +G  A F+TT+ LWT   A+ LYPFSLAL YVL  + GW+
Sbjct  532   ILIVCIVMGAFASFRTTFPLWTCSIAYILYPFSLALVYVLDYVFGWS  578



>ref|XP_010101519.1| hypothetical protein L484_008850 [Morus notabilis]
 gb|EXB88531.1| hypothetical protein L484_008850 [Morus notabilis]
Length=536

 Score =   275 bits (704),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 188/503 (37%), Positives = 286/503 (57%), Gaps = 23/503 (5%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC   YGF PCA    G LF IV+++ L+S   Q +S+ S   F+T GTG+FGA++F++L
Sbjct  26    TCVPIYGFLPCATTFWGLLFMIVVYEVLLSYGGQYISAGSDLFFETFGTGLFGASIFQLL  85

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P++ + + +GI  S +    Q    + + AG TI +LT++WGL V++G  D +    
Sbjct  86    GTIPQVGIILVTGIIASPDSVDEQAEISMGLLAGKTIMSLTLIWGLVVVLGSHDLSLPAT  145

Query  1336  DSQS--QPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
              + S  +   + F      TL+  G++ D  TS TA +ML+SL+PF++++L  +++S SG
Sbjct  146   STSSDLEQDEKPF------TLSGYGVTFDVETSKTARIMLISLIPFLILQLAKIINSPSG  199

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVS  1007
               +VVLV+LI+T+  +LAYF YQI  P IQ R L +        +  +NLLT   +PN+ 
Sbjct  200   IHVVVLVSLIVTIGLVLAYFIYQIFQPWIQNRRLEFVLRKYIRRNLLQNLLTAGRRPNIP  259

Query  1006  RIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNSRITEQ  833
              IR  FH  D + N  +S+ EL   +  I  +E  +++   V  +M+  D   + +I EQ
Sbjct  260   VIREIFHRIDQNGNSYISNSELRSLIVGIQIEESGLRQDDLVARVMEQFDTSQDHQINEQ  319

Query  832   EFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDF  653
             EF+ G+ N L    + D+ +         N  +  + E+ +  A  V        G  D+
Sbjct  320   EFVTGLSNWL--IVARDSISHPHHGIFRRNSAKTTTEEQQSLIAKNVATQSAANDGRKDW  377

Query  652   IVTV---LQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAI  482
             +  V   L +ILG AI     QPL+  ++QFS A  VP+F+IS+VV+P+ +N   A+ AI
Sbjct  378   LNYVKAGLLIILGTAITLTLGQPLVGTLVQFSFAANVPSFLISYVVIPLALNFGQAVRAI  437

Query  481   FPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTI  302
               A +K+ KA SL  SEIYN + M+NL GL+  LA+VY R ++WD SAEVLVV +I   +
Sbjct  438   SSAREKTEKAISLMLSEIYNRIFMNNLMGLVGFLALVYIRNVSWDVSAEVLVVLIICTLM  497

Query  301   GFLAYFKTTYQLWTSIFAFFLYP  233
             G    F T + +WTSI AF LYP
Sbjct  498   GLYTSFSTKFPVWTSIVAFLLYP  520



>gb|EEE56655.1| hypothetical protein OsJ_06069 [Oryza sativa Japonica Group]
Length=575

 Score =   276 bits (706),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 183/522 (35%), Positives = 283/522 (54%), Gaps = 29/522 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC     G LF ++ + +LM  +   +SS S+ +   LG GI G     IL 
Sbjct  63    CEMSYGFLPCTTTAWGNLFLVLAYGFLMFKSATYLSSGSEMLLQILGPGIVGGLFLPILG  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D +     
Sbjct  123   ALPDALLILVSGLSGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTA  182

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               S+  T+ F      +L   G+STD  TS+ A +M +S++PF++V++  +    SG +I
Sbjct  183   IDSR-DTKGF------SLLGSGVSTDKQTSYAARIMAISILPFIIVQIPKIFKLHSGHQI  235

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ LI+    LL+Y  YQ+  P IQ+R L Y+R ++                LL   G
Sbjct  236   TVLIGLIVAALLLLSYCLYQVFQPWIQRRRLEYTRLKHVMSGLLRHAQKHSIGRLLDDEG  295

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PNVS I   FH  D DN+ ++   EL+ F+  I  +++     +A   +M D D   N 
Sbjct  296   RPNVSVIEKLFHRIDQDNDGKLERGELQAFIVGINFEDIDWNSNLAADQVMADFDTSRNH  355

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKS-GEETNgaageveqaggEK  671
              I + EF+NG+   L        + A +      ND   ++  E+T     + E+   + 
Sbjct  356   FIEKGEFVNGMLRWLDEAKRTVTSGAYSKKFL--NDFHARTRDEQTGLLDKDEEEGEADG  413

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
               TW  I  +L ++LG A+    A PL+  V  FS A  +P+F ISF+V+P+  N   A+
Sbjct  414   NPTWTCIKAILLLLLGTAMAAASADPLVDAVHNFSNATHIPSFFISFIVMPLATNSSEAV  473

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA+VY R LTWD+S+EVL++ ++ 
Sbjct  474   SAIIFASRKKKRTLSLTFSEVYGGVTMNNTLCLAVFLALVYVRGLTWDFSSEVLIILLVC  533

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             + +G    F+T + LWT   AF LYP SL + Y+L    GW+
Sbjct  534   IIMGLFTSFRTDFPLWTCFVAFLLYPLSLIMVYILDYKFGWS  575



>ref|XP_011000241.1| PREDICTED: uncharacterized protein LOC105107868 [Populus euphratica]
Length=589

 Score =   276 bits (707),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 202/553 (37%), Positives = 302/553 (55%), Gaps = 36/553 (7%)
 Frame = -1

Query  1765  NQSVDQ--SSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQL  1592
             NQS++Q  SS   L    L SS+  TC+  YGF PC   + G LF I+++ YLM +A   
Sbjct  46    NQSLNQTTSSPFHLA---LKSSAEETCEQTYGFLPCTTTVIGNLFLILVYGYLMFLAATY  102

Query  1591  VSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGA  1412
             +SS S+ +   LG GI G     +L   P  ++ + SG+  S E AQ+QV  G+ + AG+
Sbjct  103   LSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSGLSGSTETAQSQVSVGMGLLAGS  162

Query  1411  TIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
             T+  LTV+WG CV+VG+ D    E  +  +  T+ F      +L   G++TD  T + A 
Sbjct  163   TVMLLTVIWGSCVVVGKCDMRETENSAIDRKDTKRF------SLTGSGVTTDIWTCYAAR  216

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +M +S+VPF++V+L+  + S SG+ + VL+ LI+++A L++Y  YQ+  P IQ+R L Y+
Sbjct  217   IMAISVVPFIVVQLLQTLHSTSGRHLAVLIGLILSLAILISYCLYQVFQPWIQERKLKYT  276

Query  1051  RFE----------------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI  920
             R +                 LLT +   + + ++  FH  D + +  +S+ EL+  +  I
Sbjct  277   RHKLVMSGILKHLKQRALGRLLTDDSSLDENVVKKLFHTIDENGDGYLSASELKALVIGI  336

Query  919   VTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPE  746
               +E+   +  AV  +MKD D   ++RI   EF NGI+  L     A   +      T +
Sbjct  337   RFEEIDFDKDDAVSKLMKDFDTSFDNRIDLGEFTNGIKKWLDEAIRAGGGSPDPGPRTHK  396

Query  745   NDD--QEKSGEETNgaageveqaggEKMGT----WDFIVTVLQVILGVAILTFCAQPLMT  584
               D   +K+ +          + G    G     W      L ++ G  I    A PL+ 
Sbjct  397   YLDAFHDKTKKAHALLRSPEPEEGQSDEGVKNPRWTSFKASLMLLAGAVIAAAFADPLVD  456

Query  583   NVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSN  404
              V  FS A  +PTF ISF+ LP+  N   A++AI  AS+K    ASLTFSE+Y  VTM+N
Sbjct  457   AVDNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTTASLTFSELYGAVTMNN  516

Query  403   LTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSL  224
             +  L   LA+VY RELTWD+SAEVLV+ ++ + +G  A F+TT+ LWTS  A+FLYPFSL
Sbjct  517   VLCLSVFLALVYFRELTWDFSAEVLVICIVCIVMGAFASFRTTFPLWTSFLAYFLYPFSL  576

Query  223   ALFYVLQ-LLGWN  188
              L YVL  +LGW+
Sbjct  577   VLVYVLDYVLGWS  589



>ref|XP_009352820.1| PREDICTED: uncharacterized protein LOC103944133 [Pyrus x bretschneideri]
Length=567

 Score =   274 bits (701),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 184/539 (34%), Positives = 295/539 (55%), Gaps = 23/539 (4%)
 Frame = -1

Query  1765  NQSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVS  1586
             N    QSSF+ +   +   + S TC+ +YGF PCA ++ G LF I++++ L+S+A+  VS
Sbjct  39    NDETSQSSFVKVLNLK---ADSVTCEPSYGFLPCATSVWGLLFLIIVYEVLLSLADHYVS  95

Query  1585  SSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATI  1406
               S+  F+  GTGIFGA+ F +L + P++ + + + I  + E A+      + + AG+TI
Sbjct  96    RGSEIFFELFGTGIFGASAFHLLGLIPQVGVVLVTVITATTETAEEMAKMNMSMLAGSTI  155

Query  1405  FNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLM  1226
               LT++WG  V  G  D +  +  S+S+ + + F      +L   G+ TD  T  TA +M
Sbjct  156   MILTLIWGSVVAFGSSDLSDSQTSSKSE-NKKPF------SLTGSGVRTDVETQDTARIM  208

Query  1225  LLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF  1046
             +LSL+P+++++L  +++S +  R+V+L++L+I  A L  Y  YQ   P IQ R L Y   
Sbjct  209   MLSLIPYLVLQLAKILTSTTAVRVVILISLLIASAILATYIIYQFFQPWIQSRRLEYLMR  268

Query  1045  E-------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMV  893
             +        LLT +G  N S I+  FH  D ++N  +S+ EL   +  I  + +      
Sbjct  269   KYIPKILLGLLTVDGYANESSIKELFHRIDKNHNTNISADELRALILGIQIEAIGLDDDD  328

Query  892   AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssad--naaaatptstPENDDQEKSGE  719
               + +MK LD  G+++I E EF+NG+   +  + S                N   E   E
Sbjct  329   YAEEVMKQLDLSGDAQIAETEFVNGLSKWINPDKSPANGKDNEHRSLFRRNNSKNETPME  388

Query  718   ETNgaageveqaggEKMGTW-DFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTF  542
             +        ++       +W + +     +ILG AI  F + PLM ++ +FS A  +PTF
Sbjct  389   DQQTPLISKKKKTRGADTSWMNLLKAAFLIILGTAITAFLSMPLMVSLQEFSTAASIPTF  448

Query  541   IISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAR  362
               S+VV+P+  N R+A+ ++  A +K+  A SLT SEIYN   M+N+ GL+  LA+VY R
Sbjct  449   TTSYVVIPLATNYRVALMSVSSAKEKTENAISLTLSEIYNAAFMNNIVGLVIFLALVYIR  508

Query  361   ELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              L+W  +AEVLVV +IS+ +G  A F   + LWT I A+ LYP SL L YVL + +GW+
Sbjct  509   NLSWHVAAEVLVVLIISIAVGLSASFSRRFPLWTCILAYILYPISLLLVYVLTIVIGWS  567



>ref|XP_008386231.1| PREDICTED: uncharacterized protein LOC103448741 [Malus domestica]
Length=584

 Score =   274 bits (701),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 194/532 (36%), Positives = 291/532 (55%), Gaps = 42/532 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  YGF PC   + G LF I+++ YLM  A   +S+ S+ + + LG GI G     IL
Sbjct  66    TCDQTYGFLPCTTTVIGNLFLILVYGYLMYSAATYLSNGSELLLEILGPGIIGGLFLPIL  125

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RA  1349
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  ++V+WG CV VG+ D     A
Sbjct  126   GALPDAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLISVIWGSCVFVGKCDIEGSVA  185

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
                +D++    T S            G+STD  T++ A +M++S++PF++V+L  ++ S 
Sbjct  186   IDNRDTKGFSITGS------------GVSTDIWTTYAAMIMIVSVIPFLIVQLPQLLDST  233

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------L  1037
             S +R+ VL++LI++V  LL+Y  YQ+  P IQ+R + Y++ ++                L
Sbjct  234   SARRLAVLISLIVSVVLLLSYCIYQVFQPWIQRRKIAYAKHKHVISGVLQQLKKRALGKL  293

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLD  863
             L   G+P+   I+  F   D D N  +S+ EL+  +  I  DE+Q     AV  +M D D
Sbjct  294   LNDEGEPDEEIIKKLFDTIDVDRNGFLSASELKALIVGIKFDEIQFDNDDAVAKLMTDFD  353

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaageve  689
                +S+I+  EF  GI   L       + +  +   T +   D  E++ EE +   G   
Sbjct  354   TSCDSQISFTEFCAGISKWLNEAKRHGDTSTDSGNHTMKFLTDFHERTKEE-HALLGANG  412

Query  688   qaggEKMGTWDF----IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
             Q+     G  +     I   L ++ G  I    A PL+  V  FS A  +PTF ISF+ L
Sbjct  413   QSDEVDEGVENVKRTSIKAGLMLLGGTLIAAAFADPLVDAVDDFSDATSIPTFFISFIAL  472

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P+  N   A++AI  AS+K  + ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S
Sbjct  473   PLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLCLAVFLALVYVRGLTWDFS  532

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             AEVLV+ ++ + +G L  F+T + LWTS  AF LYPFSLAL YVL  +LGW+
Sbjct  533   AEVLVILIVCIVMGLLGSFRTVFPLWTSSIAFLLYPFSLALVYVLDYVLGWS  584



>ref|XP_008226455.1| PREDICTED: uncharacterized protein LOC103326029 [Prunus mume]
Length=592

 Score =   274 bits (701),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 191/527 (36%), Positives = 293/527 (56%), Gaps = 33/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C+  YGF PC  ++ G LF I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  75    ACEETYGFLPCTRSVLGNLFLILVYGYLMYLAATYLSNGSELLLEILGPGIVGGLFLPIL  134

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ + SG+  S E AQ+QV  G+ + AG+T+  LT++WG CV+VG+ D   Q  
Sbjct  135   GSLPDAILILVSGLSGSTETAQSQVSVGMGLLAGSTVLILTLIWGSCVVVGKCD--IQNS  192

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L   G+STD  TS+ A +M++S++PF++V+L  +++S  G+ 
Sbjct  193   VAIDNEDTKGF------SLTGSGVSTDIWTSYAARIMVISVIPFIIVQLPQLLNSNLGKD  246

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             I VLV+LI++VA  L+Y  YQ+  P IQ+R + Y++ ++                LL ++
Sbjct  247   IAVLVSLIVSVALFLSYCLYQVFQPWIQRRRIAYAKHKHVISGILQHLKTRALGSLLKRD  306

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+PN   I+  FH  D D +  +S  EL   +  I  DE+Q  R  AV  +MK+ D   +
Sbjct  307   GEPNEEIIKKLFHAMDQDGDGSISYSELRAMIVGIRFDEIQLDRDDAVDKVMKEFDTSCD  366

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaag---eveq  686
             SRI  QEFL GI   +     + + ++     T +   D   ++ +E +         E 
Sbjct  367   SRIDLQEFLTGISKWIHEAKRSGDDSSNNDPHTMKFLFDFHSRTKQEHDLLGAGGQSDEI  426

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 +   W     VL +++G  I    A PL+  V  FS A  +PTF ISFV LP+  +
Sbjct  427   IEAVESPKWTTFKAVLMLLVGTLIAAAFADPLIDVVDNFSNATSIPTFFISFVALPLATS  486

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+K  + ASLTFS++Y   TM+N+  L   LA+VY R L WD+SAEVLV
Sbjct  487   CE-AVSAIMFASRKKIRTASLTFSQLYGSATMNNVLCLSVFLALVYFRGLEWDFSAEVLV  545

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++ + +G  + F+T + LWTS  AF LYPFS+AL YVL  + GW+
Sbjct  546   ILIVCIVMGVFSSFRTVFPLWTSSIAFLLYPFSVALIYVLDYVYGWS  592



>ref|XP_002282948.1| PREDICTED: uncharacterized protein LOC100252144 [Vitis vinifera]
Length=579

 Score =   273 bits (699),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 194/526 (37%), Positives = 289/526 (55%), Gaps = 32/526 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   I G LF IV++ YLM +A   +SS S+ + + LG G+ G  +  IL
Sbjct  63    SCDQTYGFMPCTTTIVGNLFLIVVYGYLMFLAATYLSSGSELLLEILGPGLVGGLIVPIL  122

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ + SG+  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   Q+ 
Sbjct  123   GALPDAILILVSGLSGSTETAQSQVSVGMGLLAGSTVILLTIMWGSCVIVGKCD--LQDS  180

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              ++    T+ F      +L   G+STD  TS+ A +M++S++PF++V+L  V+ S S +R
Sbjct  181   VAKDLQDTKGF------SLTGSGVSTDIWTSYAAIIMVISVIPFIIVQLPQVLHSTSARR  234

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI+++  L+ Y  YQ+  P IQKR L Y++ ++                LLT+ 
Sbjct  235   LAVLIALIVSLILLITYCLYQVFQPWIQKRRLAYAKHKHVISGLLKHLRMHTLGKLLTEE  294

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G+PN   IR  FH  D +++  +S  EL   +  I  +E+   R  AV  +M D D   +
Sbjct  295   GEPNEEIIRKLFHSIDENHDGNLSKAELRPLIVGIQFEEIDLDRNEAVDKVMSDFDTSND  354

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSG--EETNgaa--geveqa  683
               + E EF+ GI   +      + +      ++    D    G   E N        E  
Sbjct  355   QFVDEGEFVKGISRWITEAKRYEGSGPDAGPNSSSILDAFHRGTKREHNRLEGYQSDEVV  414

Query  682   ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
                +   W     V+ ++LG  I    A PL+  V  FS A  +PTF ISF+ LP+  + 
Sbjct  415   EAVENPKWITFKAVMMLLLGTLIAAVFADPLVDAVDNFSDATSIPTFFISFIALPLATSS  474

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
               A++AI  AS+K  +  SLTFS +Y  VTM+N+  L   LA+VY R LTWD+S+EVLV+
Sbjct  475   E-AVSAIIFASRKKRRTTSLTFSVLYGAVTMNNVLCLSVFLALVYVRGLTWDFSSEVLVI  533

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              ++ + +G  A F+TT+ LWTS  A  LYPFSLAL YVL  +LGW+
Sbjct  534   LIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALVYVLDYVLGWS  579



>ref|XP_004294083.1| PREDICTED: uncharacterized protein LOC101314065 [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   273 bits (699),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 183/526 (35%), Positives = 294/526 (56%), Gaps = 34/526 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF ++++ YLM  A + +SS S+ + + LG GI G     +L
Sbjct  64    TCEETYGFMPCTTTVLGNLFLMLVYGYLMYSAAKWLSSGSEILLEILGPGIVGGLFLPVL  123

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  GI + AG+T+  L+++WG CV+VG+ D   ++ 
Sbjct  124   TSLPDAMLILVSGLSGSTETAQSQVSVGIGLLAGSTVLVLSLIWGSCVVVGKCD--IEDS  181

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              ++    T+ F           G+STD  TS++A +M +S++PF++V+L  +++S S +R
Sbjct  182   TAKDNKDTKGF------NFTGSGVSTDIWTSYSARIMAVSVIPFLIVQLPQLLNSTSARR  235

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             I VLVALI++V   ++Y  YQ+  P +QKR + Y++ ++                LL  +
Sbjct  236   IAVLVALIVSVTLFVSYCVYQVSQPWVQKRHIAYAKHKHVISGILQHLKMRALGWLLDDD  295

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+PN   I   FH  D D++  +S+ EL   +  +  D+++  +  AV+ +M++ D   +
Sbjct  296   GEPNKEVIDKLFHTIDQDHDGYLSATELRALIIGVRFDQIELNKDDAVEKLMQEFDTSRD  355

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEK  671
             SR+   EF NG+   L       N+++ +       D   ++ +E +  A   +     +
Sbjct  356   SRVDSHEFFNGVSKWLNVAKRVANSSSPSDRKFL-TDFHSRTKQEHDLLAASDQSEEAIE  414

Query  670   MGTWDFIVTVLQVI----LGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
              G  +  V  L+ I    +G  I    A+PL+  V  FS A  +P F +SF+VLP+    
Sbjct  415   -GRKNLKVAFLKAIGMLLVGTLIAAVVAEPLVDVVDNFSEATSIPNFFVSFIVLPL-FTA  472

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
                ++AI  AS+K  + ASLTFS++Y  VTM N+  L   LA+VY RELTWD+SAEVLV+
Sbjct  473   SEGVSAITFASRKKIRTASLTFSQLYGSVTMKNVLCLSVFLALVYFRELTWDFSAEVLVI  532

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              ++   +G  A  +TT+ LWTS  AF LYPFS+AL YVL  + GW+
Sbjct  533   LIVCTVMGVFASLRTTFPLWTSSIAFILYPFSVALIYVLDFVFGWS  578



>ref|XP_009405607.1| PREDICTED: uncharacterized protein LOC103988717 [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   273 bits (699),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 186/520 (36%), Positives = 281/520 (54%), Gaps = 25/520 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G +F ++ + +LM  A   +SS S+ + + +G GI G     IL 
Sbjct  81    CEQTYGFLPCTTTVVGNMFLVIAYGFLMYKAATYLSSGSELLLEIMGPGIVGGLFLPILG  140

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQNQV  G+ + AG+T+  LTVLWG C+IVG+ D +     
Sbjct  141   ALPDAMLILVSGLSGSRETAQNQVLIGMGLLAGSTVMLLTVLWGSCIIVGKCDLSDNSTS  200

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               SQ  T++F      +L   G+STD  TS+ A +M +S+VPF++V+L  + +  SGQ +
Sbjct  201   IDSQ-DTKAF------SLFGSGVSTDLQTSYAARIMAISIVPFIIVQLPRIFNFPSGQSL  253

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL---------------LTQNGK  1019
              VL++LI+ +  L++Y  YQ+  P IQ+R L Y++ +++               L  +GK
Sbjct  254   AVLLSLIVAIVLLVSYCLYQVFRPWIQRRRLAYAKHKHVISGILRHAQMQALGRLIDDGK  313

Query  1018  PNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSR  845
             PNV  ++  FH  D D+N  +S  EL   +  I  DE+      AV  +M + D   NS 
Sbjct  314   PNVDVMKKLFHKLDLDSNGSLSHAELRALIIGIQIDEIDLDTDDAVDKIMIEFDTSQNSS  373

Query  844   ITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMG  665
             I E EF+ G+   +     +   + A           +   E         E        
Sbjct  374   IEEDEFIVGLTKWIDEAKRSVANSGAYSKKFMHEFHMKTRDEHNMLLDQSDEVVENVDNP  433

Query  664   TWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAA  485
              W  I  +L ++LG  +    A PL+  V  FS A  +P+F ISF+ +P+  N   A+++
Sbjct  434   MWICIKAILLLLLGTVLAAIFADPLVDAVDNFSVATSIPSFFISFIAMPLATNSSEAVSS  493

Query  484   IFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLT  305
             I  A++K  + +SLTFSEIY GVTM+NL  L   LA+VY R LTWD+SAEVLV+ ++ + 
Sbjct  494   IIFATRKKQRTSSLTFSEIYGGVTMNNLLCLAVFLALVYMRHLTWDFSAEVLVILIVCVV  553

Query  304   IGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             +G    F+TT+ LWT   AF LYP SLAL YVL  + GW+
Sbjct  554   MGLFTSFRTTFPLWTCFVAFSLYPLSLALVYVLDFVFGWS  593



>ref|XP_008367769.1| PREDICTED: uncharacterized protein LOC103431392 [Malus domestica]
Length=586

 Score =   273 bits (698),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 195/531 (37%), Positives = 292/531 (55%), Gaps = 40/531 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  68    TCEQTYGFLPCTTTVIGNLFLILVYGYLMYLAATYLSNGSEMLLEILGPGIIGGLFLPIL  127

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RA  1349
                P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LTV+WG CVIVG+ D     A
Sbjct  128   GALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLLTVIWGSCVIVGKCDIEGSVA  187

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
                KD++    T S            G+STD  TS+ A +M++S++PF++V+L  +++S 
Sbjct  188   IDNKDTKGLSLTGS------------GVSTDIWTSYAATIMIVSVIPFLIVQLPQLLNST  235

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------L  1037
             SG+ + VL++LI++VA LL+Y  YQ+  P IQ+R + Y++ ++                L
Sbjct  236   SGRHLAVLISLIVSVALLLSYCLYQVFQPWIQRRKIAYAKHKHVISGLLQHLKKRALGKL  295

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLD  863
             L   G+P+   I   F   D DN+  +S+ EL   +  I  DE+Q     AV+ +M D D
Sbjct  296   LNDEGEPDADIIGKLFCTIDGDNDGFLSASELRALIVGIRFDEIQLDNNEAVEKVMSDFD  355

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEET---Ngaag  698
                +SRI++ EF  GI   L       +        T +   D  +++ EE         
Sbjct  356   TSHDSRISKPEFFIGISKWLNEAKRQGDINTDPSNRTMKILTDFHKRTKEEHALLRADDQ  415

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
               E   G +   W  I   L +++G  I    A PL+  V  FS A  +PTF ISF+ LP
Sbjct  416   SDEVVEGVENVKWTSIKAGLMLLVGTLIAAAFADPLVDAVDNFSDATSIPTFFISFIALP  475

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             +  N   A++AI  AS+K  + ASLTFSE+Y  VTM+NL  L   LA+VYAR LTWD+S+
Sbjct  476   LATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLCLAVFLALVYARGLTWDFSS  535

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             EVLV+ ++ + +G L   +T + LWT   A+ LYPFSLAL YVL  + GW+
Sbjct  536   EVLVILIVCVVMGLLGSLRTVFPLWTCSIAYLLYPFSLALVYVLDYVFGWS  586



>ref|XP_010675392.1| PREDICTED: uncharacterized protein LOC104891403 [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   272 bits (696),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 192/527 (36%), Positives = 283/527 (54%), Gaps = 37/527 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G +F I+++ YLM  A   +S  S+ + + LG GI G     IL 
Sbjct  58    CEQSYGFLPCTTTVLGNMFLILVYGYLMYTAATYLSYGSELLLEILGPGIIGGLFLPILG  117

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RAT  1346
               P  ++ + SG+  S   AQ QVF G+ + AG+T+  +TV+WG CV+VG+ D     A 
Sbjct  118   ALPDAMLIMVSGLSGSPAVAQQQVFVGMGLLAGSTVMLITVIWGTCVLVGKCDIEGSLAV  177

Query  1345  QEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
              E+D      T+ F       L + G+STD  TS+ A +M +S++PF++V+L    SS S
Sbjct  178   DERD------TKGF------NLRDSGVSTDIWTSYAARIMAISVLPFLVVQLPQAFSSNS  225

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLL  1034
             G+ + VL+ALII+V  L++Y  YQ+  P IQ R L Y +                F  L 
Sbjct  226   GRHLAVLIALIISVLMLISYCVYQVFQPWIQVRKLQYVKHRRVMTGFLKHLKKKSFGKLC  285

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDR  860
               +G  N + I   F   D DN+  +S  EL  F+  +  D   V     V+ +MK+ D 
Sbjct  286   NDDGGLNTAVIDKIFQAVDQDNDGYLSKGELTAFVVGMHIDGMSVAEDDVVQKLMKEFDT  345

Query  859   DG-NSRITEQEFLNGIENLLanns-sadnaaaatptstPENDDQEKSGEETNgaageveq  686
             +  + R+   EF  GI  LL+       +   A      ++ D+E   E         E 
Sbjct  346   ETLDGRLDRAEFSQGISKLLSLVRGDKVSHHNADTLKHIDSYDEEAKVEHRLLGDSGDEA  405

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 +      I  VL ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N
Sbjct  406   GEVIENPKATTIKAVLFLVLGTIIAAVFADPLVDAVNNFSDATSIPSFFISFIALPLATN  465

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  A++K +K+ASLTFSE+Y  VTM+N+  L   LA+VYAR L+WD+S+EVLV
Sbjct  466   SSEAVSAIIFATRKKTKSASLTFSELYGAVTMNNVLCLSVFLALVYARGLSWDFSSEVLV  525

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             +F++ + +G L  F+TT+ LWT+I AF LYP SL L YVL  + GW+
Sbjct  526   IFLVCVIMGALGSFRTTFPLWTTIVAFLLYPLSLVLVYVLDYIFGWS  572



>ref|XP_009348415.1| PREDICTED: uncharacterized protein LOC103940069 [Pyrus x bretschneideri]
 ref|XP_009348416.1| PREDICTED: uncharacterized protein LOC103940070 [Pyrus x bretschneideri]
Length=580

 Score =   271 bits (694),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 186/516 (36%), Positives = 285/516 (55%), Gaps = 27/516 (5%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC +++ G LF I+++ YLM +A   +S+ S+ + + LG GI G     +L   P 
Sbjct  74    YGFLPCTDSVLGNLFLILVYGYLMYLAATYLSNGSELLLEILGPGIVGGLFLPVLGSLPD  133

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQ  1322
              I+ + SG+  S+E AQ+QV  G+ + AG+T+  LT++WG CV+VG+ D   Q   +   
Sbjct  134   AILILVSGLSGSKETAQSQVSVGMGLLAGSTVLILTLIWGSCVVVGKCD--IQNSVAIDN  191

Query  1321  PSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlv  1142
               T+ F      +L   G+STD  TS+ A +M +S++PF++V+L  V+SS  G +I VLV
Sbjct  192   KDTKGF------SLTGSGVSTDIWTSYAARIMAISILPFIIVQLPAVLSSKYGSQIAVLV  245

Query  1141  aliitvafllAYFGYQIIDPTIQKRSLHYS---------------RFENLLTQNGKPNVS  1007
             AL+I+VA  ++Y  YQ+  P IQ+R + Y+               RF +LLT +G+PN  
Sbjct  246   ALVISVALFISYCLYQVSQPWIQRRRIAYAKHKHVISGILQHLKMRFGSLLTDDGEPNEE  305

Query  1006  RIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQ  833
              I   F+  D + +  +S  EL   +  +  DE++  +  AV+ +M D D   +S+I   
Sbjct  306   NIIKLFYAMDQNGDGHISRNELRAMIVGLKFDEIELDKNDAVEKVMNDFDTSHDSQIDRD  365

Query  832   EFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDF  653
             EFL GI   +     + +           +   +   E         E   G +   W  
Sbjct  366   EFLFGISKWIHEAKRSGDDNDHHTMKFLFDFHLKTKQEHDLLGGQSDEIIEGVENPKWTS  425

Query  652   IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPA  473
                VL +++G  I    A PL+  V  FS A G+PTF ISF+ LP+  +   A++AI  A
Sbjct  426   FKAVLMLLIGTLIAAAAADPLIDVVDNFSTATGIPTFFISFIALPLATSCE-AVSAIMFA  484

Query  472   SQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFL  293
             S+K  +  SLTFS++Y   TM+N+  L   LA+VY RELTWD+SAEVL++ ++ + +G  
Sbjct  485   SRKKIRTTSLTFSQLYGSATMNNVLCLSVFLALVYFRELTWDFSAEVLIILIVCIVMGVF  544

Query  292   AYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
               F+T + LWTS  AF LYPFS+AL YVL  + GW+
Sbjct  545   CSFRTVFPLWTSSIAFLLYPFSVALIYVLDYIFGWS  580



>gb|EPS64918.1| sodium/calcium exchanger family protein, partial [Genlisea aurea]
Length=519

 Score =   270 bits (689),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 190/530 (36%), Positives = 296/530 (56%), Gaps = 41/530 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC     G LF I+++ YLM  A + +SS S+ + + LG GI G     IL
Sbjct  4     SCEQTYGFLPCTSTALGNLFLILVYGYLMFSAARYLSSGSELLLEILGPGIVGGLFLPIL  63

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  GI + AG+T+  LTV+WG C++VG+ D   +  
Sbjct  64    GALPDAMLILVSGLSGSVETAQSQVSVGIGLLAGSTVMLLTVIWGSCILVGKCD--IENS  121

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F       L   G++TD  TS+   +M +S++PFV+V+L  +++  SG+ 
Sbjct  122   IAIDSKDTKGF------NLTGSGVTTDIWTSYAGIIMAVSVIPFVVVQLPQILNINSGRH  175

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QN  1025
             +VVL+ALI++V+ LL+Y  YQI  P +Q+R L Y++ +++++                ++
Sbjct  176   LVVLIALIVSVSLLLSYCLYQIFQPWVQRRRLAYAKHKHVISGILMNLKKRALGRLSNED  235

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G+PN+  ++  F   D ++N  +S  EL+  +  I  DE+      A++ +MKD D   +
Sbjct  236   GEPNIEVLKKLFDAIDGNDNGYLSRSELKALIVGIRFDEINLDEEDALEKVMKDFDVSLD  295

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDD--------QEKSGEETNgaage  695
             SRI   EF++G+   L        A AA   +    DD         +  G++++     
Sbjct  296   SRIDLNEFVSGVGKWLGEARGGTAAPAARTGTMKYLDDFHIQTRREHDLLGDQSDEVVEG  355

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
             VE          + I  VL ++LG AI    A PL+  V  FS A  +PTF ISFV LP+
Sbjct  356   VENPRS------NSIKAVLLLLLGTAIAAAFADPLVDAVDNFSAATSIPTFFISFVALPL  409

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
               N   A++A+  A++K  ++ASLTFSE+Y  VTM+N+  L   LA+VY R L WD+S+E
Sbjct  410   ATNSSEAVSAVIFATRKKLRSASLTFSELYGAVTMNNVLCLSVFLAIVYVRGLVWDFSSE  469

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             VLV+ ++ + +G  A  +TT+ LWTS+ AF LYP SLAL YVL    GW+
Sbjct  470   VLVILMVCVVMGVFASVRTTFPLWTSLLAFALYPVSLALVYVLDYQFGWS  519



>ref|XP_009380498.1| PREDICTED: uncharacterized protein LOC103968880 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   271 bits (694),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 189/522 (36%), Positives = 281/522 (54%), Gaps = 27/522 (5%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G LF ++++ +LM  A   +SS S+ +   LG GI G     IL
Sbjct  76    SCEPTYGFLPCTTTVVGNLFLVLVYGFLMFKAATYLSSGSELLLQILGPGIVGGLFLPIL  135

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D +    
Sbjct  136   GALPDAMLILVSGLSGSKETAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSDSST  195

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
                 Q  T+ F      +L   GISTD  TS+ A +M +S+VPF++V+L  +    SGQR
Sbjct  196   SVDLQ-DTRGF------SLFASGISTDVQTSYAARIMAISVVPFIIVQLPRIFKFPSGQR  248

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE----------------NLLTQN  1025
             + VLVALI+ +A LL+Y  YQ++ P IQ+R L +++                  +L+  N
Sbjct  249   LAVLVALIVAIALLLSYCLYQVLQPWIQRRRLEFAKHRLVMSGILKHVHTQSLGHLMDDN  308

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             GKPN   I+  FH  D D NQ +S  EL   +  +   E+   +  AV  +M + D   +
Sbjct  309   GKPNSHVIKKLFHKVDLDKNQSISRSELRALIIGLKMGEIDLDKDGAVDKVMNEFDTSRD  368

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEK  671
               I E+EF+ GI   +     +   + +          + ++ E         E A G +
Sbjct  369   DNIQEEEFIEGISKWIDEAYRSVAFSGSYSQKLHHFHVKARN-EHNMLHDQSEEAADGTE  427

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W     +L ++LG  I    A PL+  V  FS A  +P+F ISF+ +P+  N   A+
Sbjct  428   SPAWICFKAILLLVLGTFIAAVFADPLVDAVDNFSSATKIPSFFISFIAMPLATNSSEAV  487

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  + ASLTFSEIY G TM+N+  L   L++VY R LTWD+SAEVLV+ V+ 
Sbjct  488   SAIIFASRKKQRTASLTFSEIYGGATMNNVLCLAVFLSLVYVRHLTWDFSAEVLVILVVC  547

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G     +TT+ LWT   AF LYP SL L YVL  + GW+
Sbjct  548   IVMGIFTSLRTTFPLWTCFVAFLLYPLSLVLVYVLDFVFGWS  589



>ref|XP_008645573.1| PREDICTED: uncharacterized protein LOC103626994 [Zea mays]
Length=579

 Score =   271 bits (693),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 175/521 (34%), Positives = 275/521 (53%), Gaps = 26/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +  PG LF ++ +  LM  A   +S+ S+ + + LG G+ G     IL 
Sbjct  66    CEMTYGFLPCTDTAPGNLFLVLAYGLLMFKAATYLSAGSELLLEVLGPGVVGGLFLPILG  125

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D +     
Sbjct  126   ALPDAMLILVSGLAGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDMSENSTA  185

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + SQ  T+ F      +L   G+STD  TS+ A +M +S++PF++V++  +    SG R+
Sbjct  186   TDSQ-DTKGF------SLFGSGVSTDVQTSYAARIMAISVLPFIIVQIPQIFRLHSGHRL  238

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQNG  1022
              VL+ LI     +LAY  YQ+  P +Q+R L Y+                 F  LL ++G
Sbjct  239   TVLLGLIAAALLVLAYCLYQVFQPWVQRRRLEYAGLKHVMSGLLRHAQTHIFGRLLREDG  298

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
              PN+  I   F   D DN+ ++   EL+ F+  +  ++V     +AV  +M D D   NS
Sbjct  299   TPNIPVIEKLFCKIDLDNDGKLERGELQAFILGVKFEDVDLDSDLAVDQVMADFDTSHNS  358

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
              I + EF++GI   L     +   + +      ++       E +     + E     + 
Sbjct  359   VIEKGEFIDGILRWLEEAKRSVATSGSDSRKFLQDFHTRTRDERSQLLGKDDEDGEAIEN  418

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
              TW     +L ++LG A+    A PL+  V  FS A  +P+F ISF+ +P+  N   A++
Sbjct  419   PTWTSFKAILLLLLGTAMAAAFADPLVDAVHGFSNATSIPSFFISFIAMPLATNSSEAVS  478

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  +  SLTFSE+Y  VTM+N   L   L +VY R LTWD+S+EVL++F +  
Sbjct  479   AIIFASRKKQRTLSLTFSEVYGAVTMNNTLCLAVFLGLVYVRGLTWDFSSEVLIIFSVCT  538

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              +G    F+T + LWT + A+ LYP SL + YVL    GW+
Sbjct  539   IMGLFTSFRTDFPLWTCVVAYLLYPLSLVVVYVLDFKFGWS  579



>ref|XP_009352958.1| PREDICTED: uncharacterized protein LOC103944256 [Pyrus x bretschneideri]
Length=594

 Score =   271 bits (692),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 190/563 (34%), Positives = 295/563 (52%), Gaps = 42/563 (7%)
 Frame = -1

Query  1765  NQSVDQSSFL-ALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLV  1589
             N  + QSS L AL       + S TC+  +GF PCA ++ G LF +++++ L+S+A+Q V
Sbjct  35    NDEISQSSILDALN----LKADSVTCEPIFGFLPCATSVWGLLFLVIVYEVLLSLADQYV  90

Query  1588  SSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGAT  1409
             S  S+   +  GTG+FGA+ F +L + P++ M +  G+  + E  +      + + AG++
Sbjct  91    SRGSEIFLELFGTGVFGASAFHLLGLIPQVGMVLVIGVTAATETVEEMAEMSMSMLAGSS  150

Query  1408  IFNLTVLWGLCVIVGRRDRATQEKDSQ----------------------SQPSTQSFASN  1295
             I  LT++WG  V  G  D +  +  S                       S   T S   N
Sbjct  151   IMILTLIWGSVVAFGSSDLSDSQTLSNPENKKPFSLTGLLAVALGSSDLSDSQTSSNPEN  210

Query  1294  WLK-TLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvaf  1118
                 +L   G+ TD  T  TA +M+ SL+P+++++L  +++S +  R+V+L++L+I  AF
Sbjct  211   KKPFSLTGSGVRTDVETRDTARIMMFSLIPYLILQLAKILTSTTAVRVVILISLLIASAF  270

Query  1117  llAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQ  962
             L  YF YQ   P IQ R L Y        +   +L+T+ GKPNVS I+  FH  D ++N+
Sbjct  271   LATYFIYQFFQPWIQSRRLEYLLRKYIPKNILPSLMTEGGKPNVSIIKGLFHKIDKNHNK  330

Query  961   QMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannss  788
              +SS EL   +  I  +E+          +MK  D  G+++I E EF+NGI   +     
Sbjct  331   YISSDELRALILGIQIEEIGLDDDDYAAEVMKQFDLSGDAQIAEMEFVNGISKWINPAKP  390

Query  787   adnaaaatptst--PENDDQEKSGEETNgaageveqaggEKMGTW-DFIVTVLQVILGVA  617
               N       S     N   EKS E+        +        +W + +     +ILG  
Sbjct  391   PANDKVHEHRSLFRRNNSKNEKSMEDQLAPLISKKNVTKGADTSWMNLLKAAFLIILGTG  450

Query  616   ILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTF  437
             I  F + PLM ++ +FS A  +P+F  S+VV+P+  N R+A+ ++  A +K+  A SLT 
Sbjct  451   ITVFLSMPLMVSLREFSTAASIPSFAASYVVIPLATNYRLALMSVTSAKEKTEDAISLTL  510

Query  436   SEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTS  257
             SEIY    M+N+ GL+  LA+VY R L+WD +AEVLVV +IS  +GF A F   +  WTS
Sbjct  511   SEIYTAAFMNNIVGLVIFLALVYIRNLSWDVAAEVLVVLLISTAVGFSASFSRKFPFWTS  570

Query  256   IFAFFLYPFSLALFYVLQ-LLGW  191
             + A+ LYP SL L YVL  ++GW
Sbjct  571   VLAYILYPISLLLVYVLSTVIGW  593



>ref|XP_008226453.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
 ref|XP_008226454.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
Length=579

 Score =   270 bits (691),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 191/529 (36%), Positives = 294/529 (56%), Gaps = 38/529 (7%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  YGF PC   + G LF I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  63    TCDQTYGFLPCTTTVLGNLFLILVYGYLMYLAATYLSNGSEMLLEILGPGIIGGLFLPIL  122

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RA  1349
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG CV+VG+ D     A
Sbjct  123   GALPDAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLLTVIWGSCVLVGKCDIENSIA  182

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
                KD++    T S            G+STD  TS+ A +M +S++PF++V+L  +++S 
Sbjct  183   IDNKDTKGLSLTGS------------GVSTDIWTSYAARIMAISVIPFLIVQLPQLLNST  230

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--------------LLT  1031
             SG+ + VL++LI +V  L++Y  YQ+  P IQ+R + Y++ ++              LL 
Sbjct  231   SGRHLAVLISLIFSVVLLVSYCLYQVFQPWIQRRKIAYAKHKHVISGLLHHLTNQGRLLK  290

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRD  857
             ++G+P+   I+  F   D D++  +S  EL+  +  I  DE++  +  AV  +MKD D  
Sbjct  291   EDGEPDEEIIKKLFKTIDQDSDGYLSFSELKALIVGIRFDEIELDKNDAVDKVMKDFDTS  350

Query  856   GNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEET---Ngaagev  692
              +S+I+  EF+ G+   L     A NA +       +  +D   ++ EE           
Sbjct  351   HDSKISVDEFVVGVSKWLNQAKRAGNANSDPGHRKMKFLSDFHSRTKEEHALLGAGDQSD  410

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             E   G +   W  +   L +++G  I    A PL+  V  FS A  +PTF ISF+ LP+ 
Sbjct  411   EVVEGAEKPKWTSLKAGLMLLVGTLIAAAFADPLVDAVDNFSDATSIPTFFISFIALPLA  470

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N   +++AI  AS+K  + ASLTFSE+Y  VTM+N+  L   LA+VY R L+WD+SAEV
Sbjct  471   TNSSESVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYIRGLSWDFSAEV  530

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             LV+ ++ + +G L   +T Y LWT   AF LYPFSLAL YVL  +LGW+
Sbjct  531   LVILIVCVVMGILGSLRTNYPLWTCSIAFLLYPFSLALVYVLDYVLGWS  579



>ref|XP_009348414.1| PREDICTED: uncharacterized protein LOC103940068 [Pyrus x bretschneideri]
 ref|XP_009348417.1| PREDICTED: uncharacterized protein LOC103940071 [Pyrus x bretschneideri]
Length=549

 Score =   268 bits (686),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 193/531 (36%), Positives = 291/531 (55%), Gaps = 40/531 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  31    TCEQTYGFLPCTTTVIGNLFLILVYGYLMYLAATYLSNGSELLLEILGPGIIGGLFLPIL  90

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RA  1349
                P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LTV+WG CVIVG+ D     A
Sbjct  91    GALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLLTVIWGSCVIVGKCDIQGSVA  150

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
                KD++    T S            G+STD  TS+ A +M++S++PF++V+L  +++S 
Sbjct  151   MDNKDTKRLSLTGS------------GVSTDIWTSYAATIMIVSVIPFLIVQLPQLLNST  198

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------L  1037
             SG+ + VL++L+++VA LL+Y  YQ+  P IQ+R + Y++ ++                L
Sbjct  199   SGRHLAVLISLVVSVALLLSYCLYQVFQPWIQRRKIAYAKHKHVISGLLQHLKKRALGKL  258

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLD  863
             L   G+P+   I   F   D D +  +S+ EL   +  I  DE+Q     AV+ +M D D
Sbjct  259   LNDEGEPDADIIEKLFCTIDEDRDGFLSASELRALIVGIRFDEIQLDNNEAVEKVMIDFD  318

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEET---Ngaag  698
                +S I+  EF  GI   L       + +      T +   D  +++ EE         
Sbjct  319   TSRDSHISSDEFFIGISKWLNEAKRQGDISTDPSNRTMKFLTDFHKRTKEEHALLGADDQ  378

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
               E   G +   W  I   L +++G  I    A PL+  V  FS A  +PTF ISF+ LP
Sbjct  379   SDEVVEGVENVKWTSIKAGLMLLVGTLIAAAFADPLVDAVDNFSDATSIPTFFISFIALP  438

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             +  N   A++AI  AS+K  + ASLTFSE+Y  VTM+NL  L   LA+VYAR LTWD+S+
Sbjct  439   LATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLCLAVFLALVYARGLTWDFSS  498

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             EVLV+ ++ + +G L   +T + LWTS  A+ LYPFSLAL YVL  + GW+
Sbjct  499   EVLVILIVCVVMGLLGSLRTVFPLWTSSIAYLLYPFSLALVYVLDYVFGWS  549



>ref|XP_008783929.1| PREDICTED: uncharacterized protein LOC103703017 [Phoenix dactylifera]
Length=641

 Score =   270 bits (691),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 192/522 (37%), Positives = 283/522 (54%), Gaps = 27/522 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G LF  V + +LM      +S+ S+ + + LG GI G     IL 
Sbjct  127   CEQTYGFLPCTTTVVGNLFLAVAYGFLMFKGATYLSTGSELLLEILGPGIVGGLFLPILG  186

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQNQV  G+ + AG+T+  LT+LWG CV+VG+ D  ++   
Sbjct  187   ALPDAMLILVSGLSGSKETAQNQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCD-LSENST  245

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             S     T+ F      +L   GISTD  TS+ A +M +S+VPF++V+L  +    SGQR+
Sbjct  246   SIDLQDTKGF------SLFGSGISTDLQTSYAARIMAISIVPFIIVQLPKIFKFPSGQRL  299

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL ALI + A +L+Y  YQI  P IQ+R L Y++ ++                LL  NG
Sbjct  300   AVLFALIASAALVLSYCLYQIFQPWIQRRRLAYAKHKHVISGILRHAQMQSLGRLLDDNG  359

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
              P+   IR  FH  D +++  +SS+EL   +  I  +E+   R  AV+ +M + D   N+
Sbjct  360   NPDGDVIRKLFHRLDLNSDGIISSKELRALIIGIQFEEIDLDRDDAVEKVMLEFDTSHNA  419

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev-eqaggEK  671
              I E EF+ GI+  +          +   +    +D   K+ EE N    +  E      
Sbjct  420   FIEEDEFVEGIKKWINEAKRTIVTTSGAYSQRFLHDFHMKTKEEHNMLIDKSDEAVESID  479

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
               TW  +  VL ++LG  I    A PL+  V  FS A  +P+F ISF+ +P+  N   A+
Sbjct  480   NPTWTCLKAVLLLLLGTVIAAVFADPLVDAVDNFSLATNIPSFFISFIAMPLATNSSEAV  539

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  + +SLTFSEIY GVTM+N   L   LA+VY R LTWD+SAEVLV+ V+ 
Sbjct  540   SAIIFASRKKQRTSSLTFSEIYGGVTMNNTLCLAVFLALVYLRHLTWDFSAEVLVILVVC  599

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G    F+T + LWT   A+ LYP SL + Y+L  + GW+
Sbjct  600   IVMGLFTSFRTKFPLWTCFIAYLLYPLSLVIVYILDFVFGWS  641



>ref|XP_002525142.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF37269.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   268 bits (684),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 187/526 (36%), Positives = 287/526 (55%), Gaps = 33/526 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGFFPC   I G +F I+++ YLM ++ +L+S  S+ +   LG GI G     +L
Sbjct  28    SCDETYGFFPCTTTILGNIFLILVYGYLMFLSAKLLSDGSEILLQILGPGIIGGLFLPVL  87

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
                P   + ++SG+  S E AQ+QV  G+ + AG+T+  LT+LWG C+IVG+ D   +  
Sbjct  88    SALPDSAIILASGLSGSTETAQSQVSVGMGLMAGSTVLLLTLLWGSCLIVGKCDIEGSVA  147

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
              DS+    T++F      +L   G++TD  TSF A LM++S++PF+LV+L  V+   S  
Sbjct  148   VDSK---DTKTF------SLIGSGVTTDIWTSFAARLMVISIIPFILVQLPQVLHRTSQS  198

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQ  1028
             R+ +LV+LI+++  L+ Y  YQ++ P IQKR + Y++ +N                L T 
Sbjct  199   RLAILVSLIVSLILLVCYSLYQVVQPWIQKRRIAYAKHKNIISGILKDLKKRSLGRLFTV  258

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDG  854
             NG  N   I+  F   D +++  ++  EL+  +  I  DE  +   VAV  ++KD D  G
Sbjct  259   NGDLNRDIIQKLFKTIDDNSDGYLTIAELKALIIGIQFDELDIDVSVAVDQVLKDFDTSG  318

Query  853   NSRITEQEFLNGIENLLannssadnaaaatptstPE---NDDQEKSGEETNgaageveqa  683
             +S +   EF  GI   L     +          + +     DQ+ S EE        E +
Sbjct  319   DSCVDMDEFTRGISKWLREAKHSARYFDDHSRGSSQVLTGFDQQTSAEEDVLGDQTGEIS  378

Query  682   ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
                    W+    VL +ILG  +    A PL+  V  FS A  +PTF +SFV+LP   + 
Sbjct  379   SNPGNPKWNTTKAVLMLILGTIVAAVFADPLVDAVDNFSTASNIPTFFVSFVILPFASSS  438

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
              +    IF AS+K S+ ASL +SEIY  VTMSN+  L   L +VY R LTW++S+EVL++
Sbjct  439   EVVSDMIF-ASRKKSRYASLAYSEIYGSVTMSNVLSLSVFLGLVYFRGLTWNFSSEVLII  497

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              ++ + IG +A  +TT+ LW S+ A+ +YPFSL L Y+   +LGW+
Sbjct  498   LIVCIAIGLIASLRTTFPLWMSLVAYAMYPFSLLLAYIFNYVLGWS  543



>ref|XP_003543222.1| PREDICTED: uncharacterized protein LOC100809896 [Glycine max]
 gb|KHN36868.1| hypothetical protein glysoja_001599 [Glycine soja]
Length=579

 Score =   267 bits (683),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 194/527 (37%), Positives = 294/527 (56%), Gaps = 34/527 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G LF I+++ +LM  A   +S  S+ + + LG GI G     IL 
Sbjct  62    CEQTYGFLPCTTTVLGNLFLIIVYGFLMFKAATFLSGGSELLLEILGPGIVGGLFLPILG  121

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEK  1337
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T   LT++WG CVIVG+ D   +   
Sbjct  122   ALPDAMLILVSGLSGSKEVAQSQVSVGMGLLAGSTTLLLTIIWGTCVIVGKCDIEGSIAI  181

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             DS+    T+ F      +L   G+STD  TS+ A +M++S++PFV+V+L  +++S SG+ 
Sbjct  182   DSRD---TRGF------SLTGSGVSTDIWTSYAARIMVISVLPFVIVQLPQILNSTSGRH  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI+++  L+AY  YQI  P IQ+R L + + ++                LL +N
Sbjct  233   LAVLIALIVSLGLLIAYCLYQIFQPWIQRRKLEFIKHKHVILGLLTHLKKRALGRLLKEN  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   IR  F   D + +  ++  EL   +  I  +E+      AVK +M D D  GN
Sbjct  293   GEPDKEVIRKLFQTIDENQDDNLTHNELRALVIGIQFEEIDLDHDDAVKRIMDDFDTSGN  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE-----NDDQEKSGEETNgaageveq  686
              R+  +EF+NG+   L     A  A+      T +     + + ++  +  +      E+
Sbjct  353   ERVDREEFVNGVSRWLQRAQRARVASGDAGPHTMKFLSDFHTETKREHDLLDVGGQVNEE  412

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
             A G +   W  I  VL ++LG  I    A PL+  V  FS A  +P F ISF+ LP+  N
Sbjct  413   AEGIENAKWISIKAVLLLLLGTIIAAAFADPLVDAVDNFSEATSIPAFFISFIFLPLATN  472

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+   + ASLTFSE+Y  VTM+N+  L   LA+VYAR LTWD+S+EVLV
Sbjct  473   SSEAVSAIIFASRDKRQTASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLV  532

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + V+ + +G  A F+T + LWT+I A  LYPFSLAL YVL  + GW+
Sbjct  533   ILVVCIVVGVFASFRTVFPLWTAILAILLYPFSLALVYVLDYVFGWS  579



>ref|XP_004489056.1| PREDICTED: uncharacterized protein LOC101505490 [Cicer arietinum]
Length=583

 Score =   267 bits (683),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 189/528 (36%), Positives = 287/528 (54%), Gaps = 34/528 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   I G LF I+++ +LM  A   +S+ S+ + + LG GI G     +L
Sbjct  65    TCEETYGFLPCTTTILGNLFLILVYGFLMYTAATFLSNGSELLLEILGPGIVGGLFLPVL  124

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   +  
Sbjct  125   GALPDAMLILVSGLSGSTETAQSQVSVGMGLLAGSTVLLLTIIWGTCVIVGKCDIEDSIA  184

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
              DSQ    T+ F      +L   G+STD  TS+ A +M++S++PF++V+L  ++ S SG+
Sbjct  185   IDSQD---TRGF------SLTGSGVSTDIWTSYAARIMVISVIPFLIVQLPQILHSTSGR  235

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQ  1028
              + VL+ L +++  L++Y  YQI  P IQ+R L Y + ++                LL  
Sbjct  236   HLAVLIGLAVSICLLISYCLYQIFQPWIQRRKLEYIKHKHVILGLLKHLKMRSLGRLLKD  295

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDG  854
             +G+PN   IR  F   D + +  ++  E+   +  I  +E+      AVK +M D D   
Sbjct  296   DGEPNKEVIRKLFTTIDENKDGHLTHGEMRALVVGIQFEEIDLDHDDAVKRIMVDFDTSR  355

Query  853   NSRITEQEFLNGIENLLannssadnaaaatptstPE-----NDDQEKSGEETNgaageve  689
             N  + E+EF+NG+   L     +  A+      T +     + +  +  +  +      E
Sbjct  356   NQLVDEEEFVNGVCRWLQTARRSKAASGDAGPHTMKFLSDFHTETRREHDLLDVGGQSDE  415

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                G +   W  I  VL ++LG  I    A PL+  V  FS A  +P F ISF+ LP+  
Sbjct  416   VEEGVENARWISIKAVLLLLLGAIIAAAFADPLVDAVDNFSEATSIPAFFISFIFLPLAT  475

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N   A++AI  AS+   + ASLTFSEIY  VTM+N+  L   LA+VYAR LTWD+S+EVL
Sbjct  476   NSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVL  535

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             V+ ++ + +G  A F+T + LWTSI A  LYPFSL L YVL  + GW+
Sbjct  536   VILIVCIVMGVFASFRTVFPLWTSILAILLYPFSLVLVYVLDYVFGWS  583



>ref|XP_010519243.1| PREDICTED: uncharacterized protein LOC104798750 [Tarenaya hassleriana]
Length=587

 Score =   267 bits (682),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 189/529 (36%), Positives = 292/529 (55%), Gaps = 35/529 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ YLM  A + +S+ S+ + + LG GI G     +L 
Sbjct  67    CEQTYGFMPCTKTALGNVFLILVYGYLMFTAAKYLSNGSELLLEILGPGIVGGLFLPVLG  126

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  127   ALPDAMLILVSGLSGTPETAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDSI  184

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L   G++ D  TS+ A +M +S++PF++V+   +++S SG+  
Sbjct  185   AVNGQDTKGF------HLTGSGVTVDIWTSYAARIMAISVIPFIVVQFPQIMNSTSGRHF  238

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ALII+VA L++Y  YQ+  P IQ+R L +++ ++                LL  NG
Sbjct  239   AVLLALIISVAMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDNG  298

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PN   IR  F   D + + ++S+ EL+  +  I  DE+   +  AV  +++D D+  + 
Sbjct  299   EPNEHVIRKLFETIDENKDGRLSAPELKALIIGIAFDEIDLDKDDAVGKVLQDFDKSLDE  358

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDD----QEKSGEETNgaageveqag  680
              + E EF+ GI+  L     A  AA      T +  D    Q K      GA  E E+  
Sbjct  359   HVDEDEFVRGIKRWLIEAMGAGPAAPDAGPRTMKFIDHYHQQAKREHALLGAQEENEEND  418

Query  679   gEKMGTWD----FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
                +   D     I  VL ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+ 
Sbjct  419   EAAVHVADPKAITIKAVLMLLLGTAIAAAFADPLVDTVHNFSAATSIPSFFISFIALPLA  478

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+VYAR LTW++S+EV
Sbjct  479   TNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLALVYARGLTWNFSSEV  538

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             LV+ ++ L +   A F+TTY LWT   A+ LYPFSL L Y+L    GW+
Sbjct  539   LVILIVCLVMSGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS  587



>gb|KDP31770.1| hypothetical protein JCGZ_12231 [Jatropha curcas]
Length=577

 Score =   266 bits (680),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 293/530 (55%), Gaps = 40/530 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   I G +F I+++  LM ++ +L+S  S+ +   LG GI G  +  +L
Sbjct  61    SCDETYGFLPCTTTILGNIFLILVYGCLMFLSAKLLSDGSEILLQILGPGIIGGLLLPVL  120

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RA  1349
                P   + ++SG+  S+E AQ+QV  G+ + AG+T+  LT+LWG C+IVG+ D     A
Sbjct  121   SCLPDAAIILASGLSGSKETAQSQVSVGMGLMAGSTVLLLTLLWGSCLIVGKCDIESSVA  180

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
                KD++            + +L   G++TD  TS+ A +M++S++PF++ +L  ++   
Sbjct  181   VDSKDTK------------IFSLTGSGVTTDIGTSYAARIMVISVIPFIIAQLPQILHKT  228

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------L  1037
             S   + VLV+LI++ A L  Y  YQI+ P IQ+R + Y++ +                 L
Sbjct  229   SQSHLAVLVSLIVSPALLFCYSLYQILQPWIQRRRIAYAKHKKMISGILKDLKIHALGRL  288

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLD  863
              T NG+PN   I+  F+  D++++  +++ EL   +  I  +E+   +  AV  ++KD D
Sbjct  289   FTANGQPNKDVIQKLFNTIDNNSDGYLTAAELRALILGIRFEELDIDIDDAVDQVLKDFD  348

Query  862   RDGNSRITEQEFLNGIENLLannssadn----aaaatptstPENDDQEKSGEETNgaage  695
               G++R+   EF++GI   L   + +          T     + D Q +  +  +G   +
Sbjct  349   TSGDTRVDMDEFIHGISRWLDEANHSAKHFNNHRRGTSKLLTDFDKQTEKEQAPSGDKKD  408

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
                    +   W+    V+ ++LG  I    A PL+  V  FS A  +PTF ++FV+LP 
Sbjct  409   DSAETSLENPKWNATKAVMMLLLGTVIAAVFADPLVDAVDNFSTATSIPTFFVAFVILPF  468

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
               +  +    IF AS+K+S++ASL +SEIY  VTMSN+  L   L +VY R LTW++S+E
Sbjct  469   ASSSEVVSDLIF-ASRKNSRSASLAYSEIYGSVTMSNVLSLSVFLGLVYFRGLTWNFSSE  527

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             VL++ ++ + +G +A F+TT+ +W S+ A+ LYPFSL L YVL  +LGW+
Sbjct  528   VLLILIVCVVMGLIASFRTTFPVWMSLVAYALYPFSLLLAYVLNYVLGWS  577



>dbj|BAD19956.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
 dbj|BAD19782.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
Length=571

 Score =   266 bits (679),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 181/522 (35%), Positives = 281/522 (54%), Gaps = 33/522 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC     G LF ++ + +LM  +   +SS S+ +   LG GI G     IL 
Sbjct  63    CEMSYGFLPCTTTAWGNLFLVLAYGFLMFKSATYLSSGSEMLLQILGPGIVGGLFLPILG  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D +     
Sbjct  123   ALPDALLILVSGLSGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTA  182

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               S+  T+ F      +L   G+STD  TS+ A +M +S++PF++V++  +    SG +I
Sbjct  183   IDSR-DTKGF------SLLGSGVSTDKQTSYAARIMAISILPFIIVQIPKIFKLHSGHQI  235

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ LI+    LL+Y  YQ+  P IQ+R L Y+R ++                LL   G
Sbjct  236   TVLIGLIVAALLLLSYCLYQVFQPWIQRRRLEYTRLKHVMSGLLRHAQKHSIGRLLDDEG  295

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PNVS I       D DN+ ++   EL+ F+  I  +++     +A   +M D D   N 
Sbjct  296   RPNVSVIEKI----DQDNDGKLERGELQAFIVGINFEDIDWNSNLAADQVMADFDTSRNH  351

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKS-GEETNgaageveqaggEK  671
              I + EF+NG+   L        + A +      ND   ++  E+T     + E+   + 
Sbjct  352   FIEKGEFVNGMLRWLDEAKRTVTSGAYSKKFL--NDFHARTRDEQTGLLDKDEEEGEADG  409

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
               TW  I  +L ++LG A+    A PL+  V  FS A  +P+F ISF+V+P+  N   A+
Sbjct  410   NPTWTCIKAILLLLLGTAMAAASADPLVDAVHNFSNATHIPSFFISFIVMPLATNSSEAV  469

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA+VY R LTWD+S+EVL++ ++ 
Sbjct  470   SAIIFASRKKKRTLSLTFSEVYGGVTMNNTLCLAVFLALVYVRGLTWDFSSEVLIILLVC  529

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             + +G    F+T + LWT   AF LYP SL + Y+L    GW+
Sbjct  530   IIMGLFTSFRTDFPLWTCFVAFLLYPLSLIMVYILDYKFGWS  571



>ref|XP_002522155.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40234.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   265 bits (677),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 181/530 (34%), Positives = 277/530 (52%), Gaps = 70/530 (13%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+ +YGF PC     G +F I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  57    TCEQSYGFLPCTTTALGNMFLIIVYGYLMFIAATYLSNGSELLLEILGPGIVGGLFLPIL  116

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT++WG CV+VG+ D   +E 
Sbjct  117   GALPDAMLILVSGLSGSKETAQSQVSVGMGLLAGSTVMLLTIIWGSCVVVGKCD--IREA  174

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             DS +                        S   T G+ L                  +G+ 
Sbjct  175   DSIA-----------------------ISGRDTRGISL------------------TGRH  193

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----------------LTQN  1025
             + VL+ALI+++  L++Y  YQ+  P IQKR L Y++ +++                LT++
Sbjct  194   LAVLIALILSLLMLISYCIYQVFQPWIQKRRLAYAKHKHMISGILKHLTERGLGKFLTED  253

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+PN   ++  F+  D + + ++S+ EL+  +  I  +E+   +  A   +MKD D   +
Sbjct  254   GRPNKLVMQKLFYAIDENKDNKLSASELKALILGIRFEEIDFDKDDAAGKVMKDFDTSRD  313

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDD------QEKS--GEETNgaage  695
             + I  +EF NGI   L     +         ++   DD      +E +  G E       
Sbjct  314   NSIDLEEFENGISKWLEEAKRSGAVFTDGSRTSKFLDDFHFLTKREHTLLGPEERIEDQS  373

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
              E   G +   W     VL ++LG  I    A PL+  V  FS A  +PTF ISF+ LP+
Sbjct  374   DEVVEGVENPRWISFKAVLMLLLGTIIAAVFADPLVDAVDNFSDATSIPTFFISFIALPL  433

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
               N   A++AI  AS+K+ + ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S+E
Sbjct  434   ATNSSEAVSAIIFASRKTLRTASLTFSELYGAVTMNNLLCLSVFLALVYCRGLTWDFSSE  493

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             VLV+F++ + +G  A F+TT+ LWTS  A+FLYPFSLAL YVL  + GW+
Sbjct  494   VLVIFIVCIVMGAFASFRTTFPLWTSSIAYFLYPFSLALVYVLDYVFGWS  543



>ref|XP_003571165.2| PREDICTED: uncharacterized protein LOC100833492 isoform X1 [Brachypodium 
distachyon]
Length=639

 Score =   267 bits (683),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 183/521 (35%), Positives = 280/521 (54%), Gaps = 26/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC     G LF  + + +LM  A   +S+ S+ + + LG GI G     IL 
Sbjct  126   CEMTYGFLPCTTTAGGNLFLALAYGFLMFKAATYLSAGSELLLEILGPGIVGGLFLPILG  185

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SGI  ++E AQ+QV  G+ + AG+T+  LTVLWG CV+VG+ D  T++  
Sbjct  186   ALPDALLILVSGISGTKEVAQSQVLIGMGLLAGSTVMLLTVLWGSCVVVGKCD-LTEDST  244

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
                   T+ F      +L   G+STD  TS+ A +M +S++PF++V++  ++   SGQR+
Sbjct  245   PIDSRDTKRF------SLFGSGVSTDLQTSYAARIMAISVLPFIVVQIPKILRLHSGQRL  298

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
              +L+  I+ V  L+ Y  YQI  P IQ+R L YSR +++++                 +G
Sbjct  299   TILLGFIVAVLLLITYCLYQIFQPWIQRRKLEYSRLKHVMSGLLRHAQKHAFGRLFHDDG  358

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
              PNV  I   FH  D DN+ ++   E++ F+  +  +++     +A   +M D DR  NS
Sbjct  359   TPNVPVIEKLFHKIDLDNDGRIERGEIQAFIVGVQFEDIDLDSNLAADQVMADFDRSQNS  418

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
              I + EF++G+   L     A  A+ A      E+       E       + E     + 
Sbjct  419   FIEKGEFVDGVLRWLEEAKRAVVASGAYSKKFMEDFHATARDEHAALLNKDEEDGEAIEN  478

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
              TW     VL ++LG A+    A PL+  V  FS A  +P+F ISF+ +P+  N   A++
Sbjct  479   RTWTCFKAVLLLLLGAAMAAAFADPLVDAVHNFSSATSIPSFFISFIAMPLATNSSEAVS  538

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA+VY R LTWD+S+EVLV+F++ +
Sbjct  539   AIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAVFLALVYLRGLTWDFSSEVLVIFLVCI  598

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              +G    F+T + LWT   AF LYP SL + Y+L    GW+
Sbjct  599   IMGLFTSFRTKFPLWTCFVAFLLYPLSLLMVYILDYKFGWS  639



>ref|XP_011098256.1| PREDICTED: uncharacterized protein LOC105176958 isoform X2 [Sesamum 
indicum]
Length=569

 Score =   266 bits (679),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 185/521 (36%), Positives = 287/521 (55%), Gaps = 27/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC     G LF I+++ YLM +A   +S+ S+ + + LG GI G     +L 
Sbjct  57    CEETYGFMPCTSTALGNLFLILVYGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPVLG  116

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT++WG C+IVG+ D   +   
Sbjct  117   ALPDAMLILVSGLSGSRETAQSQVSVGMGLLAGSTVMLLTLIWGTCIIVGKCD--IENSV  174

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T++F      +L   GISTD  TS+ + +M +S++PF++V+L  ++ S SG+ +
Sbjct  175   AVDSKDTKAF------SLAGSGISTDIWTSYASIIMAISVIPFIIVQLPQILHSNSGRHL  228

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQNG  1022
              VL+ALI++ + L+AY  YQ+  P +Q+R + Y++                F  L  ++G
Sbjct  229   AVLIALIVSASLLIAYCLYQVFQPMVQRRRIAYAKHKHVVAGILKHLKMHAFGKLYGEDG  288

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNS  848
             K NV  +R  F   D + +  +S  EL   +  I   E  +    AV  +MKDLD   +S
Sbjct  289   KLNVEVLRKLFRTIDDNKDGYLSHTELRALIVGIRFSESNLDEDDAVVKLMKDLDSSRDS  348

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
             R+   EF++ +   L     A  +         ++  ++   E         E A G   
Sbjct  349   RVDLHEFISTVARWLEEAKGAKTSNHTGSMKFIDDFHEQTRREHDLLGDQGDEAAEGVDN  408

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
               W  +  VL ++LG  I    A PL+  V  FS A  +P+F ISF+VLP+  N   A++
Sbjct  409   PRWTSVKAVLLLLLGTVIAAVFADPLVDAVDNFSTATSIPSFFISFIVLPLATNSSEAVS  468

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  ++ASLTFSE+Y  VTM+N+  L   LA+VY R L WD+S+EVLV+ ++ +
Sbjct  469   AIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYVRGLVWDFSSEVLVILIVCV  528

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              +G  A  +TT+ LWTS+ AF LYPFSLAL YVL  + GW+
Sbjct  529   VMGVFASIRTTFPLWTSLLAFLLYPFSLALVYVLDYVFGWS  569



>ref|XP_009409407.1| PREDICTED: uncharacterized protein LOC103991626 [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   266 bits (680),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 185/524 (35%), Positives = 284/524 (54%), Gaps = 33/524 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C+ +YGF PC   + G LF ++++ +LM  A   +S+ S+ + + LG GI G     IL
Sbjct  77    ACEPSYGFLPCTTTVAGNLFLVLVYGFLMYKAATCLSAGSEMLLEILGPGIVGGLFLPIL  136

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD--RATQ  1343
                P  ++ + SG+  S+E AQNQV  G+ + AG+T+  +T+LWG CV+VG+ D    + 
Sbjct  137   GALPDALLILVSGLSGSKEVAQNQVLIGMGLLAGSTVMLITLLWGSCVVVGKCDLLENST  196

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
               DSQ       FAS         GI+TD+ TS  A +M++S++PF++V+L  V    SG
Sbjct  197   SVDSQDTNGFSLFAS---------GITTDSQTSHAAKIMVISIIPFIIVQLPRVFKFLSG  247

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLT  1031
              R+ VL+ALI+ +A L++Y  YQ++ P I +R L ++                    L+ 
Sbjct  248   -RVAVLIALIVAIALLVSYCLYQVLQPWIHRRKLEFAEHMLMILGILGHPQTAALGRLMD  306

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRD  857
              +G+PN   I   FH  D + NQ +S  EL  F+  +   EV     V V  +MK+ D  
Sbjct  307   DDGRPNKPVIEKLFHKIDQNKNQLISPSELRAFIIGLKIHEVNLDNDVVVDKIMKEFDTS  366

Query  856   GNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqagg  677
              +  I E+EF+ GI   +   +   +A+ +        + +E+     +      E+   
Sbjct  367   HDGNIQEEEFIKGISKWITKVNHRSSASHSNDIVDYYMEAREQRNMLIDQIDEAAEENIK  426

Query  676   EKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRM  497
                 T   + ++L +ILG +I    A PL+  V  FS A  +P+F ISF+ +P+  N   
Sbjct  427   NPASTC--VTSILLLILGTSIAAVFADPLVDAVDNFSIATKIPSFFISFIAMPLATNSSE  484

Query  496   AIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFV  317
             A++AI  AS+K+ + ASLTFSEIY GVTM+N   L   LA+VY R LTWD+SAEVLV+ +
Sbjct  485   AVSAIIFASRKTQRTASLTFSEIYGGVTMNNTLCLAVFLALVYVRHLTWDFSAEVLVILI  544

Query  316   ISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + + +G     +TT+ LWT   AF LYP +L L YVL  + GW+
Sbjct  545   VCVVMGIFTSLRTTFPLWTCFVAFLLYPLALVLVYVLDFVFGWS  588



>ref|XP_010060650.1| PREDICTED: uncharacterized protein LOC104448506 [Eucalyptus grandis]
 gb|KCW67435.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=589

 Score =   266 bits (680),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 189/531 (36%), Positives = 291/531 (55%), Gaps = 42/531 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC  + PG LF IV++  LM +A   +S+ S+ + + LG GI G     +L
Sbjct  73    SCEETYGFLPCTASWPGNLFLIVVYGSLMFLAATYLSNGSELLLEILGPGIVGGLFLPML  132

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LTV+WG C+IVG+ D      
Sbjct  133   GALPDAMLILVSGLSGSTETAQSQVSVGMGLLAGSTVMLLTVIWGSCIIVGKCD--LHNS  190

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  +  T+ F      +L   G+STD  T + A +M+ S++PF++V+L  +++S SG+ 
Sbjct  191   VAMDKQDTKGF------SLKGSGVSTDLWTKYAARIMVFSVIPFIIVQLPQILNSTSGRH  244

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL++LI+++  L+AY  YQ++ P IQ+R L Y   ++                LLT +
Sbjct  245   LAVLISLIVSLILLIAYCIYQVVQPWIQRRRLAYVEDKHVFFGFLRHIRTHPLGRLLTDD  304

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             GK +       F   D + +  +++ EL+  +  +  +E+      AV  +MKD D   +
Sbjct  305   GKLDKDFAEKLFTTLDENGDGYLNAAELKALVVGMQFEEIDLNEDGAVDRIMKDFDSSND  364

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDD---------QEKSGEETNgaag  698
               +   EFL+GI   ++   S+ +      T    +D          Q KSG++T+    
Sbjct  365   CLLELPEFLDGISKWVSRARSSASGIKNFGTGKFLDDAHHQTTQEHAQLKSGDQTDEVTE  424

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
              V      K+ T   +  VL ++LG  I    A PL+  V  FS A G+PTF ISF+ LP
Sbjct  425   GVGNP---KLTT---LKAVLLLVLGTIIAGAFADPLVDAVDNFSDATGIPTFFISFIALP  478

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             +  N   A++AI  AS+K  + ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S+
Sbjct  479   LATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCLSVFLAIVYIRGLTWDFSS  538

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             EVLV+ ++   +G  A F+TT+ LWT   A  LYPFSLAL YVL  + GW+
Sbjct  539   EVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVYVLDYIFGWS  589



>ref|XP_002298903.2| sodium/calcium exchanger family protein [Populus trichocarpa]
 gb|EEE83708.2| sodium/calcium exchanger family protein [Populus trichocarpa]
Length=582

 Score =   265 bits (677),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 197/546 (36%), Positives = 299/546 (55%), Gaps = 31/546 (6%)
 Frame = -1

Query  1765  NQSVDQ--SSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQL  1592
             NQS++Q  SS   L    L SS+  TC+  YGF PC   + G LF I+++ YLM  A   
Sbjct  48    NQSLNQTTSSPFHLA---LKSSAEETCEQTYGFLPCTTTVIGNLFLILVYGYLMFFAATY  104

Query  1591  VSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGA  1412
             +SS S+ +   LG GI G     +L   P  ++ + SG+  S E AQ+QV  G+ + AG+
Sbjct  105   LSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSGLSGSTETAQSQVSVGMGLLAGS  164

Query  1411  TIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
             T+  LTV+WG CV+VG+ D +  E  +  +  T+ F      +L   G+STD  T + A 
Sbjct  165   TVMLLTVIWGSCVVVGKCDMSETENSAIDRKDTKRF------SLTGSGVSTDIWTCYAAR  218

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +M +S++PF++V+L+  + S SG+ + VL+ LI+++A L++Y  YQ+  P IQ+R L Y+
Sbjct  219   IMAISILPFIVVQLLQTLHSTSGKHLAVLIGLILSLAILISYCLYQVFQPWIQERKLKYT  278

Query  1051  RFENLLTQNGKPNVSRIRLFFHLYDSDNNQQ---------MSSRELEKFLRLIVTDEVQ-  902
             R +  L  +G     + R    L   D++           +S+ EL+  +  I  +E+  
Sbjct  279   RHK--LVMSGILKHLKQRALGRLLADDSSLDESVVVPHYCLSASELKALVIGIRFEEIDF  336

Query  901   -RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDD--QE  731
              +  AV  ++KD D+  ++ I  +EF+NGI+  L         +      T +  D   +
Sbjct  337   DKDDAVSKLIKDFDKTNDNLINFREFINGIQKWLDEAMRVGGGSPDPGPRTHKYLDNFHD  396

Query  730   KSGEETNgaageveqaggEKMGT----WDFIVTVLQVILGVAILTFCAQPLMTNVIQFSG  563
             K+ +       +  + G    G     W      L ++ G  I    A PL+  V  FS 
Sbjct  397   KTKKAHALLGSKEPEEGESDGGVKNPRWTSFKASLMLLAGAVIAAAFADPLVDAVDNFSD  456

Query  562   AVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSL  383
             A  +PTF ISF+ LP+  N   A++AI  AS+K    ASLTFSE+Y  VTM+N+  L   
Sbjct  457   ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTTASLTFSELYGAVTMNNVLCLSVF  516

Query  382   LAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             LA+VY RELTWD+SAEVLV+ ++ + +G  A F+TT+ LWT   A+FLYPFSL L YVL 
Sbjct  517   LALVYFRELTWDFSAEVLVICIVCIAMGAFASFRTTFPLWTCFLAYFLYPFSLVLVYVLD  576

Query  202   -LLGWN  188
              +LGW+
Sbjct  577   YVLGWS  582



>ref|XP_009593456.1| PREDICTED: uncharacterized protein LOC104090114 [Nicotiana tomentosiformis]
Length=564

 Score =   264 bits (675),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 189/533 (35%), Positives = 291/533 (55%), Gaps = 30/533 (6%)
 Frame = -1

Query  1720  RLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIF  1541
             R+S++  STC+ +YGF PC +   G +F I+++ YLM +A   +SS S+ + + LG G+ 
Sbjct  40    RISAAEESTCEQSYGFLPCTKTALGNVFLIIVYGYLMFLAATYLSSGSEFLLEILGPGLI  99

Query  1540  GATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGR  1361
             G     +L   P  ++ + SGI  S   AQ+QV  G+ + AG+T+  +TV+WG C IVG+
Sbjct  100   GGLFLPVLGALPDAMLILVSGISGSTAAAQSQVSVGMGLLAGSTVMLITVIWGTCCIVGK  159

Query  1360  RDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnv  1181
              D   Q   +     T+ F      +L   G+STD  TS  A +M +S+ PF++V+L  +
Sbjct  160   CD--IQNSAAIDLKDTKGF------SLTGSGVSTDVWTSHAATIMAVSVAPFLVVQLPQL  211

Query  1180  VSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN-------------  1040
             + S SG+ + VL+ALII++  L++Y  YQ+  P IQ+R L Y + ++             
Sbjct  212   LHSTSGRHLAVLIALIISLTLLVSYCLYQVFQPWIQRRRLAYVKHKHVISGVLKHLRMRA  271

Query  1039  ---LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMM  875
                L T  G PN+  +   F   D   +  +S  EL+  +  I  +E+      AV+ +M
Sbjct  272   LGRLCTDQGAPNIEVLEKLFKAIDESEDGYLSRSELKALVVGIRLEEINLNENDAVEKLM  331

Query  874   KDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaa  701
             KD D   + RI + EF+ G+   L     +   +      T +   D  E++  E +   
Sbjct  332   KDFDTSHDQRIEKSEFIAGVAKWLNEARGSKAPSIEAGPDTMKYLADMHEEARREHHFLG  391

Query  700   geveqaggEKMGTWDF-IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVV  524
              + +++           I  VL ++LG  I    A PL+  V  FS A G+P+F ISF+V
Sbjct  392   DQNDESVEAVENPRSIAIKAVLLLLLGTVIAAVFADPLVDAVNNFSSATGIPSFFISFIV  451

Query  523   LPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDY  344
             LP   N   A++AI  AS+K  ++ASLTFSE+Y  VTM+NL  L   LA+VYAR LTWD+
Sbjct  452   LPFATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCLSVFLALVYARGLTWDF  511

Query  343   SAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             S+EVLV+ ++ + +G  A  ++T+ LWTS+ AF LYP SL L YVL    GW+
Sbjct  512   SSEVLVILIVCVVMGVFASVRSTFPLWTSLVAFLLYPLSLVLVYVLDYKFGWS  564



>ref|XP_004294082.1| PREDICTED: uncharacterized protein LOC101313777 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   264 bits (674),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 193/551 (35%), Positives = 304/551 (55%), Gaps = 34/551 (6%)
 Frame = -1

Query  1765  NQSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVS  1586
             ++S   SSFL L  P L  + S TCD  YGF PC   + G LF I+++  LM  A   +S
Sbjct  39    HRSGTSSSFLTLHRPSLLKAES-TCDETYGFLPCTTTVLGNLFLILVYGALMYTAATYLS  97

Query  1585  SSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATI  1406
               S+ + + LG GI G     IL   P  ++ + SG+  S E AQ+QV  G+ + AG+T+
Sbjct  98    HGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGSTETAQDQVSVGMGLLAGSTV  157

Query  1405  FNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLM  1226
               +TV+WG CVI+G+ D   +   ++    T+ F      +L   G+STD  TS++A +M
Sbjct  158   MLITVVWGSCVIIGKCD--IENGIARDNKDTKGF------SLTGSGVSTDIWTSYSAIIM  209

Query  1225  LLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF  1046
              +S++PF++V+L  ++SS + ++  VL+ LI ++A L++Y  YQ+  P IQ+R   Y++ 
Sbjct  210   AVSVIPFIIVQLPQLLSSTAARQWAVLIGLIFSLALLISYCTYQVFQPWIQRRRFAYAKH  269

Query  1045  EN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVT  914
             ++                LL  NG+ ++  +   FH  D D + ++S  EL   +  I  
Sbjct  270   KHVISGLLQHLKMRALGRLLDDNGELDIEVVTKLFHTIDVDRDDRLSPAELRALIVGIRF  329

Query  913   DEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPE--  746
             DE++  +  AV  +MKD D   +S I+  EF+ G+   L     A ++   + + T +  
Sbjct  330   DEIELDKDDAVDKVMKDFDTSRDSHISRDEFIAGVRKWLNEAKHAGDSKTTSGSHTMKFL  389

Query  745   NDDQEKSGEETNgaageveqaggEKMGTWD----FIVTVLQVILGVAILTFCAQPLMTNV  578
             +D  E++ +E +    + +Q+     G  +     I   L ++ G  I    A PL+  V
Sbjct  390   SDFHEQTKKEHDLVGVDEDQSDEVVEGVDNPRRTSIKAGLMLLAGTLIAAAFADPLVDAV  449

Query  577   IQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLT  398
               FS A  +PTF ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+Y  VTM+N+ 
Sbjct  450   DNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKRRTASLTFSELYGAVTMNNVL  509

Query  397   GLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLAL  218
              L   LA+VY R LTWD+SAEVLV+ ++ + +G     +TT+ LWT+  A+ LYPFSL L
Sbjct  510   CLSVFLALVYVRGLTWDFSAEVLVIVIVCVVMGVFGSLRTTFPLWTTSIAYLLYPFSLVL  569

Query  217   FYVLQ-LLGWN  188
              YVL  + GW+
Sbjct  570   VYVLDYIFGWS  580



>ref|XP_002279120.1| PREDICTED: uncharacterized protein LOC100253888 [Vitis vinifera]
 emb|CBI21944.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   262 bits (669),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 188/532 (35%), Positives = 295/532 (55%), Gaps = 42/532 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   + G +F I+++ YLM +A + +S  S+ +   LG GI G     +L
Sbjct  59    SCDQTYGFLPCTTTVLGNIFLILVYGYLMFIAAKFLSDGSEILLGILGPGIIGGLFLPVL  118

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RA  1349
               FP  ++ ++SG+  S+E AQ+QV  G+ + AG+T+  LT+LWG C+IVG+ D     A
Sbjct  119   SAFPDAVIILASGLSGSKETAQSQVSIGMGLLAGSTVMLLTILWGSCIIVGKCDIENSVA  178

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
             T  KD      T+ F      +L   G+STD   S+ A +M++S++PF++V++  V+ + 
Sbjct  179   TDLKD------TRGF------SLTGSGVSTDIWASYAARIMVISVIPFIIVQISQVLHTT  226

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL---------------  1034
             S  R+ VL++LI++++ LL+Y  YQ+  P IQKR L Y++ ++L+               
Sbjct  227   SQARLTVLISLIVSLSLLLSYCLYQVFQPRIQKRRLAYAKHKHLMSGILKHLKSHILGRL  286

Query  1033  -TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLD  863
              T NG+PN   I+  F   D ++N  +S  ++   +  I  D     +   VK++MKD D
Sbjct  287   FTNNGEPNTEAIKKLFETIDVNSNGYLSVTDIRALIIGIQFDAADLDIDETVKSVMKDFD  346

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPE----NDDQEKSGEETNgaa--  701
               G+S+I   EF+ G+   L     +   A +  +++      ND   ++ EE +     
Sbjct  347   TTGDSQIDMNEFVRGMSRWLTKAKRSAIHAGSDGSNSLSTRYINDFNLRTREEQDKLEDQ  406

Query  700   geveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
              E E+    K   W+    V  ++LG  +    A PL+  V  FS A  +P+F +SFVVL
Sbjct  407   NEEEEVESIKNPKWNASKAVAMLLLGTVVAAIFADPLVDAVDNFSTATSIPSFFVSFVVL  466

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P   +     A IF AS+K  + ASLTFSEIY  VTM N+  L   L ++Y R+LTWD++
Sbjct  467   PFASSSEAVSAMIF-ASRKKLRTASLTFSEIYGSVTMGNILSLSVFLGLIYFRQLTWDFA  525

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             +EVL++ ++ + +G  A  +TT+ LWTS+ AF LYP SL L YVL   LGW+
Sbjct  526   SEVLIILIVCILMGVFAGTRTTFPLWTSLMAFLLYPLSLVLVYVLDNYLGWS  577



>ref|XP_008383883.1| PREDICTED: uncharacterized protein LOC103446524 [Malus domestica]
Length=594

 Score =   262 bits (669),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 194/565 (34%), Positives = 298/565 (53%), Gaps = 44/565 (8%)
 Frame = -1

Query  1765  NQSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVS  1586
             N  + QSS L   G  L S S  TC+  +GF PCA ++ G LF ++I++ L+S+A+Q VS
Sbjct  35    NDEISQSSILE--GLNLKSDSV-TCEPIFGFLPCATSVWGLLFLVIIYEVLLSLADQYVS  91

Query  1585  SSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATI  1406
               S+  F+  GTG+FGA+ F +L + P++ M +  G+  + E  +      + + AG++I
Sbjct  92    RGSEIFFELFGTGVFGASAFHLLGLIPQVGMVLVIGVTATTETVEEMAEMSMSMLAGSSI  151

Query  1405  FNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQ---------SFASNWLK-----------  1286
               LT++WG  V  G  D +  E  + S P  +         +F S+ L            
Sbjct  152   MILTLIWGSVVAFGSSDLS--ESQTLSNPENKKPLTGLLAVAFGSSDLSDSQTSSNPENT  209

Query  1285  ---TLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafl  1115
                +L   G+ TD  T  TA +M+ SL+P+++++L  +++S +  R+V+L+AL+I  AFL
Sbjct  210   KPFSLTGSGVRTDVETRDTARIMMFSLIPYLILQLAKILTSTTAVRVVILIALLIASAFL  269

Query  1114  lAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNV--SRIRLFFHLYDSDNN  965
               YF YQ   P IQ R L Y        +   +L+T  G PN     I   FH  D ++N
Sbjct  270   ATYFIYQFFQPWIQSRRLEYLLRKYIPKNILPSLMTVGGNPNSFSKFICRLFHRIDKNHN  329

Query  964   QQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLanns  791
             + +SS EL   +  I  +E+       V  +MK  D  G+++I E EF+NGI   +    
Sbjct  330   KYISSDELRALILGIQIEEIGLDDDDYVSEVMKQFDLSGDAQIAETEFVNGISKWINPAK  389

Query  790   sadnaaaatptst--PENDDQEKSGEETNgaageveqaggEKMGTW-DFIVTVLQVILGV  620
                N      TS     N   EKS E+        +        +W + +     +ILG 
Sbjct  390   PPANDKGHEHTSLFRRNNSKNEKSMEDQLTLLISKKNGTKGADTSWMNLLKAAFLIILGT  449

Query  619   AILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLT  440
             AI  F + PLM ++ +FS A  +P+F  S+VV+P+  N R+A+ ++  A +K+  A SLT
Sbjct  450   AITVFLSMPLMVSLRKFSTAASIPSFAASYVVIPLATNYRLALMSVTSAKEKTEDAISLT  509

Query  439   FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWT  260
              SEIY    M+N+ GL+  LA+VY R L+WD +AEVLVV +IS  +GF A F   +  WT
Sbjct  510   LSEIYTAAFMNNIVGLVIFLALVYIRNLSWDVAAEVLVVLLISTAVGFSASFSRKFPFWT  569

Query  259   SIFAFFLYPFSLALFYVL-QLLGWN  188
              I A+ LYP SL L +VL  ++GW+
Sbjct  570   CILAYILYPISLLLVHVLTTVIGWS  594



>ref|XP_010535054.1| PREDICTED: uncharacterized protein LOC104810447 [Tarenaya hassleriana]
Length=573

 Score =   261 bits (667),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 185/527 (35%), Positives = 288/527 (55%), Gaps = 41/527 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A + +S+ S+ + + LG GI G     IL 
Sbjct  52    CEQTYGFMPCTKTALGNVFLIIVYGFLMFTAAKYLSNGSELLLEILGPGIVGGLFLPILG  111

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  112   ALPDAMLILVSGLSGTPETAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDSI  169

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L   G++ D  TS+ A +M +S++PF++V+   +++S SG+ +
Sbjct  170   AVNGQDTKGFH------LTGSGVTVDIWTSYAARIMAISVIPFIIVQFPQIMNSTSGRHL  223

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ALII+V  L+AY  YQ+  P IQ+R L + + ++                LL  NG
Sbjct  224   AVLLALIISVTMLIAYCVYQVFQPWIQRRRLAFVKHKHVISGILRHLKRHALGRLLNDNG  283

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PN   IR  F   D + +  +S+ EL+  +  I  +E+   +  AV  +++D D+  + 
Sbjct  284   EPNDHVIRKLFDTIDENKDGFLSAPELKALIIGIRFEEIDLDKDDAVGKVLQDFDKSLDE  343

Query  847   RITEQEFLNGIENLLannss----adnaaaatptstPENDDQEKSGEETNgaage-----  695
             R+ + EF++GI+  L         A   A        +N  Q+   E     A E     
Sbjct  344   RVDQDEFVHGIKRWLIEAMREGGPAGRDAGPRTMKFIDNYHQQTMREHALLNAEENEEND  403

Query  694   ---veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVV  524
                V      K  T   I  VL ++LG AI    A PL+  V  FS A  +P+F ISF+ 
Sbjct  404   EEDVVHVADPKSVT---IKAVLMLLLGTAIAAAFADPLVDTVQNFSVATKIPSFFISFIA  460

Query  523   LPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDY  344
             LP+  N   A++AI  +S+K  + ASLTFSE+  GVTM+N+  L   LA+VYARELTW++
Sbjct  461   LPLATNSSEAVSAIIFSSRKKIRTASLTFSELCGGVTMNNILCLSVFLALVYARELTWNF  520

Query  343   SAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L 
Sbjct  521   SSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILD  567



>ref|XP_004244257.1| PREDICTED: uncharacterized protein LOC101263533 [Solanum lycopersicum]
Length=589

 Score =   261 bits (666),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 186/529 (35%), Positives = 285/529 (54%), Gaps = 39/529 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC +   G +F IV++ YLM  A   +SS S+ + + LG G+ G     IL 
Sbjct  73    CEQSYGFLPCTKTALGNVFLIVVYGYLMFTAATYLSSGSELLLEILGPGLIGGLFLPILG  132

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDR----AT  1346
               P  ++ + SGI  S   AQ+QV  GI + AG+T+  LT +WG C  VG+ D     A 
Sbjct  133   ALPDAMLILVSGITGSAAEAQSQVSVGIGLLAGSTVMLLTAIWGTCCTVGKCDIVNSIAV  192

Query  1345  QEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
               KD++    T S            G+STD  TS+ A +M +S++PF++V+L  +  S S
Sbjct  193   DLKDTKGLSFTGS------------GVSTDIWTSYAAMIMAVSVLPFIVVQLPQIFHSNS  240

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LL  1034
             G+ + VL+ALII+++ LL+Y  YQ+  P IQ R L Y + ++                L 
Sbjct  241   GRHLSVLIALIISLSLLLSYCLYQVFQPWIQTRKLDYVKHKHVISGILKHLKKHALGRLF  300

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDR  860
             T +G PN+  +   F+  D + ++ +S  EL   +  I  +E+      A+  +MKD D 
Sbjct  301   TDHGTPNIEVLEKLFNAIDENGDKHLSHSELRALVVGIRLEEINLDENDAIAKVMKDFDT  360

Query  859   DGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaageveq  686
               + ++   EF+ G+E  L    S + ++A    +T    +D  E++  E +    +   
Sbjct  361   SLDEQVDLHEFITGVEKWLYEAKSTNGSSAQAGPNTINYIDDFHEETRREHSLLGEDQSD  420

Query  685   aggEKMGTWD--FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
                E +       I     ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+ 
Sbjct  421   EIVEGVENPRKVAIKAASLLLLGTIIAAVFADPLVDAVNNFSSATSIPSFFISFIALPLA  480

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N   A++AI  A++K  ++ASLTFSE+Y  VTM+NL  L   LA+VYAR LTW++S+EV
Sbjct  481   TNSSEAVSAIIFATRKKQRSASLTFSELYGAVTMNNLLCLSVFLAIVYARGLTWNFSSEV  540

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             LV+ ++ + IG L   +TT+ LWTS+ AF  YPFSL L YVL  + GW+
Sbjct  541   LVILIVCIVIGVLGSIRTTFPLWTSLIAFAFYPFSLVLVYVLDYVFGWS  589



>ref|NP_001042378.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAD73036.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04292.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAG89983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70160.1| hypothetical protein OsI_00872 [Oryza sativa Indica Group]
 gb|EEE54102.1| hypothetical protein OsJ_00857 [Oryza sativa Japonica Group]
Length=584

 Score =   260 bits (665),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 179/521 (34%), Positives = 282/521 (54%), Gaps = 26/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G LF ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  71    CEQSYGFLPCTTTVLGNLFLVLAYGFLMYKAATFLSAGSELLLEIMGPGLVGGLLLPILG  130

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D       
Sbjct  131   ALPDALLVLVSGLSGSRETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDIGPNGVA  190

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
                Q + + F      +L   GISTD  TS+ A +M +S++PF++ +   ++ +  GQR+
Sbjct  191   VDLQ-NNKGF------SLTGTGISTDVQTSYAARIMGISVIPFIIAQFPKMLKTHHGQRL  243

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ALI++ + +LAY  YQ+  P IQKR L Y++ ++                LL ++G
Sbjct  244   AVLLALIVSFSLVLAYCLYQVFQPWIQKRKLAYAKHKHVISGILRHAQMEALGRLLNEDG  303

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNS  848
              PN   I+  FH  D D +Q +S  EL   +  I  +EV   +  AV  +M D D  GN 
Sbjct  304   TPNEDVIKKLFHKIDMDESQTLSRAELHALIIGINFEEVDFDKNDAVDKIMDDFDTSGND  363

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
              + E EF++G++  L     +   + A       +       E         E     + 
Sbjct  364   IVEEAEFVSGMKRWLNEAKRSVPTSGAYSNKFITDYHARTRQEHDLLVDRSDETVESVEN  423

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
               W     V  ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+  N   A++
Sbjct  424   PGWCITKAVGLLLLGSAIAAAFADPLVDAVHNFSNASHIPSFFISFIALPLATNSSEAVS  483

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  + +SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ +
Sbjct  484   AIIFASRKKLRTSSLTFSEVYGGVTMNNTLCLGVFLALIYIRNLTWDFSSEVLIILLVCV  543

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              +G    F+TT+ LWT + A+ LYP SL + Y+L  + GW+
Sbjct  544   IMGLFTSFRTTFPLWTCLVAYMLYPLSLVVVYILDFVFGWS  584



>ref|XP_011096403.1| PREDICTED: uncharacterized protein LOC105175606 [Sesamum indicum]
Length=719

 Score =   263 bits (673),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 190/301 (63%), Gaps = 29/301 (10%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE-----VQRMVAVKT  881
             E+L+T +G+PNV RI+  F  +D DN++ +S  ELE+ +   V  E      Q MV  K 
Sbjct  431   EHLVTDDGRPNVERIKALFKQFDRDNSKSLSRPELEQLIHNTVRFEESPLSCQEMV--KK  488

Query  880   MMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa  701
              +KD D DG+  I EQEF++G+   L                  +  D +KS +E +   
Sbjct  489   FIKDFDTDGDDIIDEQEFMHGMTKWLNKAVDVT-----------KCKDAKKSIDEFDKMM  537

Query  700   geveqaggEKMG----------TWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGV  551
                      ++G          TW+F  + L+VILG+AILTF + PLMT++ QFS A+GV
Sbjct  538   WGEVDDLVYEVGQNENTKLKLMTWEFNKSTLEVILGIAILTFLSAPLMTSIQQFSDAIGV  597

Query  550   PTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVV  371
             P+F ISFV++P+ +N R AI AIFPASQKSS+ +SLTFSEIY GV M+N+ GL +LLA+V
Sbjct  598   PSFFISFVIVPVAMNARSAILAIFPASQKSSRTSSLTFSEIYGGVVMNNMMGLSTLLAIV  657

Query  370   YARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLG  194
             Y +EL WDYSAEVL + V+   IG LAY +TTY LWT + AFFLYPFSLA++Y LQ +LG
Sbjct  658   YIKELEWDYSAEVLTILVVCGIIGLLAYSQTTYPLWTCVLAFFLYPFSLAMYYALQYILG  717

Query  193   W  191
             W
Sbjct  718   W  718


 Score =   239 bits (611),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 205/315 (65%), Gaps = 19/315 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC H YGFFPCA+NI GY+FQIV++QYL+ +  +L++  SK IF+ +GTG++GA+VFRIL
Sbjct  60    TCVHTYGFFPCADNIGGYIFQIVVYQYLLIIGGKLITKGSKTIFNIIGTGVYGASVFRIL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDR-ATQE  1340
              V P+++M I SG+  S+E A+ +V FG+ V AG+T+FNLT LWG+CVI  R+   A   
Sbjct  120   TVLPKMVMVIVSGVLKSKENARVKVSFGVGVYAGSTVFNLTFLWGMCVIFSRKQLFAKSA  179

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
               + S  S  S A   L  L + G + D  T +TAG+MLLSL+P+++V+L + V+S+ G 
Sbjct  180   TATGSSVSNCSVAREKLAVLKDTGATIDKKTCYTAGIMLLSLIPYIIVQLTDFVNSSFGT  239

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------Q  1028
             RIV+L+AL+++ A LL+YF YQI DP IQ+RSL YS++ENLL                 +
Sbjct  240   RIVILIALVVSTALLLSYFLYQIFDPWIQERSLEYSKYENLLAGFLQHVQRHAKEKLVDE  299

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDG  854
             NG+PN+  I+  FH  D D ++ ++  ELE  +  I + +VQ  +  A+  ++K  D + 
Sbjct  300   NGQPNIPVIKGLFHQTDKDEDKCITFLELENLIHEIQSGKVQVEKDYAISEILKAFDLNN  359

Query  853   NSRITEQEFLNGIEN  809
             + RI E EF+ G + 
Sbjct  360   DGRIEEHEFVEGCKK  374



>ref|XP_009767335.1| PREDICTED: uncharacterized protein LOC104218515 [Nicotiana sylvestris]
Length=568

 Score =   260 bits (664),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 185/524 (35%), Positives = 284/524 (54%), Gaps = 30/524 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC +   G +F I+++ YLM +A   +SS S+ + + LG G+ G     +L 
Sbjct  53    CEQSYGFLPCTKTALGNVFLIIVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPMLG  112

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SGI  S   AQ+QV  G+ + AG+T+  +TV+WG C IVG+ D   Q   
Sbjct  113   ALPDAMLILVSGISGSTAAAQSQVSVGMGLLAGSTVMLITVIWGTCCIVGKCD--IQNSV  170

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   G+STD  TS  A +M +S+ PF++V+L  ++ S SG+ +
Sbjct  171   AVDLKDTKGF------SLTGSGVSTDVWTSHAAMIMAVSVAPFLVVQLPQLLHSTSGRHL  224

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ALII++  L++Y  YQ+  P IQ+R L Y + ++                L T  G
Sbjct  225   AVLIALIISLTLLVSYCLYQVFQPWIQRRRLAYVKHKHVISGVLKHLRMRALGRLCTDQG  284

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
              PN+  +   F   D   +  +S  EL+  +  I  +E+      AV+ +MKD D   + 
Sbjct  285   APNIEVLEKLFKAIDESEDGYLSRSELKALVVGIRLEEINLNENDAVEKLMKDFDTSHDQ  344

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaageveqaggE  674
             RI   EF+ G+   L     +   +      T +   D  E++  E +    + +++   
Sbjct  345   RIEMSEFIAGVAKWLNEARGSKAPSVEAGPDTMKYLADLHEEARREHHFLGDQNDESVEA  404

Query  673   KMGTWDF-IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRM  497
                     I  VL ++LG  I    A PL+  V  FS A  +P+F ISF+VLP   N   
Sbjct  405   VENPRSIAIKAVLLLLLGTVIAAVFADPLVDAVNNFSSATSIPSFFISFIVLPFATNSSE  464

Query  496   AIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFV  317
             A++AI  AS+K  ++ASLTFSE+Y  VTM+NL  L   LA+VYAR LTWD+S+EVLV+ +
Sbjct  465   AVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCLSVFLALVYARGLTWDFSSEVLVILI  524

Query  316   ISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             + + +G  A  ++T+ LWTS+ AF LYPFSL L YVL   +GW+
Sbjct  525   VCVVMGIFASVRSTFPLWTSLLAFLLYPFSLVLVYVLDYKIGWS  568



>ref|XP_006643900.1| PREDICTED: uncharacterized protein LOC102712578 [Oryza brachyantha]
Length=577

 Score =   259 bits (663),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 179/521 (34%), Positives = 282/521 (54%), Gaps = 26/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G +F ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  64    CEQSYGFLPCTTTVLGNVFLVLAYGFLMYKAATFLSAGSELLLEIMGPGLVGGLLLPILG  123

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LTVLWG CV+VG+ D       
Sbjct  124   ALPDALLVLVSGLSGSRETAQSQVLIGMGLLAGSTVFLLTVLWGTCVVVGKCDIGPNGVA  183

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
                Q + + F      +L   GISTD  TS+ A +M +S++PF++ +   ++ +  GQR+
Sbjct  184   VDLQ-NNKGF------SLTGTGISTDVQTSYAARIMGISVIPFIIAQFPKMLKTHHGQRL  236

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ALI++   +LAY  YQ+  P IQ+R L Y++ ++                LL ++G
Sbjct  237   AVLLALIVSFLLVLAYCLYQVFQPWIQRRKLAYAKHKHVISGILRNAQKEALGRLLNEDG  296

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNS  848
              PN + I+  FH  D D +Q +S  EL   L  I  +E+   +  AV  +M D D   N+
Sbjct  297   TPNENVIKKLFHKIDMDQSQTLSRSELHALLVGINFEEIDFDKEDAVDKIMNDFDTSRNT  356

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
              + E EF+ G++  L     +   + A  T    +       E         E     + 
Sbjct  357   VVEEAEFVEGMKRWLHEAKRSVPGSGAYSTKFMSDYHARTRQEHDLLVEASDETVESVEN  416

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
               W     V  ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+  N   A++
Sbjct  417   PGWCITKAVGLLLLGSAIAAAFADPLVDAVHNFSNASHIPSFFISFIALPLATNSSEAVS  476

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  + +SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ +
Sbjct  477   AIIFASRKKLRTSSLTFSEVYGGVTMNNTLCLGVFLALIYIRNLTWDFSSEVLIILLVCV  536

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              +G    FKTT+ LWT + A+ LYP SL + Y+L  + GW+
Sbjct  537   IMGLFTSFKTTFPLWTCLVAYMLYPLSLVVVYILDFVFGWS  577



>emb|CDM82192.1| unnamed protein product [Triticum aestivum]
Length=579

 Score =   259 bits (662),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 175/522 (34%), Positives = 286/522 (55%), Gaps = 28/522 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G +F ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  66    CEQTYGFLPCTTTVFGNMFLVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILG  125

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D   +   
Sbjct  126   ALPDALLVLVSGLSGTKETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCD-VGENGV  184

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   GI+TD  TS+ A +M +S++PFV+ +   ++ +  G+R+
Sbjct  185   AIDSTDTKGF------SLTGSGITTDVQTSYAARIMAISVIPFVIAQFPKMLKTHHGERL  238

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +L+ALI + + +L Y  YQ+  P +QKR L Y++ ++                LL  +G
Sbjct  239   AILLALIASFSLVLGYCLYQVFQPWVQKRKLAYAKHKHVISGILQHAQKQALGRLLNDDG  298

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNS  848
              PN + IR  FH  D+D+++ +S  EL   +  I  +E+   +  AV  +M D D  GN 
Sbjct  299   SPNENVIRKLFHKIDNDDSRNLSRAELHALIIGINFEEIDFDKNDAVDKIMDDFDTSGND  358

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa-geveqaggEK  671
              + E EF+ G++  L        A+ A       ND   ++ E+ +       E     +
Sbjct  359   TVEEDEFVAGMKIWLHEAKQKVEASGAYSNKFV-NDYHARTREDHDQLVDRSDEAVESVE  417

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W     V  ++LG  I    A PL+  V  FS A  +P+F +SF+ LP+  N   A+
Sbjct  418   NPGWCIAKAVGYLLLGATICAAFADPLVDAVHNFSNATHIPSFFVSFIGLPLATNSSEAV  477

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y RELTWD+S+EVLV+ ++ 
Sbjct  478   SAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRELTWDFSSEVLVILLVC  537

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G    F+T++ LWT + A+ LYP +LA+ YVL  + GW+
Sbjct  538   VIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVYVLDFVFGWS  579



>ref|XP_003565462.1| PREDICTED: uncharacterized protein LOC100838274 [Brachypodium 
distachyon]
Length=582

 Score =   258 bits (659),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 180/522 (34%), Positives = 282/522 (54%), Gaps = 28/522 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G LF ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  69    CEQSYGFLPCTTTVFGNLFLVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILG  128

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D       
Sbjct  129   ALPDALLVLVSGLSGTKETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGPNNVA  188

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               S   T+ F      +L   GISTD  TS+ A +M +S++PFV+ +   ++ +  G+R+
Sbjct  189   IDST-DTKGF------SLTGAGISTDVQTSYAARIMAISVIPFVIAQFPKMLKTHHGERL  241

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +L+ALI + + +LAY  YQ+  P IQKR L Y++ ++                LL  +G
Sbjct  242   AILLALIASFSLVLAYCLYQVFQPWIQKRKLAYAKHKHVISGILKHAQMQALGRLLNDDG  301

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNS  848
              PN + IR  F+  D D +  +S  EL   +  I  +E+   +  AV  +M D D  GN 
Sbjct  302   TPNENVIRKLFYKIDMDESHNLSRSELHALIIGINFEEIDFDKDDAVDKIMDDFDTSGND  361

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa-geveqaggEK  671
              + E EF+ G++  L        A+ A       ND   ++ EE +       E     +
Sbjct  362   TVEEAEFIAGMKKWLNEAKRNVPASGAFSNKFV-NDYHARTREEHDQLVDRSDEAVESVE  420

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W     V  ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N   A+
Sbjct  421   NPGWCIAKAVGFLLLGGVICAAFADPLVDAVHNFSNATHIPSFFISFIALPLATNSSEAV  480

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ 
Sbjct  481   SAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVC  540

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G    F+T + LWT + A+ LYP SLA+ YVL  + GW+
Sbjct  541   VIMGLFTSFRTNFPLWTCLVAYLLYPLSLAVVYVLDYVFGWS  582



>ref|XP_008371442.1| PREDICTED: uncharacterized protein LOC103434855 [Malus domestica]
Length=564

 Score =   257 bits (657),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 180/496 (36%), Positives = 275/496 (55%), Gaps = 20/496 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA ++ G L  I++++ L+S+A+Q VS  S+  F+  GTGIFGA+ F +L
Sbjct  55    TCEPTYGFLPCATSVWGLLSLIIVYEVLLSLADQYVSKGSEFFFELFGTGIFGASAFHML  114

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
              + P++ M + +G+  +    +      + + AG+TI  LT++WG  V  G  D +  + 
Sbjct  115   GLIPQVGMVLVTGVTATTTTVEEMAEMNMGMLAGSTIMILTLIWGSVVAFGSYDLS--DS  172

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S S P  +   S     L   G+ TD  T  TA +M+LSL+PF++++L  +++S    R
Sbjct  173   QSSSNPEXKKPFS-----LTGSGVRTDVETRDTARIMMLSLIPFLILQLAKILTSTRAVR  227

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY----SRFEN----LLTQNGKPNVSRI  1001
             +V+LV+L+I  AFL  YF YQ   P IQ R   Y     R EN    LLT  G PNVS I
Sbjct  228   VVILVSLLIASAFLANYFIYQFFQPWIQSRRHEYLMRKYRLENILPSLLTVRGNPNVSNI  287

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNSRITEQEF  827
             +  FH  D ++N  +S+ EL   +  I  +E  +     V  +MK  D  G+++I E EF
Sbjct  288   KGLFHRIDKNHNTYISADELRALILGIQIEEFGLDDDDYVAEVMKQFDISGDAQIAETEF  347

Query  826   LNGIENLLannssadnaaaatptst--PENDDQEKSGEETNgaageveqaggEKMGTW-D  656
             +NGI   +     + N+      S     N   EK+ E+        ++       +W +
Sbjct  348   VNGISKWIDPVMPSANSKGHEHKSLFRRNNSKNEKTMEDQQTPLISKKKKTKGADKSWMN  407

Query  655   FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFP  476
              +  V  +ILG A+  F + PLM ++ +FS A  +P+F++S+VV+P+  N R+A+ ++  
Sbjct  408   LLKAVFLIILGTAMTVFLSMPLMVSLQEFSTAASIPSFVVSYVVIPLSTNYRLALTSVTS  467

Query  475   ASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGF  296
             A  ++  A SLT SEIYN V M+N+ GL+  LA+VY R L+WD SAEVLVV +IS  +G 
Sbjct  468   ARDRTENAISLTLSEIYNAVFMNNILGLVIFLALVYIRNLSWDVSAEVLVVLLISTAVGL  527

Query  295   LAYFKTTYQLWTSIFA  248
              A F   +  WTSI A
Sbjct  528   SASFSRKFPFWTSILA  543



>ref|XP_010062838.1| PREDICTED: uncharacterized protein LOC104450104 [Eucalyptus grandis]
 gb|KCW69970.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=577

 Score =   257 bits (657),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 187/535 (35%), Positives = 287/535 (54%), Gaps = 47/535 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  YGF PC  N  G LF I+++ YLM  A   +S  S+ + + LG G+ G  V  IL
Sbjct  58    TCDETYGFLPCTTNWIGNLFLILVYGYLMYTAATCLSGGSEMLLEILGPGLIGGLVLPIL  117

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  G  + AG+T+  LTV+WG CV+VG+ D   Q+ 
Sbjct  118   GALPDALLILVSGLSGSTETAQSQVSVGKGLLAGSTVMLLTVIWGSCVLVGKCD--LQDS  175

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  +  T+ F      +L   GI+ D  T   A +M++S++PF++++L+ +++S SG+ 
Sbjct  176   TAVDKLDTKGF------SLTGSGITIDDLTRRAAWIMVISVIPFLVIQLLQLLNSTSGRH  229

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL-----------------TQ  1028
             + VL+ALI++V  L++Y  YQ+  P I KR L Y +  + L                 T+
Sbjct  230   VAVLIALILSVVLLISYCLYQVFQPWILKRRLEYWQRRSALFLFLRHVKRHAPALARLTE  289

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDG  854
             +G+ N   +   F   D+D++++++  EL+ F   I  +E+      AV  +M   D   
Sbjct  290   DGEVNTEIVDQLFETIDTDDDKKLTCSELQAFAVGIRFEEIDLDANDAVDEIMAAFDTSR  349

Query  853   NSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggE  674
             + R+++ EF  GI+  L     A         +T +  D      +T             
Sbjct  350   DDRLSQDEFRKGIKKWLDEAVRAGKGFGLGRFNTTKIIDVADHRAKTEREQLLAG-----  404

Query  673   KMGTWDFIVTVLQ------------VILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISF  530
               G  D +V V++            +ILG  I    A PL+  V  FS A G+PTF ISF
Sbjct  405   --GQGDEVVKVVENAKMTSLKAVGLLILGTVIAAAFADPLVDAVDNFSDATGIPTFFISF  462

Query  529   VVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTW  350
             + LP+  N   A++AI  AS+K  + ASLTFSE+Y  VTM+NL  L   LA+VY R LTW
Sbjct  463   IALPLATNSSEAVSAIIFASRKKQETASLTFSELYGAVTMNNLLCLAVFLALVYIRGLTW  522

Query  349   DYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             D+++EV+V+ ++ + +G    F+ T+ LWT+  AF LYPFSLAL YVL  +LGW+
Sbjct  523   DFTSEVIVIVIVCIVMGVFGSFRNTFPLWTASVAFVLYPFSLALVYVLDYVLGWS  577



>gb|KHG25681.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   257 bits (657),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 185/521 (36%), Positives = 284/521 (55%), Gaps = 31/521 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC   + G +F I+++ YLM +A   +S  S+ + + LG GI G     +L
Sbjct  60    SCEQSYGFLPCTTTVLGNMFLIIVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPML  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG C+IVGR D      
Sbjct  120   GALPDAMLILVSGLSGTAETAQSQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDL----H  175

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             DS +   T +   N    L E G+STD  T + A +M +S++PF++V+L   +SS SG+ 
Sbjct  176   DSVAIDGTNTKGFN----LKESGVSTDIWTCYAARIMAISVIPFLIVQLPQALSSTSGRH  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALII++  L++Y  YQ+  P IQ+R L +++ ++                LLT +
Sbjct  232   LAVLIALIISLLMLVSYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKKHALGRLLTDD  291

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   IR  F   D +++  +S  EL   +  I  +E+   +  AV  ++ D D   +
Sbjct  292   GEPDTEIIRKLFETIDENHDGGLSPSELRALIIGIRFEEIDLDQDDAVSKVIADFDTSRD  351

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDD---QEKSGEET--Ngaageveq  686
             + + E EF+ GI   +        A   + T T +  D   Q+   E           E 
Sbjct  352   NLVQEDEFVEGITKWINEAKQTGGAYLESNTGTFKFIDHFHQQTKREHALLGSEEQSDEV  411

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 +   W  I  VL ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N
Sbjct  412   VENVENPRWISIKAVLMLLLGTLIAAAFADPLVDAVDNFSEATSIPSFFISFIALPLATN  471

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+K  + ASLTFSE+Y  VTM+N+  L   LA+VY R LTWD+S+EVLV
Sbjct  472   SSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNVLCLSVFLALVYVRGLTWDFSSEVLV  531

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             + ++ + +G  A F+TT+ LWT   A+ LYPFSL L YVL 
Sbjct  532   ILIVCVVMGAFASFRTTFPLWTCSVAYILYPFSLGLVYVLD  572



>dbj|BAJ93500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   257 bits (657),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 178/522 (34%), Positives = 288/522 (55%), Gaps = 28/522 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G +F ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  66    CEQSYGFLPCTTTVFGNMFLVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILG  125

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+TIF LT+LWG CV+VG+ D   +   
Sbjct  126   ALPDALLVLVSGLSGTKETAQSQVLIGMGLLAGSTIFLLTLLWGTCVVVGKCD-VGENGV  184

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   GI+TD  TS+ A +M +S++PFV+ +L  ++ +  G+R+
Sbjct  185   AIDSTDTKGF------SLTGSGITTDVQTSYAARIMAISVIPFVIAQLPKMLKTHHGERL  238

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +L+ALI++ + +L Y  YQ+  P +QKR L Y++ ++                LL  +G
Sbjct  239   AILLALIVSFSLVLGYCLYQVFQPWVQKRRLAYAKHKHVISGILQHAQKQALGRLLNDDG  298

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNS  848
               N + IR  FH  D+D+++ +S  EL   +  I  +E+   +  AV  +M D D  GN 
Sbjct  299   SANENVIRKLFHKIDNDDSRNLSRAELHALIIGINFEEIDFDKNDAVDKIMDDFDTSGND  358

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa-geveqaggEK  671
              + E EF+ G++  L    S   A+ A       ND   ++ EE +       E     +
Sbjct  359   TVEEDEFVAGMKIWLHEAKSKVAASGAYSNKFV-NDYHARTREEHDQLVDRSDEAVESVE  417

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W     V  ++LG  I    A PL+  V  FS A  +P+F +SF+ LP+  N   A+
Sbjct  418   NPGWCIAKAVGYLLLGATICAAFADPLVDAVHNFSNATHIPSFFVSFIGLPLATNSSEAV  477

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y RELTWD+S+EVLV+ +  
Sbjct  478   SAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRELTWDFSSEVLVILLAC  537

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G    F+T++ LWT + A+ LYP +LA+ YVL  + GW+
Sbjct  538   VIMGLFTSFRTSFPLWTCLVAYLLYPLTLAIVYVLDFVFGWS  579



>ref|XP_006348283.1| PREDICTED: uncharacterized protein LOC102600810 [Solanum tuberosum]
Length=589

 Score =   257 bits (656),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 184/529 (35%), Positives = 290/529 (55%), Gaps = 39/529 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC +   G +F I+++ YLM  A   +SS S+ + + LG G+ G     IL 
Sbjct  73    CEQSYGFLPCTKTALGNVFLIIVYGYLMFSAATYLSSGSELLLEILGPGLIGGLFLPILG  132

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RAT  1346
               P  ++ + SGI  S   AQ+QV  GI + AG+T+  LTV+WG C IVG+ D     A 
Sbjct  133   ALPDAMLILVSGITGSAAEAQSQVSVGIGLLAGSTVMLLTVIWGTCCIVGKCDIENSTAV  192

Query  1345  QEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
               KD++    T S            G++TD  TS+ A +M +S++PF++V+L  +  S S
Sbjct  193   DLKDTKGLSLTGS------------GVTTDIWTSYAAMIMAISVLPFIVVQLPQLFHSNS  240

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LL  1034
             G+ + VL+ALII+++ LL+Y  YQ+  P IQ R L Y + ++                L 
Sbjct  241   GRHLAVLIALIISLSLLLSYCLYQVFQPWIQTRKLAYVKHKHVISGILKHLKKHALGRLF  300

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDR  860
             T +G PN+  +   F+  D + +  +S  EL   +  I  +E+  +   A+  ++KD D 
Sbjct  301   TDHGTPNIEVLEKLFNAIDENGDGHLSHSELRALVVGIRLEEINLEEDDAIAKVLKDFDT  360

Query  859   DGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaageveq  686
               + ++  QEF++G+E  L    S++ ++A    +T    +D  E++  E +    +   
Sbjct  361   SCDDQLDLQEFIDGVEKWLYEARSSNGSSAQAGPNTINYIDDFHEETRREHSLLGEDQSD  420

Query  685   aggEKMGTWD--FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
                E +       I   L ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+ 
Sbjct  421   ELVEGVENPRKVAIKAALLLLLGTIIAAVFADPLVDAVNNFSSATSIPSFFISFIALPLA  480

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N   A++AI  A++K  ++ASLTFSE+Y  VTM+NL  L   LA+VY+R L W++S+EV
Sbjct  481   TNSSEAVSAIIFATRKKKRSASLTFSELYGAVTMNNLLCLSVFLAIVYSRGLVWNFSSEV  540

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             LV+ ++ + +G L   +TT+ LWT + AF LYPFSL L YVL  + GW+
Sbjct  541   LVILIVCIVMGILGSIRTTFPLWTCLIAFALYPFSLVLVYVLDYVFGWS  589



>ref|XP_011096402.1| PREDICTED: uncharacterized protein LOC105175605 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   256 bits (654),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 177/515 (34%), Positives = 279/515 (54%), Gaps = 21/515 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC+ N+ G LF IV +++L+S+  + V++ S   F   G GIFGA++F+ L
Sbjct  57    TCEPTYGFLPCSTNVWGLLFLIVAYEFLLSLGGRYVATGSDLFFKITGPGIFGASLFQFL  116

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
                P+I++ + S +  S E AQ +   G+ + AG T+  LT++WG  V++G  D  A   
Sbjct  117   GTIPQIVLILVSTLSGSLEAAQQRASLGMGLVAGTTVMLLTLIWGTSVVLGSYDLSAAIT  176

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
              D    P +          L   GI TD  TS+TA +ML++LVPF+++ L  V +S SG+
Sbjct  177   IDKSGSPKSN---------LKGFGIVTDVETSYTARIMLIALVPFLILLLAKVFNSLSGR  227

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-------SRFENLLTQNGKPNVSRI  1001
             R+++L+ALI+T   L AY  YQI  P IQ R   Y        +   L + NGKP+  +I
Sbjct  228   RVIILIALIVTFVLLFAYIFYQIFQPWIQNRRFEYLMNKYAKDKLLRLFSTNGKPDTRKI  287

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKDLDRDGNSRITEQEF  827
             +  F+  D D ++ +S+ EL   L  +    D++     V+ +++  D  G+ RI++ EF
Sbjct  288   QDLFNKIDKDGSRSVSAAELRVLLLGVKMDDDDLSTDRDVENILESFDTSGDGRISQDEF  347

Query  826   LNGIENLLannssadnaaaatpt-stPENDDQEKSGEETNgaageveqaggEKMGTWDFI  650
             + G+  L+++ S            S  +N+ Q + G  TN       +         ++ 
Sbjct  348   IKGMTTLVSDISDQTPDRIKIGGGSNSQNNSQLQQGLLTNSTGTSTSKLQRVSNSWLNYS  407

Query  649   VTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPAS  470
               +  VI+G  +L    +PL+ +V+ FS A  +P+F +S++ +P  +N   AI +I  A 
Sbjct  408   RALFFVIVGTVMLCALGEPLIKSVVAFSQAANLPSFCVSYLAIPFALNYGAAIQSIASAR  467

Query  469   QKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLA  290
             QK+ K+ SLT S +Y GV M+N+ GL+  LA VYAR L  D  AE+LVV +I + +  L 
Sbjct  468   QKTQKSISLTLSALYGGVYMNNIMGLIVFLAPVYARNLQADSFAEILVVLIICILMTLLT  527

Query  289   YFKTTYQLWTSIFAFFLYPFSLAL-FYVLQLLGWN  188
              F+TT+  W       LYP SLAL F V  +L W+
Sbjct  528   SFRTTFPRWLGYLVLLLYPISLALIFLVTSVLNWS  562



>ref|XP_007050029.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOX94186.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=586

 Score =   256 bits (655),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 180/522 (34%), Positives = 283/522 (54%), Gaps = 30/522 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G +F I+++ YLM  A +L+    + + + LG GI G     +L
Sbjct  76    SCEQTYGFLPCTTTVLGNVFLILVYGYLMFRAAKLLCDGCEILLEILGPGIIGGLFLPVL  135

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ ++SG+  SQE AQ+QV  GI + AG+T+  LTVLWG C+I+G+ D   +  
Sbjct  136   SSLPDAIIILASGLSGSQETAQSQVSVGIGLLAGSTVMLLTVLWGSCLILGKCD--LESA  193

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S+    T+ F      +L   G+STD  TS+ A +M +S++PF++V+L  V+ + S  R
Sbjct  194   LSKDLVDTKGF------SLTGSGVSTDVWTSYAARIMAISIIPFIIVQLPAVLYTTSQSR  247

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             I +L+AL+++++ LL+Y  YQ+  P IQKR + +++ ++                LLT  
Sbjct  248   IAILIALVVSISLLLSYSLYQVFQPWIQKRRIAFAKHKHVIAGILKHLSVRALGRLLTDG  307

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGN  851
             G+PN S I   F + D + +  +S  EL   +  I  +E+   +  AV  ++K+ D   +
Sbjct  308   GEPNTSVIEKLFMMIDENGDGLLSPAELRALVLGIQFEEIDMDIEDAVDKVLKEFDTSCD  367

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEK  671
             S I   EF+ GI   L          A +      ++   K  E               K
Sbjct  368   SFIDIDEFVKGISKWLNEVRRTAEGQATSIHLHHFHEQTRK--EHHLLGGQSGHFGKTVK  425

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W+    V+ ++LG  +    A PL+  V  FS A  +P+F +SFV+LPI      A+
Sbjct  426   NPVWNAFKAVMTLLLGTIVAAVFADPLVDAVSSFSTASSIPSFFVSFVILPIASTSE-AV  484

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +A+    +K    ASLT+S+IY  VTMSN+  L   L +VY R+LTWD++AEVLV+ ++ 
Sbjct  485   SALNFTGRKQLTTASLTYSQIYGSVTMSNILSLSVFLGLVYFRDLTWDFAAEVLVILIVC  544

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +G +A F+TT+ LW S+ AF LYPFSL L YVL  + GW+
Sbjct  545   IVMGAIASFRTTFPLWMSLVAFALYPFSLLLVYVLDYIFGWS  586



>ref|XP_011096401.1| PREDICTED: uncharacterized protein LOC105175605 isoform X1 [Sesamum 
indicum]
Length=563

 Score =   255 bits (651),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 177/515 (34%), Positives = 279/515 (54%), Gaps = 20/515 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC+ N+ G LF IV +++L+S+  + V++ S   F   G GIFGA++F+ L
Sbjct  57    TCEPTYGFLPCSTNVWGLLFLIVAYEFLLSLGGRYVATGSDLFFKITGPGIFGASLFQFL  116

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
                P+I++ + S +  S E AQ +   G+ + AG T+  LT++WG  V++G  D  A   
Sbjct  117   GTIPQIVLILVSTLSGSLEAAQQRASLGMGLVAGTTVMLLTLIWGTSVVLGSYDLSAAIT  176

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
              D    P +   A          GI TD  TS+TA +ML++LVPF+++ L  V +S SG+
Sbjct  177   IDKSGSPKSNLKAG--------FGIVTDVETSYTARIMLIALVPFLILLLAKVFNSLSGR  228

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-------SRFENLLTQNGKPNVSRI  1001
             R+++L+ALI+T   L AY  YQI  P IQ R   Y        +   L + NGKP+  +I
Sbjct  229   RVIILIALIVTFVLLFAYIFYQIFQPWIQNRRFEYLMNKYAKDKLLRLFSTNGKPDTRKI  288

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKDLDRDGNSRITEQEF  827
             +  F+  D D ++ +S+ EL   L  +    D++     V+ +++  D  G+ RI++ EF
Sbjct  289   QDLFNKIDKDGSRSVSAAELRVLLLGVKMDDDDLSTDRDVENILESFDTSGDGRISQDEF  348

Query  826   LNGIENLLannssadnaaaatpt-stPENDDQEKSGEETNgaageveqaggEKMGTWDFI  650
             + G+  L+++ S            S  +N+ Q + G  TN       +         ++ 
Sbjct  349   IKGMTTLVSDISDQTPDRIKIGGGSNSQNNSQLQQGLLTNSTGTSTSKLQRVSNSWLNYS  408

Query  649   VTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPAS  470
               +  VI+G  +L    +PL+ +V+ FS A  +P+F +S++ +P  +N   AI +I  A 
Sbjct  409   RALFFVIVGTVMLCALGEPLIKSVVAFSQAANLPSFCVSYLAIPFALNYGAAIQSIASAR  468

Query  469   QKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLA  290
             QK+ K+ SLT S +Y GV M+N+ GL+  LA VYAR L  D  AE+LVV +I + +  L 
Sbjct  469   QKTQKSISLTLSALYGGVYMNNIMGLIVFLAPVYARNLQADSFAEILVVLIICILMTLLT  528

Query  289   YFKTTYQLWTSIFAFFLYPFSLAL-FYVLQLLGWN  188
              F+TT+  W       LYP SLAL F V  +L W+
Sbjct  529   SFRTTFPRWLGYLVLLLYPISLALIFLVTSVLNWS  563



>gb|ACY66874.1| P20Sh095F0 [Saccharum hybrid cultivar R570]
Length=573

 Score =   255 bits (651),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 178/520 (34%), Positives = 284/520 (55%), Gaps = 27/520 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G LF ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  63    CEQSYGFLPCTTTVLGNLFLVLTYGFLMYKAATYLSTGSELLLEIMGPGLVGGLLLPILG  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D     ++
Sbjct  123   ALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPT-RE  181

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   GI+TD  TS+ A +M LS++PF++ +   ++ +  GQR+
Sbjct  182   AVDLTDTKGF------SLTGTGITTDVQTSYAARIMGLSVIPFIIAQFPKMLKTHHGQRL  235

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--------------LLTQNGKP  1016
              +L+ALI++   + +Y  YQ+  P IQ+R L Y++ ++              LL  +G P
Sbjct  236   AMLLALIVSFLLVFSYCLYQVFQPWIQRRKLAYAKHKHVISGILKHAQALGRLLNDDGTP  295

Query  1015  NVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRI  842
             N   IR  FH  D D ++ +S  EL   +  I  +EV+  R  AV  +M D D   N  +
Sbjct  296   NEDVIRKLFHKIDMDESRSLSRAELHALIVGINFNEVEFDRTDAVDKVMADFDTSRNDIV  355

Query  841   TEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev-eqaggEKMG  665
              E+EF+ G++  L           A       N+  E++ +E N       E     +  
Sbjct  356   EEEEFVQGMKKWLNEAKRHMPVGGAFSNKL--NEYHERTRQEHNELVDRSDEAVETVENP  413

Query  664   TWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAA  485
              W     V  ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+  N   A++A
Sbjct  414   GWCITKAVALLLLGAAIAAAFADPLVDAVHNFSNATHIPSFFISFIALPLATNSSEAVSA  473

Query  484   IFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLT  305
             I  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ + 
Sbjct  474   IIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVCVV  533

Query  304   IGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             +     F+TT+ LWT + A+ LYPFSL + Y+L  + GW+
Sbjct  534   MALFTSFRTTFPLWTCLVAYMLYPFSLVIVYILDYVFGWS  573



>dbj|BAI94501.1| sodium/calcium exchanger protein [Dianthus caryophyllus]
Length=581

 Score =   255 bits (651),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 179/525 (34%), Positives = 273/525 (52%), Gaps = 32/525 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC     G +F I ++ YLM +A   +S  S+ + + LG GI G     +L 
Sbjct  66    CEQTYGFLPCTTTWAGNMFLIGVYGYLMYLAATFLSDGSELLLEILGPGIVGGLFLPVLG  125

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SGI  S   AQ+QV  G+ + AG+T+  LTV+WG C+++G+ D    E  
Sbjct  126   ALPDAMLILVSGISGSTSEAQSQVSVGMGLLAGSTVMLLTVIWGTCILIGKCDMDGTEAI  185

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               +   T+ F      +L   G+STD  TS+ A +M++S++PF++V+L   + S SG+ +
Sbjct  186   DLTD--TKGF------SLLGSGVSTDTWTSYAARIMVISVLPFLVVQLPQALHSDSGRHL  237

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT-----------------QN  1025
              VL  LI++V  L++Y  YQ+  P  Q+R L Y + + L+T                  +
Sbjct  238   AVLFGLILSVLMLISYCVYQVFQPWAQERRLDYVKHKRLMTGFLKHLLQKHPVDRLFNSD  297

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKF---LRLIVTDEVQRMVAVKTMMKDLDRD-  857
             G PN   +   F   D D +  +S  EL  F   +RL      +  +A K ++K  D + 
Sbjct  298   GTPNHEVMEQIFKAIDQDGDTHLSKGELRAFVIGMRLEGVSLEEEDIAEK-ILKAFDTER  356

Query  856   GNSRITEQEFLNGIENLLannssadnaaaa-tptstPENDDQEKSGEETNgaageveqag  680
              + RI   EF+ GI  L        +           +  D+E   E         E   
Sbjct  357   HDDRIDLDEFIKGISKLFTTVRGDRSMHHNGDALEHLDRYDEESKREHLLLGEANEEGGE  416

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               +      I  V+ +++G  I    A PL+  V  FS A  +P+F ISF+ LP+  N  
Sbjct  417   EIENPKKTTIKAVIFLVIGTLIAAAFADPLVDAVDNFSTATSIPSFFISFIALPLATNSS  476

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
              A++AI  AS+K  ++ASLTFSE+Y   TM+N+  L   LA+VY R L+WD+S+EVLV+F
Sbjct  477   EAVSAIIFASRKKRRSASLTFSELYGAATMNNVLCLSVFLALVYVRGLSWDFSSEVLVIF  536

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             ++   +G L  FKT++ LWT+  AFFLYPFSL L YVL  + GW+
Sbjct  537   LVCTIMGALGSFKTSFPLWTASIAFFLYPFSLVLVYVLDYVFGWS  581



>ref|XP_010549555.1| PREDICTED: uncharacterized protein LOC104820693, partial [Tarenaya 
hassleriana]
Length=580

 Score =   254 bits (650),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 184/553 (33%), Positives = 293/553 (53%), Gaps = 51/553 (9%)
 Frame = -1

Query  1765  NQSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVS  1586
             + + DQS FL L  P  S S  +TC H YGF PCAEN+ GY+FQ+  F  L+ V +  +S
Sbjct  37    DSASDQSEFLGLE-PIKSVSDDNTCVHVYGFLPCAENVAGYVFQVFSFGCLLIVGDYFLS  95

Query  1585  SSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATI  1406
                 K+F  L  G +G  VF +L++FPRI + +S+G+  S+EGA++ V   + V  G T+
Sbjct  96    EGRSKLFVILDVGFYGGIVFPLLIMFPRIALMLSTGLTASREGAKSMVVNIVGVTVGYTV  155

Query  1405  FNLTVLWGLCVIVGRRDRATQE-----KDSQSQPST--QSFAS-NWLKTLNECGISTDAS  1250
             F LTV WG C + G     +       K + S P++  +SF   N LK L +  +  D+ 
Sbjct  156   FALTVQWGACFVFGMSSSNSSXXXXPIKRTTSDPTSPRRSFYKLNMLKRLFDSSVRADSG  215

Query  1249  TSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQK  1070
                 AG+MLL+L PF++V+L  +  S + + +VVL+ LII+ +  + YF Y   D   Q+
Sbjct  216   NKQAAGVMLLTLTPFIMVQLSEIFDSPAWRHVVVLITLIISASATILYFIYSYYDMDEQR  275

Query  1069  RSLHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF  932
             ++L  SRFE +              L ++G+ N   ++  F+ +D++N+ ++ + EL+  
Sbjct  276   KALKLSRFELMSDVVKHLQHFSPESLLRDGQLNEESLKSLFNKFDTNNDGKIQASELKD-  334

Query  931   LRLIVTDEVQRMVAVK--------TMMKDLDRDGNSRITEQEFLNGIENLLannssadna  776
                 VT E   +  +K        +++++ D++ +  I E+EF  GI   L         
Sbjct  335   ----VTVEFGLLGRIKCDIHELANSLLQEFDKNNDGEIDEREFKKGITKWLKEQKFNC--  388

Query  775   aaatptstPEND----DQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILT  608
                      +ND    +Q +  E         ++   EK+ +   +    QV++G+ I+ 
Sbjct  389   ---------DNDSSTYNQTEDSESAVLKVEGPKKELVEKLLSGKTLRAATQVVVGILIVI  439

Query  607   FCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEI  428
             F A+P M N+   S + G+P+F I+FV++P+  N +  ++A F   +  +   SLTFSEI
Sbjct  440   FLARPFMMNIELLSISAGIPSFYIAFVMIPLSRNLKNVLSAHFCRRKDKAIVTSLTFSEI  499

Query  427   YNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFA  248
             Y  VTM+NL G+  +LA+VY R L WDYS EVL+  V+ L IG  AY ++ Y     I A
Sbjct  500   YRDVTMNNLMGMSIILAIVYTRGLGWDYSTEVLITVVVGLIIGLPAYIRSNYSFPICILA  559

Query  247   FFLYPFSLALFYV  209
             F LY  SL L Y+
Sbjct  560   FVLYLASLVLVYL  572



>ref|XP_004305436.1| PREDICTED: uncharacterized protein LOC101295737 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   253 bits (647),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 280/530 (53%), Gaps = 40/530 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   + G +F I+++ Y+M ++ +L+S+ S+ +   LG GI G     +L
Sbjct  58    SCDETYGFLPCTSTVLGNIFLIIVYGYVMFLSAKLLSAGSEILLQILGPGIIGGLFLPLL  117

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDR----A  1349
                P   + ++SG+      AQ+QV  G+ + AG+ +  LT+LWG C+IVG+ D     A
Sbjct  118   SAVPDATIILASGLSGDTATAQSQVSVGMGLLAGSNVMLLTILWGTCLIVGKCDLENSVA  177

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
               EKD      T+SF      +L   G+STD  TS+ AG+M++S++PFV+V+L  V  + 
Sbjct  178   VDEKD------TKSF------SLTGSGVSTDIWTSYAAGIMVISIIPFVIVQLPQVFPTT  225

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----------------  1037
             S   + VL++LI+ + F++AY  YQ+  P IQKR L Y++ +++                
Sbjct  226   SDSSLPVLISLIVAICFVIAYSIYQVFQPWIQKRKLAYAKHKHMMSEILKQLRTNALGRF  285

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRM---VAVKTMMKDL  866
             LT +G P+   I   F   D +++  +++ +L   +  I  D+ + +    A   +MKD 
Sbjct  286   LTDDGAPDKVVIEKLFRTLDLNSDGYLNTTDLRSLIIGIEFDDGEDININEATSLVMKDF  345

Query  865   DRDGNSRITEQEFLNGIE---NLLannssadnaaaatptstPENDDQEKSGEETNgaage  695
             D   +S+I   EF  GI    N   + +  D           ++ D++   E+       
Sbjct  346   DTTHDSKIDVDEFFKGISRWINKAKHAAMMDRGKVPLSMKLLDDYDKQTKEEQDRYGDHI  405

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
              E     K   W     VL ++LG  +    A PL+  V  FS A  +PTF +SFV+LP 
Sbjct  406   DEIVEDVKNAPWHASKAVLMLLLGTILAAVVADPLVDAVDNFSTATSIPTFFVSFVILPF  465

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
             V +  +    IF  S+K  ++ASL +SEIY  VTMSN+  L   L +VY R LTW +SAE
Sbjct  466   VSSSEIVSTLIF-VSRKKQRSASLAYSEIYGSVTMSNILSLAVFLGLVYIRNLTWSFSAE  524

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             VLV+ ++ + +G +A  +TT+ +W    A  LYP SL L Y+L+ + GW+
Sbjct  525   VLVIIIVCILMGVVACCRTTFPVWLCFGAVMLYPLSLLLVYILEYVFGWS  574



>ref|XP_002451861.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
 gb|EES04837.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
Length=562

 Score =   253 bits (645),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 165/503 (33%), Positives = 263/503 (52%), Gaps = 24/503 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +  PG LF ++ + +LM  A   +S+ S+ +   LG GI G     IL 
Sbjct  83    CEMTYGFLPCTDTAPGNLFLVLAYGFLMFKAATYLSAGSELLLQILGPGIVGGLFLPILG  142

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D +     
Sbjct  143   ALPDAMLILVSGLSGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTA  202

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               S+  T+ F      +L   G+STD  TS+ A +M +S++PF++V++  +    SG R+
Sbjct  203   IDSR-DTKGF------SLFGSGVSTDVQTSYAARIMAISVLPFIIVQIPQIFKLHSGHRL  255

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLTQNGKPNVSRIRLFFHLYDS  974
              VL+ LI+    +LAY  YQI  P IQ+R L Y+  +++++  G    +++ +F  L   
Sbjct  256   AVLLGLIVAAVLVLAYCLYQIFQPWIQRRRLEYAGLKHVMS--GVLRHAQMHVFGRLLHE  313

Query  973   DNNQQMSSRELEKFLRLIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             D    +                ++  +AV  +M D DR  N  I + EF++GI   L   
Sbjct  314   DGTPNIPV--------------IENNLAVDQVMADFDRSHNFVIEKGEFIDGILRWLEEA  359

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
               +   + +      ++       E       +       +  TW     +  ++LG A+
Sbjct  360   KRSVVTSGSYSKKFLQDFHTRTRDEHNLLLGNDDNDVEAIENPTWTSFKAISLLLLGTAM  419

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
                 A PL+  V  FS A  +P+F ISF+ +P+  N   A++AI  AS+K  +  SLTFS
Sbjct  420   AAAFADPLVDAVHGFSNATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFS  479

Query  433   EIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             E+Y GVTM+N   L   L +VY R LTWD+S+EVL++F++   +G    F+T + LWT  
Sbjct  480   EVYGGVTMNNTLCLAVFLGLVYVRGLTWDFSSEVLIIFLVCTIMGLFTSFRTNFPLWTCF  539

Query  253   FAFFLYPFSLALFYVLQL-LGWN  188
              A+ LYP SL + YVL    GW+
Sbjct  540   VAYLLYPLSLVIVYVLDYKFGWS  562



>ref|XP_008463718.1| PREDICTED: uncharacterized protein LOC103501799 [Cucumis melo]
Length=590

 Score =   253 bits (646),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 188/527 (36%), Positives = 286/527 (54%), Gaps = 32/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC     G LF I+++ YLM +A + +S+ S+ + + LG GI G      L
Sbjct  72    SCEQSYGFLPCTTTALGNLFLIIVYGYLMFLAAKYLSTGSELLLEILGPGIVGGLFLPAL  131

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   Q+ 
Sbjct  132   GALPDAMLILVSGLAGSAEVAQSQVSVGMGLLAGSTVMLLTLIWGTCVIVGKCD--LQDS  189

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L E G+STD  TS+ A +M++S+VPF++V+L  +++S SG+ 
Sbjct  190   VAIDSQDTKGF------SLTESGVSTDIWTSYAARIMVISVVPFLIVQLPQMLNSTSGRH  243

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI++V+  + Y  YQ+  P IQ+R L + + ++                LLT+N
Sbjct  244   LAVLIALIVSVSMFITYCLYQVFQPWIQRRKLAFVKHKHVIFGFLRHLKQQTLGRLLTEN  303

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G+P+   I   F   D + +  +S+ EL   +  I  DE+      AV  +M D D   +
Sbjct  304   GEPDKEIIEKLFSRIDVNKDGLLSASELRALIVGIQFDEIDLDHDDAVDKIMNDFDTSRD  363

Query  850   SRITEQEFLNGIENLLannssadn---aaaatptstPENDDQEKSGEET--Ngaageveq  686
             S +   EF NGI   L+    +                N  QE   E    +      E 
Sbjct  364   SHVDSNEFGNGIIRWLSQVQGSRTGRGDDGPHTMKYLHNFHQETKREHDLLDVGEQSDEV  423

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
               G + G    I  +L ++LG AI    A PL+  V  FS A  +P F ISF+ LP+  N
Sbjct  424   VEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVHNFSNATKIPAFFISFIALPLATN  483

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+   K ASLTFSE+Y  VTM+N+  L   LA+VY R L W++S+EVLV
Sbjct  484   SSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCLSVFLALVYLRGLVWNFSSEVLV  543

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + V+++ +G +  F+T + LWTS+ A  LYPFSL L YVL  + GW+
Sbjct  544   ILVVTVVMGVMGSFRTAFPLWTSLVALLLYPFSLVLVYVLDYVFGWS  590



>ref|XP_008673552.1| PREDICTED: uncharacterized protein LOC103649588 [Zea mays]
Length=575

 Score =   252 bits (643),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 180/522 (34%), Positives = 285/522 (55%), Gaps = 28/522 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G LF ++ + YLM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  62    CEQSYGFLPCTTTVLGNLFLVLTYGYLMYKAATYLSAGSELLLEIMGPGLVGGLLLPILG  121

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D     ++
Sbjct  122   ALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPN-RE  180

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   GI+TD  TS+ A +M LS++PF++ +   ++ +  GQR+
Sbjct  181   AVDVTDTKGF------SLTGTGITTDVQTSYAARIMGLSVIPFIIAQFPKMLKTHHGQRL  234

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +L+ALI++   +L+Y  YQ+  P IQ+R L Y++ ++                LL  +G
Sbjct  235   AMLLALIVSFLLVLSYCLYQVFQPWIQRRKLAYAKHKHVISGILRHAQMQSLGRLLNDDG  294

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
              PN   IR  F   D D ++ +S  EL   +  I  +EV   R  AV  +M D D   N 
Sbjct  295   TPNDDVIRKLFRKIDMDQSESLSRAELHALIVGINFEEVDFDRTDAVDKVMDDFDTSRND  354

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev-eqaggEK  671
              + ++EF+ G++  L     +     A  T    N+  E++ +E N       E     +
Sbjct  355   VVEQEEFVQGMKKWLNEAKRSVPVGGAFSTKFI-NEYHERTRQEHNELVDRSDEAVESVE  413

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W     V  ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+  N   A+
Sbjct  414   NPGWCIAKAVALLLLGAAIAAAFADPLVDAVHNFSNATHIPSFFISFIALPLATNSSEAV  473

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ 
Sbjct  474   SAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVC  533

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + +     F+TT+ LWT + A+ LYPFSL L Y+L  + GW+
Sbjct  534   VVMALFTSFRTTFPLWTCLVAYMLYPFSLVLVYILDYVFGWS  575



>gb|EYU44997.1| hypothetical protein MIMGU_mgv1a003664mg [Erythranthe guttata]
Length=571

 Score =   251 bits (642),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 185/533 (35%), Positives = 286/533 (54%), Gaps = 48/533 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC     G LF I+++ YLM +A   +S+ S+ + + LG GI G     IL
Sbjct  57    TCEQTYGFLPCTSTGLGNLFLILVYGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPIL  116

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGR----RDRA  1349
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  +TV+WG C+IVG+     D A
Sbjct  117   GALPDAMLILVSGLSGSVETAQSQVSVGMGLLAGSTVMLITVIWGTCIIVGKCDIENDLA  176

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
                +D++    T S            GI+TD  TS+   +M +S++PFV+V+L  ++ S 
Sbjct  177   IDSRDTKGLSLTGS------------GITTDVWTSYAGIIMAISVIPFVIVQLPQILHSD  224

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL---------------  1034
             SG+ + VL+ALI++V  L++Y  YQ+  P +Q+R L + + ++++               
Sbjct  225   SGRHLSVLIALIVSVTSLISYCLYQVFQPVVQRRRLAFVKHKHVISGILRQLKMRSLGRL  284

Query  1033  -TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLD  863
              T +GKPN   +   F   D +++  +S  EL   +  I  +E+      A+  ++KD D
Sbjct  285   STDDGKPNEEVLTKLFKAIDENDDGFLSQAELRALIVGIQFNEINMDEDDALAKVIKDFD  344

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPEND-------DQEKSGEETNga  704
                +S++   EF+ GI   L     A   +    +    +D       + E  GE+++  
Sbjct  345   TSLDSQVDLNEFVAGIGKWLEEAKGARGGSNQAGSMKYIDDYHKQTKREHELLGEQSDEI  404

Query  703   ageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVV  524
                VE            I   L ++LG  I    A PL+  V  FS A  +PTF ISF+ 
Sbjct  405   VEGVENPRSTS------IKAGLLLLLGTLIAAAFADPLVDAVDNFSAATSIPTFFISFIA  458

Query  523   LPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDY  344
             LP+  N   A++AI  AS+K  ++ASLTFSE+Y  VTM+N   L   L +VY R LTWD+
Sbjct  459   LPLATNSSEAVSAIIFASRKKIRSASLTFSELYGAVTMNNALCLSVFLGLVYVRGLTWDF  518

Query  343   SAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             S+EVLV+ ++ + +G  A  +TT+ LWT+I AF LYPFSLAL YVL  + GW+
Sbjct  519   SSEVLVILIVCIVMGVFASVRTTFPLWTAILAFLLYPFSLALVYVLDYVFGWS  571



>ref|XP_006358955.1| PREDICTED: uncharacterized protein LOC102579474 [Solanum tuberosum]
Length=577

 Score =   251 bits (642),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 179/525 (34%), Positives = 285/525 (54%), Gaps = 30/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC +   G +F I+++ YLM +    +SS S+ + + LG GI G     +L
Sbjct  61    SCEQSYGFMPCTKTALGNVFLILVYGYLMFLGATYLSSGSELLLEILGPGIIGGLFLPVL  120

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SGI  S   AQ+QV  G+ + AG+T+  +T++WG C IVG+ D   Q  
Sbjct  121   GALPDAMLILVSGISGSTAAAQSQVSVGMGLLAGSTVMLITIIWGTCCIVGKCD--IQNS  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L   G+STD  TS  A +M  S+ PF++V+L  ++ S SG+ 
Sbjct  179   VAVDMKDTRGF------SLTGSGVSTDIWTSHAATIMAASVTPFLVVQLPQLLHSTSGRH  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ LII+++ L++Y  YQ+  P IQ R L Y + ++                L T  
Sbjct  233   LSVLIGLIISLSLLVSYCVYQVFQPWIQSRRLAYVKHKHVISGVLKQLRMRALGRLCTDQ  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G PN+  +   F   D + +  +S  EL+  +  I  +E+      A++ +MKD D   +
Sbjct  293   GAPNIEVLEKLFKAIDENEDGYLSRAELKALVVGIRLEEINLHENDAIEKLMKDFDTSHD  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNgaageveqagg  677
              RI   EF+ G+   L     ++ ++      T +  +D  E++  E +    + +++  
Sbjct  353   HRIEMSEFIAGVTKWLTEARGSEASSPEAGPDTMKYLDDLHEQTRREHHFLGDQSDESVE  412

Query  676   EKMGTWDFIV-TVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
                     ++  VL ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N  
Sbjct  413   TVENPRSTVIKAVLLLLLGTVIAAVFADPLVDAVNNFSSATSIPSFFISFIALPLATNSS  472

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
              A++AI  AS+K  ++ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S+EVLV+ 
Sbjct  473   EAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCLSVFLALVYIRGLTWDFSSEVLVIL  532

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             ++ + +G  A  ++T+ LWTS+ AF LYPFSL L YVL    GW+
Sbjct  533   IVCVVVGVFASVRSTFPLWTSLLAFLLYPFSLVLVYVLDYKFGWS  577



>ref|XP_009353170.1| PREDICTED: uncharacterized protein LOC103944425 [Pyrus x bretschneideri]
Length=628

 Score =   253 bits (645),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 174/496 (35%), Positives = 274/496 (55%), Gaps = 20/496 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA ++ G L  I++++ L+S+A+Q VS  S+  F+  GTGIFGA+ F +L
Sbjct  119   TCEPTYGFLPCATSVWGLLSLIIVYEVLLSLADQYVSKGSEFFFELFGTGIFGASAFHML  178

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
              + P++ M + +G+  +    +      + + AG+TI  LT++WG  V  G  D +  + 
Sbjct  179   GLIPQVGMVLVTGVTATSTTVEEMAEMSMGMLAGSTIMILTLIWGSVVAFGSYDLSDSQT  238

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S  + + + F      +L   G+ TD  T  TA +M+LSL+PF++++L  +++S    R
Sbjct  239   SSNPE-NKKPF------SLTGSGVRTDVETQDTARIMMLSLIPFLILQLAKILTSTRAVR  291

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY----SRFEN----LLTQNGKPNVSRI  1001
             +V+LV+L+I  AFL  YF YQ   P IQ R   Y     R EN    LLT  G PNVS I
Sbjct  292   VVILVSLLIASAFLANYFIYQFFQPWIQSRRHEYLMRKYRPENILPSLLTVRGNPNVSNI  351

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNSRITEQEF  827
             +  FH  D +++  +S+ EL   +  I  +E  +     V  +MK  D  G+++I E +F
Sbjct  352   KGLFHRIDKNHSTYISADELRALILGIQIEEFGLDDDDYVAEVMKQFDISGDAQIAETDF  411

Query  826   LNGIENLLannssadnaaaatpts--tPENDDQEKSGEETNgaageveqaggEKMGTW-D  656
             +NGI   +     + N+      S     N   EK+ E+        ++       +W +
Sbjct  412   VNGISKWINPVMPSANSKGHEHKSLFRRNNSKNEKTKEDQQTPLISKKKKTKGADKSWMN  471

Query  655   FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFP  476
              +  V  + LG A+  F + PLM ++ +FS A  +P+F +S+VV+P+  N R+A+ ++  
Sbjct  472   LLKAVFLITLGTAMTVFLSMPLMVSLQEFSTAASIPSFAVSYVVIPLSTNYRLALMSVTS  531

Query  475   ASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGF  296
             A  ++  A SLT SEIYN   M+N++GL+  LA+VY R L+WD SAEVLVV +IS  +G 
Sbjct  532   ARDRTENAISLTLSEIYNAAFMNNISGLVVFLALVYIRNLSWDVSAEVLVVLLISTAVGL  591

Query  295   LAYFKTTYQLWTSIFA  248
              A F   +  WTSI A
Sbjct  592   SASFSRKFPFWTSILA  607



>ref|XP_010234099.1| PREDICTED: uncharacterized protein LOC100833492 isoform X2 [Brachypodium 
distachyon]
Length=666

 Score =   254 bits (648),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 183/548 (33%), Positives = 281/548 (51%), Gaps = 53/548 (10%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC     G LF  + + +LM  A   +S+ S+ + + LG GI G     IL 
Sbjct  126   CEMTYGFLPCTTTAGGNLFLALAYGFLMFKAATYLSAGSELLLEILGPGIVGGLFLPILG  185

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SGI  ++E AQ+QV  G+ + AG+T+  LTVLWG CV+VG+ D  T++  
Sbjct  186   ALPDALLILVSGISGTKEVAQSQVLIGMGLLAGSTVMLLTVLWGSCVVVGKCD-LTEDST  244

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
                   T+ F      +L   G+STD  TS+ A +M +S++PF++V++  ++   SGQR+
Sbjct  245   PIDSRDTKRF------SLFGSGVSTDLQTSYAARIMAISVLPFIVVQIPKILRLHSGQRL  298

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
              +L+  I+ V  L+ Y  YQI  P IQ+R L YSR +++++                 +G
Sbjct  299   TILLGFIVAVLLLITYCLYQIFQPWIQRRKLEYSRLKHVMSGLLRHAQKHAFGRLFHDDG  358

Query  1021  KPNVS---------------------------RIRLFFHLYDSDNNQQMSSRELEKFLRL  923
              PNV                            +I   FH  D DN+ ++   E++ F+  
Sbjct  359   TPNVPVIEKYATGPHCAAYLHLIKEILLNDAVKICRLFHKIDLDNDGRIERGEIQAFIVG  418

Query  922   IVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstP  749
             +  +++     +A   +M D DR  NS I + EF++G+   L     A  A+ A      
Sbjct  419   VQFEDIDLDSNLAADQVMADFDRSQNSFIEKGEFVDGVLRWLEEAKRAVVASGAYSKKFM  478

Query  748   ENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQF  569
             E+       E       + E     +  TW     VL ++LG A+    A PL+  V  F
Sbjct  479   EDFHATARDEHAALLNKDEEDGEAIENRTWTCFKAVLLLLLGAAMAAAFADPLVDAVHNF  538

Query  568   SGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLL  389
             S A  +P+F ISF+ +P+  N   A++AI  AS+K  +  SLTFSE+Y GVTM+N   L 
Sbjct  539   SSATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLA  598

Query  388   SLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
               LA+VY R LTWD+S+EVLV+F++ + +G    F+T + LWT   AF LYP SL + Y+
Sbjct  599   VFLALVYLRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLLMVYI  658

Query  208   LQL-LGWN  188
             L    GW+
Sbjct  659   LDYKFGWS  666



>gb|ACY66868.1| P20Sh148J07 [Saccharum hybrid cultivar R570]
Length=563

 Score =   251 bits (640),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 177/520 (34%), Positives = 285/520 (55%), Gaps = 29/520 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC   + G LF ++ + + M  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  55    CEQSYGFLPCTTTVLGNLFLVLTYGFFMYKAATYLSTGSELLLEIMGPGLVGGLLLPILG  114

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D     ++
Sbjct  115   ALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPT-RE  173

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   GI+TD  TS+ A +M LS++PF++ +   ++ +  GQR+
Sbjct  174   AVDLTDTKGF------SLTGTGITTDVQTSYAARIMGLSVIPFIIAQFPKMLKTHHGQRL  227

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--------------LLTQNGKP  1016
              +L+ALI++   +L+Y  YQ+  P IQ+R L Y++ ++              LL  +G P
Sbjct  228   AMLLALIVSFLLVLSYCVYQVFQPWIQRRKLAYAKHKHVISGILKHAQALGRLLNDDGTP  287

Query  1015  NVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRI  842
             N   IR  FH  D D ++ +S  EL   +  I  +EVQ     AV  +M D D   N  +
Sbjct  288   NEDVIRKLFHKIDMDESRSLSRAELHALIVGINFNEVQFDSTDAVDKVMADFDTSRNDIV  347

Query  841   TEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa-geveqaggEKMG  665
              E+EF+ G++  L           A+      N+  E++ +E +       E     +  
Sbjct  348   EEEEFVQGMKKWLNEAKRHMPVGDASKF----NEYHERTRQEHDQLIDRSDEAVESVENP  403

Query  664   TWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAA  485
              W     V  ++LG AI    A PL+  V  FS A  +P+F ISF+ LP+  N   A++A
Sbjct  404   GWCITKAVALLLLGAAIAAAFADPLVDAVHNFSNATHIPSFFISFIALPLATNSSEAVSA  463

Query  484   IFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLT  305
             I  AS+K  + +SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ + 
Sbjct  464   IIFASRKKQRTSSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVCVV  523

Query  304   IGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             +     F+TT+ LWT + A+ LYPFSL + Y+L  + GW+
Sbjct  524   MALFTSFRTTFPLWTCLVAYMLYPFSLVIVYILDYVFGWS  563



>ref|XP_009604315.1| PREDICTED: uncharacterized protein LOC104099119 [Nicotiana tomentosiformis]
Length=574

 Score =   251 bits (640),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 181/541 (33%), Positives = 281/541 (52%), Gaps = 64/541 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC +   G +F IV++ YLM +A   +SS S+ + + LG G+ G      L 
Sbjct  59    CEQSYGFLPCTKTALGNVFLIVVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPALG  118

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RAT  1346
               P  ++ + SG+  +   AQ+QV  GI + AG+T+  LT +WG C IVG+ D     A 
Sbjct  119   ALPDAMLILVSGVSGTAAAAQSQVSVGIGLLAGSTVMLLTAIWGTCCIVGKCDIQNSVAV  178

Query  1345  QEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
               +D++    T S            G++TD  TS+ A +M +S++PF++V+L  +  S S
Sbjct  179   DLRDTKGLSLTGS------------GVTTDIWTSYAAMIMAVSVIPFIVVQLPQLFHSTS  226

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LL  1034
             G+ + VL+ALII+++ L++Y  YQ+  P IQ R L Y + ++                L 
Sbjct  227   GRHLAVLIALIISLSLLISYCLYQVFQPWIQTRRLDYVKHKHVISGILKHLKKHALGRLF  286

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDR  860
             T +G PN+  I   F+  D + +  +S  EL   +  I  +E+      A+  ++KD D 
Sbjct  287   TDHGTPNIQVIEKLFNSIDENGDGYLSHSELRALVVGISLEEINLDENDAIAKVLKDFDT  346

Query  859   DGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqag  680
               + ++  +EF+ G+E  L    S              N    ++G +T     +  +  
Sbjct  347   SSDEKLDLKEFIAGVEKWLYEARS-------------SNGSSREAGPDTMKYLDDFHEQT  393

Query  679   gEKMG----TWDFIVTVLQ------------VILGVAILTFCAQPLMTNVIQFSGAVGVP  548
               +      T D IV  ++            ++LG  I    A PL+  V  FS A  +P
Sbjct  394   RMEHSLLGDTSDEIVEGVENPRKVAIKAALLLLLGTIIAAVFADPLVDAVNNFSSATSIP  453

Query  547   TFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVY  368
             TF ISF+ LP+  N   A++AI  AS+K+ K+ASLTFSE+Y  VTM+NL  L   LA+VY
Sbjct  454   TFFISFIALPLATNSSEAVSAIIFASRKNKKSASLTFSELYGAVTMNNLLCLSVFLAIVY  513

Query  367   ARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
              R LTW++S+EVLV+ ++ + +G L    TT+ LWT   AF LYP SL L YVL  + GW
Sbjct  514   IRGLTWNFSSEVLVILIVCVIMGVLGSIHTTFPLWTCSIAFLLYPMSLVLVYVLDYVFGW  573

Query  190   N  188
             +
Sbjct  574   S  574



>ref|XP_004293919.1| PREDICTED: uncharacterized protein LOC101312324 [Fragaria vesca 
subsp. vesca]
Length=562

 Score =   250 bits (638),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 177/514 (34%), Positives = 280/514 (54%), Gaps = 21/514 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA +  G  F +++++ L+ +A   ++S S+  F   GTG+FGA+VF +L
Sbjct  59    TCEPIYGFLPCATSFWGLAFMVIVYEILLYLANSFITSGSELFFQMYGTGLFGASVFHLL  118

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P++ + + +G+  + E A+      I + AG+ I  LT++WG  V  G  D +    
Sbjct  119   GTVPQVGIVLVTGVTGTAETAEAMATMNIGMVAGSAIMLLTLVWGSVVAFGSYDIS----  174

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             DS   P++ +       ++   G++TDA T  TA +M++SL+PF+++++  V+SS SG R
Sbjct  175   DS---PTSSNRGHKNRFSITGYGVTTDAETRSTARIMMVSLIPFLILQVAKVLSSTSGIR  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
             IV+LV+L+++ AFL+ Y  YQ+  P IQ R L +        +   + LT +G PNVS I
Sbjct  232   IVILVSLLVSFAFLVTYCIYQVFQPWIQNRRLEFLMSKYVQKTLLPSFLTASGDPNVSNI  291

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ-RMVAVKTMMKDLDRDGNSRITEQEFL  824
             +  F   D ++N  +S+ EL   +  I   EV      V   M+D D  G+S+I+EQEF+
Sbjct  292   QEVFTRIDQNHNTYISAYELRALVLGIQIGEVGLDSDYVDKAMEDFDISGDSQISEQEFV  351

Query  823   NGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DFIV  647
             +GI   +    SA+              ++   G++   +  +  +   +   TW + + 
Sbjct  352   DGISKWVNATPSANGQGQGHRRFLSSKTEEALGGKQKQVSKKKKSKLTDK---TWTNQLK  408

Query  646   TVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQ  467
                 +ILG+ I+   A PLM  +  FS A  +P+F  S+V++P+ IN   A+  I  A  
Sbjct  409   AACLLILGIGIMILLATPLMETIQDFSTAASIPSFFTSYVLIPLAINYGQALQLITSAQD  468

Query  466   KSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAY  287
             K+  A SL+ SEIYNGV M+N+ GL   LA+VY R L+WD  A VL V +I   +G    
Sbjct  469   KTENAVSLSLSEIYNGVFMNNVMGLTIFLALVYIRNLSWDVCAAVLAVLIICSVMGLYTS  528

Query  286   FKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             F T +  WT I A+ +YP SL + YVL   LGW 
Sbjct  529   FSTKFPFWTCILAYIMYPISLLMIYVLTSYLGWT  562



>ref|XP_009803286.1| PREDICTED: uncharacterized protein LOC104248681 [Nicotiana sylvestris]
Length=706

 Score =   253 bits (647),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 188/291 (65%), Gaps = 10/291 (3%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMK  872
             E+L+  +G PN  RI+  FH YD D N  ++  ELE+ +  +   EV+  R  +VK +++
Sbjct  419   EHLVNDDGSPNTERIKEIFHQYDFDGNNVITKPELEELIGSVKFGEVEINRDDSVKKVLR  478

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEK---SGEETNgaa  701
             D D+DGN+ I E EF++G+   L    S               D+ EK   S  +     
Sbjct  479   DFDKDGNNMIDEHEFVHGMTKWLNEAISVTKCPDKKRAI----DEYEKIKWSEVDKLVYE  534

Query  700   geveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
              E +     K+ TW F  +VLQV+LG+AILT CA+PL+ ++   S A+G+P+F+I FV++
Sbjct  535   VEKDGEINYKLLTWAFNKSVLQVLLGIAILTLCAKPLVISIEDLSDAMGMPSFLIPFVMV  594

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P+ +N RMAIAAIFPASQKSSK ASLTFSEIY GV M+N+ G+ +LLAVV  ++L WDYS
Sbjct  595   PLALNARMAIAAIFPASQKSSKTASLTFSEIYGGVIMNNIMGMTTLLAVVCIKDLRWDYS  654

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
             AEVL+V V+   +G LA+F TTY LWT + AF LYPFS+ LFY+L+ + GW
Sbjct  655   AEVLIVLVVCSVVGLLAFFSTTYPLWTCLLAFSLYPFSVLLFYLLECVFGW  705


 Score =   216 bits (551),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 191/312 (61%), Gaps = 24/312 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C   YG FPCA +I GY+F I+++QYL+   E+LVS  SK +F+ LG GIFGAT+F+IL 
Sbjct  56    CQQLYGIFPCANSIGGYIFLIIVYQYLLITGERLVSRGSKTLFNILGPGIFGATIFQILK  115

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               PRI+M I+SG+  S+E AQNQ+  GI    GAT+FNLT++WG+CVI G +D   +   
Sbjct  116   TLPRIVMVIASGVAASKEKAQNQISSGISTTVGATVFNLTLMWGICVIFGTKDMTEKSAA  175

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + S P    F S  LK L+E G++ D  TS TAG+MLLSL+P  LV+ V   +S   +RI
Sbjct  176   ASSSP----FKS--LKGLSETGVTIDPKTSKTAGIMLLSLIPLALVQPVTTFNSFFARRI  229

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
             ++ + L+++V  L++YF YQI DP +Q+RSL YS++ENLL                 + G
Sbjct  230   LIFITLLVSVMLLMSYFLYQIFDPWMQERSLEYSKYENLLAGFLHHVQRHARGKLINEEG  289

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P++  I+  F   D D N+ ++  ELE     I + +V+  +  A+  ++   D++ + 
Sbjct  290   QPDIDVIKRLFLETDKDANKCLTLAELENLTLDIQSGKVKVDKDYAITKILNSFDQNNDK  349

Query  847   RITEQEFLNGIE  812
              I E EF+ G +
Sbjct  350   IIEEDEFVEGCK  361



>ref|XP_009605371.1| PREDICTED: uncharacterized protein LOC104099939 [Nicotiana tomentosiformis]
Length=706

 Score =   253 bits (646),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/290 (46%), Positives = 187/290 (64%), Gaps = 10/290 (3%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKD  869
             +L+  +G PN+ RI+  FH YD D N  ++  ELE+ +  +   EV+  R  +VK +++D
Sbjct  420   HLVNDDGSPNIERIKEIFHQYDFDGNNAITKPELEELIGSVKFGEVEINRDDSVKKVLRD  479

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEK---SGEETNgaag  698
              D+DGN+ I E EF++G+   L       N            DD +K   S  +      
Sbjct  480   FDKDGNNMIDEHEFVHGMTKWLNEAVKVTNCPDKKRAI----DDYDKIKWSEVDKLVYEV  535

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
             E +     K+ TW F   VLQV+LG+AILT CA+PL+ ++   S A+G+P+F+I FV++P
Sbjct  536   EKDGEIKYKLLTWAFNKAVLQVLLGIAILTLCAKPLVISIEDLSDAMGMPSFLIPFVMVP  595

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             + +N RMAIAAIFPASQKSSK ASLTFSEIY GV M+N+ G+ +LLA V+ ++L WDYSA
Sbjct  596   LALNARMAIAAIFPASQKSSKTASLTFSEIYGGVIMNNIMGMTTLLAAVFIKDLRWDYSA  655

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
             EVL+V V+   +G LA+F TTY LWT + AF LYPFS+ LFY+L+ + GW
Sbjct  656   EVLIVLVVCSVVGLLAFFTTTYPLWTCLLAFSLYPFSVLLFYLLECVFGW  705


 Score =   217 bits (552),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 193/312 (62%), Gaps = 24/312 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C   YG FPCA +I GY+F IV++QYL+   E+LVS  SK +F+ L TGIFGAT+F+IL 
Sbjct  56    CQQLYGIFPCANSIGGYIFLIVVYQYLLITGERLVSRGSKALFNILRTGIFGATIFQILK  115

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
              FPRI+M I+SG+  S+E AQNQ+  GI    GAT+FNLT++WG+CVI G +D   +   
Sbjct  116   TFPRIVMVIASGVSASKEKAQNQISSGISTTVGATVFNLTLMWGICVIFGTKDMTEKSAA  175

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               S PS +SF     K L+E G++ D  TS TAG+MLLSL+PF LV+ V   +S   +RI
Sbjct  176   ESSSPS-KSF-----KGLSETGVTIDPKTSKTAGIMLLSLIPFALVQPVTAFNSFFARRI  229

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
             ++ + L+++V  LL+YF YQI DP +Q+RSL YS++ENLL                 + G
Sbjct  230   LIFITLLVSVMLLLSYFLYQIFDPWMQERSLEYSKYENLLAGFLHHVQKHARGKLINEEG  289

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P++  I+  F   D D N+ ++  ELE     I + +V+  +  A+  ++   D++ + 
Sbjct  290   QPDIDVIKRLFLETDKDANKCLTLAELENLTLDIQSGKVKVDKDYAITKILNSFDQNNDK  349

Query  847   RITEQEFLNGIE  812
              I E EF+ G +
Sbjct  350   IIDEDEFVEGCK  361



>ref|XP_004146032.1| PREDICTED: uncharacterized protein LOC101209298 isoform 1 [Cucumis 
sativus]
 ref|XP_004162934.1| PREDICTED: uncharacterized protein LOC101229160 isoform 1 [Cucumis 
sativus]
 gb|KGN55087.1| hypothetical protein Csa_4G628350 [Cucumis sativus]
Length=589

 Score =   250 bits (638),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 187/527 (35%), Positives = 284/527 (54%), Gaps = 32/527 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC     G LF I+++ YLM +A   +S+ S+ + + LG GI G      L
Sbjct  71    SCEQSYGFLPCTTTALGNLFLIIVYGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPAL  130

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   Q+ 
Sbjct  131   GALPDAMLILVSGLAGSAEVAQSQVSVGMGLLAGSTVMLLTLIWGTCVIVGKCD--LQDS  188

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L E G+STD  TS+ A +M++S+VPF++V+L  +++S SG+ 
Sbjct  189   VAIDSQDTKGF------SLTESGVSTDIWTSYAARIMVISVVPFLIVQLPQMLNSTSGRH  242

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALII+V+  + Y  YQ+  P IQ+R L + + ++                LLT+N
Sbjct  243   LAVLIALIISVSMFIIYCLYQVFQPWIQRRKLAFVKHKHVIFGFLRHLKQQTLGRLLTEN  302

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGN  851
             G+P+   I   F   D + +  +S+ EL   +  I  DE  +    AV  +M D D   +
Sbjct  303   GEPDKEIIEKLFSRIDVNKDGLLSASELRALIVGIQFDEMDLDHDDAVDKIMNDFDTSRD  362

Query  850   SRITEQEFLNGIENLLannssadn---aaaatptstPENDDQEKSGEET--Ngaageveq  686
             S +   EF NGI   L+    +                N  QE   E    +      E 
Sbjct  363   SHVDSNEFGNGIIRWLSQVQGSRTGRGEDGPHTMKYLHNFHQETKREHDLLDVGEQSDEV  422

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
               G + G    I  +L ++LG AI    A PL+  V  FS A  +P F ISF+ LP+  N
Sbjct  423   VEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVHNFSNATKIPAFFISFIALPLATN  482

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+   K ASLTFSE+Y  VTM+N+  L   LA+VY R L W++S+EVLV
Sbjct  483   SSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCLSVFLALVYMRGLVWNFSSEVLV  542

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++++ +G +  F+T + LWTS+ A  LYP SL L YVL  + GW+
Sbjct  543   ILIVTMIMGVMGSFRTAFPLWTSLVALLLYPLSLVLVYVLDYVFGWS  589



>ref|XP_004251882.1| PREDICTED: uncharacterized protein LOC101257045 [Solanum lycopersicum]
Length=578

 Score =   250 bits (638),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 181/525 (34%), Positives = 280/525 (53%), Gaps = 30/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC +   G +F I+++ YLM +    +SS S+ + + LG GI G     +L
Sbjct  62    SCEQSYGFLPCTKTALGNVFLILVYGYLMFLGATYLSSGSELLLEILGPGIIGGLFLPVL  121

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SGI  S   AQ+QV  G+ + AG+T+  +TV+WG C IVG+ D   Q  
Sbjct  122   GALPDAMLILVSGISGSTAAAQSQVSVGMGLLAGSTVMLITVIWGTCCIVGKCD--IQNS  179

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T  F      +L   G+STD  TS  A +M  S+ PF++V+L  ++ S SG+ 
Sbjct  180   VAVDMKDTNGF------SLTGSGVSTDIWTSHAATIMAASVTPFLVVQLPQLLHSTSGRH  233

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ LII++  L++Y  YQ+  P IQ R L Y + ++                L T  
Sbjct  234   LSVLIGLIISLTLLVSYCIYQVFQPWIQSRRLAYVKHKHVISGVLRQLRMRALGRLCTDQ  293

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G PN+  +   F+  D + +  +S  EL+  +  I  +E+      AV+ +MKD D   +
Sbjct  294   GAPNIEVLEKLFNAIDENEDGHLSRTELKALVVGIRLEEINLHENDAVEKLMKDFDTSHD  353

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETN-gaageveqag  680
              ++   EF+ G+   L     ++  +      T +  +D  E++  E +       E   
Sbjct  354   HQVEMSEFIAGVTKWLTEARGSEAPSPEAGPDTMKYLDDLHEQTRREHHFLGDQSDESVE  413

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               +      I  VL ++LG  I    A PL+  V  FS A  +P+F ISF+ LP+  N  
Sbjct  414   TVENPRSTAIKAVLLLLLGTVIAAVFADPLVDAVNNFSSATSIPSFFISFIALPLATNSS  473

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
              A++AI  AS+K  ++ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S+EVLV+ 
Sbjct  474   EAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCLSVFLALVYIRGLTWDFSSEVLVIL  533

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             ++ + +G  A  ++T+ LWTS+ AF LYPFSL L YVL    GW+
Sbjct  534   IVCVVVGVFASVRSTFPLWTSLLAFLLYPFSLVLVYVLDYKFGWS  578



>ref|XP_006392816.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
 gb|ESQ30102.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
Length=585

 Score =   250 bits (638),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 183/544 (34%), Positives = 290/544 (53%), Gaps = 65/544 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  65    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  124

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEK  1337
               P  ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D R T   
Sbjct  125   ALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAV  184

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             ++Q    T+ F      +L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG+ 
Sbjct  185   NNQD---TKRF------SLKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQMLDSTSGRH  235

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VLVALI++VA L++Y  YQ+  P IQ+R L +++ ++                LL   
Sbjct  236   LAVLVALILSVAMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHALGRLLDDE  295

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   IR  F   D++ +  +S+ EL+  +  I  +++   +  AV  +++D D+  +
Sbjct  296   GQPDEHVIRRLFETIDANKDGHLSATELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLD  355

Query  850   SRITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DD  737
              ++ ++EF+ GI+  L     A                                 EN ++
Sbjct  356   EQVDQEEFVRGIKQWLIQAMGAAGPAGPDAGPRTMKFLDHFHKQTKREHALLGDNENGEN  415

Query  736   QEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAV  557
              E SGE  +                W  I   L ++LG AI    A PL+  V  FS A 
Sbjct  416   DEDSGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAAT  461

Query  556   GVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLA  377
             G+P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA
Sbjct  462   GIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLA  521

Query  376   VVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-  200
             +VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L   
Sbjct  522   IVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYW  581

Query  199   LGWN  188
              GW+
Sbjct  582   FGWS  585



>emb|CDY25725.1| BnaC03g69500D [Brassica napus]
Length=581

 Score =   249 bits (637),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 176/538 (33%), Positives = 287/538 (53%), Gaps = 55/538 (10%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  61    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  120

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  121   ALPDAMLIMVSGLSGDAATAQTQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDSI  178

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PF++V+L  ++ S SG+ +
Sbjct  179   AVNNQDTKGF------HLKDSGVTVDVWTSYAARIMAISVIPFIIVQLPQMLDSTSGRHL  232

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +LVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  233   ALLVALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDEG  292

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ +  +S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  293   QPDEHVIRRLFETIDANKDGHLSAAELKALIIGISFEDIDLDKDDAVGKVLQDFDKTLDE  352

Query  847   RITEQEFLNGIENLLannssad------------------naaaatptstPENDDQEKSG  722
             ++ ++EF+ GI+  L     A                   +       +   +DD  ++ 
Sbjct  353   QVDQEEFVRGIKRWLIQAMGAAGPSGPGAGPRTMKYLDHFHVQTKREHALLGDDDNGEND  412

Query  721   EETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTF  542
             EE+   A             W  I   L ++LG AI    A PL+  V  FS A G+P+F
Sbjct  413   EESGEVADP----------KWVTIKAALLLLLGAAIAAAFADPLVDTVNNFSAATGIPSF  462

Query  541   IISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAR  362
              ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+VY R
Sbjct  463   FISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIVYLR  522

Query  361   ELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGW  191
              LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    GW
Sbjct  523   GLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGW  580



>gb|KDP21052.1| hypothetical protein JCGZ_21523 [Jatropha curcas]
Length=571

 Score =   249 bits (635),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 182/540 (34%), Positives = 293/540 (54%), Gaps = 32/540 (6%)
 Frame = -1

Query  1747  SSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKI  1568
             S FL + G R   +++ TC+  YGF PC   I G LF +V+++YL+S++   +S  S+  
Sbjct  42    SKFLKIDGLR---TTTVTCEPTYGFLPCTTEIWGQLFLLVVYEYLLSLSAHYISEGSELF  98

Query  1567  FDTLGT-GIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTV  1391
              +T GT  IF A+VF++L +FP++I+ + +G   + +  Q+    G+ + AG+ I NLT+
Sbjct  99    LETSGTDNIFSASVFQMLGMFPQVILVLVAGFSGTSDTVQSMAEMGMGLLAGSVIMNLTL  158

Query  1390  LWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK-TLNECGISTDASTSFTAGLMLLSl  1214
             +WG  V  G          S SQ ST S   N  K +L   G+ TD  T  TA +MLLS+
Sbjct  159   IWGSVVAFGSY--------SLSQASTSSNTENQDKFSLTGYGVRTDNQTKTTARIMLLSM  210

Query  1213  vpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-------  1055
             +PF+L++L  +++S    RI+V+V+LI+T+ +L+ Y  YQ   P I++R L Y       
Sbjct  211   IPFLLLQLAKILNSTLATRIIVIVSLIVTLIYLITYCIYQAFTPWIRERRLEYLMRKYGQ  270

Query  1054  -SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVK  884
              +  + L   NG+PN + IR  F   D ++N Q+S+ EL   +  I  +EV       V 
Sbjct  271   TNILQALRMSNGEPNEANIRELFQKIDQNSNTQISAAELRALVIGIQIEEVGLNEDDFVS  330

Query  883   TMMKDLDRDGNSRITEQEFLNGIENLLann--------ssadnaaaatptstPENDDQEK  728
              + ++ D  G+S I+E EF+ G+   ++N         ++       +  S  + + +E+
Sbjct  331   KVFEEFDISGDSNISENEFIQGLSKWISNANVSGKNNQATQTVKKLTSSNSNSKGNSEEQ  390

Query  727   SGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVP  548
                    A G        K   W +I     ++ G A+    A PLM  + +F+  + +P
Sbjct  391   QSLVAKKAEGNQASKNTNKNAWWSYIKAAFLILSGTAVTFLLATPLMQTLQEFATDINIP  450

Query  547   TFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVY  368
             +F++S+ V+P+ ++ + A  AI  A +K+ KA SLT SE+Y GV M+N+ GL   LA+V 
Sbjct  451   SFLVSYFVVPLALSFKQAYRAITSAREKTEKAVSLTLSELYGGVFMNNVMGLAIFLALVC  510

Query  367   ARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGW  191
              ++L+WD SAE+L V +I   +G  A F + +  WT I A+ LYP SLA  YVL    GW
Sbjct  511   IKDLSWDVSAEILTVLIICSGMGLSATFSSKFPFWTCIIAYALYPISLAFIYVLTTFCGW  570



>emb|CDY25869.1| BnaA05g14600D [Brassica napus]
Length=585

 Score =   249 bits (635),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 180/543 (33%), Positives = 290/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  65    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  124

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  125   ALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDNI  182

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PFV+V+L  V++S SG+ +
Sbjct  183   ALNNQDTKGF------HLKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQVLNSTSGRHL  236

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  237   AVLVALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDEG  296

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ + ++S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  297   QPDEHVIRKLFDTIDANKDGRLSATELKALIIGISFEDIDFDKDDAVGRVLQDFDKTLDE  356

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
              + ++EF+ GI++ L     A                                 EN ++ 
Sbjct  357   EVDQEEFVRGIKHWLIQAMGASGHSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  416

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  417   EESGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  462

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+
Sbjct  463   IPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAI  522

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  523   VYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  582

Query  196   GWN  188
             GW+
Sbjct  583   GWS  585



>ref|XP_009144785.1| PREDICTED: uncharacterized protein LOC103868446 [Brassica rapa]
Length=585

 Score =   249 bits (635),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 180/543 (33%), Positives = 290/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  65    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  124

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  125   ALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDNI  182

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PFV+V+L  V++S SG+ +
Sbjct  183   ALNNQDTKGF------HLKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQVLNSTSGRHL  236

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  237   AVLVALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDEG  296

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ + ++S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  297   QPDEHVIRKLFDTIDANKDGRLSATELKALIIGISFEDIDFDKDDAVGRVLQDFDKTLDE  356

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
              + ++EF+ GI++ L     A                                 EN ++ 
Sbjct  357   EVDQEEFVRGIKHWLIQAMGASGHSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  416

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  417   EESGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  462

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+
Sbjct  463   IPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAI  522

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  523   VYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  582

Query  196   GWN  188
             GW+
Sbjct  583   GWS  585



>ref|XP_009147618.1| PREDICTED: uncharacterized protein LOC103871140 [Brassica rapa]
Length=576

 Score =   249 bits (635),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 178/543 (33%), Positives = 288/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  56    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  115

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  116   ALPDAMLIMVSGLSGDAATAQTQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDNI  173

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PF++V+L  ++ S SG+ +
Sbjct  174   AVNNQDTKGF------HLKDSGVTVDVWTSYAARIMAISVIPFIIVQLPQMLDSTSGRHL  227

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  228   AVLVALILSVVMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHALGRLLDDEG  287

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ +  +S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  288   QPDEHVIRKLFETIDANKDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLDE  347

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
             ++ ++EF+ GI++ L     A                                 EN ++ 
Sbjct  348   QVDQEEFVRGIKHWLIQAMGAAGPSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  407

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  408   EESGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  453

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+
Sbjct  454   IPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAI  513

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  514   VYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  573

Query  196   GWN  188
             GW+
Sbjct  574   GWS  576



>emb|CDY55841.1| BnaCnng29300D [Brassica napus]
Length=585

 Score =   249 bits (635),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 180/543 (33%), Positives = 290/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  65    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  124

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  125   ALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDDI  182

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PFV+V+L  V++S SG+ +
Sbjct  183   AVNNQDTKGFH------LKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQVLNSTSGRHL  236

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  237   AVLVALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDEG  296

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ + ++S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  297   QPDEHVIRKLFDTIDANKDGRLSATELKALIIGISFEDINFDKDDAVGRVLQDFDKTLDE  356

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
              + ++EF+ GI++ L     A                                 EN ++ 
Sbjct  357   EVDQEEFVRGIKHWLIQAMGASGHSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  416

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  417   EESGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  462

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+
Sbjct  463   IPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAI  522

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  523   VYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  582

Query  196   GWN  188
             GW+
Sbjct  583   GWS  585



>ref|NP_564623.2| Na+/Ca 2+ exchanger-like protein [Arabidopsis thaliana]
 gb|AAM20402.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32908.1| sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Arabidopsis thaliana]
Length=585

 Score =   249 bits (635),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 176/542 (32%), Positives = 286/542 (53%), Gaps = 60/542 (11%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L
Sbjct  65    ACEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPML  124

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++ 
Sbjct  125   GALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDS  182

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              + +   T+ F       L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG++
Sbjct  183   IAVNNQDTKGF------HLKDSGVTVDIWTSYAARIMAISVIPFVIVQLPQMLGSTSGRQ  236

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   
Sbjct  237   LSVLIALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDE  296

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   IR  F   D++N+  +S+ EL+  +  I  +++   +  AV  +++D D+  +
Sbjct  297   GQPDEHVIRKLFLTIDANNDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLD  356

Query  850   SRITEQEFLNGIENLLanns--------------------sadnaaaatptstPENDDQE  731
              ++ ++EF+ GI+  L                                      EN + +
Sbjct  357   EQVDQEEFVRGIKQWLIQAMGGAPSGPEAGPRTMKFLDNFHVQTKREHALLGDNENGEND  416

Query  730   KSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGV  551
             + G E                  W  I   L ++LG AI    A PL+  V  FS A G+
Sbjct  417   EEGGEVADP-------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATGI  463

Query  550   PTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVV  371
             P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+V
Sbjct  464   PSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIV  523

Query  370   YARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LG  194
             Y R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    G
Sbjct  524   YVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFG  583

Query  193   WN  188
             W+
Sbjct  584   WS  585



>ref|XP_009354324.1| PREDICTED: uncharacterized protein LOC103945475 [Pyrus x bretschneideri]
Length=585

 Score =   248 bits (634),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 181/529 (34%), Positives = 278/529 (53%), Gaps = 39/529 (7%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G +F ++++ YLM ++ +L+S+ S+ +   LG GI G     +L
Sbjct  70    SCEQTYGFLPCTSTVLGNIFLVLVYGYLMFLSAKLLSNGSEILLQILGPGIVGGLFLPLL  129

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDR----A  1349
                P   + ++SG+    E AQ+QV  G+ + AG+ +  LT+LWG C+IVG+ D     A
Sbjct  130   GSLPDATIILASGLSGDTETAQSQVSVGMGLMAGSNVMLLTILWGTCLIVGKCDIENSIA  189

Query  1348  TQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
               +KD +            L +L   G+STD  TS++A +M++SL+PFV+V+L  V  + 
Sbjct  190   VDQKDEK------------LFSLTGSGVSTDIWTSYSARIMIISLIPFVIVQLPQVFHAT  237

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------L  1037
             S  R+ +L++L ++++F++AY  YQ+  P IQKR L YS+ ++                L
Sbjct  238   SDSRLAILISLAVSISFVIAYSFYQVFQPWIQKRKLAYSKHKHVMSEILKQLKTNALGRL  297

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLD  863
             LT +G PN   I+  F   D D++  +++ +L   +  I  D++   +  A+  +MKD D
Sbjct  298   LTNDGDPNKVIIQKLFKTLDQDSDGYLNTSDLRSLIIGIQFDDIDINIDEAILQVMKDFD  357

Query  862   RDGNSRITEQEFLNGIENLLannssadna---aaatptstPENDDQEKSGEETNgaagev  692
                +S+I E EF  GI   L     A               E  DQ+   E         
Sbjct  358   TSHDSKIDEDEFFRGISRWLNKAKRAAIMDRGKIPQSMKLLEEYDQKTKKEYDQFGDQID  417

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             E     K   W     V+ + LG  +    A PL+  V  FS A  +P+F ISFVVLP  
Sbjct  418   EVVEDVKNAKWHASKAVVLLFLGTIVAAAVADPLVDAVDNFSTATSIPSFFISFVVLPFA  477

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              +  +    IF  S+K  + ASL +SEIY  VTMSN+  L   L +VY R LTW +SAEV
Sbjct  478   SSSEIVTTLIF-VSRKKQRTASLAYSEIYGSVTMSNILSLAVFLGLVYVRNLTWSFSAEV  536

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             LV+ ++ + +G +A F+TT+ LW S  A  LYP SL L Y+L  + GW+
Sbjct  537   LVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLVYILNYICGWS  585



>ref|XP_009106991.1| PREDICTED: uncharacterized protein LOC103832685 [Brassica rapa]
 emb|CDY02520.1| BnaA08g01270D [Brassica napus]
Length=583

 Score =   248 bits (633),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 178/543 (33%), Positives = 287/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  63    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  123   ALPDAMLIMVSGLSGDAATAQTQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDSI  180

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PF++V+L  ++ S SG+ +
Sbjct  181   AVNNQDTKGF------HLKDSGVTVDVWTSYAARIMAISVIPFIIVQLPQMLDSTSGRHL  234

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  235   AVLVALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLNDEG  294

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ +  +S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  295   QPDEHVIRRLFETIDANKDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLDE  354

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
             ++ ++EF+ GI+  L     A                                 EN ++ 
Sbjct  355   QVDQEEFVRGIKRWLIQAMGAAGPSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  414

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  415   EESGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  460

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+
Sbjct  461   IPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAI  520

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  521   VYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  580

Query  196   GWN  188
             GW+
Sbjct  581   GWS  583



>gb|EMS61578.1| hypothetical protein TRIUR3_22187 [Triticum urartu]
Length=497

 Score =   245 bits (626),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 171/505 (34%), Positives = 280/505 (55%), Gaps = 28/505 (6%)
 Frame = -1

Query  1642  LFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQ  1463
             +F ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL   P  ++ + SG+  ++
Sbjct  1     MFLVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTK  60

Query  1462  EGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKT  1283
             E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D   ++  +     T+ F      +
Sbjct  61    ETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCD-VGEDGVAIDSTDTKGF------S  113

Query  1282  LNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYF  1103
             L+  GI+TD  TS+ A +M +S++PFV+ +   ++ +  G+R+ +L+ALI + + +LAY 
Sbjct  114   LSGSGITTDVQTSYAARIMAISVIPFVIAQFPKMLYTHHGERLAILLALIASFSLVLAYC  173

Query  1102  GYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSD  971
              YQ+  P +QKR L Y++ ++                +L  +G PN + IR  FH  D+D
Sbjct  174   LYQVFQPWVQKRKLAYAKHKHVISGILQHAQKQALGRMLNDDGSPNENVIRKLFHKIDND  233

Query  970   NNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLan  797
             +++ +S  EL   +  I  DE+   +  AV  +M D D  GN  + E EF+ G++  L  
Sbjct  234   DSRNLSRAELHALIIGINFDEIDFDKNDAVDKIMDDFDTSGNDTVEEDEFVAGMKTWLNE  293

Query  796   nssadnaaaatptstPENDDQEKSGEETNgaag-eveqaggEKMGTWDFIVTVLQVILGV  620
                   A+ A       ND   ++ EE +       E     +   W     V  +ILG 
Sbjct  294   AKQKVAASGAYSNKFV-NDYHARTREEHDQLVDRSDEAVESVENPGWCIAKAVGYLILGA  352

Query  619   AILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLT  440
              I    A PL+  V  FS A  +P+F +SF+ LP+  N   A++AI  AS+K  +  SLT
Sbjct  353   TICAAFADPLVDAVHNFSNATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLT  412

Query  439   FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWT  260
             FSE+Y GVTM+N   L   LA++Y RELTWD+S+EVLV+ ++ + +G    F+T++ LWT
Sbjct  413   FSEVYGGVTMNNTLCLGVFLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWT  472

Query  259   SIFAFFLYPFSLALFYVLQ-LLGWN  188
              + A+ LYP +LA+ YVL  + GW+
Sbjct  473   CLVAYLLYPLTLAVVYVLDFVFGWS  497



>ref|XP_010478257.1| PREDICTED: uncharacterized protein LOC104757229 [Camelina sativa]
Length=580

 Score =   248 bits (632),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 172/547 (31%), Positives = 274/547 (50%), Gaps = 41/547 (7%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
             Q    + FL+L  P L+S +   C H YGF PCA+NI GY+FQ+  F  L+ + E  +S 
Sbjct  42    QDGSSNEFLSLDPPNLTSEN--ACVHVYGFLPCADNIEGYVFQVFSFGCLLIIGEYFLSK  99

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F     G FG  +F +L++FPRI + +S+G+  S+E A + V   + V  G ++F
Sbjct  100   GRSKLFVIFEVGFFGGIIFPLLVMFPRIALILSTGLMGSREMANSMVGNNVAVTVGYSVF  159

Query  1402  NLTVLWGLCVIVG----RRDRATQEKDSQS------QPSTQSFASNWLKTLNECGISTDA  1253
              LTV WG CV+ G      D++    + QS       P      +N +K L    +  D 
Sbjct  160   ALTVQWGACVVFGLPGLSSDQSIGNGEVQSIASGTKSPRRNGIRNNLIKKLVGASVRADP  219

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
                  AG+MLL+L PFVLV       S S    +VL+ L+ + +  + +F Y   D   Q
Sbjct  220   KNKKAAGIMLLTLFPFVLVTFSETFDSKSWDDSIVLITLLFSGSATVLFFVYLYFDKADQ  279

Query  1072  KRSLHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEK  935
              +SL ++RFE +              L ++ + +   ++  F   D + + ++   EL+ 
Sbjct  280   VKSLDHARFELMSEVHKHLQNFAPQSLIKDKQLSKESLKSLFEKIDVNKDGKIQVSELKD  339

Query  934   FLRLIVTDEVQRMVA-----VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaa  770
                 +    + RM         T++ D D D +  I E EF  GIE  L       ++  
Sbjct  340   LT--VEFGVLGRMKCDIHELATTLLADFDSDKDGEIDETEFEKGIEKWLRQYKFTVDST-  396

Query  769   atptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPL  590
                    ++  + ++ +E      +  +    K+ T      V++VI+G+ I++F A P 
Sbjct  397   -------DSQKEYQAEDEAVLKMVQTNECLFTKLLTKRTFKAVIEVIIGILIVSFLAMPF  449

Query  589   MTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTM  410
             M N+   S + GVP+F + F V+P+  N + A++A F   +  ++  S  FSEIY  VT+
Sbjct  450   MMNIELLSVSAGVPSFYVVFAVIPLARNLKNALSAHFCRKKDQARITSDIFSEIYRDVTL  509

Query  409   SNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPF  230
             +NL G+  +LA+VY R LTWDYS EVL++ ++ L IG  AY ++TY  W  + AF LY F
Sbjct  510   NNLLGITIILAIVYLRGLTWDYSTEVLIIVIVGLLIGVPAYVRSTYPFWICVLAFALYFF  569

Query  229   SLALFYV  209
             SL L Y+
Sbjct  570   SLVLIYL  576



>ref|XP_004233846.1| PREDICTED: uncharacterized protein LOC101251749 [Solanum lycopersicum]
Length=716

 Score =   251 bits (640),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 184/288 (64%), Gaps = 4/288 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMK  872
             E+L+  +G PN+ RIR  FH YD D N  ++  ELE+ +  +   EV+      VK +++
Sbjct  429   EHLVKDDGTPNIERIREIFHQYDFDGNNAITKPELEELIGSVKFGEVEINHEDTVKKVLR  488

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
             D DR+GN  I E EF++G+   L    S             E D  + S  +      E 
Sbjct  489   DFDRNGNDMIDEDEFVHGMTRWLNEAISVTKCPDKKRAID-EYDKIKWSEVDKIVYEVES  547

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +     K+ TW F  +VLQV+LG+AI+T CA+PL+ ++   S A+G+P+F+I FV++P+ 
Sbjct  548   DGEINYKLLTWTFNKSVLQVLLGIAIMTLCAKPLVISIEDLSDAMGIPSFLIPFVMVPLA  607

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
             +N RMAIAAIFPASQKSS  ASLTFSEIY GV M+N+ G+ +LLAVV  ++L WDYSAEV
Sbjct  608   LNARMAIAAIFPASQKSSITASLTFSEIYGGVIMNNIMGMATLLAVVCIKDLRWDYSAEV  667

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
             L++ V+   IG LA+F TTY LWT + AF LYPFS+ LFY+L+ + GW
Sbjct  668   LIILVVCSVIGLLAFFSTTYPLWTCLVAFSLYPFSVVLFYLLECVFGW  715


 Score =   238 bits (607),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 213/335 (64%), Gaps = 23/335 (7%)
 Frame = -1

Query  1756  VDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSS  1577
             +DQ S     GP L SSS  TC+  YG FPCA NI GY+F IV+ QYL++  E L+S  S
Sbjct  42    IDQVSNNQEHGPPLVSSSGKTCEQVYGVFPCANNIAGYIFLIVVCQYLLNTGESLISRGS  101

Query  1576  KKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNL  1397
             K +F+ LGTGIFGATVF+ILM  PRI+M I+SG+  S+E AQ Q+  GI    GAT+FNL
Sbjct  102   KTLFNILGTGIFGATVFQILMTLPRIVMVIASGVSASKEKAQFQISSGISTTVGATVFNL  161

Query  1396  TVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLS  1217
             T++WG+C+I G ++  T + DSQS+ S+       LK+L + G+  D  TS+TAG+MLLS
Sbjct  162   TLMWGICLICGTKN-MTDKPDSQSEESS---PFKRLKSLQDTGVRIDKETSYTAGIMLLS  217

Query  1216  lvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL  1037
             L+PFVLV+ V  ++S  G+RI++ + LI+++  L++YF YQ++DP +Q+RSL YS++ENL
Sbjct  218   LIPFVLVQPVTALNSFVGRRILIFITLIVSLILLVSYFLYQVLDPWMQERSLEYSKYENL  277

Query  1036  LT----------------QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--  911
             L                 + G+P++  I+  FH  D D ++ ++  ELE  +  + +   
Sbjct  278   LAGFLHHVQRHARGKLINEEGQPDIDVIKRLFHETDRDADKCLTLTELENLILEMQSGKV  337

Query  910   -EVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIEN  809
              EV +  A+  ++   D++ +  I E+EF+ G + 
Sbjct  338   VEVDKDYAISKILNSFDKNNDKVIQEEEFVEGCKK  372



>emb|CDY24108.1| BnaA06g01060D [Brassica napus]
Length=648

 Score =   249 bits (635),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 178/543 (33%), Positives = 288/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  128   CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  187

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  188   ALPDAMLIMVSGLSGDAATAQTQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDNI  245

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PF++V+L  ++ S SG+ +
Sbjct  246   AVNNQDTKGFH------LKDSGVTVDVWTSYAARIMAISVIPFIIVQLPQMLDSTSGRHL  299

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  300   AVLVALILSVVMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHALGRLLDDEG  359

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ +  +S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  360   QPDEHVIRKLFETIDANKDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLDE  419

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
             ++ ++EF+ GI++ L     A                                 EN ++ 
Sbjct  420   QVDQEEFVRGIKHWLIQAMGAAGPSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  479

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  480   EESGEVADP--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  525

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+
Sbjct  526   IPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAI  585

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  586   VYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  645

Query  196   GWN  188
             GW+
Sbjct  646   GWS  648



>ref|XP_008362437.1| PREDICTED: uncharacterized protein LOC103426126 [Malus domestica]
Length=549

 Score =   246 bits (628),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 176/525 (34%), Positives = 275/525 (52%), Gaps = 31/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G +F ++++ Y+M ++ +L+S+ S+ +   LG GI G     +L
Sbjct  34    SCEQTYGFLPCTSTVLGNIFLVLVYGYMMFLSAKLLSNGSEILLQILGPGIVGGLFLPLL  93

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P   + ++SG+    E AQ+QV  G+ + AG+ +  LT+LWG C+IVG+ D   +  
Sbjct  94    GSLPDATIILASGLSGDTETAQSQVSVGMGLMAGSNVMLLTILWGTCLIVGKCD--IENS  151

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  Q   + F      +L   G+STD  TS++A +M+ SL+PFV+V+L  V  + S  R
Sbjct  152   IAVDQKDEKRF------SLTGSGVSTDIWTSYSARIMIJSLIPFVIVQLPQVFHATSDSR  205

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + +L++L ++++F++AY  YQ+  P IQKR L YS+ ++                LLT +
Sbjct  206   VAILISLAVSISFVIAYSFYQVFQPWIQKRKLAYSKHKHVMSEILKQLKTNALGRLLTND  265

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGN  851
             G PN   I+  F   D D++  +++ +L   +  I  D++   +  A+  +M+D D   +
Sbjct  266   GDPNKVIIQKLFKTLDQDSDGYLNTSDLRSLIIGIQFDDIDINIDEAIIQVMRDFDTSHD  325

Query  850   SRITEQEFLNGIENLLannssadna---aaatptstPENDDQEKSGEETNgaageveqag  680
             S+I E EF  GI   L                     E  DQ+   E         E   
Sbjct  326   SKIDEDEFFRGISRWLNKAKREAIXDRGKIPXSMKLLEEYDQKTKKEYDQFGDQIDEVVE  385

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               K   W     V+ + LG  +    A PL+  V  FS A  +P+F ISFVVLP   +  
Sbjct  386   DVKNAKWHASKAVVLLFLGTIVAAAVADPLVDAVDSFSTATSIPSFFISFVVLPFASSSE  445

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
             +    IF  S+K  + ASL +SEIY  VTMSN+  L   L +VY R LTW +SAEVLV+ 
Sbjct  446   IVTTLIF-XSRKKQRTASLAYSEIYGSVTMSNILSLAVFLGLVYVRNLTWSFSAEVLVIL  504

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             ++ + +G +A F+TT+ LW S  A  LYP SL L Y+L  + GW+
Sbjct  505   IVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLVYILDYICGWS  549



>ref|XP_006852513.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
 gb|ERN13980.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
Length=574

 Score =   246 bits (628),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 170/503 (34%), Positives = 275/503 (55%), Gaps = 27/503 (5%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF ++++ YLM +    +S+ S+ + + LG GI G     IL
Sbjct  60    TCEQTYGFLPCTSTVLGNLFLVIVYGYLMFLGATYLSTGSELLLEVLGPGIVGGLFLPIL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ + SG+  S E AQ QV  G+ + +G+T+  LT+LWG C+++G+ D  ++  
Sbjct  120   GALPDAILILVSGLSGSTETAQKQVLIGMGLLSGSTVMLLTLLWGSCIVLGKCD-LSERS  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  Q  T+ F      +L   GI+TD STS  A +M+LS++PF++V+L  ++ S S +R
Sbjct  179   TAIDQQDTKRF------SLIGSGITTDRSTSMAARIMVLSIIPFIIVQLPTILHSTSWKR  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QN  1025
             + +LV+L++ V  L++Y  YQ+ +P IQKR   Y++ +++++                 +
Sbjct  233   VAILVSLVVAVLLLISYCLYQVFEPWIQKRRFAYAKHKHIISGILKSLQKHALGRLFDAD  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G+PN++ I   FH+ D D N ++S  EL+ F+  I  + +     V V  +M D D   +
Sbjct  293   GQPNIAAIHKLFHVIDQDKNGKISCSELQAFIIGIQLENINLDEEVDVANVMADFDISYD  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqagg-E  674
             S I   EF+ GI   L    +  +      +    +D   K+ EE +    E ++     
Sbjct  353   SNIDLPEFVRGITKWLYEAKNVVDHPGHYSSKFT-SDFHLKTKEELDRLDNESDEIVEGI  411

Query  673   KMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMA  494
             +      +  V  ++ G  I    A PL+  V  FS A  +P+F ISF+ +P+  N   A
Sbjct  412   ENARTVCLKAVFLLLCGTVIAAVFADPLVDAVSNFSTATSIPSFFISFIAMPLATNSSEA  471

Query  493   IAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVI  314
             ++A+  AS+K  + ASLTFSEIY  VTM+N+  L   LA+VY R LTWD+SAEVLV+ V+
Sbjct  472   VSALIFASRKKQRTASLTFSEIYGAVTMNNILCLAVFLALVYVRHLTWDFSAEVLVILVV  531

Query  313   SLTIGFLAYFKTTYQLWTSIFAF  245
              L +G +  F+TT+ LW    A+
Sbjct  532   VLIMGLVGSFRTTFPLWACFIAY  554



>emb|CDY26003.1| BnaC06g06210D [Brassica napus]
Length=571

 Score =   246 bits (627),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 177/543 (33%), Positives = 288/543 (53%), Gaps = 63/543 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L 
Sbjct  51    CEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLG  110

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+      AQ QV  G+ + AG+T+  LTV+WG C +VG+ D   ++  
Sbjct  111   ALPDAMLIMVSGLSGDAATAQTQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDNI  168

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             + +   T+ F       L + G++ D  TS+ A +M +S++PF++V+L  V++S SG+ +
Sbjct  169   AVNNRDTKGF------HLKDSGVTVDVWTSYAARIMAISVIPFIIVQLPQVLNSTSGRHL  222

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VLVALI++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G
Sbjct  223   AVLVALILSVVMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHALGRLLDDEG  282

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P+   IR  F   D++ +  +S+ EL+  +  I  +++   +  AV  +++D D+  + 
Sbjct  283   QPDEHVIRKLFETIDANKDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLDE  342

Query  847   RITEQEFLNGIENLLannssad---------------------naaaatptstPEN-DDQ  734
             ++ ++EF+ GI++ L     A                                 EN ++ 
Sbjct  343   QVDQEEFVRGIKHWLIQAMGAAGPSGPDAGPRTMKFLDHFHVQTKREHALLGDNENGEND  402

Query  733   EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVG  554
             E+SGE  +                W  I   L ++LG AI    A PL+  V  FS A G
Sbjct  403   EESGEVADR--------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATG  448

Query  553   VPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAV  374
             +P+F ISF+ LP+  N   +++AI  AS+K  + ASLTFSE+  G TM+N+  L   LA+
Sbjct  449   IPSFFISFIALPLATNSSESVSAIIFASRKKIRTASLTFSELCGGATMNNILCLSVFLAI  508

Query  373   VYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-L  197
             VY R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    
Sbjct  509   VYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWF  568

Query  196   GWN  188
             GW+
Sbjct  569   GWS  571



>ref|XP_008368645.1| PREDICTED: uncharacterized protein LOC103432241 [Malus domestica]
Length=585

 Score =   246 bits (628),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 176/525 (34%), Positives = 275/525 (52%), Gaps = 31/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   + G +F ++++ Y+M ++ +L+S+ S+ +   LG GI G     +L
Sbjct  70    SCEQTYGFLPCTSTVLGNIFLVLVYGYMMFLSAKLLSNGSEILLQILGPGIVGGLFLPLL  129

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P   + ++SG+    E AQ+QV  G+ + AG+ +  LT+LWG C+IVG+ D   +  
Sbjct  130   GSLPDATIILASGLSGDTETAQSQVSVGMGLMAGSNVMLLTILWGTCLIVGKCD--IENS  187

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  Q   + F      +L   G+STD  TS++A +M+ SL+PFV+V+L  V  + S  R
Sbjct  188   IAVDQKDEKRF------SLTGSGVSTDIWTSYSARIMIJSLIPFVIVQLPQVFHATSDSR  241

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + +L++L ++++F++AY  YQ+  P IQKR L YS+ ++                LLT +
Sbjct  242   VAILISLAVSISFVIAYSFYQVFQPWIQKRKLAYSKHKHVMSEILKQLKTNALGRLLTND  301

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGN  851
             G PN   I+  F   D D++  +++ +L   +  I  D++   +  A+  +M+D D   +
Sbjct  302   GDPNKVIIQKLFKTLDQDSDGYLNTSDLRSLIIGIQFDDIDINIDEAIIQVMRDFDTSHD  361

Query  850   SRITEQEFLNGIENLLannssadna---aaatptstPENDDQEKSGEETNgaageveqag  680
             S+I E EF  GI   L                     E  DQ+   E         E   
Sbjct  362   SKIDEDEFFRGISRWLNKAKREAIXDRGKIPXSMKLLEEYDQKTKKEYDQFGDQIDEVVE  421

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               K   W     V+ + LG  +    A PL+  V  FS A  +P+F ISFVVLP   +  
Sbjct  422   DVKNAKWHASKAVVLLFLGTIVAAAVADPLVDAVDSFSTATSIPSFFISFVVLPFASSSE  481

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
             +    IF  S+K  + ASL +SEIY  VTMSN+  L   L +VY R LTW +SAEVLV+ 
Sbjct  482   IVTTLIF-XSRKKQRTASLAYSEIYGSVTMSNILSLAVFLGLVYVRNLTWSFSAEVLVIL  540

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             ++ + +G +A F+TT+ LW S  A  LYP SL L Y+L  + GW+
Sbjct  541   IVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLVYILDYICGWS  585



>gb|ADN33808.1| sodium/calcium exchanger family protein [Cucumis melo subsp. 
melo]
Length=585

 Score =   246 bits (627),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 187/527 (35%), Positives = 283/527 (54%), Gaps = 37/527 (7%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC     G LF I+++ YLM +A + +S+ S+ + + LG GI G      L
Sbjct  72    SCEQSYGFLPCTTTALGNLFLIIVYGYLMFLAAKYLSTGSELLLEILGPGIVGGLFLPAL  131

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++     I  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   Q+ 
Sbjct  132   GALPDAML-----ILGSAEVAQSQVSVGMGLLAGSTVMLLTLIWGTCVIVGKCD--LQDS  184

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L E G+STD  TS+ A +M++S+VPF++V+L  +++S SG+ 
Sbjct  185   VAIDSQDTKGF------SLTESGVSTDIWTSYAARIMVISVVPFLIVQLPQMLNSTSGRH  238

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI++V+  + Y  YQ+  P IQ+R L + + ++                LLT+N
Sbjct  239   LAVLIALIVSVSMFITYCLYQVFQPWIQRRKLAFVKHKHVIFGFLRHLKQQTLGRLLTEN  298

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   I   F   D + +  +S+ EL   +  I  DE+      AV  +M D D   +
Sbjct  299   GEPDKEIIEKLFSRIDVNKDGLLSASELRALIVGIQFDEIDLDHDDAVDKIMNDFDTSRD  358

Query  850   SRITEQEFLNGIENLLannssadn---aaaatptstPENDDQEKSGEET--Ngaageveq  686
             S +   EF NGI   L+    +                N  QE   E    +      E 
Sbjct  359   SHVDSNEFGNGIIRWLSQVQGSRTGRGDDGPHTMKYLHNFHQETKREHDLLDVGEQSDEV  418

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
               G + G    I  +L ++LG AI    A PL+  V  FS A  +P F ISF+ LP+  N
Sbjct  419   VEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVHNFSNATKIPAFFISFIALPLATN  478

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+   K ASLTFSE+Y  VTM+N+  L   LA+VY R L W++S+EVLV
Sbjct  479   SSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCLSVFLALVYLRGLVWNFSSEVLV  538

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + V+++ +G +  F+T + LWTS+ A  LYPFSL L YVL  + GW+
Sbjct  539   ILVVTVVMGVMGSFRTAFPLWTSLVALLLYPFSLVLVYVLDYVFGWS  585



>ref|XP_011027724.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
 ref|XP_011027725.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
Length=554

 Score =   245 bits (625),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 177/513 (35%), Positives = 278/513 (54%), Gaps = 24/513 (5%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF +V+++YL+S+A++ +SS S   F   GTGIFG +VF +L
Sbjct  54    TCEPIYGFMPCTTKVWGNLFLLVVYEYLLSLADKYISSGSNLFFQMFGTGIFGGSVFYVL  113

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
               FP+I++ + + +  S++   + V   +   AG+T+ +LT++WG  +  G  D      
Sbjct  114   GKFPQIVLVLVTLLSASEDVVGSAVSMSMGFLAGSTMMSLTIIWGSVIAFGSYDL-----  168

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
               Q  PS+ +  +  L   N  G+ TD  T +TA ++LLS++P++++EL  VV+S+S  R
Sbjct  169   --QQTPSS-NLENKMLCLSNGYGVKTDIVTKYTARIILLSMIPYLILELSKVVNSSSATR  225

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
               VL+ALIITV  L+ Y  +Q+  P IQ R+L Y        +  ++L    G+P   +I
Sbjct  226   AAVLIALIITVILLVTYCTFQVFQPWIQDRTLEYLILSYVKKNLLQSLCNPYGRPIEFKI  285

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRM--VAVKTMMKDLDRDGNSRITEQEF  827
             R  F   D + N Q+S  E+  FL  I    V  +    V  +M + D  G+  I+++EF
Sbjct  286   RQLFRKIDLNKNGQISEDEVRAFLVGIEAGVVGLIGDHCVSKVMAEFDFSGDHGISKEEF  345

Query  826   LNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIV  647
             + GI   L   +  +N    T      N +   S EE      E + +       W++  
Sbjct  346   IRGISKWLDEANGVENNGNQTELF---NSNLPGSREEQQIWEAEQQDSKNSD--EWNYSK  400

Query  646   TVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQ  467
                 ++LG AI    A+PL   + + + A+ VP+F++S+ ++P  +N R    +I   S 
Sbjct  401   ATYFILLGTAIAVLLAKPLTKTLQELATAIKVPSFLVSYFLVPFALNFRQGYKSIISVSD  460

Query  466   KSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAY  287
             K  K+ SLT S+IY GV M+N+ GL S L +VY RE+ WD +AE+LVV VI   IG  + 
Sbjct  461   KKEKSVSLTLSQIYCGVFMNNVLGLTSFLTIVYIREVEWDITAEILVVLVICSGIGLSSS  520

Query  286   FKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGW  191
             F + +  WT + A+ LYP SL   YVL + LGW
Sbjct  521   FSSKFPFWTCLVAYALYPISLGFLYVLTISLGW  553



>ref|XP_003634635.1| PREDICTED: uncharacterized protein LOC100264164 [Vitis vinifera]
 emb|CBI20221.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   245 bits (625),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 193/533 (36%), Positives = 293/533 (55%), Gaps = 45/533 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC     G LF I+++ YLM +A   +SS S+ + + LG G+ G  +  IL
Sbjct  63    SCDQTYGFMPCTTTTVGNLFLILVYGYLMFLAATYLSSGSELLLELLGPGLVGGLLLPIL  122

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
                P  ++ + SG+  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D + +  
Sbjct  123   GALPDAMLILVSGLSGSTETAQSQVSVGMGLLAGSTVMLLTIIWGTCVIVGKCDLQDSVA  182

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
             KDSQ    T+ F      +L   G+STD  TS+ A +M++S++PF++V+L  V+ S S +
Sbjct  183   KDSQ---DTKGF------SLTGSGVSTDIWTSYAAIIMVISVIPFIIVQLPQVLHSTSAR  233

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQ  1028
             R+ VL+ALI+++  L+ Y  YQ+  P IQKR L Y++ ++                LLT+
Sbjct  234   RLAVLIALIVSLILLITYCLYQVFVPWIQKRRLAYAKHKHVISGLLKHLRKRALGKLLTE  293

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDG  854
              G+PN   IR  FH  D +++  +S  EL   +  I  +E+   +  AV  +M D D   
Sbjct  294   EGEPNEEIIRKLFHTIDENHDGNLSKAELRALIVGIQFEEIDLDKNEAVDKVMSDFDTSN  353

Query  853   NSRITEQEFLNGIENLLannssa----------dnaaaatptstPENDDQEKSGEETNga  704
             +  + E EF+ GI   L                 ++         + +     G++++  
Sbjct  354   DQFVDEGEFVKGISRWLMEAKRYGGSGPDAGPNSSSVLDAFHRGTKREHHRLGGDQSD--  411

Query  703   ageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVV  524
                 E     +   W     V+ ++LG  I    A PL+  V  FS A  +PTF ISF+ 
Sbjct  412   ----EVVEAVENPKWITFKAVMMLLLGTLIAAVFADPLVDAVDNFSDATSIPTFFISFIA  467

Query  523   LPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDY  344
             LP+  N   A++AI  AS+K ++  SLTFSE+Y  VTM+N+  L   LA+VY R LTWD+
Sbjct  468   LPLATNSSEAVSAIIFASRKKNRTTSLTFSELYGAVTMNNVLCLSVFLALVYVRGLTWDF  527

Query  343   SAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             S+EVLV+ ++ + +G  A F+TT+ LWTS  A  LYPFSLAL YVL  +LGW+
Sbjct  528   SSEVLVIVIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALVYVLDYVLGWS  580



>ref|XP_010052481.1| PREDICTED: uncharacterized protein LOC104441166 isoform X1 [Eucalyptus 
grandis]
Length=576

 Score =   244 bits (624),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 168/503 (33%), Positives = 261/503 (52%), Gaps = 33/503 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             CD  YGF PC   + G +F I+ + YLM +A +L+S  S+ +   LG GI G     +L 
Sbjct  59    CDQTYGFLPCTTTVWGNVFLILAYGYLMFLAAKLLSDGSEILLQILGPGIIGGLFLPVLS  118

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P   + ++SG+  S E AQ+QV  G+ + AG+T+  LTVLWG C+IVG+ D   +   
Sbjct  119   SLPDATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCD--IENST  176

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +  Q  T+ F      +L   G+STD  TS+ A +M++S++PF++V+L  +  ++S  R 
Sbjct  177   TMDQKDTKKF------SLAGSGVSTDIWTSYAARIMMISIIPFIIVQLPEIFGASSLSRA  230

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE----------------NLLTQNG  1022
              VLV+ I+++  LL+Y  YQI  P IQKR + Y+  +                 L+T  G
Sbjct  231   AVLVSFIVSICLLLSYCLYQIFQPRIQKRRIAYAMHKRIISGLLQQLKARTLGKLVTDEG  290

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNS  848
             KPN   I   F   D D+N  +S  EL   +  I  +EV   +  AV  +++D D   +S
Sbjct  291   KPNTVVIEKLFETLDVDSNGNLSPAELRALIIGIHFEEVDINMDDAVHKVIEDFDTSRDS  350

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPEN------DDQEKSGEETNgaageveq  686
             ++   EF+ GI   L         A      +         D++ +   +      +  +
Sbjct  351   KLDSAEFIEGISKWLKRARRTAAGAHVQDDISLTTRLLDSFDERTEQQLDQLVDQEDELE  410

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 K   W+    +L ++LG AI    A PL+  V  FS A  +P+F +SFV+LP   +
Sbjct  411   VDDVKNVKWNTAKAILMLLLGTAIAAITADPLVDAVDNFSTATSIPSFFVSFVILPFACS  470

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
               +    +F +S+K  +  SLT+SEIY  VTM N+  L   L +VY R+LTWD+ +EVLV
Sbjct  471   SEVVSCLMF-SSRKKKRTTSLTYSEIYGSVTMGNVLSLAVFLGLVYVRQLTWDFFSEVLV  529

Query  325   VFVISLTIGFLAYFKTTYQLWTS  257
               ++ L +G +A F+TT+ LW S
Sbjct  530   TVIVCLVMGAIASFRTTFPLWMS  552



>gb|EYU28049.1| hypothetical protein MIMGU_mgv1a003825mg [Erythranthe guttata]
Length=561

 Score =   243 bits (620),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 170/509 (33%), Positives = 272/509 (53%), Gaps = 22/509 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC+ N+ G LF IV+++ L+S   + V   S   F   G GIFGA++F++L
Sbjct  56    TCEPIYGFLPCSTNVWGLLFLIVVYEILLSTGGKFVGIGSNLFFQITGPGIFGASLFQLL  115

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD--RATQ  1343
              VFP+I++ + S +  + E AQ +   G+ + AG T+  LT++WG+ VI+G  D   A  
Sbjct  116   GVFPQIVLVLVSSLSGTTEAAQQRATLGMGLVAGTTVMLLTLIWGISVILGSYDLSEAIT  175

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
               DS +Q  T              G+ TD  TS+TA +ML++L+PFV++    V +S  G
Sbjct  176   VDDSGNQKDTP----------KGHGVVTDVETSYTARIMLITLIPFVILLFAKVFNSPLG  225

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-------SRFENLLTQNGKPNVSR  1004
             +R+V+L+ALI+TV+ LLA+  YQI  P IQ R   Y        +   LL++NGKP+ S+
Sbjct  226   KRVVILIALIVTVSLLLAFITYQIFRPWIQNRRFEYLMNKYAKDKLLRLLSRNGKPDTSK  285

Query  1003  IRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA--VKTMMKDLDRDGNSRITEQE  830
             I   F   D + N  +S  EL   L  +  D+        V+ ++   D  G+  I + E
Sbjct  286   IEGLFSKIDKNGNAAVSPAELRVLLLGVKMDDEDLGTDRDVENILASFDVSGDGLIQKDE  345

Query  829   FLNGIENLLannssadnaaaatp-tstPENDDQEKSGEETNgaageveqaggEKMGTWDF  653
             F+ G+  L+   S    +      ++   ND++   G   N                 ++
Sbjct  346   FIRGMTELVTGLSDQTPSRLKLTGSNVSPNDNESMQGLLANSHKFSPSVIKRTANSWLNY  405

Query  652   IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPA  473
             +   L V +G  +L   A+PL+ +V+ F+ A  + +F +S++ +P  +N  +A+A+I  +
Sbjct  406   LRAGLFVAIGTVMLCALAEPLIKSVVAFAQAANLSSFSVSYLAIPFAMNYGVAVASIASS  465

Query  472   SQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFL  293
              Q++ K+ SLT S +Y+GV M+N+ GL+  LA V+AR L  D  A+V VV VI + +  L
Sbjct  466   RQRTQKSISLTLSALYSGVYMNNIIGLIVFLAPVFARNLEADVFAQVAVVLVICIFMTLL  525

Query  292   AYFKTTYQLWTSIFAFFLYPFSLALFYVL  206
                +TT+  W       LYP SLA+ Y+L
Sbjct  526   TSLRTTFPRWLGCVVLLLYPISLAVVYLL  554



>ref|XP_010041151.1| PREDICTED: uncharacterized protein LOC104430086 [Eucalyptus grandis]
Length=579

 Score =   243 bits (621),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 180/533 (34%), Positives = 279/533 (52%), Gaps = 44/533 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC     G LF I+++ YLM  A   +S  S+ + + LG G+    V  +L
Sbjct  61    SCDETYGFMPCTTTWIGNLFLILVYIYLMYTAAMCLSRGSEMLLEILGPGLISGLVLPML  120

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  G  + AG+T+  LTV+WG CV+VG+ D   Q+ 
Sbjct  121   GAIPNALLILVSGLSGSTETAQSQVSIGKGLLAGSTVMLLTVIWGSCVLVGKCD--LQDS  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  +  T+ F      +L   GI+ D  T   A +M++S++PF++++L+ ++ S SG+ 
Sbjct  179   TAVDKLDTKGF------SLTGSGITIDNLTRSAAWIMVISVIPFLVIQLLQLLDSTSGRH  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY----------------SRFENLLTQN  1025
             + VL+ALI++V  L++Y  YQ+    IQ R + Y                     L+  +
Sbjct  233   VAVLIALILSVVLLISYCLYQVFQRQIQVRRMKYWEERRVIFGFLGHVKKRAIGRLMKDD  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA-VKTMMKDLDRDGNS  848
             G+ N   +   F   D++N+  +++ EL+ F+  I  +E+    +    +M   D   ++
Sbjct  293   GEVNTEIVYKIFKTIDTNNDDHLTASELKAFVIGIRFEEIDLDASDADKIMAAFDTSHDN  352

Query  847   RITEQEFLNGIENLLannss------------adnaaaatptstPENDDQEKSGEETNga  704
             R++  EF  GI+  L                 A               +Q   GE+++  
Sbjct  353   RLSYDEFRKGIKKCLKKAVRSGKGSNLKNVVDAIKIIDHAGHQAKNEHEQLLEGEQSDVV  412

Query  703   ageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVV  524
                VE      +        V  +ILG  I    A PL+  V  FS A G+PTF ISF+V
Sbjct  413   VEIVENVKMTSLKA------VGLLILGTVIAAAFADPLVDAVDYFSDATGIPTFFISFIV  466

Query  523   LPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDY  344
             LP+  N   A++AI  AS+K  K ASLTFSE+Y  VT++NL  L   LA+VY R LTWD+
Sbjct  467   LPLATNSSEAVSAIIFASRKKQKTASLTFSELYGAVTVNNLLCLAVFLALVYIRGLTWDF  526

Query  343   SAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             ++EV+V+ ++ + +G  A F+TT+ LWT   AF LYPFSLAL YVL  +LGW+
Sbjct  527   TSEVIVILIVCIVMGIFASFRTTFPLWTVSVAFILYPFSLALVYVLDYVLGWS  579



>emb|CDY37675.1| BnaA04g19930D [Brassica napus]
Length=576

 Score =   243 bits (620),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 166/542 (31%), Positives = 282/542 (52%), Gaps = 38/542 (7%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
               V    FL L  P+  + S + C+H YGF PCA N+ GY+FQ++ F  L+ V +  +S 
Sbjct  41    HDVSDYKFLTLDPPK--TLSGTECEHVYGFLPCANNVGGYVFQVLTFGCLLIVGDYFLSV  98

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                ++F T   G +G  +F +L +FPR+++ +++G+    + A + V   + V AG T+F
Sbjct  99    GRSQLFLTFDVGFYGGIIFPLLTMFPRLVLMLANGLSLGSDVANSFVDNNMGVTAGYTVF  158

Query  1402  NLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNEC-----GISTDASTSFT  1238
              LT+ WG CV+      + + ++ ++   T+     W +  N        +  D      
Sbjct  159   ALTIQWGACVVFSITGSSLENEERKT--ITKIIQDWWSQRHNIVKNIVGNVDVDTKNKKP  216

Query  1237  AGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLH  1058
             AG+MLLSL PF++V L  +  S S + I++L+ LII+ +  + YF Y   D   Q+ SL 
Sbjct  217   AGIMLLSLAPFLMVTLTAIFDSHSWRHIIILITLIISSSSTILYFVYSYADQDNQRESLE  276

Query  1057  YSRFE---------------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRL  923
             ++RFE               NLL +NG+ N   I+  F   D++N++++   EL+ F ++
Sbjct  277   HARFEIMSEVHKLLKKFSPENLL-ENGEINKESIKSLFEFLDTNNDEKIQISELKDF-KI  334

Query  922   IVTDEVQRMVAV----KTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatpts  755
                +  +R   +    K  +K  D+D +  + + EF  G+ ++L N+    +        
Sbjct  335   EFWNFGRRKCEINKIAKEFLKKYDKDADGHLDKDEFEAGVTDMLKNHKIKFDNL------  388

Query  754   tPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVI  575
               E++ ++ S  +         Q    K    + +   ++VI+G+ I+ F A+P M N+ 
Sbjct  389   --EDEKEDHSEVKGTLKMKTPSQKLVTKFLYMETLGAAIKVIVGILIVLFLAKPFMMNIE  446

Query  574   QFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTG  395
               S + GVP+F I FV++P+  N +  ++A F   +   K +  TFSEIY  +TM+NL G
Sbjct  447   LLSVSAGVPSFYIVFVIIPLARNLKNTLSARFCHPKDKEKISIHTFSEIYKDITMNNLMG  506

Query  394   LLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALF  215
             L  +LAV+YAR L W+ S E  ++ ++ L IG  AY ++TY  W  +FAF +Y FSL L 
Sbjct  507   LSIILAVIYARGLAWNCSVEAFILVIVGLAIGLPAYMRSTYPFWICVFAFAMYIFSLVLI  566

Query  214   YV  209
             Y+
Sbjct  567   YL  568



>ref|NP_174197.2| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 gb|AEE31029.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=564

 Score =   243 bits (619),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 169/528 (32%), Positives = 268/528 (51%), Gaps = 43/528 (8%)
 Frame = -1

Query  1744  SFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIF  1565
              FL+L  P     + + C H Y F PCA+N+ GY+FQ+  F  ++ + E  ++    K+F
Sbjct  47    EFLSLDPPN--DITKNMCVHVYDFLPCADNVAGYVFQVFSFGCILIIGEYFLTKGRTKLF  104

Query  1564  DTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLW  1385
                  G +G  +F +L +FPRI + +S+G+  S+E A ++V   I V  G ++F LT+ W
Sbjct  105   LIFEVGFYGGIIFPLLTMFPRIALILSTGLVGSREMASSRVGNIIGVTVGYSVFALTIQW  164

Query  1384  GLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpf  1205
             G C++ G      +      QP   S AS          +  D +   +AG+MLL+++PF
Sbjct  165   GACILFGLSGTKPE------QPIDLSAAS----------VEADITNKKSAGIMLLTILPF  208

Query  1204  vlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----  1037
             +LV    + SS     I+VL+ LII+ +   AYF Y   D   Q +SL ++RFE +    
Sbjct  209   ILVTFSEISSSQYWNDIIVLITLIISASATFAYFFYSYFDRDDQAKSLDHARFELMSEVH  268

Query  1036  ----------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF---LRLIVTDEVQRM  896
                       L ++G+ N   ++  F   D++ + ++   EL+       +I   +    
Sbjct  269   KHLQIFSPKSLIRDGQLNQESLKRLFQKIDANGDGKIQVAELKDLTVEFGMIGRVKCHID  328

Query  895   VAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEE  716
               V T++ D DRDG+  I E EF  GI+  L     + +          E     K  + 
Sbjct  329   KLVHTLVDDFDRDGDREIDEAEFEIGIKKWLNQYKFSFDTTVPPREDQAEGVPILKVEKP  388

Query  715   TNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFII  536
                           K+ +W  +   L+VILG+ ++ + A+P M N+   S + GVP+F +
Sbjct  389   EQSLVK--------KLLSWRTLRASLEVILGMLVVIYLARPFMMNIQLLSESAGVPSFYV  440

Query  535   SFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAREL  356
              FVV+P+  N +  ++A F   +  +K  S TFSEIY  VTM+NL G+  +LA+VYAREL
Sbjct  441   VFVVIPLARNLKNTLSAHFCRKKDKAKITSDTFSEIYKDVTMNNLMGISIILAIVYAREL  500

Query  355   TWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFY  212
              WDY+ EVL++ ++ L IG  AY +TTY  W  + AF LY  SL + Y
Sbjct  501   VWDYTTEVLIIVIVGLLIGLPAYVRTTYPFWICLLAFALYFISLVVVY  548



>ref|XP_004146033.1| PREDICTED: uncharacterized protein LOC101209298 isoform 2 [Cucumis 
sativus]
 ref|XP_004162935.1| PREDICTED: uncharacterized protein LOC101229160 isoform 2 [Cucumis 
sativus]
Length=584

 Score =   243 bits (620),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 186/527 (35%), Positives = 281/527 (53%), Gaps = 37/527 (7%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+ +YGF PC     G LF I+++ YLM +A   +S+ S+ + + LG GI G      L
Sbjct  71    SCEQSYGFLPCTTTALGNLFLIIVYGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPAL  130

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++     I  S E AQ+QV  G+ + AG+T+  LT++WG CVIVG+ D   Q+ 
Sbjct  131   GALPDAML-----ILGSAEVAQSQVSVGMGLLAGSTVMLLTLIWGTCVIVGKCD--LQDS  183

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L E G+STD  TS+ A +M++S+VPF++V+L  +++S SG+ 
Sbjct  184   VAIDSQDTKGF------SLTESGVSTDIWTSYAARIMVISVVPFLIVQLPQMLNSTSGRH  237

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALII+V+  + Y  YQ+  P IQ+R L + + ++                LLT+N
Sbjct  238   LAVLIALIISVSMFIIYCLYQVFQPWIQRRKLAFVKHKHVIFGFLRHLKQQTLGRLLTEN  297

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGN  851
             G+P+   I   F   D + +  +S+ EL   +  I  DE  +    AV  +M D D   +
Sbjct  298   GEPDKEIIEKLFSRIDVNKDGLLSASELRALIVGIQFDEMDLDHDDAVDKIMNDFDTSRD  357

Query  850   SRITEQEFLNGIENLLannssadn---aaaatptstPENDDQEKSGEET--Ngaageveq  686
             S +   EF NGI   L+    +                N  QE   E    +      E 
Sbjct  358   SHVDSNEFGNGIIRWLSQVQGSRTGRGEDGPHTMKYLHNFHQETKREHDLLDVGEQSDEV  417

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
               G + G    I  +L ++LG AI    A PL+  V  FS A  +P F ISF+ LP+  N
Sbjct  418   VEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVHNFSNATKIPAFFISFIALPLATN  477

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A++AI  AS+   K ASLTFSE+Y  VTM+N+  L   LA+VY R L W++S+EVLV
Sbjct  478   SSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCLSVFLALVYMRGLVWNFSSEVLV  537

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             + ++++ +G +  F+T + LWTS+ A  LYP SL L YVL  + GW+
Sbjct  538   ILIVTMIMGVMGSFRTAFPLWTSLVALLLYPLSLVLVYVLDYVFGWS  584



>gb|EMT26919.1| hypothetical protein F775_25869 [Aegilops tauschii]
Length=469

 Score =   239 bits (610),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 159/457 (35%), Positives = 254/457 (56%), Gaps = 28/457 (6%)
 Frame = -1

Query  1498  IMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQP  1319
             ++ + SG+  ++E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D  T+   +    
Sbjct  21    LLVLVSGLSGTKETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCD-VTENGVAIDST  79

Query  1318  STQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlva  1139
              T+ F      +L   GI+TD  TS+ A +M +S+VPFV+ +   ++ +  G+R+ +L+A
Sbjct  80    DTKGF------SLTGSGITTDVQTSYAARIMAISVVPFVIAQFPKMLKTHHGERLAILLA  133

Query  1138  liitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPNVS  1007
             LI + + +LAY  YQ+  P +QKR L Y++ ++                LL  +G PN +
Sbjct  134   LIASFSLVLAYCLYQVFQPWVQKRKLAYAKHKHVISGILQHAQKQALGRLLNDDGSPNEN  193

Query  1006  RIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQ  833
              IR  FH  D+D+++ +S  EL   +  I  +E+   +  AV  +M D D  GN  + E 
Sbjct  194   VIRKLFHKIDNDDSRNLSRAELHALIIGINFEEIDFDKNDAVDKIMDDFDTSGNDTVEED  253

Query  832   EFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaag-eveqaggEKMGTWD  656
             EF+ G++  L        A+ A       ND   ++ E+ +       E     +   W 
Sbjct  254   EFVAGMKIWLHEAKQKVEASGAYSNKFV-NDYHARTREDHDQLVDRSDEAVESVENPGWC  312

Query  655   FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFP  476
                 V  ++LG  I    A PL+  V  FS A  +P+F +SF+ LP+  N   A++AI  
Sbjct  313   IAKAVGYLLLGATICAAFADPLVDAVHNFSNATHIPSFFVSFIGLPLATNSSEAVSAIIF  372

Query  475   ASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGF  296
             AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y RELTWD+S+EVLV+ ++ + +G 
Sbjct  373   ASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRELTWDFSSEVLVILLVCVIMGL  432

Query  295   LAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
                F+T++ LWT + A+ LYP +LA+ YVL  + GW+
Sbjct  433   FTSFRTSFPLWTCLVAYLLYPLTLAVVYVLDFVFGWS  469



>ref|XP_004968611.1| PREDICTED: uncharacterized protein LOC101771765 [Setaria italica]
Length=575

 Score =   241 bits (616),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 295/540 (55%), Gaps = 28/540 (5%)
 Frame = -1

Query  1747  SSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKI  1568
             +S + L  P ++++    C+ +YGF PC   + G LF I+++ +LM  A   +SS S+ +
Sbjct  44    ASVIRLASPAVAAAVEGKCEQSYGFLPCTTTVLGNLFLILVYGFLMFKAATYLSSGSELL  103

Query  1567  FDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVL  1388
              + +G G+ G  +  IL   P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+L
Sbjct  104   LEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKETAQSQVLIGMGLLAGSTVFLLTLL  163

Query  1387  WGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvp  1208
             WG CV+VG+ D A    ++    +T+ F      +L    I+TD  TS+ A +M LS++P
Sbjct  164   WGTCVVVGKCD-AGPNGEAVDLTNTKGF------SLTGTCITTDVQTSYAARIMGLSVIP  216

Query  1207  fvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----  1040
             FV+ +   ++ +  GQR+ VL+ALI++   +L+Y  YQ+  P IQ+R L Y++ ++    
Sbjct  217   FVIAQFPKMLKTHHGQRLAVLLALIVSFLLVLSYCVYQVFQPWIQRRKLAYAKHKHVISG  276

Query  1039  ------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--  902
                         LL ++G PN   IR  F   D D +  +S  EL   +  I  +E+   
Sbjct  277   ILRHAQMQSLGRLLNEDGTPNEDVIRKLFRKIDMDESCTLSRSELHALIVGINFEELDFD  336

Query  901   RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSG  722
             +M AV  +M D D   N  + E+EF+ G++  L     +  A  A       ND  E++ 
Sbjct  337   KMDAVNKVMDDFDTSRNDVVEEEEFVQGMKKWLNEAKRSVPAGGAFSHKFI-NDFHERTR  395

Query  721   EETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPT  545
             +E +       E     +   W     V  ++LG AI    A PL+  V  FS A  +P+
Sbjct  396   QEHDQLIDRSDEAVESVENPGWCITKAVALLLLGAAIAAAFADPLVDTVHNFSNATHIPS  455

Query  544   FIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYA  365
             F ISF+ LP+  N   A++AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y 
Sbjct  456   FFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYF  515

Query  364   RELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             R LTWD+S+EVL++ V+ + +     F+TT+ LWT + A+ LYP SL + Y+L  + GW+
Sbjct  516   RNLTWDFSSEVLIILVVCVVMALFTSFRTTFPLWTCLVAYVLYPLSLVIVYILDYVFGWS  575



>ref|XP_007021639.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13164.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=707

 Score =   244 bits (622),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 170/502 (34%), Positives = 271/502 (54%), Gaps = 31/502 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC+    G LF I+++ YLM +A   +S+ S+ +    G GI G      L
Sbjct  61    SCEQTYGFLPCSTTALGNLFLILVYGYLMYLAATYLSNGSEVLHVIRGPGIVGGLSLPPL  120

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  + E AQ+QV  G+ + AG+TI  LTV+WG CV VGR D   ++ 
Sbjct  121   GALPNAMLILVSGLSGAPETAQSQVSVGMGMLAGSTIMFLTVVWGSCVAVGRCD--LRDS  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +     T+ F      +L E G+STD  T + A +M +S++PF++V++  +++S  G+R
Sbjct  179   VAVDGTITKGF------SLTETGVSTDIWTCYAARIMAISVIPFIIVQVSQILNSTLGRR  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI++++ L++Y  YQ+  P +Q+R L +++ ++                LL  N
Sbjct  233   LAVLIALIVSLSLLVSYCLYQVFQPRVQRRRLAFAKHKHFISGILKHLEKTALGKLLDDN  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGN  851
             G PN   IR  F   D +++  +S+ EL+ F+  I  +E+   +  A++ +M D D   +
Sbjct  293   GDPNTEMIRELFETIDENHDGSLSTCELKAFIIGIRFEEIDLDKDDALRKVMADFDISLD  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPENDDQ-----EKSGEETNgaageveq  686
             S + E EF+ GIE  +                T +  D      ++  +         E 
Sbjct  353   SLVQEGEFVRGIEKWIIEAKRTGGTYLEPNKGTFKFIDHFHKQAKREHDLLGSEEQTDEV  412

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                 +   W  +  VL ++LG  I    A PL+  V  FS A  +P+F ISFV LP+  N
Sbjct  413   VEDVENPGWTSLKAVLMLLLGTLIAAAFADPLVDAVDNFSIATSIPSFFISFVALPLASN  472

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
                A+ AI  AS+K  + ASLTFSE+Y  VTM+N+  L   LA+VYAR LTWD+S+EVLV
Sbjct  473   SSKAVPAIIFASRKKKRTASLTFSELYATVTMNNVLCLSVFLALVYARGLTWDFSSEVLV  532

Query  325   VFVISLTIGFLAYFKTTYQLWT  260
             + ++ + +G  A F+TT+ LWT
Sbjct  533   ILIVCIVMGAFASFRTTFPLWT  554



>ref|XP_009141357.1| PREDICTED: uncharacterized protein LOC103865312 [Brassica rapa]
Length=547

 Score =   240 bits (613),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 165/537 (31%), Positives = 271/537 (50%), Gaps = 56/537 (10%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
               V    FL L  P+  + S + C+H YGF PCA N+ GY+FQ++ F  L+ V +  +S 
Sbjct  40    HDVSDYKFLTLDPPK--TLSGTECEHVYGFLPCANNVGGYVFQVLTFGCLLIVGDYFLSV  97

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                ++F T   G +G  +F +L +FPRI++ +++G+    + A + V   + V AG T+F
Sbjct  98    GRSQLFLTFDVGFYGGIIFPLLTMFPRIVLMLANGLSLGSDVANSFVDNNMGVTAGYTVF  157

Query  1402  NLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLML  1223
              LT+ WG CV+                            T ++  +  D      AG+ML
Sbjct  158   ALTIQWGACVVFSI-------------------------TGSKASVDVDTKNKKPAGIML  192

Query  1222  LSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF-  1046
             LSL PF++V L  +  S S + I++L+ LII+ +  + YF Y   D   Q+ SL ++RF 
Sbjct  193   LSLAPFLMVTLTAIFDSHSWRHIIILITLIISSSSTILYFVYSYADQDNQRESLEHARFE  252

Query  1045  --------------ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE  908
                           ENLL QNG+ N   I+  F   D++N++++   EL+ F ++   + 
Sbjct  253   IMSEVHKLLKKFSPENLL-QNGEINKESIKSLFEFLDTNNDEKIQISELKDF-KIEFWNF  310

Query  907   VQRMVAV----KTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEND  740
              +R   +    K  +K  D+D +  + + EF  G+ ++L                  E++
Sbjct  311   GRRKCEINKIAKEFLKKYDKDADGHLDKDEFEAGVTDML--------KNHKIKFDNLEDE  362

Query  739   DQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGA  560
              ++ S  +         Q    K    + +   ++VI+G+ I+ F A+P M N+   S +
Sbjct  363   KEDHSEVKGTLKMKTPSQKLVTKFLYMETLGAAIKVIVGILIVLFLAKPFMMNIELLSVS  422

Query  559   VGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLL  380
              GVP+F I FV++P+  N +  ++A F   +   K +  TFSEIY  +TM+NL GL  +L
Sbjct  423   AGVPSFYIVFVIIPLARNLKNTLSARFCHPKDKEKISIHTFSEIYKDITMNNLMGLSIIL  482

Query  379   AVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             AV+YAR L W+ S E  ++ ++ L IG  AY ++TY  W  +FAF +Y FSL L Y+
Sbjct  483   AVIYARGLAWNCSVEAFILVIVGLAIGLPAYMRSTYPFWICVFAFAMYIFSLVLIYL  539



>emb|CAN78652.1| hypothetical protein VITISV_033128 [Vitis vinifera]
Length=598

 Score =   241 bits (614),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 184/553 (33%), Positives = 291/553 (53%), Gaps = 63/553 (11%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   + G +F I+++ YLM +A + +S  S+ +   LG GI G     +L
Sbjct  59    SCDQTYGFLPCTTTVLGNIFLILVYGYLMFIAAKFLSDGSEILLGILGPGIIGGLFLPVL  118

Query  1516  MVFPRIIMTISS---------------------GIFNSQEGAQNQVFFGIRVNAGATIFN  1400
               FP  ++ + S                     G   +++  + QV  G+ + AG+T+  
Sbjct  119   SAFPDAVIILESSTLLTPLSDPRFPMGAIIIHLGYLEAKKQLKVQVSIGMGLLAGSTVML  178

Query  1399  LTVLWGLCVIVGRRD----RATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
             LT+LWG C+IVG+ D     AT  KD      T+ F      +L   G+STD   S+ A 
Sbjct  179   LTILWGSCIIVGKCDIENSVATDLKD------TRGF------SLTGSGVSTDIWASYAAR  226

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +M++S++PF++V++  V+ + S  R+ VL++LI++++ LL+Y  YQ+  P IQKR L Y+
Sbjct  227   IMVISVIPFIIVQISQVLHTTSQARLTVLISLIVSLSLLLSYCLYQVFQPRIQKRRLAYA  286

Query  1051  RFENLL----------------TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI  920
             + ++L+                T NG+PN   I+  F   D ++N  +S  ++   +  I
Sbjct  287   KHKHLMSGILKHLKSHILGRLFTNNGEPNTEAIKKLFETIDVNSNGYLSVTDIRALIIGI  346

Query  919   VTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPE  746
               D     +   VK++MKD D  G+S+I   EF+ G+   L     +   A +  +++  
Sbjct  347   QFDAADLDIDETVKSVMKDFDTTGDSQIDMNEFVRGMSRWLTKAKRSAIHAGSDGSNSLS  406

Query  745   ----NDDQEKSGEETNgaag--eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMT  584
                 ND   ++ EE +      E E+    K   W+    V  ++LG  +    A PL+ 
Sbjct  407   TRYINDFNLRTREEQDKLEDQNEEEEVESIKNPKWNASKAVAMLLLGTVVAAIFADPLVD  466

Query  583   NVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSN  404
              V  FS A  +P+F +SFVVLP   +     A IF AS+K  + ASLTFSEIY  VTM N
Sbjct  467   AVDNFSTATSIPSFFVSFVVLPFASSSEAVSAMIF-ASRKKLRTASLTFSEIYGSVTMGN  525

Query  403   LTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSL  224
             +  L   L ++Y R+LTWD+++EVL++ ++ + +G  A  +TT+ LWTS+ AF LYP SL
Sbjct  526   ILSLSVFLGLIYFRQLTWDFASEVLIILIVCILMGVFAGTRTTFPLWTSLMAFLLYPLSL  585

Query  223   ALFYVLQ-LLGWN  188
              L YVL   LGW+
Sbjct  586   VLVYVLDNYLGWS  598



>emb|CDP05978.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   238 bits (606),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 179/502 (36%), Positives = 273/502 (54%), Gaps = 42/502 (8%)
 Frame = -1

Query  1612  MSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFG  1433
             M +A   +SS S+ + + LG G+ G     +L   P  ++ + SG+  S E AQ+QV  G
Sbjct  1     MFLAATFLSSGSELLLEILGPGLIGGLFLPMLGALPDAMLILVSGLSGSAETAQSQVSVG  60

Query  1432  IRVNAGATIFNLTVLWGLCVIVGRRDRATQ-EKDSQSQPSTQSFASNWLKTLNECGISTD  1256
             I + AG+T+  LTV+WG CV VG+ D      KD Q    T+ F      +L   G+STD
Sbjct  61    IGLLAGSTVMLLTVIWGACVTVGKCDIENHVAKDLQD---TKGF------SLTGSGVSTD  111

Query  1255  ASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTI  1076
               T + A +M +S++PF++V+L  ++ S SG+ + VL+ALI++VA L++Y  YQ+  P I
Sbjct  112   IWTCYAAIIMAVSVLPFLVVQLPQMLKSNSGRHLAVLIALIVSVALLISYCLYQVFQPWI  171

Query  1075  QKRSLHYSRFENLLT----------------QNGKPNVSRIRLFFHLYDSDNNQQMSSRE  944
             Q+R L +++ + +++                 +G  N   +   F+  D D +  +SS E
Sbjct  172   QRRRLAFTKHKRVISGILKHLKMRALGRLCNDDGTINKEVVEKLFNTIDEDKDGYLSSSE  231

Query  943   LEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaa  770
             L   +  I  +E+      AV+ +MKD D   +S I+  EF  GI   L     +  + A
Sbjct  232   LRALVIGIRFEEINLDENDAVEKVMKDFDTSRDSLISFDEFSYGISRWLDEAKGSRASQA  291

Query  769   atptstPENDDQEKS-------GEETNgaageveqaggEKMGTWDFIVTVLQVILGVAIL  611
                T     D  E++       GE+++     V+            I  VL ++LG  I 
Sbjct  292   GPGTMKYLEDFHEQTKREHYLLGEQSDEIVEGVDNPRRTT------IKAVLLLLLGTVIA  345

Query  610   TFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSE  431
                A PL+  V  FS A  +P+F ISF+ LP+  N   A++AI  AS+K  ++ASLTFSE
Sbjct  346   AVFADPLVDAVDNFSSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSE  405

Query  430   IYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIF  251
             +Y  VTM+N+  L   LA+VYAR LTWD+S+EVLV+ ++ + +G     +TT+ LWTS+ 
Sbjct  406   LYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGIFGSLRTTFPLWTSLI  465

Query  250   AFFLYPFSLALFYVLQ-LLGWN  188
             AF LYPFSLAL YVL  + GW+
Sbjct  466   AFLLYPFSLALVYVLDYVFGWS  487



>emb|CBI20223.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   237 bits (605),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 179/498 (36%), Positives = 271/498 (54%), Gaps = 32/498 (6%)
 Frame = -1

Query  1612  MSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFG  1433
             M +A   +SS S+ + + LG G+ G  +  IL   P  I+ + SG+  S E AQ+QV  G
Sbjct  1     MFLAATYLSSGSELLLEILGPGLVGGLIVPILGALPDAILILVSGLSGSTETAQSQVSVG  60

Query  1432  IRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
             + + AG+T+  LT++WG CVIVG+ D   Q+  ++    T+ F      +L   G+STD 
Sbjct  61    MGLLAGSTVILLTIMWGSCVIVGKCD--LQDSVAKDLQDTKGF------SLTGSGVSTDI  112

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
              TS+ A +M++S++PF++V+L  V+ S S +R+ VL+ALI+++  L+ Y  YQ+  P IQ
Sbjct  113   WTSYAAIIMVISVIPFIIVQLPQVLHSTSARRLAVLIALIVSLILLITYCLYQVFQPWIQ  172

Query  1072  KRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSREL  941
             KR L Y++ ++                LLT+ G+PN   IR  FH  D +++  +S  EL
Sbjct  173   KRRLAYAKHKHVISGLLKHLRMHTLGKLLTEEGEPNEEIIRKLFHSIDENHDGNLSKAEL  232

Query  940   EKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaa  767
                +  I  +E+   R  AV  +M D D   +  + E EF+ GI   +      + +   
Sbjct  233   RPLIVGIQFEEIDLDRNEAVDKVMSDFDTSNDQFVDEGEFVKGISRWITEAKRYEGSGPD  292

Query  766   tptstPENDDQEKSG--EETNgaa--geveqaggEKMGTWDFIVTVLQVILGVAILTFCA  599
                ++    D    G   E N        E     +   W     V+ ++LG  I    A
Sbjct  293   AGPNSSSILDAFHRGTKREHNRLEGYQSDEVVEAVENPKWITFKAVMMLLLGTLIAAVFA  352

Query  598   QPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNG  419
              PL+  V  FS A  +PTF ISF+ LP+  +   A++AI  AS+K  +  SLTFS +Y  
Sbjct  353   DPLVDAVDNFSDATSIPTFFISFIALPLATSSE-AVSAIIFASRKKRRTTSLTFSVLYGA  411

Query  418   VTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFL  239
             VTM+N+  L   LA+VY R LTWD+S+EVLV+ ++ + +G  A F+TT+ LWTS  A  L
Sbjct  412   VTMNNVLCLSVFLALVYVRGLTWDFSSEVLVILIVCVVMGVFASFRTTFPLWTSFVALLL  471

Query  238   YPFSLALFYVLQ-LLGWN  188
             YPFSLAL YVL  +LGW+
Sbjct  472   YPFSLALVYVLDYVLGWS  489



>ref|XP_007212014.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
 gb|EMJ13213.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
Length=489

 Score =   237 bits (605),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 179/501 (36%), Positives = 274/501 (55%), Gaps = 38/501 (8%)
 Frame = -1

Query  1612  MSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFG  1433
             M +A   +S+ S+ + + LG GI G     IL   P  ++ + SG+  + E AQ+QV  G
Sbjct  1     MYLAATYLSNGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTETAQSQVSVG  60

Query  1432  IRVNAGATIFNLTVLWGLCVIVGRRDR----ATQEKDSQSQPSTQSFASNWLKTLNECGI  1265
             + + AG+T+  LTV+WG C++VG+ D     A   KD++    T S            G+
Sbjct  61    MGLLAGSTVMLLTVIWGSCILVGKCDIENSIAIDNKDTKGLSLTGS------------GV  108

Query  1264  STDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIID  1085
             STD  TS+ A +M +S++PF++V+L  +++S SG+ + VL++LI++V  L++Y  YQ+  
Sbjct  109   STDIWTSYAARIMAISVIPFLIVQLPQLLNSTSGRHLAVLISLIVSVVLLVSYCLYQVFQ  168

Query  1084  PTIQKRSLHYSRF--------------ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSR  947
             P IQ+R + Y++               E LLT +G+P+   I+  F   D D++  +S  
Sbjct  169   PWIQRRKIAYAKHKHVISGLLQHLTNQERLLTVDGEPDEEIIKKLFKTIDQDSDGYLSFS  228

Query  946   ELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaa  773
             EL   +  I  DE++  +  AV  +MKD D   +SRI+  EF  G+   L     A NA 
Sbjct  229   ELRALIVGIRFDEIELDKNDAVNKVMKDFDTSHDSRISVDEFWVGVSKWLKEAKRAGNAN  288

Query  772   aatptstPE--NDDQEKSGEETNgaageveqaggEKMG---TWDFIVTVLQVILGVAILT  608
             +     T +  +D   ++ EE        +     +      W  +   L +++G  I  
Sbjct  289   SDPGHRTMKFLSDFHSRTKEEHALLGAGDQSDEVVEGAENPKWTSLKAGLMLLVGTLIAA  348

Query  607   FCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEI  428
               A PL+  V  FS A  +PTF ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+
Sbjct  349   AFADPLVDAVDNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSEL  408

Query  427   YNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFA  248
             Y  VTM+N+  L   LA+VY R L+WD+SAEVLV+ ++ + +G L   +T Y LWT   A
Sbjct  409   YGAVTMNNILCLSVFLALVYIRGLSWDFSAEVLVILIVCVVMGILGSLRTNYPLWTCSIA  468

Query  247   FFLYPFSLALFYVLQ-LLGWN  188
             F LYPFSLAL YVL  +LGW+
Sbjct  469   FLLYPFSLALVYVLDYVLGWS  489



>gb|KCW89606.1| hypothetical protein EUGRSUZ_A01890 [Eucalyptus grandis]
Length=557

 Score =   239 bits (609),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 166/501 (33%), Positives = 260/501 (52%), Gaps = 33/501 (7%)
 Frame = -1

Query  1687  HAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVF  1508
             + YGF PC   + G +F I+ + YLM +A +L+S  S+ +   LG GI G     +L   
Sbjct  42    YTYGFLPCTTTVWGNVFLILAYGYLMFLAAKLLSDGSEILLQILGPGIIGGLFLPVLSSL  101

Query  1507  PRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQ  1328
             P   + ++SG+  S E AQ+QV  G+ + AG+T+  LTVLWG C+IVG+ D   +   + 
Sbjct  102   PDATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCD--IENSTTM  159

Query  1327  SQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivv  1148
              Q  T+ F      +L   G+STD  TS+ A +M++S++PF++V+L  +  ++S  R  V
Sbjct  160   DQKDTKKF------SLAGSGVSTDIWTSYAARIMMISIIPFIIVQLPEIFGASSLSRAAV  213

Query  1147  lvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE----------------NLLTQNGKP  1016
             LV+ I+++  LL+Y  YQI  P IQKR + Y+  +                 L+T  GKP
Sbjct  214   LVSFIVSICLLLSYCLYQIFQPRIQKRRIAYAMHKRIISGLLQQLKARTLGKLVTDEGKP  273

Query  1015  NVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRI  842
             N   I   F   D D+N  +S  EL   +  I  +EV   +  AV  +++D D   +S++
Sbjct  274   NTVVIEKLFETLDVDSNGNLSPAELRALIIGIHFEEVDINMDDAVHKVIEDFDTSRDSKL  333

Query  841   TEQEFLNGIENLLannssadnaaaatptstPEN------DDQEKSGEETNgaageveqag  680
                EF+ GI   L         A      +         D++ +   +      +  +  
Sbjct  334   DSAEFIEGISKWLKRARRTAAGAHVQDDISLTTRLLDSFDERTEQQLDQLVDQEDELEVD  393

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               K   W+    +L ++LG AI    A PL+  V  FS A  +P+F +SFV+LP   +  
Sbjct  394   DVKNVKWNTAKAILMLLLGTAIAAITADPLVDAVDNFSTATSIPSFFVSFVILPFACSSE  453

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
             +    +F +S+K  +  SLT+SEIY  VTM N+  L   L +VY R+LTWD+ +EVLV  
Sbjct  454   VVSCLMF-SSRKKKRTTSLTYSEIYGSVTMGNVLSLAVFLGLVYVRQLTWDFFSEVLVTV  512

Query  319   VISLTIGFLAYFKTTYQLWTS  257
             ++ L +G +A F+TT+ LW S
Sbjct  513   IVCLVMGAIASFRTTFPLWMS  533



>ref|XP_009766997.1| PREDICTED: uncharacterized protein LOC104218248 [Nicotiana sylvestris]
Length=574

 Score =   239 bits (610),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 180/541 (33%), Positives = 279/541 (52%), Gaps = 64/541 (12%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC +   G +F IV++ YLM +A   +SS S+ + + LG G+ G      L 
Sbjct  59    CEQSYGFLPCTKTALGNVFLIVVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPALG  118

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RAT  1346
               P  ++ + SG+  +   AQ QV  GI + AG+T+  LT +WG C IVG+ D     A 
Sbjct  119   ALPDAMLILVSGVSGTAAAAQGQVSVGIGLLAGSTVMLLTAIWGTCCIVGKCDIQNSVAV  178

Query  1345  QEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
               +D++    T S            G++TD  TS+ A +M +S++PF++V+L  +  S S
Sbjct  179   DLRDTKGLSMTGS------------GVTTDIWTSYAAMIMAVSVIPFIVVQLPQLFHSTS  226

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LL  1034
             G+ + VL+ALII+++ L++Y  YQ+  P IQ R L Y + ++                L 
Sbjct  227   GRHLAVLIALIISLSLLVSYCLYQVFQPWIQTRRLAYVKHKHVISGILKHLKKHALGRLF  286

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDR  860
             T +G PN+  I   F+  D + +  +S  EL   +  I  +E+      A+  ++KD D 
Sbjct  287   TDHGTPNIQVIEKLFNAIDENGDGYLSHSELRALVVGISLEEINLDENDAIAKVLKDFDT  346

Query  859   DGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqag  680
               + ++   EF+ G+E  L    S              N    ++G +T     +  +  
Sbjct  347   SSDDKLDLTEFIAGVEKWLYEARS-------------SNGSSREAGPDTMKYLDDFHEQT  393

Query  679   gEKMG----TWDFIVTVLQ------------VILGVAILTFCAQPLMTNVIQFSGAVGVP  548
               +      T D IV  ++            ++LG  I    A PL+  V  FS A  +P
Sbjct  394   RMEHSLLGDTSDEIVEGVENPRKVAIKAALLLLLGTIIAAVFADPLVDAVNNFSSATSIP  453

Query  547   TFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVY  368
             TF ISF+ LP+  N   A++AI  AS+K+ K+ SLTFSE+Y  VTM+NL  L   LA+VY
Sbjct  454   TFFISFIALPLATNSSEAVSAIIFASRKNKKSTSLTFSELYGAVTMNNLLCLSVFLAIVY  513

Query  367   ARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
              R LTW++S+EVLV+ ++ + +G L   +TT+ LWT   AF LYP SL L YVL  + GW
Sbjct  514   IRGLTWNFSSEVLVILIVCVVMGVLGSIRTTFPLWTCSIAFLLYPLSLVLVYVLDYVFGW  573

Query  190   N  188
             +
Sbjct  574   S  574



>ref|XP_007213956.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
 gb|EMJ15155.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
Length=490

 Score =   237 bits (604),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 275/499 (55%), Gaps = 33/499 (7%)
 Frame = -1

Query  1612  MSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFG  1433
             M +A   +S+ S+ + + LG G+ G     IL   P  I+ + SG+  S E AQ+QV  G
Sbjct  1     MYLAATYLSNGSELLLEILGPGVVGGLFLPILGSLPDAILILVSGLSGSTETAQSQVSVG  60

Query  1432  IRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
             + + AG+T+  LT++WG CV+VG+ D   Q   +     T+ F      +L   G+STD 
Sbjct  61    MGLLAGSTVLILTLIWGSCVVVGKCD--IQNSVAIDNKDTKGF------SLTGSGVSTDI  112

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
              TS+ A +M++S++PF++V+L  +++S  G+ I VLV+LI++VA  L+Y  YQ+  P IQ
Sbjct  113   WTSYAARIMVISVIPFIIVQLPQLLNSNLGKDIAVLVSLIVSVALFLSYCLYQVFQPWIQ  172

Query  1072  KRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSREL  941
             +R + +++ ++                LL  +G+PN   I+  FH  D D +  +S+ EL
Sbjct  173   RRRIAFAKHKHVISGILQHLKTRALGSLLKGDGEPNEEIIKKLFHAMDQDGDGSISASEL  232

Query  940   EKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaa  767
                +  I  DE+Q  R  AV  +MK+ D   +SRI  QEFL GI   +     + + ++ 
Sbjct  233   RAMIVGIRFDEIQLDRDDAVDKVMKEFDTSCDSRIDLQEFLTGISKWIHEAKRSGDDSSN  292

Query  766   tptstPEN--DDQEKSGEETNgaag---eveqaggEKMGTWDFIVTVLQVILGVAILTFC  602
                 T +   D   ++ +E +         E   G +   W      L +++G  I    
Sbjct  293   NDPHTMKFLFDFHSRTKQEHDLLGAGGQSDEIIEGVESPKWTTFKAGLMLLVGTLIAAAF  352

Query  601   AQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYN  422
             A PL+  V  FS A  +PTF ISFV LP+  +   A++AI  AS+K  + ASLTFS++Y 
Sbjct  353   ADPLIDVVDNFSSATSIPTFFISFVALPLATSCE-AVSAIMFASRKKIRTASLTFSQLYG  411

Query  421   GVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFF  242
               TM+N+  L   LA+VY R L WD+SAEVLV+ ++ + +G  + F+T + LWTS  AF 
Sbjct  412   SATMNNVLCLSVFLALVYFRGLEWDFSAEVLVILIVCIVMGVFSSFRTVFPLWTSSIAFL  471

Query  241   LYPFSLALFYVLQ-LLGWN  188
             LYPFS+AL YVL  + GW+
Sbjct  472   LYPFSVALIYVLDYVYGWS  490



>ref|XP_006415620.1| hypothetical protein EUTSA_v10007172mg [Eutrema salsugineum]
 gb|ESQ33973.1| hypothetical protein EUTSA_v10007172mg [Eutrema salsugineum]
Length=585

 Score =   239 bits (609),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 175/522 (34%), Positives = 277/522 (53%), Gaps = 40/522 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C H YGF PCA+N+ GY FQ+  F  L+ V E  +S    K+F     G +G  +F +L 
Sbjct  62    CIHIYGFLPCADNVGGYAFQVFSFGCLLIVGEYFLSKGRSKLFVIFEVGFYGGIIFPLLT  121

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG----RRDRAT  1346
             +FPRI + +S+G+  S+E A ++V   + V  G T+F LT+ WG CV+ G    R D++ 
Sbjct  122   MFPRIALLLSTGLMGSREIANSRVNNKVGVTVGYTVFALTMQWGSCVVFGLSGSRSDQSI  181

Query  1345  QE-KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
             +  +D+ S      +  N  K L    +  D      AG+MLL+L+PFV+V L  +  + 
Sbjct  182   RRGQDTTSLSPNLFYGKNLFKNLAGASVEADPKNKKAAGIMLLTLLPFVMVTLTEIFDTK  241

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL--------------LT  1031
             S   I+VL  LII+ +  L YF Y   D   QK+SL  +RFE +              L 
Sbjct  242   SWNDIIVLTTLIISASATLVYFVYSYFDRADQKKSLDLARFELMSEVHKHLQIFSPQNLI  301

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVAVK--------TMM  875
             ++G+ +   ++  F   D + + ++   EL++     +T E   +  VK        T++
Sbjct  302   RDGQLSKESLKRLFDKIDVNKDGKIQVSELKE-----ITLEFGMLGRVKCDIHELATTLL  356

Query  874   KDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaage  695
              D D+D +  I E EF  GIE  L     + +          E   + ++ E+      +
Sbjct  357   ADFDKDRDGEIDEIEFERGIEKWLKQYKFSFDNT--------ECHRENRAEEDGVLKVEK  408

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
              +++   K+ T   +   ++VI+G+ I+ F A PLMT++   S + GVP+F  +FV++P+
Sbjct  409   PKESLVVKLLTKRTLRAFIEVIVGILIVIFLATPLMTDIQLLSVSAGVPSFYAAFVMVPL  468

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
               N + A++A F + +  ++  S TFSEIY  VTM+NL G+  +LA+VY R LTWDYS E
Sbjct  469   ARNLQNALSAHFCSKKDKARVTSDTFSEIYKDVTMNNLLGISIILAIVYFRGLTWDYSTE  528

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             VL++ ++ L IG  AY ++TY  W  + AF LY FSL L Y+
Sbjct  529   VLIIVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLVLIYL  570



>ref|NP_001151543.1| LOC100285177 precursor [Zea mays]
 gb|ACG43258.1| calcium ion binding protein [Zea mays]
Length=568

 Score =   238 bits (606),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 173/521 (33%), Positives = 276/521 (53%), Gaps = 26/521 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G LF ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  55    CEQTYGFLPCTTTVLGNLFLVLAYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILG  114

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D     ++
Sbjct  115   ALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPG-RE  173

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   G++TD  TS+ A +M LS++PF++ +   ++ +  GQR+
Sbjct  174   AVDVTDTKGF------SLTGTGVTTDVQTSYAARIMGLSVIPFIIAQFPKMLKTHHGQRL  227

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +L+AL+++ A +LAY  YQ+  P IQ+R L Y++ ++                LL  +G
Sbjct  228   AMLLALVVSFALVLAYCLYQVFQPWIQRRKLAYAKHKHVISGILRHAQMQSLGRLLNDDG  287

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
              PN   IR  F   D D ++ +S  EL   +  I  +EV   R  AV  +M D D   N 
Sbjct  288   TPNEQVIRKLFRKIDMDESRSLSRAELHALIVGINFEEVDFDRTDAVDKVMDDFDTSRND  347

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
              + E+EF+ G+   L     +     A  +       +    E         E     + 
Sbjct  348   VVEEEEFVQGMRKWLDEARRSVPVGGAFSSKFIHEYHERTRQEHDELVDRSDEAVESVEN  407

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
               W     V  ++LG A     A PL+  V  FS A  +P+F ISF+ LP+  N   A++
Sbjct  408   PGWCIAKAVALLLLGSAAAAAFADPLVDAVHGFSNATRIPSFFISFIALPLATNSSEAVS  467

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ +
Sbjct  468   AIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVCV  527

Query  307   TIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
              +     F+TT+ LWT + A+ LYP SL + Y+L  + GW+
Sbjct  528   VMALFTSFRTTFPLWTCLVAYMLYPLSLIIVYILDYVFGWS  568



>ref|XP_011098255.1| PREDICTED: uncharacterized protein LOC105176958 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   238 bits (606),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 270/498 (54%), Gaps = 26/498 (5%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC     G LF I+++ YLM +A   +S+ S+ + + LG GI G     +L 
Sbjct  57    CEETYGFMPCTSTALGNLFLILVYGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPVLG  116

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+  LT++WG C+IVG+ D   +   
Sbjct  117   ALPDAMLILVSGLSGSRETAQSQVSVGMGLLAGSTVMLLTLIWGTCIIVGKCD--IENSV  174

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T++F      +L   GISTD  TS+ + +M +S++PF++V+L  ++ S SG+ +
Sbjct  175   AVDSKDTKAF------SLAGSGISTDIWTSYASIIMAISVIPFIIVQLPQILHSNSGRHL  228

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQNG  1022
              VL+ALI++ + L+AY  YQ+  P +Q+R + Y++                F  L  ++G
Sbjct  229   AVLIALIVSASLLIAYCLYQVFQPMVQRRRIAYAKHKHVVAGILKHLKMHAFGKLYGEDG  288

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMKDLDRDGNS  848
             K NV  +R  F   D + +  +S  EL   +  I   E  +    AV  +MKDLD   +S
Sbjct  289   KLNVEVLRKLFRTIDDNKDGYLSHTELRALIVGIRFSESNLDEDDAVVKLMKDLDSSRDS  348

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKM  668
             R+   EF++ +   L     A  +         ++  ++   E         E A G   
Sbjct  349   RVDLHEFISTVARWLEEAKGAKTSNHTGSMKFIDDFHEQTRREHDLLGDQGDEAAEGVDN  408

Query  667   GTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIA  488
               W  +  VL ++LG  I    A PL+  V  FS A  +P+F ISF+VLP+  N   A++
Sbjct  409   PRWTSVKAVLLLLLGTVIAAVFADPLVDAVDNFSTATSIPSFFISFIVLPLATNSSEAVS  468

Query  487   AIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISL  308
             AI  AS+K  ++ASLTFSE+Y  VTM+N+  L   LA+VY R L WD+S+EVLV+ ++ +
Sbjct  469   AIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYVRGLVWDFSSEVLVILIVCV  528

Query  307   TIGFLAYFKTTYQLWTSI  254
              +G  A  +TT+ LWTS+
Sbjct  529   VMGVFASIRTTFPLWTSL  546



>gb|AAF69532.1|AC008007_7 F12M16.12 [Arabidopsis thaliana]
Length=574

 Score =   237 bits (605),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 171/542 (32%), Positives = 277/542 (51%), Gaps = 71/542 (13%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C+  YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L
Sbjct  65    ACEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPML  124

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D   ++ 
Sbjct  125   GALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCD--LRDS  182

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              + +   T+ F       L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG++
Sbjct  183   IAVNNQDTKGF------HLKDSGVTVDIWTSYAARIMAISVIPFVIVQLPQMLGSTSGRQ  236

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL+ALI             +  P IQ+R L +++ ++                LL   
Sbjct  237   LSVLIALI-----------LSVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDE  285

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGN  851
             G+P+   IR  F   D++N+  +S+ EL+  +  I  +++   +  AV  +++D D+  +
Sbjct  286   GQPDEHVIRKLFLTIDANNDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLD  345

Query  850   SRITEQEFLNGIENLLanns--------------------sadnaaaatptstPENDDQE  731
              ++ ++EF+ GI+  L                                      EN + +
Sbjct  346   EQVDQEEFVRGIKQWLIQAMGGAPSGPEAGPRTMKFLDNFHVQTKREHALLGDNENGEND  405

Query  730   KSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGV  551
             + G E                  W  I   L ++LG AI    A PL+  V  FS A G+
Sbjct  406   EEGGEVADP-------------KWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATGI  452

Query  550   PTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVV  371
             P+F ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+V
Sbjct  453   PSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIV  512

Query  370   YARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LG  194
             Y R LTW++S+EVLV+ ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    G
Sbjct  513   YVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFG  572

Query  193   WN  188
             W+
Sbjct  573   WS  574



>ref|XP_002305761.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
 gb|EEE86272.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
Length=560

 Score =   237 bits (604),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 171/519 (33%), Positives = 277/519 (53%), Gaps = 30/519 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF +V+++YL+S+A++ +SS S   F   GTG+FG +VF ++
Sbjct  54    TCEPIYGFMPCTTKVWGNLFLLVVYEYLLSLADKYISSGSNLFFQMFGTGVFGGSVFYVV  113

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
               FP+I++ + + +  S+    + V   +   AG+T+ +LT++WG  +  G  D   Q  
Sbjct  114   GKFPQIVLVLVTLLSASENVVGSAVSMSMGFLAGSTMMSLTIIWGSVIAFGSYD-LQQTN  172

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S  +  T   ++ +       G+ TD  T +TA ++LLS++P++++EL  V +S+S  R
Sbjct  173   SSNLENKTPCLSNGY-------GVKTDIVTKYTARIILLSMIPYLILELSKVFNSSSATR  225

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
               VL+ALI+TV  L+ Y  +Q+  P IQ R+L Y        +  ++L    G+P   RI
Sbjct  226   AGVLIALIVTVILLVTYCTFQVFQPWIQDRTLEYLILSYVKKNLLQSLCNPYGRPIEFRI  285

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRM--VAVKTMMKDLDRDGNSRITEQEF  827
             R  FH  D + N Q+S  E+  FL  I    V  +    V  +M + D  G+  I+++EF
Sbjct  286   RQLFHKIDLNKNGQISEDEVRAFLVGIEAGVVGLIGDHCVSKVMAEFDFSGDHGISKEEF  345

Query  826   LNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIV  647
             + GI   L   +  +N    T      N +   +GE+      E + +       W++  
Sbjct  346   IGGISKWLDEANGVENNGNQTELF---NSNLPGTGEKQQIWEAEQQDSKNSD--EWNYSK  400

Query  646   TVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQ  467
                 ++LG AI    A+PL   + + + A+ VP+F++S+ ++P  +N R    +I   S 
Sbjct  401   ATYFILLGTAIAVLLAKPLTKTLQELATAIKVPSFLVSYFLVPFALNFRQGYKSITSVSD  460

Query  466   KSSKAASLT------FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLT  305
             K  K+ SLT      F +IY GV M+N+ GL S L +VY R++ WD +AE+LVV VI   
Sbjct  461   KKEKSVSLTLSQGKVFVQIYCGVFMNNVLGLTSFLTIVYIRDVEWDITAEILVVLVICSG  520

Query  304   IGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGW  191
             IG  + F + +  WT + A+ LYP SL   YVL + LGW
Sbjct  521   IGLSSSFSSKFPFWTCLVAYALYPISLGFLYVLTISLGW  559



>ref|XP_010509800.1| PREDICTED: uncharacterized protein LOC104786159 [Camelina sativa]
Length=613

 Score =   237 bits (604),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 175/551 (32%), Positives = 281/551 (51%), Gaps = 44/551 (8%)
 Frame = -1

Query  1744  SFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIF  1565
              FL L  P+  + + + C H YGF PCA+NI GY+FQ+  F  L+ + +  +S    K+F
Sbjct  60    KFLTLDPPK--NVAKAACTHVYGFLPCADNIGGYIFQVFSFGCLLIIGDYFLSEGRSKLF  117

Query  1564  DTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLW  1385
                  G +G  VF +L +FPRI + IS G+  + EGA   V   + V  G TIF LT+ W
Sbjct  118   VIFEVGFYGGIVFPLLTMFPRIALMISPGLAATHEGALMIVGNNVGVTIGHTIFALTMQW  177

Query  1384  GLCVIVG----------RRDRATQEKDSQSQ-PSTQSFASNWLKTLNECGISTDASTSFT  1238
             G CV+ G          RR+ + +   S ++ P    + +  LK++ E  +  D      
Sbjct  178   GACVVFGLTSPNPDPSIRRESSIKRTTSDTKNPRRGFYRTKILKSVVEASVEADPKNKKP  237

Query  1237  AGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLH  1058
             AG+MLL+L+PF+LV L ++  +     I++L+ LII+ +  + YF Y   D   QK+SL 
Sbjct  238   AGIMLLTLIPFLLVTLPDLFDAQPWSDIIMLITLIISCSSTIIYFVYSYFDTADQKKSLD  297

Query  1057  YSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRL  923
             +++FE +              L ++G+ +   ++  F   D + + ++   EL+   +  
Sbjct  298   HAKFELMSEVHKHLQSFSPRTLIRDGQLSKESLKSLFDKIDRNKDGKIQISELKDLTVEF  357

Query  922   IVTDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLanns----------sadn  779
              V  +++  +     T++ + D+D N  + E EF  GI  LL              +   
Sbjct  358   GVFGKMKCDINEFASTLLAEFDKDKNGELDEDEFEEGIMKLLNQYKFDNQDTPRGNNTCI  417

Query  778   aaaatptstPENDDQEKSGEETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFC  602
                A+ +   +N  Q   GEE      E+ ++    K  +   +  V++VI G+ I+ F 
Sbjct  418   YRTASDSVHVKNLSQ---GEEAGVLKLEMPKKTLVAKFLSLRTLRAVIKVIGGMLIVVFL  474

Query  601   AQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYN  422
             A+P M N+   S + GVP+F   F V+P+V N +  ++A F   +  ++ AS  FSEIY 
Sbjct  475   AKPFMVNIGLLSYSAGVPSFYCVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEIYR  534

Query  421   GVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFF  242
              VTM+NL G+   LA+VY + L WDYS E L+V VI + IG  AY ++TY  W  + AF 
Sbjct  535   DVTMNNLMGMSITLAIVYTKGLKWDYSIEALLVVVIGMAIGLPAYVRSTYPFWICVLAFS  594

Query  241   LYPFSLALFYV  209
             +Y FSL L Y+
Sbjct  595   MYIFSLVLIYI  605



>ref|NP_001185109.1| Calcium-binding EF-hand family protein [Arabidopsis thaliana]
 gb|AEE31030.1| Calcium-binding EF-hand family protein [Arabidopsis thaliana]
Length=578

 Score =   236 bits (601),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 183/538 (34%), Positives = 275/538 (51%), Gaps = 33/538 (6%)
 Frame = -1

Query  1753  DQSS--FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSS  1580
             D+SS  FL+L  P LS S    C H YGF PCA+NI GY+FQ+  F  L+ + E  +S  
Sbjct  43    DRSSNDFLSLNPPNLSES---ACVHVYGFLPCADNIEGYVFQVFSFGCLLIIGEYFLSKG  99

Query  1579  SKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFN  1400
               K+F     G FG  +F +L +FPRI + +S+G+  S+E A +     + V  G ++F 
Sbjct  100   RSKLFVIFEVGFFGGIIFPLLTMFPRIALILSTGLIGSREIANSMTGNNVAVTVGYSVFA  159

Query  1399  LTVLWGLCVIVG----RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
             LT+ WG CV+ G    R D  +   D  S       + N LK L    I  D      AG
Sbjct  160   LTMQWGACVVFGLSGLRSDDQSITCDISSPRRQVKKSINLLKNLAGASIRADPKNKKAAG  219

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +MLL+L+PFVLV         S    +VLV LI + +  + YF Y   D   Q +SL Y+
Sbjct  220   IMLLTLLPFVLVTFSETFHIKSWDDNMVLVTLIFSGSATVLYFVYLYFDKADQVKSLEYA  279

Query  1051  RFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLIV  917
             +FE +              L +NG+     ++  F  +D + + ++   EL+   +   V
Sbjct  280   KFELMSEVHKHLQNFSPQSLIRNGQLCQESLKSLFKKFDVNKDGKIQVSELKDLTVDFGV  339

Query  916   TDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN  743
                V+  +     T++ D D + +  I E EF  GIE  L     + N   +      E+
Sbjct  340   LGRVKCDINELATTLLADFDSNRDGEIDETEFAIGIEKWLKQYKFSFNGTESQGEDIAED  399

Query  742   DDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSG  563
             D   K  +        ++     K+ T   +  V++VI+G+ I++F A P M N+   S 
Sbjct  400   DGVLKVEQ-------LLKGCLFTKLLTKRTLKAVIEVIIGITIVSFLAMPFMMNIELLSV  452

Query  562   AVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSL  383
             + GVP+F + F V+P+  N + A++A F   ++ +K  S TFSEIY  VT++NL G+  +
Sbjct  453   SAGVPSFYVVFAVIPLARNLKNALSAHFCRKKEKAKITSDTFSEIYRDVTLNNLLGITII  512

Query  382   LAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             LA+VY R LTWDYS EVL++ ++ L IG  AY ++TY  W  + AF LY FSL L Y+
Sbjct  513   LAIVYIRGLTWDYSTEVLIIVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLILIYL  570



>ref|XP_006469050.1| PREDICTED: uncharacterized protein LOC102616350 [Citrus sinensis]
Length=577

 Score =   235 bits (599),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 287/511 (56%), Gaps = 32/511 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC  ++ G +F I ++ YLM +A +L+S+ S+ +   +G GI G     +L 
Sbjct  63    CEQTYGFLPCTTSLLGNVFLIAVYGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLS  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEK  1337
               P   + ++SG+  S+E AQNQV  G+ + AG+T+  LTVLWG C++VG+ D   T   
Sbjct  123   SVPDAAIILASGLSGSKETAQNQVSVGMGLLAGSTVMLLTVLWGSCLLVGKCDIEGTTAV  182

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             D +    T+ F      +L   G+STD  T + A +M+LS+VPF++V+L  V+++ S  R
Sbjct  183   DLKD---TKRF------SLTGSGVSTDVWTCYAARIMVLSIVPFIIVQLPKVLNTTSISR  233

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL----------------TQN  1025
             + VL++LI++++ ++AY  YQ+  P IQKR + Y++ + L+                T +
Sbjct  234   VTVLISLIVSISLVIAYSIYQVFQPWIQKRRIEYAKQKQLISGILKLVKTHSLGRLFTDD  293

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGN  851
             G+PN+  I+  F++ D + +  +S++EL   +  I  +++   +  A++ +M+D D   +
Sbjct  294   GEPNIDVIQKLFNIIDENADGCLSAKELRALVIGIQFEDIDMNIDDAIEKVMEDFDTSKD  353

Query  850   SRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNga-ageveqag  680
             S I E EF+ GI   L     +        + TP   ND QE++  E +       E A 
Sbjct  354   SCIDEHEFIVGISRWLNRLKHSAIQRHDDGSWTPRLINDFQERARTEYDLLGDKNDEVAE  413

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               +   W     V  ++ G  +   C+ PL+  V  FS A  +P+  ++F++LP   +  
Sbjct  414   LIENPKWRASKAVSMLLTGTIVAAVCSDPLVDAVDNFSTASNIPSLFVAFIILPFATSSE  473

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
              A++A+  AS+K S+ +SLT+S IY  VTMSN+  L   L++VY R LTW++SAEV V+ 
Sbjct  474   -AVSALIFASRKRSRTSSLTYSAIYGSVTMSNILSLSVFLSLVYFRHLTWNFSAEVSVIL  532

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFS  227
             ++ +++G +A F+TT+ LW  + A  LYP S
Sbjct  533   LVCISMGLIASFRTTFPLWMCLVACMLYPIS  563



>dbj|BAF00582.1| hypothetical protein [Arabidopsis thaliana]
Length=578

 Score =   234 bits (598),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 182/538 (34%), Positives = 274/538 (51%), Gaps = 33/538 (6%)
 Frame = -1

Query  1753  DQSS--FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSS  1580
             D+SS  FL+L  P LS S    C H YGF PCA+NI GY+FQ+  F  L+ + E  +S  
Sbjct  43    DRSSNDFLSLNPPNLSES---ACVHVYGFLPCADNIEGYVFQVFSFGCLLIIGEYFLSKG  99

Query  1579  SKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFN  1400
               K+F     G FG  +F +L +FPRI + +S+G+  S+E A +     + V  G ++F 
Sbjct  100   RSKLFVIFEVGFFGGIIFPLLTMFPRIALILSTGLIGSREIANSMTGNNVAVTVGYSVFA  159

Query  1399  LTVLWGLCVIVG----RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
             LT+ WG CV+ G    R D  +   D  S       + N LK L    I  D      AG
Sbjct  160   LTMQWGACVVFGLSGLRSDDQSITCDISSPRRQVKKSINLLKNLAGASIRADPKNKKAAG  219

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +MLL+L+PFVLV         S    +VLV LI + +  + YF Y   D   Q +SL Y+
Sbjct  220   IMLLTLLPFVLVTFSETFHIKSWDDNMVLVTLIFSGSATVLYFVYLYFDKADQVKSLEYA  279

Query  1051  RFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLIV  917
             +FE +              L +NG+     ++  F  +D + + ++   EL+   +   V
Sbjct  280   KFELMSEVHKHLQNFSPQSLIRNGQLCQESLKSLFKKFDVNKDGKIQVSELKDLTVDFGV  339

Query  916   TDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN  743
                V+  +     T++ D D + +  I E EF  GIE  L     + N   +      E+
Sbjct  340   LGRVKCDINELATTLLADFDSNRDGEIDETEFAIGIEKWLKQYKFSFNGTESQGEDIAED  399

Query  742   DDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSG  563
             D   K  +        ++     K+ T   +  V++VI+G+ I++F   P M N+   S 
Sbjct  400   DGVLKVEQ-------LLKGCLFTKLLTKRTLKAVIEVIIGITIVSFLGMPFMMNIELLSV  452

Query  562   AVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSL  383
             + GVP+F + F V+P+  N + A++A F   ++ +K  S TFSEIY  VT++NL G+  +
Sbjct  453   SAGVPSFYVVFAVIPLARNLKNALSAHFCRKKEKAKITSDTFSEIYRDVTLNNLLGITII  512

Query  382   LAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             LA+VY R LTWDYS EVL++ ++ L IG  AY ++TY  W  + AF LY FSL L Y+
Sbjct  513   LAIVYIRGLTWDYSTEVLIIVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLILIYL  570



>ref|XP_004234097.2| PREDICTED: uncharacterized protein LOC101254062 isoform X1 [Solanum 
lycopersicum]
Length=694

 Score =   237 bits (604),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 207/310 (67%), Gaps = 22/310 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             CDH YGFFPCA+++ G++F I I+QYL+ V E+LVS+ SK +F+ L TGIFGAT+F+IL 
Sbjct  48    CDHLYGFFPCADSVGGFIFLIAIYQYLLIVGEKLVSNGSKTLFNILSTGIFGATLFQILK  107

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
              FPRII+ I+SG+F S++ AQNQV  G+  N GAT+FNLT++WG+CVI G +++  +   
Sbjct  108   AFPRIILVIASGVFTSKDKAQNQVSTGVSTNVGATVFNLTIMWGICVIFGSKEKYEK---  164

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             S  QP+  S   N L+ L   G+S D  T++TAG+MLLSL+PF LV+LVN  ++  G+RI
Sbjct  165   STLQPAESSLF-NSLRVLTNNGVSIDKKTNYTAGIMLLSLIPFALVQLVNAFNTYYGRRI  223

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
             V+   L+I+V FLL YF YQ++DP IQ+RSL YS++ENLL+                + G
Sbjct  224   VIFTTLVISVTFLLTYFIYQLLDPWIQERSLEYSKYENLLSAFLQHMQRHASGMLIDKQG  283

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P++  I+  F   D D N+ ++  ELE  +  + + +++  +  AV  +++  D + ++
Sbjct  284   RPDIQVIQRLFSETDRDANKSITLVELENLVNNMQSGKIKVDKNYAVSKILRAFDLNNDT  343

Query  847   RITEQEFLNG  818
             RI E EF+ G
Sbjct  344   RIDEDEFVEG  353


 Score =   229 bits (583),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 174/283 (61%), Gaps = 3/283 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMK  872
             E++L  +G PNV RI+  FH YD+D N  ++  ELEK +  +   +VQ     +V  +M 
Sbjct  413   EHILNDDGSPNVERIKEIFHQYDTDGNNFITQPELEKLVLSVKYGDVQLNSDDSVMKVMN  472

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
             D D + N+ I E EF+ G+   L       +          E D    S  E      E 
Sbjct  473   DFDTNRNNMIDEHEFVEGMTRWLNEAIRVTDCKDKKRAID-EYDKIMWSKVENLVYEVEK  531

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +     K+ TW F  ++ Q+ILGVA++T C++PL+ ++ + S A+G+P+F+I FV++P+ 
Sbjct  532   DGKINYKLLTWAFNKSIFQLILGVAMMTLCSKPLVDSIKKLSEAIGMPSFLIPFVIVPLA  591

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
             +N RM IAAI+PASQK SK ASLTFSEIY GV  +N+ G+ +LLA+VYA++LTWDYSA+V
Sbjct  592   LNARMTIAAIYPASQKCSKTASLTFSEIYVGVIRNNIMGMTTLLAIVYAKDLTWDYSAQV  651

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             L+V V    IG LA F T Y LWTS+ AF LYP  +  FY+LQ
Sbjct  652   LIVLVACGIIGVLALFSTRYPLWTSLLAFSLYPSCVMFFYLLQ  694



>gb|EMS45634.1| hypothetical protein TRIUR3_11261 [Triticum urartu]
Length=427

 Score =   230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 159/431 (37%), Positives = 235/431 (55%), Gaps = 28/431 (6%)
 Frame = -1

Query  1420  AGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSF  1241
             AG+TI  LT+LWG CVIVG+ D +       SQ  T++F      +L   G+STD  TS+
Sbjct  5     AGSTIMLLTILWGSCVIVGKCDLSEDSTTIDSQ-DTKAF------SLFGSGVSTDLQTSY  57

Query  1240  TAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSL  1061
              A +M +S++PF++V++  ++   SG R+ +L+ LI+ V  LL Y  YQI  P IQ+R L
Sbjct  58    AARIMAISVLPFIVVQIPQILKLQSGHRLTLLLGLIVAVLLLLTYCLYQIFQPWIQRRKL  117

Query  1060  HYSR----------------FENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL  929
              YSR                F +L+  +G PNVS I   FH  D DN+ ++   EL+ F+
Sbjct  118   EYSRLKHVMSGLLKHAQMHTFGHLVDDDGTPNVSVIEKLFHKIDLDNDGKIGRGELQAFI  177

Query  928   RLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatpts  755
               +  ++++    +A   +M D DR  NS I + EF++G+   L         + A    
Sbjct  178   VGVNFEDIELDTNLATDQVMADFDRSRNSSIEKGEFVDGVLRWLEEAKRVVAGSGAYSKK  237

Query  754   tPENDDQEKSGEETNgaageveqa-ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNV  578
               + D    +GEE N    + E      +  TW     +  ++LG A+    A PL+  V
Sbjct  238   FMD-DFHITTGEEHNALLDKHEDDGESIENPTWTCFKAISLLLLGTAMAAAFADPLVDAV  296

Query  577   IQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLT  398
               FS A  +P+F ISF+ +P+  N   A++AI  AS+K  +  SLTFSE+Y GVTM+N  
Sbjct  297   HNFSSATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTL  356

Query  397   GLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLAL  218
              L   LA+VY R LTWD+S+EVLV+F++ + +G    F+T + LWT   AF LYP SL L
Sbjct  357   CLAVFLALVYVRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLVL  416

Query  217   FYVLQL-LGWN  188
              Y+L    GW+
Sbjct  417   VYILDYKFGWS  427



>ref|XP_006446746.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
 gb|ESR59986.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
Length=575

 Score =   233 bits (595),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 286/514 (56%), Gaps = 38/514 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC  ++ G +F I ++ YLM +A +L+S+ S+ +   +G GI G     +L 
Sbjct  63    CEQTYGFLPCTTSLLGNVFLIAVYGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLS  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD----RAT  1346
               P   + ++SG+  S+E AQNQV  G+ + AG+ +  LTVLWG C++VG+ D     A 
Sbjct  123   SVPDAAIILASGLSGSKETAQNQVSVGMGLLAGSIVMLLTVLWGSCLLVGKCDIEGTTAV  182

Query  1345  QEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
               KD++    T S            G+STD  T + A +M+LS+VPF++V+L  V+++ S
Sbjct  183   DLKDTKRFSFTGS------------GVSTDVWTCYAARIMVLSVVPFIIVQLPQVLNTTS  230

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL----------------  1034
               R+ VL++LI++++ ++AY  YQ+  P IQKR + Y++ + L+                
Sbjct  231   ISRVTVLISLIVSISLVIAYSIYQVFQPWIQKRRIEYAKQKQLISGILKLVKMHALGRLF  290

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDR  860
             T +G+PN+  I+  F++ D + +  +S++EL   +  I  ++V   +  A++ +M+D D 
Sbjct  291   TDDGEPNIDVIQKLFNIIDENADGCLSAKELRALVIGIQFEDVDTNIDDAIEKVMEDFDT  350

Query  859   DGNSRITEQEFLNGIENLLannssadnaaaatptstPE--NDDQEKSGEETNga-ageve  689
               +S I E EF+ GI   L     +        + TP   ND QE++  E +       E
Sbjct  351   SKDSCIDEHEFVVGISRWLNRLKHSAIQRQDDGSWTPRLINDFQERARTEYDLLGDKNDE  410

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
              A   +   W     V  +++G  +   C+ PL+  V  FS A  +P+  ++F++LP   
Sbjct  411   VAELIENPKWMASKAVSILLMGTIVAAVCSDPLVDAVDNFSTASNIPSLFVAFIILPFAT  470

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             +   A++A+  AS+K S+ +SLT+S IY  VTMSN+  L   L++VY R LTW++SAEV 
Sbjct  471   SSE-AVSALIFASRKRSRTSSLTYSAIYGSVTMSNILSLSVFLSLVYFRHLTWNFSAEVS  529

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFS  227
             V+ ++ + +G +A F+TT+ LW  + A  LYPFS
Sbjct  530   VILLVCILMGLIASFRTTFPLWMCLVACMLYPFS  563



>gb|EYU28050.1| hypothetical protein MIMGU_mgv1a023246mg [Erythranthe guttata]
Length=682

 Score =   235 bits (600),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 187/306 (61%), Gaps = 19/306 (6%)
 Frame = -1

Query  1096  QIIDPTIQKRSLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV  917
             +I+   ++       + E+L+T +GKP++ RI+  F  +D+D N+ +S+ ELE+ +  + 
Sbjct  393   KIMSKILKHAETQLLKSESLITPDGKPDIERIQSLFKQFDTDGNKSISASELEQLISTVK  452

Query  916   TDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN  743
               E +  R   +K +  D D+D N+ I E+EF+ G++  L                    
Sbjct  453   FGEFKPKREDIIKELFNDFDKDDNNSIDEREFVEGVKKWLNKAIHVA-----------NT  501

Query  742   DDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSG  563
              D+ +S +E +    +        +     IV++ QV+ G+ ILTF   PLM +++Q S 
Sbjct  502   PDKTRSIDEFDQIVWKKAVHNNGAL-----IVSIFQVVFGIGILTFLGGPLMGSILQLSY  556

Query  562   AVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSL  383
             A+G+P+F ISFV++P+ +N R A+ A  PASQKS ++ASLTFSEIY GV M+N+ GL +L
Sbjct  557   AMGLPSFGISFVIVPLAMNARAALTAFLPASQKSERSASLTFSEIYGGVIMNNIAGLTTL  616

Query  382   LAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             LA+VYA++LTWD+SAEVL + V+   IG+L+Y   TY LWTSI AFFLYPFS+ L Y +Q
Sbjct  617   LAIVYAKDLTWDFSAEVLTILVVCAIIGYLSYSSPTYPLWTSIVAFFLYPFSMGLCYFVQ  676

Query  202   L-LGWN  188
             + L WN
Sbjct  677   VYLSWN  682


 Score =   199 bits (505),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 194/347 (56%), Gaps = 51/347 (15%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCDH YGF PC+EN  GY+FQI+++Q L+   E+ +   SK +F  +G G FG  +FRIL
Sbjct  7     TCDHQYGFLPCSENAAGYIFQIMVYQGLLIFGEKQIGKGSKVLFHIIGAGKFGGIIFRIL  66

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
             M  P +++ I SG+F+S+E AQNQV  G+ + AG T+F+LTV WG+CVIVGRRD   +  
Sbjct  67    MALPSMMLMIVSGVFSSKENAQNQVSLGVGIYAGITVFSLTVQWGICVIVGRRDLKEKPN  126

Query  1336  DSQSQPSTQ--------------------SFASNWLKTLN--------------ECGIST  1259
             +    P T                     + A    K L+              + G++ 
Sbjct  127   ECDEIPHTNCLPAREKISILKGSEFRIQITMACFACKILSYEVTIFFFFCPFTADTGVAI  186

Query  1258  DASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPT  1079
             D  T  TAG++LLSL+P+V+V++V++  ++SG   + L++L+ +   LL+YF YQI++P 
Sbjct  187   DPETRQTAGIVLLSLIPYVIVQIVDIFQTSSGNHFITLISLVFSTLSLLSYFLYQILNPW  246

Query  1078  IQKRSLHYSRFE--------------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSREL  941
             IQ+RSL YSR+E               L+ ++GK N + +   F   D D ++ ++  E+
Sbjct  247   IQERSLDYSRYEMLRTGFLKHVQRQGQLVNEDGKLNTNVVEKLFADTDKDADKCITKDEM  306

Query  940   EKFLRLIVTD---EVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIEN  809
             EK +  ++     ++    AV  +MK  D D ++ I+EQEF+ G + 
Sbjct  307   EKLVVDVLNTGQVKIDDKFAVAEVMKTFDFDDDTSISEQEFIKGCKK  353



>gb|EMT05376.1| hypothetical protein F775_06447 [Aegilops tauschii]
Length=503

 Score =   231 bits (590),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 250/479 (52%), Gaps = 55/479 (11%)
 Frame = -1

Query  1483  SGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSF  1304
             SG+  ++E AQ+QV  G+ + AG+TI  LT+LWG CVIVG+ D +       SQ  T++F
Sbjct  33    SGLSGTKEVAQSQVLIGMGLLAGSTIMLLTILWGSCVIVGKCDLSENSTTIDSQ-DTKAF  91

Query  1303  ASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitv  1124
                   +L   G+STD  TS+ A +M +S++PF++V++  ++   SG R+ +L+ LI+ V
Sbjct  92    ------SLFGSGVSTDLQTSYAARIMAISILPFIVVQIPQILKLQSGHRLTLLLGLIVAV  145

Query  1123  afllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQNGKPNVS-----  1007
               LL Y  YQI  P IQ+R L YSR                F +L+  +G PNVS     
Sbjct  146   LLLLTYCLYQIFQPWIQRRKLEYSRLKHVMSGLLKHAQMHTFGHLIDDDGTPNVSVIEKY  205

Query  1006  ----------------------RIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--R  899
                                   +I   FH  D DN+ ++   EL+ F+  +  ++++   
Sbjct  206   DWFAIRFYLYFHPKKYLLNDTVKIGRLFHKIDLDNDGKIGRGELQAFIVGVNFEDIELDS  265

Query  898   MVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGE  719
              +A   +M D DR  NS I + EF++G+   L         + A      E D    +GE
Sbjct  266   NLATDQVMADFDRSRNSSIEKGEFVDGVLRWLEEAKRVVAGSGAYSKKFME-DFHITTGE  324

Query  718   ETNgaageveqa-ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTF  542
             E N    + E      +  TW     +  ++LG A+    A PL+  V  FS A  +P+F
Sbjct  325   EHNALLDKHEDDGESIENPTWTCFKAISLLLLGTAMAAAFADPLVDAVHNFSSATSIPSF  384

Query  541   IISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAR  362
              ISF+ +P+  N   A++AI  AS+K  +  SLTFSE+Y GVTM+N   L   LA+VY R
Sbjct  385   FISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAVFLALVYIR  444

Query  361   ELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              LTWD+S+EVLV+F++ + +G    F+T + LWT   AF LYP SL L Y+L    GW+
Sbjct  445   GLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLVLVYILDYKFGWS  503



>ref|XP_006410547.1| hypothetical protein EUTSA_v10016396mg [Eutrema salsugineum]
 gb|ESQ52000.1| hypothetical protein EUTSA_v10016396mg [Eutrema salsugineum]
Length=612

 Score =   234 bits (596),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 171/549 (31%), Positives = 269/549 (49%), Gaps = 43/549 (8%)
 Frame = -1

Query  1741  FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFD  1562
             FL L  P+  + S + C H YGF PCA+NI GY+FQ+  F  L+ + +  +S    K+F 
Sbjct  61    FLTLDPPK--NVSKAACLHVYGFLPCADNIGGYVFQVFSFGCLLIIGDYFLSEGRSKLFV  118

Query  1561  TLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWG  1382
                 G +G  VF +L +FPR  + +S G+  + +GA   V   I V  G T+F LT+ WG
Sbjct  119   IFEVGFYGGIVFPLLTMFPRFALMLSPGLSATHDGALLIVSNNIGVTVGHTVFALTMQWG  178

Query  1381  LCVIVG----------RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
              CV+ G          RR    +       P    +    LK++ E  +  D      AG
Sbjct  179   ACVVFGLTGPNSDQSIRRGAVQRTTSDTKSPRRGFYRMKILKSVVEASVDADPKNKKAAG  238

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +MLL+L PF++V L ++    S    ++L+ LI++ +  L YF Y   D   QK+SL ++
Sbjct  239   IMLLTLAPFLMVTLPDLFDVQSWSDTIMLITLIVSCSSTLIYFVYSYFDTADQKKSLDHA  298

Query  1051  RFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVT  914
             +FE +              L ++G+ +   ++  F   D + + ++   EL+    L V 
Sbjct  299   KFELMSEVHKHLQSFSPRSLIRDGQLSKESLKSLFDRIDRNKDGKIQISELKD---LTVE  355

Query  913   DEV-QRMVA-----VKTMMKDLDRDGNSRITEQEFLNGIENLL--------annssadna  776
               V  RM         T++ D D+D +  + E EF  G+  LL              +  
Sbjct  356   FGVFGRMKCDINEFANTLLADFDKDKDGELDENEFEEGVMKLLNQYKFDSQETPRHNNTY  415

Query  775   aaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQ  596
                T + +    +Q +  E         +Q    K+ +   +  V++V+ G+ I+ F A+
Sbjct  416   IYRTASDSVHVKNQSQGEEAGVLKLEMPKQTLVAKLLSMRTLRAVIKVVGGMLIVLFLAK  475

Query  595   PLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGV  416
             P M N+   S + GVP+F   F V+P+V N +  ++A F   +  ++ AS  FSEIY  V
Sbjct  476   PFMINIGLLSVSAGVPSFYSVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEIYRDV  535

Query  415   TMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLY  236
             TM+NL G+  +LA+VY R L WDYS E L+V V+ L IG  AY ++TY  W  + AF +Y
Sbjct  536   TMNNLMGMSIILAIVYTRGLKWDYSTEALLVVVVGLAIGLPAYLRSTYPFWICVMAFAMY  595

Query  235   PFSLALFYV  209
              FSL L Y+
Sbjct  596   IFSLVLIYL  604



>ref|XP_010317432.1| PREDICTED: uncharacterized protein LOC101254062 isoform X2 [Solanum 
lycopersicum]
Length=668

 Score =   235 bits (599),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 207/310 (67%), Gaps = 22/310 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             CDH YGFFPCA+++ G++F I I+QYL+ V E+LVS+ SK +F+ L TGIFGAT+F+IL 
Sbjct  48    CDHLYGFFPCADSVGGFIFLIAIYQYLLIVGEKLVSNGSKTLFNILSTGIFGATLFQILK  107

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
              FPRII+ I+SG+F S++ AQNQV  G+  N GAT+FNLT++WG+CVI G +++  +   
Sbjct  108   AFPRIILVIASGVFTSKDKAQNQVSTGVSTNVGATVFNLTIMWGICVIFGSKEKYEK---  164

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             S  QP+  S   N L+ L   G+S D  T++TAG+MLLSL+PF LV+LVN  ++  G+RI
Sbjct  165   STLQPAESSLF-NSLRVLTNNGVSIDKKTNYTAGIMLLSLIPFALVQLVNAFNTYYGRRI  223

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
             V+   L+I+V FLL YF YQ++DP IQ+RSL YS++ENLL+                + G
Sbjct  224   VIFTTLVISVTFLLTYFIYQLLDPWIQERSLEYSKYENLLSAFLQHMQRHASGMLIDKQG  283

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P++  I+  F   D D N+ ++  ELE  +  + + +++  +  AV  +++  D + ++
Sbjct  284   RPDIQVIQRLFSETDRDANKSITLVELENLVNNMQSGKIKVDKNYAVSKILRAFDLNNDT  343

Query  847   RITEQEFLNG  818
             RI E EF+ G
Sbjct  344   RIDEDEFVEG  353


 Score =   142 bits (359),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 120/208 (58%), Gaps = 3/208 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMK  872
             E++L  +G PNV RI+  FH YD+D N  ++  ELEK +  +   +VQ     +V  +M 
Sbjct  413   EHILNDDGSPNVERIKEIFHQYDTDGNNFITQPELEKLVLSVKYGDVQLNSDDSVMKVMN  472

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
             D D + N+ I E EF+ G+   L       +          E D    S  E      E 
Sbjct  473   DFDTNRNNMIDEHEFVEGMTRWLNEAIRVTDCKDKKRAID-EYDKIMWSKVENLVYEVEK  531

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +     K+ TW F  ++ Q+ILGVA++T C++PL+ ++ + S A+G+P+F+I FV++P+ 
Sbjct  532   DGKINYKLLTWAFNKSIFQLILGVAMMTLCSKPLVDSIKKLSEAIGMPSFLIPFVIVPLA  591

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEI  428
             +N RM IAAI+PASQK SK ASLTFSE+
Sbjct  592   LNARMTIAAIYPASQKCSKTASLTFSEV  619


 Score = 31.2 bits (69),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = -3

Query  422  WSDNEQPNRAAIIASSGVCKGVNMGLFCRSVGGFCHISHNRLSCLL  285
            WSD EQ +         +CKG+N+GLF  S   F  + +N  SC++
Sbjct  623  WSDQEQHHGHDNTIGYSICKGLNLGLFSTSANSFGGLWNNWGSCII  668



>ref|XP_010499420.1| PREDICTED: uncharacterized protein LOC104776935 [Camelina sativa]
Length=580

 Score =   233 bits (593),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 172/542 (32%), Positives = 273/542 (50%), Gaps = 41/542 (8%)
 Frame = -1

Query  1747  SSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKI  1568
             + FL+L  P L+S     C H YGF PCA+NI GY+FQ+  F  L+ + E  +S    K+
Sbjct  47    NEFLSLDPPNLTSEK--ACVHVYGFLPCADNIEGYVFQVFSFGCLLIIGEYFLSKGRSKL  104

Query  1567  FDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVL  1388
             F     G FGA +F +L++FPRI + +S+G+  S+E A + V   + V  G ++F LTV 
Sbjct  105   FVIFEVGFFGAIIFPLLVMFPRITLILSTGLMGSREMANSMVGNNVAVTVGYSVFALTVQ  164

Query  1387  WGLCVIVG----RRDRATQEKDSQS------QPSTQSFASNWLKTLNECGISTDASTSFT  1238
             WG CV+ G      D++ +  + QS       P      +N +K L    +  D      
Sbjct  165   WGACVVFGLPGFSSDQSIRNGEVQSIASGTKSPRRNGIRNNLIKKLVGASVKADPKNKKA  224

Query  1237  AGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLH  1058
             AG+MLL+L PFVLV       S S    +VL+ L+ + +  + +F Y   D   Q +SL 
Sbjct  225   AGIMLLTLFPFVLVTFSETFDSESWDDSIVLITLLFSGSATVLFFVYLYFDKADQVKSLD  284

Query  1057  YSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI  920
             ++RFE +              L ++ + +   ++  F   D + + ++   EL+     +
Sbjct  285   HARFELMSEVHKHLQNFSPQSLIRDKQLSKESLKSLFEKIDVNKDGKIQVSELKDLT--V  342

Query  919   VTDEVQRMVA-----VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatpts  755
                 + RM         T++ D D D +  I E EF  GIE  L       ++       
Sbjct  343   EFGVLGRMKCDIHELATTLLADFDSDKDGEIDETEFEKGIEKWLRQYKFTVDST------  396

Query  754   tPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVI  575
               E+  + +  +E      +  +    K+ T      V +VI+G+ I++F A+P M N+ 
Sbjct  397   --ESQREYQDEDEAVLKMVKTNECLFTKLLTKRTFKAVTEVIIGILIVSFLAKPFMMNIE  454

Query  574   QFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTG  395
               S + GVP+F + F V+P+  N + A++A F   +  ++  S  FS+IY  VT++NL G
Sbjct  455   LLSVSAGVPSFYVVFAVIPLARNLKNALSAHFCRKKDQARITSDIFSDIYRDVTLNNLLG  514

Query  394   LLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALF  215
             +  +LA+VY R LTWDYS EVL++ ++ L IG  AY ++TY  W  + AF LY FSL L 
Sbjct  515   ITIILAIVYLRGLTWDYSTEVLIIVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLVLI  574

Query  214   YV  209
             Y+
Sbjct  575   YL  576



>ref|NP_180949.2| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
 dbj|BAC42052.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08907.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana]
Length=610

 Score =   233 bits (595),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 177/544 (33%), Positives = 275/544 (51%), Gaps = 35/544 (6%)
 Frame = -1

Query  1741  FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFD  1562
             +L L  P+  + S + C H YGF PCA+NI GY+FQ+  F  L+ + +  +S    K+F 
Sbjct  61    YLTLDPPK--NVSKAACIHVYGFLPCADNIGGYVFQVFSFGCLLIIGDYFLSQGRSKLFV  118

Query  1561  TLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWG  1382
                 G +G  VF +L +FPRI + IS G+  + EGA   V   + V  G TIF LT+ WG
Sbjct  119   IFEVGFYGGIVFPLLTMFPRIALMISPGLAATHEGALMIVGNNVGVTIGHTIFALTMQWG  178

Query  1381  LCVIVG----------RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
              CVI G          RR    +       P    +    LK++ E  +  D      AG
Sbjct  179   ACVIFGLTSPNSDPSIRRGSIKRTSSDTKNPRRGFYRMKILKSVVEASVDADPKNKKAAG  238

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +MLL+LVPF+LV L +++   S   I++L+ LII+ +    YF Y   D   QK+SL ++
Sbjct  239   IMLLTLVPFLLVTLPDLLDVQSWSDIIMLITLIISCSSTFIYFVYSYFDTADQKKSLDHA  298

Query  1051  RFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLIV  917
             +FE +              L ++G+ +   ++  F   D + + ++   EL+   +   V
Sbjct  299   KFELMSEVHKHLQSFSPRTLIRDGQLSKESLKSLFDKIDRNKDGKIQISELKDLTVEFGV  358

Query  916   TDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLanns--sadnaaaatptstP  749
               +++  +     T++ + D+D N  + E EF  GI  LL +    + ++          
Sbjct  359   FGKMKCDINEFASTLLAEFDKDKNGELDENEFEEGIMKLLNHYKFDNQESPRQNNTYIYR  418

Query  748   ENDDQEKS---GEETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTN  581
                D  KS   GEE      E+ +Q    K  +   +  V +VI G+ I+ F A+P M N
Sbjct  419   TPSDSVKSLSQGEEAGVLKLEMPKQTLVAKFLSMSTLRAVTKVIGGMLIVVFLAKPFMVN  478

Query  580   VIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNL  401
             +   S + GVP+F   F V+P+V N +  ++A F   +  ++ AS  FSEIY  VTM+NL
Sbjct  479   IGLLSVSAGVPSFYSVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEIYRDVTMNNL  538

Query  400   TGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLA  221
              G+   LA+VY+R L W+YS E L+V V+ + IG  AY ++TY  W  + AF +Y FSL 
Sbjct  539   MGMSITLAIVYSRGLKWEYSIESLLVVVVGIAIGLPAYVRSTYPFWICVMAFAMYIFSLV  598

Query  220   LFYV  209
             L Y+
Sbjct  599   LIYI  602



>ref|XP_006343216.1| PREDICTED: uncharacterized protein LOC102593213 [Solanum tuberosum]
Length=695

 Score =   234 bits (598),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 207/312 (66%), Gaps = 21/312 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             CDH YGFFPCA+++ G++F I I+QYL+ V E+LVS+ SK +F+ LGTGIFGAT+F+IL 
Sbjct  48    CDHLYGFFPCADSVGGFIFLIAIYQYLLIVGEKLVSNGSKTLFNILGTGIFGATLFQILK  107

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
              FPRII+ I+SG+F+S++ AQNQV  G+  N GAT+FNLT++WG+CVI G +++    + 
Sbjct  108   AFPRIILVIASGVFSSKDKAQNQVSTGVSTNVGATVFNLTIMWGICVIFGSKEK---HQK  164

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             S  QP+      N L+ L+  G++ D  T++TAG+M LSL+PF LV+LVN  ++  G+RI
Sbjct  165   STMQPAESYSLFNSLQVLSNKGVTIDKKTNYTAGIMFLSLIPFALVQLVNAFNTYFGRRI  224

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT----------------QNG  1022
             V+   L+I+V FLL YF YQ++DP IQ+RSL YS++ENLL                 + G
Sbjct  225   VIFTTLVISVTFLLTYFIYQLLDPWIQERSLEYSKYENLLAAFLQHMQRHASGMLIDKQG  284

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +P++  I+  F   D D N+ ++  ELE  +  + + +++  +  A+  ++   D + ++
Sbjct  285   RPDIQVIQRLFSETDRDANKSITLVELENLVYNMQSGKIKVDKNYAISKILTAFDLNNDT  344

Query  847   RITEQEFLNGIE  812
             RI E EF+ G +
Sbjct  345   RIDEDEFVEGCK  356


 Score =   234 bits (596),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 178/284 (63%), Gaps = 5/284 (2%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMK  872
             E++L  +G PNV RI+  FH YDSD N  ++  ELEK +  +   +VQ     +V+ +M 
Sbjct  414   EHILNDDGSPNVERIKEIFHQYDSDGNNFITQPELEKLVLSVKYGDVQLNSDDSVRKVMN  473

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGE-ETNgaage  695
             D D + N+ I E EF++G+   L       N          +  D+   GE E      E
Sbjct  474   DFDTNCNNMIDEHEFVDGMTRWLNEAIRVTNCKDKKRAI--DEYDKIMWGEVEKLVYEVE  531

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
              +     K+ TW F  ++ QVILG+A++T C++PL+ ++ + S A+G+P+F+I FV++P+
Sbjct  532   KDGKINYKLLTWAFNKSIFQVILGIAMMTLCSKPLVNSIKKLSEAIGMPSFLIPFVIVPL  591

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
              +N RM IAAI+PASQK SK ASLTFSEIY GV  +N+ G+ +LLA+VYA++LTWDYSA+
Sbjct  592   ALNARMTIAAIYPASQKCSKTASLTFSEIYVGVMRNNIMGMTTLLAIVYAKDLTWDYSAQ  651

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             VL+V V    IG LA F T Y LWTS+ AF LYP  +  FY+LQ
Sbjct  652   VLIVLVACSIIGLLALFSTRYPLWTSLLAFSLYPSCVVFFYLLQ  695



>emb|CDX84660.1| BnaA03g15700D [Brassica napus]
Length=595

 Score =   231 bits (590),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 169/549 (31%), Positives = 267/549 (49%), Gaps = 46/549 (8%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
                 +  FL L  P+  + S + C H YGF PCA+NI GY FQ+  F  L+ + +  +S 
Sbjct  54    HGASEYEFLTLDPPK--NVSKAACLHVYGFLPCADNIGGYAFQVFSFGCLLVIGDYFLSE  111

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F     G +G  VF +L +FPRI++ +S G+  + +GA   V   + V  G T+F
Sbjct  112   GRSKLFVIFEVGFYGGIVFPLLTMFPRIVLMLSPGLSATHDGALAIVGSNVGVTVGHTVF  171

Query  1402  NLTVLWGLCVIVG----------RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
              LT+ WG CV+ G           R    +       P    + +  LK + E  +  D 
Sbjct  172   ALTMQWGACVVFGLTSPSSGQSTPRGSIKRTTSDTKNPRRGFYRAKILKNIVEASVDADP  231

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
                  AG+MLL+L PF++V L +++ + S   I +L+ LII+ +    YF Y   D   Q
Sbjct  232   KNKKAAGIMLLTLAPFLIVTLPDLLDAQSWSDITILITLIISCSSTFIYFVYSYFDTADQ  291

Query  1072  KRSLHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEK  935
             K+SL  ++FE +              L ++G+     ++  F   D + + ++   EL+ 
Sbjct  292   KKSLDNAKFELMSEVHKHLQSFSPRSLIRDGQLTKESLKSLFDKIDRNKDGKIQISELKD  351

Query  934   F-LRLIVTDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaat  764
               +   V   ++  +     T++ D D+D +  + E EF  G+  LL             
Sbjct  352   LTVEFGVYGRMKCDINEFANTLLADFDKDKDGELDENEFEEGVMKLL-------------  398

Query  763   ptstPENDDQEKSG---EETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFCAQ  596
                  +N D  + G   EE      E+ +Q    K+ +   +  VL+VI G+ ++ F A+
Sbjct  399   NQYKFDNPDTPRQGNTCEEAGVLKLEMPKQTLVAKLLSLRTLKAVLKVIGGMLMVLFLAK  458

Query  595   PLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGV  416
             P M N+   S   GVP+F   F V+P+V N +  ++A F   +  ++ AS  FSEIY  V
Sbjct  459   PFMININLLSVTAGVPSFYAVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEIYRDV  518

Query  415   TMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLY  236
             TM+NL G+  +LA+VY + L WDYS E LV  V+ L IG  AY ++TY  W  + AF +Y
Sbjct  519   TMNNLMGMSIVLAIVYTKGLKWDYSTEALVAVVVGLAIGLPAYVRSTYPFWICVLAFAMY  578

Query  235   PFSLALFYV  209
               SL L Y+
Sbjct  579   ISSLVLIYL  587



>ref|XP_010500958.1| PREDICTED: uncharacterized protein LOC104778258 [Camelina sativa]
Length=585

 Score =   231 bits (589),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 179/526 (34%), Positives = 279/526 (53%), Gaps = 37/526 (7%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L   P 
Sbjct  69    YGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPD  128

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEKDSQS  1325
              ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D R T   ++Q 
Sbjct  129   AMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQD  188

Query  1324  QPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvl  1145
                T+ F      +L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG+ + VL
Sbjct  189   ---TKRF------SLTDSGVTVDIWTSYAARIMAISVIPFVIVQLPQMLGSQSGRHLSVL  239

Query  1144  valiitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPN  1013
             VAL+++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G+P+
Sbjct  240   VALVLSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHSLGRLLDDEGQPD  299

Query  1012  VSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDR-------  860
                IR  F   D++ +  +S+ EL+  +  I  +E+   +  AV  +++D D+       
Sbjct  300   EHVIRKLFETIDANKDGHLSAAELKALIIGISFEEIDFDKDDAVGKVLQDFDKTLDEQVD  359

Query  859   -DGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqa  683
              D   R  +   L  + N       A                +E +    N      E+ 
Sbjct  360   EDEFVRGIKHWLLQAMGNAAPAGPDAGPRTMKFLDHFHVQTKREHTLLGDNDNGENEEEG  419

Query  682   ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
             G      W  I   L +ILG AI    A PL+  V  FS A G+P+F ISF+ LP+  N 
Sbjct  420   GEVSDPKWITIKAALLLILGAAIAAAFADPLVDTVNNFSAATGIPSFFISFIALPLATNS  479

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
               A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+VY R LTW++S+EVLV+
Sbjct  480   SEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIVYLRGLTWNFSSEVLVI  539

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    GW+
Sbjct  540   LIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS  585



>ref|XP_006295951.1| hypothetical protein CARUB_v10025093mg [Capsella rubella]
 gb|EOA28849.1| hypothetical protein CARUB_v10025093mg [Capsella rubella]
Length=613

 Score =   231 bits (589),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 166/531 (31%), Positives = 269/531 (51%), Gaps = 36/531 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C H YGF PCA+NI GY+FQ+  F  L+ + +  +S    K+F     G +G  VF +L 
Sbjct  75    CTHVYGFLPCADNIGGYVFQVFSFGCLLIIGDYFLSEGRSKLFVIFEVGFYGGIVFPLLT  134

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG----------  1364
             +FPRI + IS G+  + EGA   V   + V  G TIF LT+ WG CV+ G          
Sbjct  135   MFPRIALMISPGLAATHEGALMIVGNNVGVTFGHTIFALTMQWGACVVFGLTSPNPDPSI  194

Query  1363  RRDRATQEKDSQSQ-PSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelv  1187
             RR  + +   S ++ P    + +  LK++ E  +  D      AG+MLL+L+PF LV L 
Sbjct  195   RRGTSIKRTTSDTKNPRRGFYRTKILKSVVETSVDADPKNKKAAGVMLLTLIPFFLVTLP  254

Query  1186  nvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----------  1037
             +++ +     I++L+ LII+ +  + YF Y   D   Q++SL +++FE +          
Sbjct  255   DLLDAQPWSDIIMLITLIISCSSTIIYFVYSYFDTADQRKSLDHAKFELMSEVHKHLQSF  314

Query  1036  ----LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLIVTDEVQRMVA--VKTM  878
                 L ++G+ +   ++  F   D + + ++   EL+   +   V  +++  +     T+
Sbjct  315   SPQTLIRDGQLSKESLKSLFDKIDRNKDGKIQISELKDLTVEFGVFGKMKCDINEFASTL  374

Query  877   MKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEK-------SGE  719
             + + D+D N  + E EF  GI  LL      +        +       +         GE
Sbjct  375   LAEFDKDKNGELDENEFEEGIMKLLNQYKFDNQETPRQNNTYIYRSASDSLHVKNLSQGE  434

Query  718   ETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTF  542
             E      E+ ++    K  +   +  V++V+ G+ I+ F A+P M N+   S + GVP+F
Sbjct  435   EAAVLKLEMPKKTLVAKFLSMRTLRAVIKVVGGMLIVVFLAKPFMVNIGLLSVSAGVPSF  494

Query  541   IISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAR  362
                F V+P+V N +  ++A F   +  ++ AS  FSEIY  VTM+NL G+   LA+VY++
Sbjct  495   YTVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEIYRDVTMNNLMGMSITLAIVYSK  554

Query  361   ELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
              L WDYS E L+V VI + IG  AY ++TY  W  + AF +Y FSL L Y+
Sbjct  555   GLKWDYSIEALLVVVIGMAIGLPAYVRSTYPFWICVLAFAMYIFSLVLIYI  605



>ref|XP_010479874.1| PREDICTED: uncharacterized protein LOC104758667 [Camelina sativa]
Length=585

 Score =   230 bits (587),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 179/526 (34%), Positives = 280/526 (53%), Gaps = 37/526 (7%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L   P 
Sbjct  69    YGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPD  128

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEKDSQS  1325
              ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D R T   ++Q 
Sbjct  129   AMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQD  188

Query  1324  QPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvl  1145
                T+ F      +L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG+ + VL
Sbjct  189   ---TKRF------SLKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQMLGSQSGRHLSVL  239

Query  1144  valiitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPN  1013
             VAL+++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G+P+
Sbjct  240   VALVLSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHSLGRLLDDEGQPD  299

Query  1012  VSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKD--------LD  863
                IR  F   D++ +  +S+ EL+  +  I  +E+   +  AV  +++D        +D
Sbjct  300   EHVIRKLFDTIDANKDGHLSAAELKALIIGISFEEIDFDKDDAVGKLLQDFDKTLDEQVD  359

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqa  683
             +D   R  +   L  + N       A                +E +    N      E+ 
Sbjct  360   QDEFVRGIKHWLLQAMGNSAPAGPDAGPRTMKFLDHFHVQTKREHTLLGDNENGENEEEG  419

Query  682   ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
             G      W  I   L +ILG AI    A PL+  V  FS A G+P+F ISF+ LP+  N 
Sbjct  420   GEVADPKWITIKAALLLILGAAIAAAFADPLVDTVNNFSAATGIPSFFISFIALPLATNS  479

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
               A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+VY R LTW++S+EVLV+
Sbjct  480   SEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIVYLRGLTWNFSSEVLVI  539

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    GW+
Sbjct  540   LIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS  585



>ref|XP_006307086.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39984.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=585

 Score =   229 bits (585),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 179/526 (34%), Positives = 279/526 (53%), Gaps = 37/526 (7%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L   P 
Sbjct  69    YGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPD  128

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEKDSQS  1325
              ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D R T   ++Q 
Sbjct  129   AMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQD  188

Query  1324  QPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvl  1145
                T+ F      +L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG+ + VL
Sbjct  189   ---TKRF------SLKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQMLGSTSGRHLSVL  239

Query  1144  valiitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPN  1013
             VAL+I+V  L++Y  YQ+  P IQ+R L +++ ++                LL   G+P+
Sbjct  240   VALVISVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHALGRLLDDEGQPD  299

Query  1012  VSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAV--------KTMMKDLD  863
                IR  F   D++ +  +S+ EL+  +  I  +E+   +  AV        KT+ + +D
Sbjct  300   EHVIRRLFETIDANKDGHLSAAELKALIIGISFEEIDFDKDDAVGKVLQDFDKTLDEQVD  359

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqa  683
             +D   R  +   L  +         A                +E +    N      E+ 
Sbjct  360   QDEFVRGIKHWLLQAMGTAGPAGPDAGPRTMKFLDHFHVQTKREHTLLGDNENGENEEEG  419

Query  682   ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
             G      W  I   L ++LG AI    A PL+  V  FS A G+P+F ISF+ LP+  N 
Sbjct  420   GEVADPKWITIKAALLLLLGAAIAAAFADPLVDTVNNFSAATGIPSFFISFIALPLATNS  479

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
               A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+VY R LTW++S+EVLV+
Sbjct  480   SEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIVYLRGLTWNFSSEVLVI  539

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    GW+
Sbjct  540   LIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS  585



>ref|XP_002881319.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57578.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=612

 Score =   229 bits (585),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 171/534 (32%), Positives = 265/534 (50%), Gaps = 41/534 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C H YGF PCA+NI GY+FQ+  F  L+ + +  +S    K+F     G +G  +F +L
Sbjct  74    ACIHVYGFLPCADNIGGYIFQVFSFGCLLIIGDYFLSEGRSKLFLIFEVGFYGGIIFPLL  133

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG---------  1364
              +FPRI + IS G+  + EGA   V   + V  G TIF LT+ WG CV+ G         
Sbjct  134   TMFPRIALMISPGLVATHEGALMIVGNNVGVTMGHTIFALTMQWGACVVFGLTGPNSDPS  193

Query  1363  -RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelv  1187
              RR    +       P    +    LK++ E  +  D      AG+MLL+LVPF+LV L 
Sbjct  194   IRRGSIKRTASDTKNPRRGFYRMKILKSVVEASVDADPKNKKAAGIMLLTLVPFLLVTLP  253

Query  1186  nvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----------  1037
             +++ + S   I++L+ LII+ +    YF Y   D   QK+SL +++FE +          
Sbjct  254   DLLDAQSWSDIIMLITLIISCSSTFIYFVYSYFDTADQKKSLDHAKFELMSEVHKHLQSF  313

Query  1036  ----LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV-QRMVA-----V  887
                 L ++G+ +   ++  F   D + + ++   EL+    L V   V  RM        
Sbjct  314   SPRTLIRDGQLSKESLKSLFDKIDRNKDGKIQISELKD---LTVEFGVFGRMKCDINEFA  370

Query  886   KTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQE-------K  728
              T++ + D+D N  + E EF  GI  LL      +  +     +       +        
Sbjct  371   STLLAEFDKDKNGELDENEFEEGIMKLLNQYKFDNQESPRHNNTYIYRTPSDSVHVKNLS  430

Query  727   SGEETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGV  551
             +G+E      E+ +Q    K  +   +  V +VI G+ I+ F A+P M N+   S + GV
Sbjct  431   NGKEAGVLKLEMPKQTLVAKFLSMRTLRAVTKVIGGMLIVVFLAKPFMVNIGLLSVSAGV  490

Query  550   PTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVV  371
             P+F   F V+P+V N +  ++A F   +  ++ AS  FSEIY  VTM+NL G+   LA+V
Sbjct  491   PSFYSVFAVIPLVRNLKNTLSAHFCRKKDKARIASEMFSEIYRDVTMNNLMGMSITLAIV  550

Query  370   YARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             Y+R L W+YS E L+V V+ + IG  AY ++TY  W  + AF +Y FSL L Y+
Sbjct  551   YSRGLKWEYSIESLLVVVVGIAIGLPAYVRSTYPFWICVMAFAMYIFSLVLIYI  604



>ref|XP_011096404.1| PREDICTED: uncharacterized protein LOC105175608 [Sesamum indicum]
Length=707

 Score =   230 bits (587),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/291 (42%), Positives = 181/291 (62%), Gaps = 19/291 (7%)
 Frame = -1

Query  1051  RFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTM  878
             + E+L+T +GKPN  +I+  F  +D+D NQ +S+ ELE+ L  +   E  V+    VK +
Sbjct  433   KAESLITPDGKPNTEQIQNLFRQFDTDGNQSISASELEQLLTTVKFGESRVKYEDIVKEL  492

Query  877   MKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaag  698
              KD D + N+ I  +EF +G+   L                  +  D+ +  +E +    
Sbjct  493   FKDFDVNNNTTIDPKEFEDGVTKWLNRAMDVA-----------KTTDKRRIIDEFDKIVW  541

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
             +       +   WDFI++V QV++G+ +LTF   PLMT+++Q S A+ + +F ISFV++P
Sbjct  542   KQP-----EYRMWDFIMSVFQVLVGILMLTFLGGPLMTSILQLSYAMRLSSFSISFVIVP  596

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             + +N R AI A+ PA QK+ ++ASLTFSEIY GV M+N+ GL +LLA+V+A+ELTWD+SA
Sbjct  597   LAMNARTAITALLPAKQKNERSASLTFSEIYGGVIMNNIAGLTTLLAIVFAKELTWDFSA  656

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             EVL + V+   IG LAY   TY LWT I AFFLYPFSL ++Y +Q+ L WN
Sbjct  657   EVLTILVVCAIIGILAYSCNTYPLWTCILAFFLYPFSLGMYYFVQVFLSWN  707


 Score =   189 bits (479),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 188/311 (60%), Gaps = 18/311 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+H YGF PCAEN  GY+FQI+++Q L++  E+ +   S+ +F  +G G  G  +FRIL
Sbjct  65    TCNHQYGFLPCAENAAGYIFQILVYQGLLTFGERQIGRGSQVLFHIIGAGKIGGIIFRIL  124

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
             M  P +++ I SG+F+S+E AQ+QV  G+ + AG T+F+LT+ WG+CVI GRR+   + K
Sbjct  125   MSLPSMMLMIVSGVFSSKENAQSQVSLGVGIYAGMTVFSLTLQWGICVIFGRRELTDKSK  184

Query  1336  D-SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
             + +++  S+   A   L  L + G+  D  T   A +MLLSL+P+++V+LV+   ++S  
Sbjct  185   EHAEASQSSCLQAKEKLIILKDTGVLVDRDTRSIARIMLLSLIPYIVVQLVDFFHTSSAN  244

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT--------------QNG  1022
             RI+ L ALI++   L+AYFGYQI DP +Q+RSL Y+++E L T              ++G
Sbjct  245   RIITLTALIVSSLSLIAYFGYQIWDPLVQQRSLEYAKYETLRTKFLEHVKQQGQLVNEDG  304

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD---EVQRMVAVKTMMKDLDRDGN  851
               N   I   F   D D N  ++  ELEK +  ++T     + + +A+  +M+  D + +
Sbjct  305   ALNTDAISKLFVETDKDKNNSIAKNELEKLVVDVITTGKMNIDKTIAIADVMQTFDFNED  364

Query  850   SRITEQEFLNG  818
               I EQEF+ G
Sbjct  365   GCIKEQEFIEG  375



>gb|KFK23894.1| hypothetical protein AALP_AAs69390U000200 [Arabis alpina]
Length=595

 Score =   228 bits (582),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 163/539 (30%), Positives = 270/539 (50%), Gaps = 34/539 (6%)
 Frame = -1

Query  1744  SFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIF  1565
              F+ L  P+  + S + C+H YGF PCA+N+ GY+FQ+  F  L+ + +  +S    K+F
Sbjct  56    KFVTLDPPK--NVSKAACEHVYGFLPCADNLGGYVFQVFSFGCLLIIGDYFLSEGRSKLF  113

Query  1564  DTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLW  1385
                  G +G  VF +L +FPRI + +S G+  + +GA   V   + V  G T+F LT+ W
Sbjct  114   LIFEVGFYGGIVFPLLTMFPRIALMLSPGLTATHDGALTIVGNNVGVTVGHTVFALTMQW  173

Query  1384  GLCVIVGR---------RDRATQEKDSQSQ-PSTQSFASNWLKTLNECGISTDASTSFTA  1235
             G CV+ G          R  A +   S ++ P    +    LK++ E  +  D      A
Sbjct  174   GACVVFGMTGPSSNQSFRKEAVKRISSDTKIPRRGFYRMKILKSVLEASVDADPKNKKAA  233

Query  1234  GLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY  1055
             G+MLL+L PF++V L ++  + +   + +L+ LI+T +    YF Y   D   QK+SL +
Sbjct  234   GIMLLTLAPFLMVTLPDLFGAQTWSDVTMLITLIVTCSSTFIYFVYSYFDIADQKKSLDH  293

Query  1054  SRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLI  920
             ++FE +                ++G+ +   ++  F   D + + ++   EL+   +   
Sbjct  294   AKFELMSEVHKHLQSFSPRNFIRDGQLSKESLKSLFDRIDRNKDGKIQIAELKDLTVEFG  353

Query  919   VTDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPE  746
             V  +++  +     T++ D D+D +  + E EF  GI  LL +    +            
Sbjct  354   VFGKMKCDINEFANTLLMDFDKDKDGELDENEFEEGIMKLLDHYKFDNQDTPRH-----N  408

Query  745   NDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFS  566
             N     + +         +Q    K+ +   +  V +V+ G+ I+ F A+P M N+   S
Sbjct  409   NTWYRTTSDPAALKLEMPKQTLAAKLFSMRILRAVTKVMGGMLIVVFLARPFMMNIGFLS  468

Query  565   GAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLS  386
              + GVP+F   FVV+P+V N +  ++A F   +  ++ AS  FSEIY  VTM+NL G+  
Sbjct  469   VSSGVPSFYSVFVVIPLVRNLKNTLSAHFCRKKDKARIASDKFSEIYRDVTMNNLMGMSI  528

Query  385   LLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
              LA+VY + L WDYS E L+  V+ L IG  AY K+TY  W ++ AF +Y FSL L Y+
Sbjct  529   TLAIVYTKGLKWDYSTEALLAVVVGLAIGIPAYVKSTYPFWIAVMAFAMYFFSLVLIYL  587



>ref|XP_010462200.1| PREDICTED: uncharacterized protein LOC104742841 [Camelina sativa]
Length=581

 Score =   228 bits (580),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 179/526 (34%), Positives = 279/526 (53%), Gaps = 37/526 (7%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC +   G +F I+++ +LM  A   +S+ S+ + + LG GI G     +L   P 
Sbjct  65    YGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPD  124

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQEKDSQS  1325
              ++ + SG+      AQ+QV  G+ + AG+T+  LTV+WG C +VG+ D R T   ++Q 
Sbjct  125   AMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQD  184

Query  1324  QPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvl  1145
                T+ F      +L + G++ D  TS+ A +M +S++PFV+V+L  ++ S SG+ + VL
Sbjct  185   ---TKRF------SLKDSGVTVDVWTSYAARIMAISVIPFVIVQLPQMLGSQSGRHLSVL  235

Query  1144  valiitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPN  1013
             VAL+++V  L++Y  YQ+  P IQ+R L +++ ++                LL   G+P+
Sbjct  236   VALVLSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISGILKHLKQHSLGRLLDDEGQPD  295

Query  1012  VSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAV--------KTMMKDLD  863
                IR  F   D++ +  +S+ EL+  +  I  +E+   +  AV        KT+ + +D
Sbjct  296   EHVIRRLFDTIDANKDGHLSAAELKALIIGISFEEIDFDKDDAVGKVLQDFDKTLDEQVD  355

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqa  683
             +D   R  +   L  +         A                +E +    N      E+ 
Sbjct  356   QDEFVRGIKHWLLQAMGTAGPAGPDAGPRTMKFLDHFHVQTKREHTLLGDNENGENEEEG  415

Query  682   ggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVING  503
             G      W  I   L +ILG AI    A PL+  V  FS A G+P+F ISF+ LP+  N 
Sbjct  416   GEVADPKWITIKAALLLILGAAIAAAFADPLVDTVNNFSAATGIPSFFISFIALPLATNS  475

Query  502   RMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVV  323
               A++AI  AS+K  + ASLTFSE+  GVTM+N+  L   LA+VY R LTW++S+EVLV+
Sbjct  476   SEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCLSVFLAIVYLRGLTWNFSSEVLVI  535

Query  322   FVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              ++ L +G  A F+TTY LWT   A+ LYPFSL L Y+L    GW+
Sbjct  536   LIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS  581



>emb|CDX79552.1| BnaC03g18880D [Brassica napus]
Length=596

 Score =   228 bits (580),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 173/554 (31%), Positives = 275/554 (50%), Gaps = 40/554 (7%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
                 +  FL L  P+  + S + C H YGF PCA+NI GY FQ+  F  L+ + +  +S 
Sbjct  54    HGASEYEFLTLDPPK--NVSKAACLHVYGFLPCADNIGGYAFQVFSFGCLLVIGDYFLSE  111

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F     G +G  VF +L +FPRI++ +S G+  + + A   V   + V  G T+F
Sbjct  112   GRSKLFVIFEVGFYGGIVFPLLTMFPRIVLMLSPGLSATHDDALAIVGSNVGVTVGYTVF  171

Query  1402  NLTVLWGLCVIVG----------RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
              LT+ WG CV+ G           R    +       P    + +  LK + E  +  D 
Sbjct  172   ALTMQWGACVVFGLTSPSSGQSTPRGSIKRTTSDTKNPRRGFYRTKILKNIVEANVDADP  231

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
                 +AG+MLL+L PF++V L +++ + +   I +L+ LIITV+    YF Y   D   Q
Sbjct  232   KNKKSAGIMLLTLAPFLMVTLPDLLDAQAWSDITILITLIITVSSTFIYFVYSYFDTADQ  291

Query  1072  KRSLHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEK  935
             K+SL  ++FE +              L ++G+     ++  F   D + + ++   EL+ 
Sbjct  292   KKSLDNAKFELMSEVHKHLQSFSPRSLIRDGQLTKESLKSLFDKIDRNKDGKIQISELKD  351

Query  934   F-LRLIVTDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaat  764
               +   V   ++  +     T++ D D+D +  + E EF  G+  LL    +A ++    
Sbjct  352   LTVEFGVYGRMKCDINEFANTLLADFDKDKDGELDENEFEEGVMKLLNQYKTASDSVHV-  410

Query  763   ptstPENDDQEKSGEETNgaagev-eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLM  587
                  +N  Q   GEE      E+ +Q    K+ +   +  VL+VI G+ ++ F A+P M
Sbjct  411   -----KNLSQ---GEEAGVLKLEMPKQTLVAKLLSLRTLKAVLKVIGGMLMVLFLAKPFM  462

Query  586   TNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMS  407
              N+   S   GVP+F   F V+P+V N +  ++A F   +  ++ AS  FSEIY  VTM+
Sbjct  463   ININLLSVTAGVPSFYAVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEIYRDVTMN  522

Query  406   NLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFS  227
             NL G+  +LA+VY + L WDYS E L+  V+ L IG  AY ++TY  W S+ AF +Y  S
Sbjct  523   NLMGMSIVLAIVYTKGLKWDYSTEALLAVVVGLAIGLPAYVRSTYPFWISVLAFAMYISS  582

Query  226   LALFYV-LQLLGWN  188
             L L Y+   L G N
Sbjct  583   LVLIYLHFHLRGQN  596



>ref|XP_008229131.1| PREDICTED: uncharacterized protein LOC103328510 [Prunus mume]
Length=575

 Score =   227 bits (579),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 176/525 (34%), Positives = 275/525 (52%), Gaps = 31/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   + G  F I+++ YLM ++ +L+S+ S+ +   LG GI G     +L
Sbjct  60    SCDQTYGFLPCTTTVLGNTFLIIVYGYLMFLSAKLLSNGSEILLQILGPGIVGGFFLPLL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P   + ++SG+    E AQ+QV  G+ + AG+ +  LT+LWG C++VG+ D   +  
Sbjct  120   SSIPDATIILASGLSGDTETAQSQVSVGMGLLAGSNVMLLTILWGTCLLVGKCD--LENS  177

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  Q   + F      +L   G+STD  TS+ A +M+ S++PFV+V+L  V  + S  R
Sbjct  178   VAVDQKDEKRF------SLTGSGVSTDIWTSYAARIMVFSIIPFVIVQLPQVFHTTSDSR  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + +L++LI+ ++F++AY  YQ+  P IQKR L  S+ ++                LLT +
Sbjct  232   LAILISLIVAISFVIAYSLYQVFQPWIQKRKLALSKHKHVMSEILIQLKTNALGRLLTND  291

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGN  851
             G PN   I   F   D D++  +S+ +L   +  I  D++   +  A+  +M+D D   +
Sbjct  292   GDPNKVVIEKLFKTLDQDSDGYLSTADLRSLIIGIQFDDIDINIDEAISQVMRDFDTSHD  351

Query  850   SRITEQEFLNGIE---NLLannssadnaaaatptstPENDDQEKSGEETNgaageveqag  680
             S+I   EF  GI    N     +  +           E+ D++   E+        E   
Sbjct  352   SKIDVDEFFKGISKWINKAKRVAIMERGKLPPSMKLLEDFDKKTKKEQDQFMDQMDEVVE  411

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               K   W     V  ++LG  +    A PL+  V  FS A  +P+F ISFV+LP   +  
Sbjct  412   DVKNVKWHGSKAVGLLLLGTIVAAVFADPLVDAVDDFSTATSIPSFFISFVILPFASSSE  471

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
             +    IF  S+K  + ASL +SEIY  VTMSN+  L   L +VY R LTW +SAEVLV+ 
Sbjct  472   IVSTLIF-VSRKKQRTASLAYSEIYGSVTMSNILSLAVFLGLVYIRNLTWSFSAEVLVIV  530

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             V+ + +G +A F+TT+ LW S+ A  LYP SL L Y+L  + GW+
Sbjct  531   VVCILMGAIASFRTTFPLWMSLVAMLLYPLSLLLVYILDYVFGWS  575



>emb|CDY34082.1| BnaA09g27080D [Brassica napus]
Length=585

 Score =   227 bits (578),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 169/523 (32%), Positives = 268/523 (51%), Gaps = 42/523 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C H YGF PCA+N+ GY+FQ+  F  L+ + E  +S    K+F     G +G  VF +L 
Sbjct  62    CVHVYGFLPCADNVAGYVFQVFFFGCLLIIGENFLSEGRTKLFVIFEVGFYGGIVFPLLT  121

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG----RRDRAT  1346
             +F RI + +SSG+  S+E A + V   + V    T+F LT+ WG CV+ G      D++ 
Sbjct  122   MFTRIALILSSGLTGSREIANSMVDNNVGVTVAYTVFALTMQWGSCVVFGLSGLGSDQSI  181

Query  1345  QEKDSQSQPSTQSFASNWL--KTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSS  1172
             ++ + Q   S  +     L  K + E G+  D      AG+MLL+L+PFV+V L  +  S
Sbjct  182   RKGEVQRISSDTTMPRRQLIMKIVAEAGVKADPKNKKAAGIMLLTLLPFVMVTLSEIFDS  241

Query  1171  ASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL--------------L  1034
              S +  +VL+ LII+ +  + YF Y   D   Q++SL  +RFE +               
Sbjct  242   KSWKDRIVLITLIISGSATVVYFLYSYFDTADQQKSLDRARFELMSEVHKHLQNFSPQSF  301

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVAVK--------TM  878
              +NG+ +   +   F   D + + ++   EL+      +T E   +  +K        T+
Sbjct  302   IKNGQLSKESLHRLFEKIDVNKDGKIQVSELKD-----LTVEFGMLGRMKCDIHELATTL  356

Query  877   MKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaag  698
             + D D D +  I E EF  GI   L     + ++             ++   E+      
Sbjct  357   LADFDSDSDGEIDEIEFEKGISRWLKQYKFSFDSTEC---------QRDNRAEDRVLKME  407

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
             + +++   K+ +   +   ++VI+G+ I+ F A P M N+   S + GVP+F + FVV+P
Sbjct  408   QPKESLVAKLLSQRTMRATIEVIVGILIVLFLATPFMANIELLSKSAGVPSFYVVFVVIP  467

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             +  N R A++A F   +  ++  S TFSEIY  VTM+NL G+  +LA+VY R LTWDYS 
Sbjct  468   LARNLRNALSAHFCRKKDKARVTSDTFSEIYKDVTMNNLLGISIILAIVYTRGLTWDYST  527

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             EVL++ ++ L IG  AY ++TY  W  + AF LY FSL L Y+
Sbjct  528   EVLIIVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLVLVYL  570



>ref|XP_010058976.1| PREDICTED: uncharacterized protein LOC104446874 [Eucalyptus grandis]
 gb|KCW74042.1| hypothetical protein EUGRSUZ_E02666 [Eucalyptus grandis]
Length=561

 Score =   226 bits (576),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 161/496 (32%), Positives = 272/496 (55%), Gaps = 20/496 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC   + G LF + +++ L+++A + VSS S+  F   GTGIFGA++F++L
Sbjct  52    TCEPTYGFLPCTTELWGELFLVAVYECLLALAGKYVSSGSELFFRMFGTGIFGASLFQML  111

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD-RATQE  1340
               FP++I+ +++ I  S +  ++     + + AG+ IF+L+++WG  V  G  D  ++  
Sbjct  112   GTFPQVIIMLANAISASSDKTESVATMAMAMLAGSAIFSLSLVWGSIVAFGSCDFSSSSP  171

Query  1339  KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
               S  QP+ +         L   G+ TD  T + A +M +S++PF++++   +V+  +G+
Sbjct  172   SSSDRQPTREPC------RLTGSGVETDPETKYIARIMFVSMIPFLILQSAKIVNFTAGK  225

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSR  1004
             RIV+LV+LI+TV FL+ Y  YQ+  P IQK+ L Y        S  ++LLT +GKPNV R
Sbjct  226   RIVILVSLIVTVIFLVTYCTYQVFKPWIQKKRLEYLVRLYEGESILQSLLTVHGKPNVLR  285

Query  1003  IRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA--VKTMMKDLDRDGNSRITEQE  830
             I+  F   D + + ++   EL  F+  I   E          ++MK  D   ++ I+E E
Sbjct  286   IKDLFQKMDQNKDSRVPKTELYSFMLGIQIMEAGLNTDDFTDSVMKLFDSSIDASISESE  345

Query  829   FLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGT--WD  656
             F+ GI   L  ++   N+ A   +S   N  QE + E+ +      + +         W+
Sbjct  346   FVQGISEWLDEDTLPVNSLAQARSSAG-NQSQETTPEQESLLLPHYKTSKSTGRFDVWWN  404

Query  655   FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFP  476
             +      +I+G  I    A PL  +  +F  A G+  F IS+V++P+  + R  ++A+  
Sbjct  405   YTKAGFLIIVGSGITVLLAGPLGDSFEEFGRAAGIRPFFISYVLIPLATSYRQVLSAVIS  464

Query  475   ASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGF  296
               +K+ +  S   +E+YNGV M+N+ GL + LA+VY +++ WD  AEVLVV +I   +GF
Sbjct  465   VKKKTKRDISGALTEVYNGVFMNNVMGLATFLALVYIKDIAWDVPAEVLVVLLICTLMGF  524

Query  295   LAYFKTTYQLWTSIFA  248
             +  F T +QLWT I +
Sbjct  525   ITSFCTKFQLWTCILS  540



>ref|XP_009132970.1| PREDICTED: uncharacterized protein LOC103857518 [Brassica rapa]
Length=612

 Score =   226 bits (577),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 166/553 (30%), Positives = 265/553 (48%), Gaps = 37/553 (7%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
                 +  FL L  P+  + S + C H YGF PCA+NI GY FQ+  F  L+ + +  +S 
Sbjct  54    HGASEYEFLTLDPPK--NVSKAACLHVYGFLPCADNIGGYAFQVFSFGCLLVIGDYFLSE  111

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F     G +G  VF +L +FPRI++ +S G+  + +GA   V   + V  G T+F
Sbjct  112   GRSKLFVIFEVGFYGGIVFPLLTMFPRIVLMLSPGLSATHDGALAIVGSNVGVTVGHTVF  171

Query  1402  NLTVLWGLCVIVG----------RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
              LT+ WG CV+ G           R    +       P    + +  LK + E  +  D 
Sbjct  172   ALTMQWGACVVFGLTSPSSGQSTPRGSIKRTTSDTKNPRRGFYRAKILKNIVEASVDADP  231

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
                  AG+MLL+L PF++V L +++ + S   I +L+ LII+ +    YF Y   D   Q
Sbjct  232   KNKKAAGIMLLTLAPFLIVTLPDLLDAQSWSDITILITLIISCSSTFIYFVYSYFDTADQ  291

Query  1072  KRSLHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEK  935
             K+SL  ++FE +              L ++G+     ++  F   D + + ++   EL+ 
Sbjct  292   KKSLDNAKFELMSEVHKHLQSFSPRSLIRDGQLTKESLKSLFDKIDRNKDGKIQISELKD  351

Query  934   F-LRLIVTDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaat  764
               +   V   ++  +     T++ D D+D +  + E EF  G+  LL      +      
Sbjct  352   LTVEFGVYGRMKCDINEFANTLLADFDKDKDGELDENEFEEGVMKLLNQYKFDNPDTPRQ  411

Query  763   ptstPENDDQE-------KSGEETNgaageveq-aggEKMGTWDFIVTVLQVILGVAILT  608
               +       +         GEE      E+ +     K+ +   +  VL+VI G+ ++ 
Sbjct  412   GNTCIYRTASDSVHVKNLSQGEEAGVLKLEMPKQTLVAKLLSLRTLKAVLKVIGGMLMVL  471

Query  607   FCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEI  428
             F A+P M N+   S   GVP+F   F V+P+V N +  ++A F   +  ++ AS  FSEI
Sbjct  472   FLAKPFMININLLSVTAGVPSFYAVFAVIPLVRNLKNTLSAHFCRKKDKARIASEKFSEI  531

Query  427   YNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFA  248
             Y  VTM+NL G+  +LA+VY + L WDYS E LV  V+ L IG  AY ++TY  W  + A
Sbjct  532   YRDVTMNNLMGMSIVLAIVYTKGLKWDYSTEALVAVVVGLAIGLPAYVRSTYPFWICVLA  591

Query  247   FFLYPFSLALFYV  209
             F +Y  SL L Y+
Sbjct  592   FAMYISSLVLIYL  604



>ref|XP_009113633.1| PREDICTED: uncharacterized protein LOC103838933 [Brassica rapa]
Length=585

 Score =   226 bits (575),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 169/523 (32%), Positives = 268/523 (51%), Gaps = 42/523 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C H YGF PCA+N+ GY+FQ+  F  L+ + E  +S    K+F     G +G  VF +L 
Sbjct  62    CVHVYGFLPCADNVAGYVFQVFSFGCLLIIGENFLSEGRTKLFVIFEVGFYGGIVFPLLT  121

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG----RRDRAT  1346
             +F RI + +SSG+  S+E A + V   + V    T+F LT+ WG CV+ G      D++ 
Sbjct  122   MFTRIALILSSGLTGSREIANSMVDNNVGVTVAYTVFALTMQWGSCVVFGLSGLGSDQSI  181

Query  1345  QEKDSQSQPSTQSFASNWL--KTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSS  1172
             ++ + Q   S  +     L  K + E G+  D      AG+MLL+L+PFV+V L  +  S
Sbjct  182   RKGEVQRISSDTTMPRRQLIMKIVAEAGVKADPKNKKAAGIMLLTLLPFVMVTLSEIFDS  241

Query  1171  ASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL--------------L  1034
              S +  +VL+ LII+ +  + YF Y   D   Q++SL  +RFE +               
Sbjct  242   KSWKDRIVLITLIISGSATVVYFLYSYFDTADQQKSLDRARFELMSEVHKHLQNFSPQSF  301

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVAVK--------TM  878
              +NG+ +   +   F   D + + ++   EL+      +T E   +  +K        T+
Sbjct  302   IKNGQLSKESLHRLFEKIDVNKDGKIQVSELKD-----LTVEFGMLGRMKCDIHELATTL  356

Query  877   MKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaag  698
             + D D D +  I E EF  GI   L     + ++             ++   E+      
Sbjct  357   LVDFDSDSDGEIDEIEFEKGISRWLKQYKFSFDSTEC---------QRDNRAEDRVLKME  407

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
             + +++   K+ +   +   ++VI+G+ I+ F A P M N+   S + GVP+F + FVV+P
Sbjct  408   QPKESLVAKLLSQRTMRATIEVIVGILIVLFLATPFMANIELLSKSAGVPSFYVVFVVIP  467

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
             +  N R A++A F   +  ++  S TFSEIY  VTM+NL G+  +LA+VY R LTWDYS 
Sbjct  468   LARNLRNALSAHFCRKKDKARVTSDTFSEIYKDVTMNNLLGISIILAIVYTRGLTWDYST  527

Query  337   EVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             EVL++ ++ L IG  AY ++TY  W  + AF LY FSL L Y+
Sbjct  528   EVLIIVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLVLVYL  570



>ref|XP_007213018.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
 gb|EMJ14217.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
Length=575

 Score =   225 bits (574),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 274/525 (52%), Gaps = 31/525 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC   + G  F I+++ YLM ++ +L+S+ S+ +   LG GI G     +L
Sbjct  60    SCDQTYGFLPCTTTVLGNTFLIIVYGYLMFLSAKLLSNGSEILLQILGPGIVGGFFLPLL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P   + ++SG+    E AQ+QV  G+ + AG+ +  LT+LWG C++VG+ D   +  
Sbjct  120   SSIPDATIILASGLSGDTETAQSQVSVGMGLLAGSNVMLLTILWGTCLLVGKCD--LENS  177

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  Q   + F      +L   G+STD  TS+ A +M+ S++PFV+V+L  V    S  R
Sbjct  178   VAVDQKDEKRF------SLTGSGVSTDIWTSYAARIMVFSIIPFVIVQLPQVFHRTSDNR  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + +L++LI+ ++F++AY  YQ+  P IQKR L  S+ ++                LLT +
Sbjct  232   LAILISLIVAISFVIAYSLYQVFQPWIQKRKLALSKHKHVMSEILIQLKTNALGRLLTND  291

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGN  851
             G PN   I   F   D D++  +S+ +L   +  I  D++   +  A+  +M+D D   +
Sbjct  292   GDPNKVVIEKLFKTLDQDSDGYLSTADLRSLIIGIQFDDMDINIDEAISQVMRDFDTSHD  351

Query  850   SRITEQEFLNGIE---NLLannssadnaaaatptstPENDDQEKSGEETNgaageveqag  680
             S+I   EF  GI    N     +  +           E+ D++   E+        E   
Sbjct  352   SKIDVDEFFKGISRWINKAKRVAIMERGKLPPSMKLLEDFDKKTKKEQDQFMDQMDEVVE  411

Query  679   gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGR  500
               K   W     V  ++LG  +    A PL+  V  FS A  +P+F +SFV+LP   +  
Sbjct  412   DVKNVKWHASKAVGLLLLGTIVAAVFADPLVDAVDNFSTATSIPSFFVSFVILPFASSSE  471

Query  499   MAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVF  320
             +    IF  S+K  + ASL +SEIY  VTMSN+  L   L +VY R LTW +SAEVLV+ 
Sbjct  472   IVSTLIF-VSRKKQRTASLAYSEIYGSVTMSNILSLAVFLGLVYIRNLTWSFSAEVLVIV  530

Query  319   VISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             V+ + +G +A F+TT+ LW S+ A  LYP SL L Y+L  + GW+
Sbjct  531   VVCILMGAIASFRTTFPLWMSLVAMLLYPLSLLLVYILDYVFGWS  575



>gb|AAK32813.1|AF361800_1 At1g53210/F12M16_12 [Arabidopsis thaliana]
 gb|AAM91449.1| At1g53210/F12M16_12 [Arabidopsis thaliana]
Length=493

 Score =   222 bits (566),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 166/514 (32%), Positives = 269/514 (52%), Gaps = 60/514 (12%)
 Frame = -1

Query  1612  MSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFG  1433
             M  A   +S+ S+ + + LG GI G     +L   P  ++ + SG+      AQ+QV  G
Sbjct  1     MFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVSVG  60

Query  1432  IRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
             + + AG+T+  LTV+WG C +VG+ D   ++  + +   T+ F       L + G++ D 
Sbjct  61    MGLLAGSTVMLLTVIWGTCTVVGKCD--LRDSIAVNNQDTKGF------HLKDSGVTVDI  112

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
              TS+ A +M +S++PFV+V+L  ++ S SG+++ VL+ALI++V  L++Y  YQ+  P IQ
Sbjct  113   WTSYAARIMAISVIPFVIVQLPQMLGSTSGRQLSVLIALILSVLMLISYCVYQVFQPWIQ  172

Query  1072  KRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSREL  941
             +R L +++ ++                LL   G+P+   IR  F   D++N+  +S+ EL
Sbjct  173   RRRLAFAKHKHVISGILRHLKQHALGRLLDDEGQPDEHVIRKLFLTIDANNDGHLSAAEL  232

Query  940   EKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLanns--------  791
             +  +  I  +++   +  AV  +++D D+  + ++ ++EF+ GI+  L            
Sbjct  233   KALIIGISFEDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKQWLIQAMGGAPSGPE  292

Query  790   ------------sadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIV  647
                                       EN + ++ G E                  W  I 
Sbjct  293   AGPRTMKFLDNFHVQTKREHALLGDNENGENDEEGGEVADP-------------KWITIK  339

Query  646   TVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQ  467
               L ++LG AI    A PL+  V  FS A G+P+F ISF+ LP+  N   A++AI  AS+
Sbjct  340   AALLLLLGAAIAAAFADPLVDTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASR  399

Query  466   KSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAY  287
             K  + ASLTFSE+  GVTM+N+  L   LA+VY R LTW++S+EVLV+ ++ L +G  A 
Sbjct  400   KKIRTASLTFSELCGGVTMNNILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFAS  459

Query  286   FKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             F+TTY LWT   A+ LYPFSL L Y+L    GW+
Sbjct  460   FRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS  493



>gb|AAF24539.2|AC007508_2 F1K23.2 [Arabidopsis thaliana]
Length=1062

 Score =   229 bits (584),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 159/527 (30%), Positives = 253/527 (48%), Gaps = 70/527 (13%)
 Frame = -1

Query  1741  FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFD  1562
             FL+L  P     + + C H Y F PCA+N+ GY+FQ+  F  ++ + E  ++    K+F 
Sbjct  573   FLSLDPPN--DITKNMCVHVYDFLPCADNVAGYVFQVFSFGCILIIGEYFLTKGRTKLFL  630

Query  1561  TLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWG  1382
                 G +G  +F +L +FPRI + +S+G+  S+E A ++V   I V  G ++F LT+ WG
Sbjct  631   IFEVGFYGGIIFPLLTMFPRIALILSTGLVGSREMASSRVGNIIGVTVGYSVFALTIQWG  690

Query  1381  LCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfv  1202
              C++ G      +      QP   S AS          +  D +   +AG+MLL+++PF+
Sbjct  691   ACILFGLSGTKPE------QPIDLSAAS----------VEADITNKKSAGIMLLTILPFI  734

Query  1201  lvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL-----  1037
             LV  V                              Q  D   Q +SL ++RFE +     
Sbjct  735   LVFFVKNS---------------------------QYFDRDDQAKSLDHARFELMSEVHK  767

Query  1036  ---------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF---LRLIVTDEVQRMV  893
                      L ++G+ N   ++  F   D++ + ++   EL+       +I   +     
Sbjct  768   HLQIFSPKSLIRDGQLNQESLKRLFQKIDANGDGKIQVAELKDLTVEFGMIGRVKCHIDK  827

Query  892   AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEET  713
              V T++ D DRDG+  I E EF  GI+  L     + +          E     K  +  
Sbjct  828   LVHTLVDDFDRDGDREIDEAEFEIGIKKWLNQYKFSFDTTVPPREDQAEGVPILKVEKPE  887

Query  712   NgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIIS  533
                          K+ +W  +   L+VILG+ ++ + A+P M N+   S + GVP+F + 
Sbjct  888   QSLVK--------KLLSWRTLRASLEVILGMLVVIYLARPFMMNIQLLSESAGVPSFYVV  939

Query  532   FVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELT  353
             FVV+P+  N +  ++A F   +  +K  S TFSEIY  VTM+NL G+  +LA+VYAREL 
Sbjct  940   FVVIPLARNLKNTLSAHFCRKKDKAKITSDTFSEIYKDVTMNNLMGISIILAIVYARELV  999

Query  352   WDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFY  212
             WDY+ EVL++ ++ L IG  AY +TTY  W  + AF LY  SL + Y
Sbjct  1000  WDYTTEVLIIVIVGLLIGLPAYVRTTYPFWICLLAFALYFISLVVVY  1046


 Score =   213 bits (543),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 164/496 (33%), Positives = 248/496 (50%), Gaps = 33/496 (7%)
 Frame = -1

Query  1753  DQSS--FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSS  1580
             D+SS  FL+L  P LS S    C H YGF PCA+NI GY+FQ+  F  L+ + E  +S  
Sbjct  43    DRSSNDFLSLNPPNLSES---ACVHVYGFLPCADNIEGYVFQVFSFGCLLIIGEYFLSKG  99

Query  1579  SKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFN  1400
               K+F     G FG  +F +L +FPRI + +S+G+  S+E A +     + V  G ++F 
Sbjct  100   RSKLFVIFEVGFFGGIIFPLLTMFPRIALILSTGLIGSREIANSMTGNNVAVTVGYSVFA  159

Query  1399  LTVLWGLCVIVG----RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
             LT+ WG CV+ G    R D  +   D  S       + N LK L    I  D      AG
Sbjct  160   LTMQWGACVVFGLSGLRSDDQSITCDISSPRRQVKKSINLLKNLAGASIRADPKNKKAAG  219

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +MLL+L+PFVLV         S    +VLV LI + +  + YF Y   D   Q +SL Y+
Sbjct  220   IMLLTLLPFVLVTFSETFHIKSWDDNMVLVTLIFSGSATVLYFVYLYFDKADQVKSLEYA  279

Query  1051  RFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLIV  917
             +FE +              L +NG+     ++  F  +D + + ++   EL+   +   V
Sbjct  280   KFELMSEVHKHLQNFSPQSLIRNGQLCQESLKSLFKKFDVNKDGKIQVSELKDLTVDFGV  339

Query  916   TDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN  743
                V+  +     T++ D D + +  I E EF  GIE  L     + N   +      E+
Sbjct  340   LGRVKCDINELATTLLADFDSNRDGEIDETEFAIGIEKWLKQYKFSFNGTESQGEDIAED  399

Query  742   DDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSG  563
             D   K  +        ++     K+ T   +  V++VI+G+ I++F A P M N+   S 
Sbjct  400   DGVLKVEQ-------LLKGCLFTKLLTKRTLKAVIEVIIGITIVSFLAMPFMMNIELLSV  452

Query  562   AVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSL  383
             + GVP+F + F V+P+  N + A++A F   ++ +K  S TFSEIY  VT++NL G+  +
Sbjct  453   SAGVPSFYVVFAVIPLARNLKNALSAHFCRKKEKAKITSDTFSEIYRDVTLNNLLGITII  512

Query  382   LAVVYARELTWDYSAE  335
             LA+VY R LTWDYS E
Sbjct  513   LAIVYIRGLTWDYSTE  528



>ref|XP_008655084.1| PREDICTED: LOC100285177 isoform X1 [Zea mays]
Length=596

 Score =   223 bits (567),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 173/549 (32%), Positives = 276/549 (50%), Gaps = 54/549 (10%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC   + G LF ++ + +LM  A   +S+ S+ + + +G G+ G  +  IL 
Sbjct  55    CEQTYGFLPCTTTVLGNLFLVLAYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILG  114

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D     ++
Sbjct  115   ALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPG-RE  173

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
             +     T+ F      +L   G++TD  TS+ A +M LS++PF++ +   ++ +  GQR+
Sbjct  174   AVDVTDTKGF------SLTGTGVTTDVQTSYAARIMGLSVIPFIIAQFPKMLKTHHGQRL  227

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              +L+AL+++ A +LAY  YQ+  P IQ+R L Y++ ++                LL  +G
Sbjct  228   AMLLALVVSFALVLAYCLYQVFQPWIQRRKLAYAKHKHVISGILRHAQMQSLGRLLNDDG  287

Query  1021  KPNVSRIR----------------------------LFFHLYDSDNNQQMSSRELEKFLR  926
              PN   IR                              F   D D ++ +S  EL   + 
Sbjct  288   TPNEQVIRKCDSFPLSQLLSVVWPVVRSLAHCFRSCRLFRKIDMDESRSLSRAELHALIV  347

Query  925   LIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptst  752
              I  +EV   R  AV  +M D D   N  + E+EF+ G+   L     +     A  +  
Sbjct  348   GINFEEVDFDRTDAVDKVMDDFDTSRNDVVEEEEFVQGMRKWLDEARRSVPVGGAFSSKF  407

Query  751   PENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQ  572
                  +    E         E     +   W     V  ++LG A     A PL+  V  
Sbjct  408   IHEYHERTRQEHDELVDRSDEAVESVENPGWCIAKAVALLLLGSAAAAAFADPLVDAVHG  467

Query  571   FSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGL  392
             FS A  +P+F ISF+ LP+  N   A++AI  AS+K  +  SLTFSE+Y GVTM+N   L
Sbjct  468   FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  527

Query  391   LSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFY  212
                LA++Y R LTWD+S+EVL++ ++ + +     F+TT+ LWT + A+ LYP SL + Y
Sbjct  528   GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  587

Query  211   VLQ-LLGWN  188
             +L  + GW+
Sbjct  588   ILDYVFGWS  596



>ref|NP_180950.2| Calcium-binding EF-hand family protein [Arabidopsis thaliana]
 gb|AEC08908.1| Calcium-binding EF-hand family protein [Arabidopsis thaliana]
Length=566

 Score =   222 bits (565),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 162/532 (30%), Positives = 265/532 (50%), Gaps = 43/532 (8%)
 Frame = -1

Query  1741  FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFD  1562
             FL L  P+  S S + C H YGF PCA+N+ GY+FQ+  F  L+ + +  +S    K+F 
Sbjct  49    FLTLDPPK--SLSRTACVHVYGFLPCADNVEGYIFQVFSFGSLLIIGDYFLSEGRSKLFV  106

Query  1561  TLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWG  1382
                 G +G  +F +L +FPRI + +S+G+  S++ A + +   + +  G T+F+LT+ WG
Sbjct  107   IFEVGFYGGIIFPLLTMFPRIALMLSTGLSLSRDVASSFIDDNVGLTVGHTVFSLTIQWG  166

Query  1381  LCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfv  1202
              CV+       T  +  Q+    +      LK   E  +  D      AG+MLLSL PF+
Sbjct  167   ACVVFS----ITGPRSDQADGLIEKL--KILKGFVEARVEADPKNKKAAGIMLLSLSPFL  220

Query  1201  lvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL-----  1037
             +V    +  S S   I+VL+ LII+ +  + YF Y  +D   Q++SL ++RFE +     
Sbjct  221   MVTFSAIFDSHSWSHIIVLITLIISSSSTVVYFVYSYLDTANQEKSLDHARFELMSEVHK  280

Query  1036  ---------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRM----  896
                      L ++G+ +   ++  F   D + + ++   EL+     I      RM    
Sbjct  281   HLKRFSPKHLIKDGELSKESLKSLFKKTDKNKDGKIQISELKDLT--IELSNFGRMRYDI  338

Query  895   -VAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGE  719
                 K  ++D D D +  + E EF  GI  LL                    D +E   E
Sbjct  339   NELAKAFLEDFDGDNDGELEENEFEEGIARLLKQYKFNV------------EDQRENQTE  386

Query  718   ETNgaageve--qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPT  545
             E      E++  +    K+ + + ++   +VI+G+ I+ F A+P M N+   S + G+P+
Sbjct  387   ENGVLKLEIKPKKTLVTKLLSMETLIATTEVIVGILIVLFLAKPFMLNIQLLSISAGIPS  446

Query  544   FIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYA  365
             F I F ++P   N +  ++  F   +   + +S TFSEIY  +TM+NL G+  +LA+VY 
Sbjct  447   FYIVFAMIPFARNLKNTLSTRFCRGKDKKRVSSNTFSEIYKDITMNNLLGMSVILAIVYT  506

Query  364   RELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             R LTW YS E L++ ++ L IG   Y ++TY  W  + AF +Y FSL L Y+
Sbjct  507   RGLTWKYSVETLIMVIVGLIIGLPIYIRSTYPFWMCVLAFAMYFFSLLLIYI  558



>emb|CDY64851.1| BnaCnng45370D [Brassica napus]
Length=584

 Score =   221 bits (563),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 166/519 (32%), Positives = 262/519 (50%), Gaps = 35/519 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C H YGF PCA+N+ GY+FQ+  F  L+ + E  +S    K+F     G +G  VF +L 
Sbjct  62    CVHVYGFLPCADNVAGYVFQVFSFGCLLIIGENFLSEGRTKLFVIFEVGFYGGIVFPLLT  121

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG----RRDRAT  1346
             +F RI + +SSG+  S+E A + V   + V    T+F LT+ WG CV+ G      D++ 
Sbjct  122   MFTRIALILSSGLTGSREIANSMVDNNVGVTVAYTVFALTMQWGACVVFGLSGLGSDQSI  181

Query  1345  QEKDSQSQPSTQSFASNWL-KTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSA  1169
             +  + Q   S  +     L   +   G+  D      AG+MLL+L+PFV+V L  +  S 
Sbjct  182   RNGEVQRISSDTTIPRRQLIMKIVAAGVKADPKNKKAAGIMLLTLLPFVMVTLSEMFDSK  241

Query  1168  SGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL--------------LT  1031
             S +  +VL+ LII+ +  + YF Y   D   Q++SL  +RFE +                
Sbjct  242   SWKDRIVLITLIISGSATVVYFLYSYFDTADQEKSLDRARFELMSEVHKHLQNFSPQSFI  301

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA-----VKTMMKDL  866
             +NG+ +   +   F   D + + ++   EL+     +    + RM         T++ D 
Sbjct  302   KNGQLSKESLHRLFEKIDVNKDGKIQVSELKDL--TVEFGMLGRMKCDIHELATTLLADF  359

Query  865   DRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveq  686
             D D +  I E EF  GI   L     + ++             ++   E+      + ++
Sbjct  360   DSDSDGEIDEIEFEKGISRWLKQYKFSFDSTEC---------QRDNRAEDRVLRMEQPKE  410

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
             +   K+ +   +   ++VI+G+ I+ F A P M N+   S + GVP+F + FVV+P+  N
Sbjct  411   SLVAKLLSQRTMRATIEVIVGILIVLFLATPFMANIELLSKSAGVPSFYVVFVVIPLARN  470

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
              R A+ A F   +  ++  S TFSEIY  VTM+NL G+  +LA+VY R LTWDYS EVL+
Sbjct  471   LRNALTAHFCRKKDKARVTSDTFSEIYKDVTMNNLLGISIILAIVYTRGLTWDYSTEVLI  530

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             + ++ L IG  AY ++TY  W  + AF LY FSL L Y+
Sbjct  531   IVIVGLIIGVPAYVRSTYPFWICVLAFALYFFSLVLVYL  569



>ref|XP_008358657.1| PREDICTED: uncharacterized protein LOC103422380 [Malus domestica]
Length=410

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 151/427 (35%), Positives = 231/427 (54%), Gaps = 42/427 (10%)
 Frame = -1

Query  1420  AGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSF  1241
             AG+TI  LT++WG  V  G  D       S SQ S+ S   N   +L   G+ TD  T  
Sbjct  10    AGSTIMILTLIWGSVVAFGSSDL------SDSQTSSNSENKNPF-SLTGSGVRTDVETRD  62

Query  1240  TAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSL  1061
             TA +M+LS +P++ ++L  +++S +  R+V+L++L+I  A L  Y  YQ   P IQ R L
Sbjct  63    TARIMMLSSIPYLFLQLAKILTSTTAVRVVILISLLIASAILATYIIYQFFQPWIQSRRL  122

Query  1060  HYSRFE-------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV-  905
              Y   +       +LLT +G  N S I+  FH  D ++N  +S+ EL+  +  I  +E+ 
Sbjct  123   EYLMLKYIRKILPSLLTVDGNANESSIKELFHRVDKNHNTYISADELKALILGIQIEEIG  182

Query  904   -QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEK  728
                    + +MK  D  G+++ITE EF+NGI   +                   N D+  
Sbjct  183   LDDDDYAEEVMKQFDLSGDAQITETEFVNGISKWI-------------------NPDKTP  223

Query  727   SGEETNgaageveqaggEKMG-----TW-DFIVTVLQVILGVAILTFCAQPLMTNVIQFS  566
             +  ET+    ++     +K       +W + +     +ILG AI  F + PLM ++ +FS
Sbjct  224   AKNETSMEDQQIPLIVKKKKTRGADTSWMNLLKAAFLIILGTAITVFLSMPLMVSLQEFS  283

Query  565   GAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLS  386
              A  +P+F+ S+VV+P+  N R+A+ ++  A  K+  A SLT SEIYN   M+N+ GL+ 
Sbjct  284   TAASIPSFMASYVVIPLATNYRLALMSVLSAKDKTENAISLTLSEIYNAAFMNNIVGLII  343

Query  385   LLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL  206
              LA+VY R L+WD +AEVLVV +IS+ +G  A F   +  WTSI A+ LYP SL L YVL
Sbjct  344   FLALVYIRNLSWDVAAEVLVVLIISIAVGLSASFSRKFPFWTSILAYILYPISLLLVYVL  403

Query  205   QL-LGWN  188
              + +GW+
Sbjct  404   TIVIGWS  410



>ref|XP_010460672.1| PREDICTED: uncharacterized protein LOC104741492 [Camelina sativa]
Length=557

 Score =   220 bits (560),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 167/537 (31%), Positives = 265/537 (49%), Gaps = 44/537 (8%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
             Q    + FL+L  P LSS +   C H YGF PCA+NI GY+FQ+  F  L+ + E  +S 
Sbjct  42    QDGSSNEFLSLDPPNLSSEN--ACVHVYGFLPCADNIEGYVFQVFSFGCLLIIGEYFLSK  99

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F       FG  +F +L++FPRI + +++G+  S+E A + V   + V  G ++F
Sbjct  100   GRCKLFVIFEVCFFGGIIFPLLVMFPRITLILATGLMGSREMANSMVGNNVAVTVGYSVF  159

Query  1402  NLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLML  1223
              LTV WG CV+ G              P   S  S     +    +  D      AG+ML
Sbjct  160   ALTVQWGACVVFGL-------------PGLSSDQSIGNGEVQRASVKADPKNKKAAGIML  206

Query  1222  LSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE  1043
             L+L PFVLV       S S    ++L+ L+ + +  + +F Y   D   Q +SL ++RFE
Sbjct  207   LTLFPFVLVTFSETFDSKSWDDSIILITLLFSGSATVLFFVYHYFDKADQVKSLDHARFE  266

Query  1042  NL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV  905
              +              L ++ + +   ++  F   D + + ++   EL+     +    +
Sbjct  267   LMSEVHKHLQNFAPQSLIRDKQLSKESLKSLFEKIDVNKDGKIQVSELKDLT--VEFGVL  324

Query  904   QRMVA-----VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEND  740
              RM         T++ D D D +  I E EF  GIE  L       ++         ++ 
Sbjct  325   GRMKCDIHELATTLLADFDSDKDGEIDETEFEKGIEKWLRQYKFTVDST--------DSQ  376

Query  739   DQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGA  560
              + ++ +E      +  +    K+ T      V +VI+G+ I++F A P M N+   S +
Sbjct  377   KEYQAEDEAVLKMVQTNECLFTKLLTKRTFKAVTEVIIGILIVSFLAMPFMMNIELLSVS  436

Query  559   VGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLL  380
              GVP+F + F V+P+  N + A++A F   +  ++  S  FSEIY  VT++NL G+  +L
Sbjct  437   AGVPSFYVVFAVIPLARNLKNALSAHFCRKKDQARITSDIFSEIYRDVTLNNLLGITIIL  496

Query  379   AVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             A+VY R LTWDYS EVL++ ++ L IG  AY ++TY  W S+ AF LY FSL L Y+
Sbjct  497   AIVYLRGLTWDYSTEVLIIVIVGLIIGVPAYVRSTYPFWISVLAFALYVFSLVLIYL  553



>ref|XP_002992821.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
 gb|EFJ06111.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
Length=531

 Score =   218 bits (556),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 168/539 (31%), Positives = 279/539 (52%), Gaps = 48/539 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC+  + G +F ++++ +L+  A Q +S  S+ +   L  GI G  +  IL
Sbjct  4     SCEPNYGFLPCSTGVAGNIFLLIVYGFLLLKAAQFLSEGSELLLLVLNPGIIGGLLLPIL  63

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ + SG+F S+E   +QV  G+ + AG+TI  LT+LWG  +IVGR D   QE 
Sbjct  64    GALPDAILILVSGLFASEEEVLSQVLVGMGLLAGSTIMLLTLLWGSSLIVGRCD--LQEV  121

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +       ++    +   +++ G++TDA T  +A +ML++++P++L +L  ++      R
Sbjct  122   NGNLVAKDKTLTRKF--DVSKTGVTTDAQTKASAWIMLITVIPYILAQLPKIIRQPQLGR  179

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR--------------------FENL  1037
               ++++ +++   LLAY  YQI  P IQ+R +  +R                    + +L
Sbjct  180   FFIILSCVLSFGSLLAYCIYQITSPWIQQRRIALARQRFRLFHTLQKLSSYSKSKSWGDL  239

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL-RLIVTDE--VQRMVAVKTMMKDL  866
             +  +G  N   +   F  +D D +  ++  EL+  +  L +  E  + +   VK  M D 
Sbjct  240   VLPDGSTNTEALTKLFSYFDEDKSGHLTQHELKALIIGLGIGHESLLPKEEEVKAWMSDF  299

Query  865   DRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEND---DQEKSGEETNgaage  695
             DR  + +I+E EF++G                       +ND   D E    +T+  A  
Sbjct  300   DRSSDDKISESEFISGFTRW-------TKDLQQPKEEHRDNDNGWDTEAQSAQTSYMALM  352

Query  694   veqaggEKMG--------TWDFIVT--VLQVILGVAILTFCAQPLMTNVIQFSGAVGVPT  545
               Q GGE+          T + I+T  VL ++LG  I    A PL+ ++  FS A G+P+
Sbjct  353   DGQGGGEEKEEEESGESMTKNQIITKAVLLIVLGALIAGIFADPLVDSIENFSSATGIPS  412

Query  544   FIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYA  365
             F I+FV  P+  N   AI+++  A++K  +  SLT+S+IY GVTM+N   L   LAVV  
Sbjct  413   FFIAFVATPLATNSSEAISSVLFAAKKKKQNISLTYSQIYGGVTMNNTLCLGIFLAVVAY  472

Query  364   RELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
             R LTWD+S+EVLV+ +++L +G     +TT+ LWTS     LYP S+ +  +L  +LGW
Sbjct  473   RGLTWDFSSEVLVITLVALIMGIFGGTRTTFPLWTSFIPLALYPLSILVVALLDYVLGW  531



>ref|XP_010058975.1| PREDICTED: uncharacterized protein LOC104446873 [Eucalyptus grandis]
Length=507

 Score =   218 bits (554),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 166/492 (34%), Positives = 273/492 (55%), Gaps = 22/492 (4%)
 Frame = -1

Query  1609  SVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGI  1430
             ++A   +SS S+  F   GTGIFGA++F++L  FP++I+ ++S I +S +  ++    G+
Sbjct  20    ALAGHYLSSGSELFFRMFGTGIFGASLFQMLGTFPQVIIMLASAITSSSDTIESMAAMGM  79

Query  1429  RVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDAS  1250
              + AG+ IF+L+++WG  +  G RD ++    S S  S   F    L +L   G+ TD  
Sbjct  80    AMLAGSAIFSLSLVWGSIIAFGSRDSSSS---SSSSTSANQFTKK-LISLTGSGVETDTE  135

Query  1249  TSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQK  1070
             T + A +M +S++PF+++ L  +++S +G RIVVL++LIIT+ FL+ Y  YQ+  P IQ 
Sbjct  136   TRYIARIMFVSMIPFLILSLAKIINSTTGIRIVVLISLIITLIFLITYCTYQVFKPWIQS  195

Query  1069  RSLHYSR--------FENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVT  914
             + L Y R         E+LLT +GKPN  +I   F   D D + ++S  EL  F+  I  
Sbjct  196   KRLQYIRRLYDGDSILESLLTIDGKPNELQIIDLFQKIDQDKDSKVSKTELYAFMLGIQI  255

Query  913   DEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLL------annssadnaaaatpt  758
             +E           +MK  D   ++ I+E EF+ GI   L        N  A  ++++  +
Sbjct  256   EEAGLSTDDFTDAVMKKFDVSLDAAISESEFVQGISKWLDEDTDPTTNGLAVQSSSSESS  315

Query  757   stPENDDQEKSGEETNgaageveqaggEKMGTW-DFIVTVLQVILGVAILTFCAQPLMTN  581
              T  N  Q    E+ +  + +       K+  W ++      +ILG  ++    QPLM +
Sbjct  316   KTTSNKSQGTPDEQESLLSQDKTSKPTSKLAIWWNYTKAGFLIILGTGVMILIGQPLMES  375

Query  580   VIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNL  401
             + +F+ A  +P+F +S+V++P  ++ R  + AI  A +K+ K  S   +E+YNGV M+N+
Sbjct  376   LQEFATAADIPSFFVSYVLIPWAMSYRQILGAISSAKKKTKKDISGALTEVYNGVFMNNV  435

Query  400   TGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLA  221
              GL + LA+VY +++TWD SAEVLVV +I   +G +    T +Q W  I A+ LYP SL 
Sbjct  436   MGLATFLAIVYIKDITWDVSAEVLVVLLICTFMGVITSSCTKFQFWMGILAYALYPLSLL  495

Query  220   LFYVL-QLLGWN  188
               Y+L  +LGW+
Sbjct  496   FLYILTSVLGWS  507



>gb|EPS57671.1| hypothetical protein M569_17145, partial [Genlisea aurea]
Length=448

 Score =   216 bits (549),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 162/462 (35%), Positives = 241/462 (52%), Gaps = 45/462 (10%)
 Frame = -1

Query  1483  SGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSF  1304
             SG+  S+E AQ QV  GI + AG+T+  LTV+WG CV+VG+ D   Q   S     T+ F
Sbjct  2     SGLSGSKETAQKQVSVGIGLLAGSTVMLLTVIWGSCVVVGKCD--LQNNVSIDSQDTKCF  59

Query  1303  ASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitv  1124
             +          G+STD  TS+ A +M +S+VPFV+V+L  ++ S SG+ + VL+AL+++ 
Sbjct  60    SPT------GSGVSTDVWTSYAARIMAVSVVPFVVVQLPQILHSNSGRHLAVLIALVVSA  113

Query  1123  afllAYFGYQIIDPTIQKRSLHYSRFENLLTQ----------------NGKPNVSRIRLF  992
               L AY  YQ+  P IQ+R L Y+R +++++                 +G PN   +R  
Sbjct  114   LLLAAYCSYQVFQPWIQRRRLAYARHKHVVSGILKHFKMRSLGKLSDGSGNPNREVLRKL  173

Query  991   FHLYDSDNNQQMSSRELEKF-----LRLIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEF  827
             FH  D +++  +S  EL        L L+  D  +   AV  +++D D   ++R+   EF
Sbjct  174   FHTIDENDDGFLSHSELRALIAGIQLELVNLDYDE---AVSKVLQDFDSSRDNRVDLDEF  230

Query  826   LNGIENLLannssadnaaaatptstPENDD--------QEKSGEETNgaageveqaggEK  671
             + G+   L        AA +       +          Q   G E        +      
Sbjct  231   VAGVGKWLHEARGRGIAADSMAYIDEHHKKTRAQHDLLQGGGGAEQEDDEAAQDIENR--  288

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
                W  I   + ++LG AI    A PL+  V  FS A  +PTF ISFV LP+  N   A+
Sbjct  289   --RWVTIKAAIFLVLGTAIAAAFADPLVDAVDNFSSATKIPTFFISFVALPLATNSSEAV  346

Query  490   AAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVIS  311
             +AI  AS+K  ++ASLTFSE+Y   TM+N+  L   LA+VY R L W++S+EVLV+ ++ 
Sbjct  347   SAIIFASRKKMRSASLTFSELYGAATMNNVLCLSVFLALVYVRGLNWNFSSEVLVILIVC  406

Query  310   LTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             + IG    F+TT+ LW+   AFFLYPFSL L Y+L    GW+
Sbjct  407   IAIGVFGSFRTTFPLWSCSVAFFLYPFSLGLVYLLDYHFGWS  448



>ref|XP_006304623.1| hypothetical protein CARUB_v10011719mg [Capsella rubella]
 gb|EOA37521.1| hypothetical protein CARUB_v10011719mg [Capsella rubella]
Length=562

 Score =   217 bits (553),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 165/539 (31%), Positives = 278/539 (52%), Gaps = 54/539 (10%)
 Frame = -1

Query  1753  DQSSFLALGGPRL-sssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSS  1577
             +Q   ++L  P++  S +   C H YGF PCAEN+ GY FQ+  F  L+ V +  +S   
Sbjct  43    NQQEIISLEPPKINESLTREACVHLYGFLPCAENVIGYAFQVFSFGSLLIVGDYFLSKGR  102

Query  1576  KKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNL  1397
              ++ D    G++G  +F +L +FP I +T+ +G+  S E AQ+ +   +    G+++F L
Sbjct  103   AELLDIFEVGLYGGIIFPLLKIFPIIALTLVTGLSTSPEVAQSMIVDFVGATVGSSVFAL  162

Query  1396  TVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTL---NECGISTDASTSFTAGLM  1226
             T+ WG C+I G         D   Q        + L  +   +E  + TD+ T   A +M
Sbjct  163   TIQWGACIIFGTTGVLDTGGDQLVQKEKFLQIYDLLPIIFQSSESRVETDSRTKKGARIM  222

Query  1225  LLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF  1046
             LL+L+PF++V+L  + +S S +  +VL+ LI++ +  L      ++D + QK SL  +RF
Sbjct  223   LLTLIPFLIVQLSELFNSRSWRHNMVLMTLIVSSSATLLLLALLLLDTSGQKNSLDKARF  282

Query  1045  ENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE  908
             E +              + ++GK     ++  F  +D DN+ +M+  EL +F     T E
Sbjct  283   ELMSEVKKKLQRYSLKRILKDGKLTRESLKNLFDKFDKDNDGKMAISELNEF-----TLE  337

Query  907   VQRM--------VAVKTMMKDLDRDGNSRITEQEFLNGIENLLannss-adnaaaatpts  755
               ++           KT++K+ D+D +  + E+EF  GI   L    +     AAA    
Sbjct  338   FGKLGKLKCDMNALAKTVLKEFDKDDDGMVNEEEFAKGITKWLNERKTGLVPCAAAAVAP  397

Query  754   tPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVI  575
             + + ++Q+KS   T                    ++  ++VI G+ I+ F A+P M N+ 
Sbjct  398   SLKVEEQKKSVGYT--------------------LIATVKVITGILIVVFLAKPFMMNIS  437

Query  574   QFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTG  395
               S + G+P+F ++F V+P+  N + A++  F   ++  +AASLTFS+IY  VT++NL G
Sbjct  438   LLSASAGIPSFDVAFAVIPLSRNLKNALSLHFCVKKEKQEAASLTFSQIYRDVTLNNLMG  497

Query  394   LLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI--FAFFLYPFSL  224
             +  +LA+VYA+ LTW+ S EVL+V    L +G  A   +TY LW S   F F++ PF L
Sbjct  498   MSIILAIVYAKGLTWNCSTEVLIVVFFGLIVGVPASITSTYPLWASFVAFGFYIIPFIL  556



>ref|XP_002987555.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
 gb|EFJ11391.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
Length=531

 Score =   216 bits (551),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 166/539 (31%), Positives = 281/539 (52%), Gaps = 48/539 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC+  + G +F ++++ +L+  A Q +S  S+ +   L  GI G  +  IL
Sbjct  4     SCEPNYGFLPCSTGVAGNIFLLIVYGFLLLKAAQFLSEGSELLLLVLNPGIIGGLLLPIL  63

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ + SG+F S+    +QV  G+ + AG+TI  LT+LWG  +IVGR D   QE 
Sbjct  64    GALPDAILILVSGLFASEAEVLSQVLVGMGLLAGSTIMLLTLLWGSSLIVGRCD--LQEV  121

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +       ++    +   +++ G++TDA T  +A +ML++++P++L +L  ++      R
Sbjct  122   NGNLVAKDKTLTRKF--DVSKTGVTTDAQTKVSAWIMLITVIPYILAQLPKIIRQPQLGR  179

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR--------------------FENL  1037
               ++++ +++   LLAY  YQI+ P IQ+R +  +R                    + +L
Sbjct  180   FFIILSCVLSFGSLLAYCIYQIMSPWIQQRRIALARQRFRLFHTLQKLSSYSKSKSWGDL  239

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL-RLIVTDE--VQRMVAVKTMMKDL  866
             +  +G  N   +   F  +D D +  ++  EL+  +  L +  E  + +   +K  M D 
Sbjct  240   VLSDGSTNTEALTKLFSYFDEDKSGHLTQHELKALIIGLGIGHESLLPKEEELKAWMSDF  299

Query  865   DRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEND---DQEKSGEETNgaage  695
             DR  + +I+E EF++G    + +                +ND   D E    +T+  A  
Sbjct  300   DRSSDDKISESEFISGFTRWIKDLQQPKEEHR-------DNDNGWDTEAQSAQTSYMALM  352

Query  694   veqaggEKMG--------TWDFIVT--VLQVILGVAILTFCAQPLMTNVIQFSGAVGVPT  545
               Q GGE+          T + I+T  VL ++LG  I    A PL+ ++  FS A G+P+
Sbjct  353   DGQGGGEEKEEEESGESMTKNQIITKAVLLIVLGALIAGIFADPLVDSIENFSSATGIPS  412

Query  544   FIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYA  365
             F I+FV  P+  N   AI+++  A++K  +  SLT+S+IY GVTM+N   L   LAVV  
Sbjct  413   FFIAFVATPLATNSSEAISSVLFAAKKKKQNISLTYSQIYGGVTMNNTLCLGIFLAVVAY  472

Query  364   RELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGW  191
             R LTWD+S+EVLV+ +++L +G     +TT+ LWTS     LYP S+ +  +L  +LGW
Sbjct  473   RGLTWDFSSEVLVITLVALIMGIFGGTRTTFPLWTSFIPLALYPLSILVVALLDYVLGW  531



>gb|ACN27225.1| unknown [Zea mays]
Length=487

 Score =   214 bits (545),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 153/456 (34%), Positives = 242/456 (53%), Gaps = 26/456 (6%)
 Frame = -1

Query  1498  IMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQP  1319
             ++ + SG+  S+E AQ+QV  G+ + AG+T+F LT+LWG CV+VG+ D     +++    
Sbjct  39    LLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPG-REAVDVT  97

Query  1318  STQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlva  1139
              T+ F      +L   G++TD  TS+ A +M LS++PF++ +   ++ +  GQR+ +L+A
Sbjct  98    DTKGF------SLTGTGVTTDVQTSYAARIMGLSVIPFIIAQFPKMLKTHHGQRLAMLLA  151

Query  1138  liitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPNVS  1007
             L+++ A +LAY  YQ+  P IQ+R L Y++ ++                LL  +G PN  
Sbjct  152   LVVSFALVLAYCLYQVFQPWIQRRKLAYAKHKHVISGILRHAQMQSLGRLLNDDGTPNEQ  211

Query  1006  RIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQ  833
              IR  F   D D ++ +S  EL   +  I  +EV   R  AV  +M D D   N  + E+
Sbjct  212   VIRKLFRKIDMDESRSLSRAELHALIVGINFEEVDFDRTDAVDKVMDDFDTSRNDVVEEE  271

Query  832   EFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDF  653
             EF+ G+   L     +     A  +       +    E         E     +   W  
Sbjct  272   EFVQGMRKWLDEARRSVPVGGAFSSKFIHEYHERTRQEHDELVDRSDEAVESVENPGWCI  331

Query  652   IVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPA  473
                V  ++LG A     A PL+  V  FS A  +P+F ISF+ LP+  N   A++AI  A
Sbjct  332   AKAVALLLLGSAAAAAFADPLVDAVHGFSNATRIPSFFISFIALPLATNSSEAVSAIIFA  391

Query  472   SQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFL  293
             S+K  +  SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ + +   
Sbjct  392   SRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVCVVMALF  451

Query  292   AYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
               F+TT+ LWT + A+ LYP SL + Y+L  + GW+
Sbjct  452   TSFRTTFPLWTCLVAYMLYPLSLIIVYILDYVFGWS  487



>ref|XP_010052488.1| PREDICTED: uncharacterized protein LOC104441166 isoform X2 [Eucalyptus 
grandis]
Length=491

 Score =   214 bits (545),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 166/494 (34%), Positives = 255/494 (52%), Gaps = 33/494 (7%)
 Frame = -1

Query  1612  MSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFG  1433
             M +A +L+S  S+ +   LG GI G     +L   P   + ++SG+  S E AQ+QV  G
Sbjct  1     MFLAAKLLSDGSEILLQILGPGIIGGLFLPVLSSLPDATIILASGVSGSAEDAQSQVSVG  60

Query  1432  IRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDA  1253
             + + AG+T+  LTVLWG C+IVG+ D   +   +  Q  T+ F      +L   G+STD 
Sbjct  61    MGLLAGSTVMLLTVLWGTCIIVGKCD--IENSTTMDQKDTKKF------SLAGSGVSTDI  112

Query  1252  STSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQ  1073
              TS+ A +M++S++PF++V+L  +  ++S  R  VLV+ I+++  LL+Y  YQI  P IQ
Sbjct  113   WTSYAARIMMISIIPFIIVQLPEIFGASSLSRAAVLVSFIVSICLLLSYCLYQIFQPRIQ  172

Query  1072  KRSLHYSRFE----------------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSREL  941
             KR + Y+  +                 L+T  GKPN   I   F   D D+N  +S  EL
Sbjct  173   KRRIAYAMHKRIISGLLQQLKARTLGKLVTDEGKPNTVVIEKLFETLDVDSNGNLSPAEL  232

Query  940   EKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaa  767
                +  I  +EV   +  AV  +++D D   +S++   EF+ GI   L         A  
Sbjct  233   RALIIGIHFEEVDINMDDAVHKVIEDFDTSRDSKLDSAEFIEGISKWLKRARRTAAGAHV  292

Query  766   tptstPEN------DDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTF  605
                 +         D++ +   +      +  +    K   W+    +L ++LG AI   
Sbjct  293   QDDISLTTRLLDSFDERTEQQLDQLVDQEDELEVDDVKNVKWNTAKAILMLLLGTAIAAI  352

Query  604   CAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIY  425
              A PL+  V  FS A  +P+F +SFV+LP   +  +    +F +S+K  +  SLT+SEIY
Sbjct  353   TADPLVDAVDNFSTATSIPSFFVSFVILPFACSSEVVSCLMF-SSRKKKRTTSLTYSEIY  411

Query  424   NGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAF  245
               VTM N+  L   L +VY R+LTWD+ +EVLV  ++ L +G +A F+TT+ LW S  A 
Sbjct  412   GSVTMGNVLSLAVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLAL  471

Query  244   FLYPFSLALFYVLQ  203
              LYP SL L YVL 
Sbjct  472   ALYPLSLLLVYVLD  485



>gb|EYU43358.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=559

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 158/515 (31%), Positives = 267/515 (52%), Gaps = 33/515 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  YGF PC+ N+ G LF IV+++ L+S+  Q V + S   F   G G+FG ++F++L
Sbjct  66    TCDPIYGFLPCSTNLWGLLFLIVVYEILLSIGGQYVVNGSTLFFQITGPGVFGGSLFQLL  125

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P+++M + S +  +   AQ +   G+ + AG T+  LT++WG  VI+G  D +    
Sbjct  126   GTIPQVVMVLVSALSGTIAAAQQRATLGMGLVAGTTVMLLTLIWGTSVILGSSDLSQSST  185

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              + +  +  S            G+ TD  TS+ A +ML+SL+PF+++    + +S++G+R
Sbjct  186   TTATTTTDSS------------GVVTDVETSYIARIMLISLIPFLVLVFALIFNSSTGKR  233

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-------SRFENLLTQNGKPNVSRIR  998
             + +L+ALI++V  L+AY  YQI  P IQ R   +        +   L+T NGK + ++I 
Sbjct  234   VTILIALIVSVTLLIAYIIYQIFQPWIQNRCFQFVVTKYGQDKLLTLITTNGKTDPNKIL  293

Query  997   LFFHLYDSDNNQQMSSRELEKFL---RLIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEF  827
             + F+  + + +  +S+ E+   L   ++ + D+      V  +M   D   +  I + EF
Sbjct  294   VLFNKINKNADATVSTAEVRGLLLGVKMDINDDKSTERDVGMIMASFDTSSDGVINQDEF  353

Query  826   LNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DFI  650
              NG+  L+     +D +   +   T  N      G      +     +      +W +++
Sbjct  354   TNGMTKLV-----SDLSNQTSSQITTTNGTTNSQG----LISTSTSTSQTAPTNSWSNYL  404

Query  649   VTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPAS  470
                  VI G+ IL   ++PL+ +V+ FS A    TF +S++ +P  +N  +AI +I  A 
Sbjct  405   RAGFFVIFGILILCAFSEPLIRSVVDFSIAANFSTFSVSYLAIPFAMNYGVAIQSIASAR  464

Query  469   QKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLA  290
             QK+  + SLT S +Y GV M+N+ GL+  LA VY R L+ +  AEVL+V +I   +    
Sbjct  465   QKTQISISLTLSSLYAGVYMNNIIGLIVFLAPVYVRNLSTNVCAEVLLVLIICTVMSVFT  524

Query  289   YFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
                TT+  W       LYP SLA  Y+L  +LGW+
Sbjct  525   SIYTTFPRWIGYILVSLYPISLATVYILTTVLGWS  559



>gb|KCW74041.1| hypothetical protein EUGRSUZ_E02665 [Eucalyptus grandis]
Length=472

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 160/474 (34%), Positives = 265/474 (56%), Gaps = 22/474 (5%)
 Frame = -1

Query  1555  GTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLC  1376
             GTGIFGA++F++L  FP++I+ ++S I +S +  ++    G+ + AG+ IF+L+++WG  
Sbjct  3     GTGIFGASLFQMLGTFPQVIIMLASAITSSSDTIESMAAMGMAMLAGSAIFSLSLVWGSI  62

Query  1375  VIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlv  1196
             +  G RD ++    S S  S   F    L +L   G+ TD  T + A +M +S++PF+++
Sbjct  63    IAFGSRDSSSS---SSSSTSANQFTKK-LISLTGSGVETDTETRYIARIMFVSMIPFLIL  118

Query  1195  elvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR--------FEN  1040
              L  +++S +G RIVVL++LIIT+ FL+ Y  YQ+  P IQ + L Y R         E+
Sbjct  119   SLAKIINSTTGIRIVVLISLIITLIFLITYCTYQVFKPWIQSKRLQYIRRLYDGDSILES  178

Query  1039  LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA--VKTMMKDL  866
             LLT +GKPN  +I   F   D D + ++S  EL  F+  I  +E           +MK  
Sbjct  179   LLTIDGKPNELQIIDLFQKIDQDKDSKVSKTELYAFMLGIQIEEAGLSTDDFTDAVMKKF  238

Query  865   DRDGNSRITEQEFLNGIENLLanns------sadnaaaatptstPENDDQEKSGEETNga  704
             D   ++ I+E EF+ GI   L  ++       A  ++++  + T  N  Q    E+ +  
Sbjct  239   DVSLDAAISESEFVQGISKWLDEDTDPTTNGLAVQSSSSESSKTTSNKSQGTPDEQESLL  298

Query  703   ageveqaggEKMGTW-DFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFV  527
             + +       K+  W ++      +ILG  ++    QPLM ++ +F+ A  +P+F +S+V
Sbjct  299   SQDKTSKPTSKLAIWWNYTKAGFLIILGTGVMILIGQPLMESLQEFATAADIPSFFVSYV  358

Query  526   VLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWD  347
             ++P  ++ R  + AI  A +K+ K  S   +E+YNGV M+N+ GL + LA+VY +++TWD
Sbjct  359   LIPWAMSYRQILGAISSAKKKTKKDISGALTEVYNGVFMNNVMGLATFLAIVYIKDITWD  418

Query  346   YSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
              SAEVLVV +I   +G +    T +Q W  I A+ LYP SL   Y+L  +LGW+
Sbjct  419   VSAEVLVVLLICTFMGVITSSCTKFQFWMGILAYALYPLSLLFLYILTSVLGWS  472



>gb|KFK23895.1| hypothetical protein AALP_AAs69390U000300 [Arabis alpina]
Length=570

 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 168/531 (32%), Positives = 275/531 (52%), Gaps = 35/531 (7%)
 Frame = -1

Query  1741  FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFD  1562
             FL L  P+  + S + C H YGF PC++N+ GY+FQ+  F  L+ + +  +S    K+F 
Sbjct  48    FLTLSPPK--NLSGTACVHVYGFLPCSDNVRGYVFQVFSFGCLLIIGDYFLSEGRSKLFV  105

Query  1561  TLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWG  1382
                 G +G  VF +L +FPRI + +S+G+  S + A + +   + +  G T+F LT+ WG
Sbjct  106   IFEVGFYGGIVFPLLTMFPRIALMLSTGLSLSSDVANSFIGENVAITVGYTVFALTIQWG  165

Query  1381  LCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfv  1202
              CV+      +  +  S  +P+T + +   +K+L E  +  D     +AG+MLLSL PF+
Sbjct  166   ACVVFSMTGPSFDQ--SVRRPTTDARSQKIVKSLVEASVEADPKNKKSAGIMLLSLAPFL  223

Query  1201  lvelvnvVSSAS-GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----  1037
             LV L  +  S S    I+VL+ LII+ +  + YF Y   D + Q++SL  +RFE +    
Sbjct  224   LVTLSVIFESHSLSHNIIVLITLIISSSSTVVYFLYSYFDTSNQEKSLDQARFELMSEVH  283

Query  1036  ----------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA-  890
                       L ++G+ N   ++  F   D++N+ ++   EL+     I      RM   
Sbjct  284   KHLQRFSPKNLVKDGELNKESLKRLFEKTDTNNDGKIQISELKDLT--IEFWNFGRMKCD  341

Query  889   ----VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSG  722
                  K  ++D D D +  + E+EF  GI  LL     + +          + D +E   
Sbjct  342   INELAKDFLEDFDGDKDGELEEKEFEEGIARLLKQYKFSFDN---------QEDQRESQN  392

Query  721   EETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTF  542
             EE        ++    K+ +   +   ++VI+G+ I+ F A+P M N+   S + G+P+F
Sbjct  393   EEGVLKMEIPKRTLVTKLLSVKTLGAAIEVIVGILIVLFLAKPFMLNIELLSISAGIPSF  452

Query  541   IISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAR  362
              I F ++P+  N +  ++  F   +   + +S TFSEIY  VTM+NL G+  +LA+VY R
Sbjct  453   YIVFTMIPLGRNLKNTLSTRFCRGKDKKRISSNTFSEIYKDVTMNNLMGISIILAIVYMR  512

Query  361   ELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
              LTW YS E L++ +I L IG   Y ++TY  W S+ AF +Y FSL L Y+
Sbjct  513   GLTWSYSMETLILVIIGLIIGLPVYMRSTYPFWISVLAFAMYFFSLLLIYL  563



>ref|XP_002522156.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40235.1| calcium ion binding protein, putative [Ricinus communis]
Length=588

 Score =   213 bits (543),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 160/524 (31%), Positives = 258/524 (49%), Gaps = 35/524 (7%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC+    G L  I+ + Y M +A   +S  S+ + + LG GI G  +  +L     
Sbjct  74    YGFMPCSTTAMGNLLLIIGYGYAMFLAATYLSKGSEMLHEILGPGIVGGLLLPVLCALSD  133

Query  1501  IIMTISSG---IFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDS  1331
              ++ +       F S+  AQ ++  G+ + AG+T   LT++WG C+  G+ D    +  +
Sbjct  134   AVIVLGKLEYLDFGSKAVAQKEISVGMGLLAGSTALLLTLVWGSCIFFGKCDIRKIDSLA  193

Query  1330  QSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRiv  1151
                  T+ F       L   G+STD  T + A +M +S++P ++V+    ++S + + + 
Sbjct  194   IDGHGTKGF------NLTGTGVSTDIWTCYGARIMTVSVIPIIVVQSSEFLNSTAERHLA  247

Query  1150  vlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF----------------ENLLTQNGK  1019
             +L++ +I++  L++Y  YQ+  P IQ+R L Y++                 E LLT +G+
Sbjct  248   ILISFVISLVMLISYCSYQVFRPWIQRRRLAYAKHNHVISGMLKHFKDTASERLLTDDGE  307

Query  1018  PNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSR  845
             P    I+  F   D + +  +S  EL+  +  I  +E+Q  R  A K +MK+ D   ++ 
Sbjct  308   PKKEVIKKLFQDIDQNGDNFLSVSELKALIIGICFEEIQFDRDDAAKKIMKEFDTSKDNH  367

Query  844   ITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEK--  671
             I   EF NGI         A  +  +    +  ND    + +E      E +     +  
Sbjct  368   IDITEFENGIVKWHNEAKQAAISTNSGDHHSLINDFHRHTKKEHALLGPEAQSDEEVEGV  427

Query  670   --MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRM  497
               +G W  I  +L    G  +L   A PL+  V  FS A  VP+F ISFV LP + N   
Sbjct  428   ENLGRWKSIAMLLW---GAFLLAVSADPLVDAVKNFSKATTVPSFFISFVTLPFITNSGE  484

Query  496   AIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFV  317
             A +AI   S K  + ASLT SE+Y  +T+  L  L   L ++Y R L WD+ ++ +V+ +
Sbjct  485   AFSAITFISHKKMRTASLTLSELYGKITVKILLCLSVFLGLIYFRGLKWDFMSKAMVLLI  544

Query  316   ISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             +   +G  A F+TT+ LWTS  A  LYPFSLAL YVL  + GW+
Sbjct  545   VCTVMGAFASFQTTFPLWTSSLACLLYPFSLALVYVLDHVYGWS  588



>ref|XP_010058973.1| PREDICTED: uncharacterized protein LOC104446871 [Eucalyptus grandis]
Length=542

 Score =   211 bits (536),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 152/517 (29%), Positives = 272/517 (53%), Gaps = 41/517 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  Y F PC   + G +F IV++++L+  A   V+S S+      GTGIF +++F+IL
Sbjct  53    TCDLTYSFLPCTTELLGEIFLIVVYEFLLGYAANCVNSGSELFLRMFGTGIFSSSLFQIL  112

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P +I+ + S I +S E  +     G+ +  G+ +++LT++WG  V  G         
Sbjct  113   GSLPSVIIMLVSSISSSVETVETTAAMGMAMLTGSAVYSLTIVWGSVVAFGS--------  164

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
                                +  GI TD  T   A +M +S++PF++++L  +++S +G +
Sbjct  165   -------------------HSSGIETDTETKKIASIMFVSMIPFLILQLAKIINSTTGTK  205

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRI  1001
             +VV + L +TV  L+A +   +  P IQ++S  Y        S+F +L   +GK + SRI
Sbjct  206   VVVSITLGVTVILLIADYTLLVFRPWIQEKSFAYITSKYSGNSKFLSLCIVDGKTSESRI  265

Query  1000  RLFFHLYDSDNNQQMSSRELEKFLR-LIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEFL  824
             +  F   + +N+ Q+S  EL  FL  L    +V        MM  LD   ++ ++E EF+
Sbjct  266   KEVFRKINQNNDSQVSKAELYSFLLGLQEGADVSTDDYAVAMMTKLDDSHDASLSEMEFV  325

Query  823   NGIENLLan-nssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMG---TWD  656
              GI   L     ++++ A     S  ++++   + EE      + +     +     +W+
Sbjct  326   QGITKWLNQGTLASNSHAQDLAKSRSQSNNSTGAIEEQERLLSQQDTTSKPRSALAISWN  385

Query  655   FIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFP  476
             +      ++LG  ++     PLM +    +  + +P+F++S+V+LP+ ++ + A+ AI  
Sbjct  386   YAKASFLIVLGTTMMVILGSPLMQSFQDVASDLNMPSFLVSYVMLPLAMSYKQALGAITS  445

Query  475   ASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGF  296
             A +K+ K  S   SE+Y GV ++NL GL++ L ++  ++++W+ SAEVLVV +I   +G 
Sbjct  446   ARKKTLKDISGPMSEVYRGVFLNNLMGLVTFLLLLLIKDISWNVSAEVLVVLLICSFMGV  505

Query  295   LAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             L   +T + LWT++ A+ LYPFS+ L YVL  +LGW+
Sbjct  506   LTSLRTQFPLWTAVLAYSLYPFSILLLYVLTSVLGWS  542



>gb|KCW74040.1| hypothetical protein EUGRSUZ_E02663 [Eucalyptus grandis]
Length=567

 Score =   210 bits (535),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 156/519 (30%), Positives = 279/519 (54%), Gaps = 20/519 (4%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  Y F PC   + G +F IV++++L+  A   V+S S+      GTGIF +++F+IL
Sbjct  53    TCDLTYSFLPCTTELLGEIFLIVVYEFLLGYAANCVNSGSELFLRMFGTGIFSSSLFQIL  112

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P +I+ + S I +S E  +     G+ +  G+ +++LT++WG  V  G    +    
Sbjct  113   GSLPSVIIMLVSSISSSVETVETTAAMGMAMLTGSAVYSLTIVWGSVVAFGSHSISKTSS  172

Query  1336  DSQS--QPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
              S +    S  S  S  + +    GI TD  T   A +M +S++PF++++L  +++S +G
Sbjct  173   SSITFYIYSGHSLPSGIVGS----GIETDTETKKIASIMFVSMIPFLILQLAKIINSTTG  228

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY--------SRFENLLTQNGKPNVS  1007
              ++VV + L +TV  L+A +   +  P IQ++S  Y        S+F +L   +GK + S
Sbjct  229   TKVVVSITLGVTVILLIADYTLLVFRPWIQEKSFAYITSKYSGNSKFLSLCIVDGKTSES  288

Query  1006  RIRLFFHLYDSDNNQQMSSRELEKFLR-LIVTDEVQRMVAVKTMMKDLDRDGNSRITEQE  830
             RI+  F   + +N+ Q+S  EL  FL  L    +V        MM  LD   ++ ++E E
Sbjct  289   RIKEVFRKINQNNDSQVSKAELYSFLLGLQEGADVSTDDYAVAMMTKLDDSHDASLSEME  348

Query  829   FLNGIENLLan-nssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMG---T  662
             F+ GI   L     ++++ A     S  ++++   + EE      + +     +     +
Sbjct  349   FVQGITKWLNQGTLASNSHAQDLAKSRSQSNNSTGAIEEQERLLSQQDTTSKPRSALAIS  408

Query  661   WDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAI  482
             W++      ++LG  ++     PLM +    +  + +P+F++S+V+LP+ ++ + A+ AI
Sbjct  409   WNYAKASFLIVLGTTMMVILGSPLMQSFQDVASDLNMPSFLVSYVMLPLAMSYKQALGAI  468

Query  481   FPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTI  302
               A +K+ K  S   SE+Y GV ++NL GL++ L ++  ++++W+ SAEVLVV +I   +
Sbjct  469   TSARKKTLKDISGPMSEVYRGVFLNNLMGLVTFLLLLLIKDISWNVSAEVLVVLLICSFM  528

Query  301   GFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             G L   +T + LWT++ A+ LYPFS+ L YVL  +LGW+
Sbjct  529   GVLTSLRTQFPLWTAVLAYSLYPFSILLLYVLTSVLGWS  567



>ref|XP_011027726.1| PREDICTED: uncharacterized protein LOC105127946 isoform X2 [Populus 
euphratica]
Length=507

 Score =   208 bits (530),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 166/493 (34%), Positives = 260/493 (53%), Gaps = 28/493 (6%)
 Frame = -1

Query  1624  FQYLMS----VAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEG  1457
             F YL+S      ++ +SS S   F   GTGIFG +VF +L  FP+I++ + + +  S++ 
Sbjct  27    FSYLISDGLDKKDKYISSGSNLFFQMFGTGIFGGSVFYVLGKFPQIVLVLVTLLSASEDV  86

Query  1456  AQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLN  1277
               + V   +   AG+T+ +LT++WG  +  G  D        Q  PS+ +  +  L   N
Sbjct  87    VGSAVSMSMGFLAGSTMMSLTIIWGSVIAFGSYDL-------QQTPSS-NLENKMLCLSN  138

Query  1276  ECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGY  1097
               G+ TD  T +TA ++LLS++P++++EL  VV+S+S  R  VL+ALIITV  L+ Y  +
Sbjct  139   GYGVKTDIVTKYTARIILLSMIPYLILELSKVVNSSSATRAAVLIALIITVILLVTYCTF  198

Query  1096  QIIDPTIQKRSLHY--------SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSREL  941
             Q+  P IQ R+L Y        +  ++L    G+P   +IR  F   D + N Q+S  E+
Sbjct  199   QVFQPWIQDRTLEYLILSYVKKNLLQSLCNPYGRPIEFKIRQLFRKIDLNKNGQISEDEV  258

Query  940   EKFLRLIVTDEVQRM--VAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaa  767
               FL  I    V  +    V  +M + D  G+  I+++EF+ GI   L   +  +N    
Sbjct  259   RAFLVGIEAGVVGLIGDHCVSKVMAEFDFSGDHGISKEEFIRGISKWLDEANGVENNGNQ  318

Query  766   tptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLM  587
             T      N +   S EE      E + +       W++      ++LG AI    A+PL 
Sbjct  319   TELF---NSNLPGSREEQQIWEAEQQDSKNSD--EWNYSKATYFILLGTAIAVLLAKPLT  373

Query  586   TNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMS  407
               + + + A+ VP+F++S+ ++P  +N R    +I   S K  K+ SLT S+IY GV M+
Sbjct  374   KTLQELATAIKVPSFLVSYFLVPFALNFRQGYKSIISVSDKKEKSVSLTLSQIYCGVFMN  433

Query  406   NLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFS  227
             N+ GL S L +VY RE+ WD +AE+LVV VI   IG  + F + +  WT + A+ LYP S
Sbjct  434   NVLGLTSFLTIVYIREVEWDITAEILVVLVICSGIGLSSSFSSKFPFWTCLVAYALYPIS  493

Query  226   LALFYVLQL-LGW  191
             L   YVL + LGW
Sbjct  494   LGFLYVLTISLGW  506



>gb|KCW67437.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=429

 Score =   204 bits (520),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 156/439 (36%), Positives = 239/439 (54%), Gaps = 42/439 (10%)
 Frame = -1

Query  1420  AGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSF  1241
             AG+T+  LTV+WG C+IVG+ D       +  +  T+ F      +L   G+STD  T +
Sbjct  5     AGSTVMLLTVIWGSCIIVGKCD--LHNSVAMDKQDTKGF------SLKGSGVSTDLWTKY  56

Query  1240  TAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSL  1061
              A +M+ S++PF++V+L  +++S SG+ + VL++LI+++  L+AY  YQ++ P IQ+R L
Sbjct  57    AARIMVFSVIPFIIVQLPQILNSTSGRHLAVLISLIVSLILLIAYCIYQVVQPWIQRRRL  116

Query  1060  HYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL  929
              Y   ++                LLT +GK +       F   D + +  +++ EL+  +
Sbjct  117   AYVEDKHVFFGFLRHIRTHPLGRLLTDDGKLDKDFAEKLFTTLDENGDGYLNAAELKALV  176

Query  928   RLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatpts  755
               +  +E+      AV  +MKD D   +  +   EFL+GI   ++   S+ +      T 
Sbjct  177   VGMQFEEIDLNEDGAVDRIMKDFDSSNDCLLELPEFLDGISKWVSRARSSASGIKNFGTG  236

Query  754   tPENDD---------QEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFC  602
                +D          Q KSG++T+     V      K+ T   +  VL ++LG  I    
Sbjct  237   KFLDDAHHQTTQEHAQLKSGDQTDEVTEGVGNP---KLTT---LKAVLLLVLGTIIAGAF  290

Query  601   AQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYN  422
             A PL+  V  FS A G+PTF ISF+ LP+  N   A++AI  AS+K  + ASLTFSE+Y 
Sbjct  291   ADPLVDAVDNFSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYG  350

Query  421   GVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFF  242
              VTM+NL  L   LA+VY R LTWD+S+EVLV+ ++   +G  A F+TT+ LWT   A  
Sbjct  351   AVTMNNLLCLSVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALL  410

Query  241   LYPFSLALFYVLQ-LLGWN  188
             LYPFSLAL YVL  + GW+
Sbjct  411   LYPFSLALVYVLDYIFGWS  429



>ref|XP_006340117.1| PREDICTED: uncharacterized protein LOC102587762 [Solanum tuberosum]
Length=703

 Score =   210 bits (534),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 162/290 (56%), Gaps = 19/290 (7%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMK  872
             E L   +G PN+  I+  FH  D D+N  +   ELEK    +   + +     +VK +MK
Sbjct  424   EGLRNDDGSPNIESIKRLFHKLDDDHNSYLIPSELEKLTENVKFRQARLNHKTSVKEIMK  483

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
             D D++ +  I E EFL G+   L N                E+ D+   GE         
Sbjct  484   DFDQNDDHMIDENEFLRGVTYWLRNAKQTTK----------EHHDKVMWGEVEKFLDEAE  533

Query  691   eqag----gEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVV  524
                        +  WD   +VLQVILG+AILT CA P+M N+IQ + A+GVP+F +SFV+
Sbjct  534   RGNHRCFNHSLVLKWDICKSVLQVILGIAILTLCADPIMDNIIQLASAIGVPSFFLSFVI  593

Query  523   LPIVINGRMAIAAIF---PASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELT  353
             +P+ IN R AI AI     A+Q+S   +SLTFSEIY GV M+N+ G+ ++L V+YA++L 
Sbjct  594   VPLAINARTAITAITLLSSANQQSCTTSSLTFSEIYVGVIMNNIMGMSTVLTVLYAKDLR  653

Query  352   WDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             W+YS EVLV  VI    G  A+ +TTY LWT I AF  YP +LAL Y+LQ
Sbjct  654   WEYSPEVLVSMVICAVNGSFAFTRTTYPLWTCIVAFLFYPIALALLYILQ  703


 Score =   204 bits (519),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 127/334 (38%), Positives = 209/334 (63%), Gaps = 23/334 (7%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QS++L+LG  +    S   C+H YGFFPCAENI GYLF IV FQYL+ + E++++  S 
Sbjct  47    NQSNYLSLGNLK-ELPSGDQCNHIYGFFPCAENIGGYLFMIVTFQYLLILGEKVLAIGSN  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             ++F  L TGIFGA++F  L+ +PRI+M  +SG+  ++E AQ  V   +  N G+++ NLT
Sbjct  106   RLFSILDTGIFGASIFPTLITWPRIVMAFASGLLVTREKAQVSVSSALGSNVGSSVLNLT  165

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSl  1214
             VLWG+CVI+GR++ +T    ++S  ST       L+ L   G+ T+  T + AG+M LSL
Sbjct  166   VLWGICVILGRQNTSTNSNSAESSTSTLK-----LEDLKGRGVVTNNLTGYIAGIMFLSL  220

Query  1213  vpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL-  1037
              PF ++   +++SS+ G+RI +LVALI++V FLL+YF YQ+ +P IQ++SL Y + +NL 
Sbjct  221   APFTIMLFSDIISSSVGKRITILVALIVSVTFLLSYFTYQMWNPLIQQKSLEYIKHQNLV  280

Query  1036  --------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ-  902
                           L + G P+++ ++  F   D D +  ++  ELE+ ++ + + +V+ 
Sbjct  281   QVFVQHIQRQARGNLFKGGHPDINALKRLFAKTDRDRSHSITVTELEELVKQLESGKVKV  340

Query  901   -RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLL  803
                 A+ T+ +  D++ + RI E+EF+ G + L+
Sbjct  341   DSDFALSTLSRIFDQNRDGRINEEEFIEGSKKLI  374



>ref|XP_009629500.1| PREDICTED: uncharacterized protein LOC104119642 [Nicotiana tomentosiformis]
Length=704

 Score =   208 bits (529),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/334 (39%), Positives = 208/334 (62%), Gaps = 20/334 (6%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QS +L+ G  +   +S   C H YGFFPC ENI GY+F IVIFQYL+ + E++ S  S 
Sbjct  44    NQSEYLSPGSSKALITSGDECKHIYGFFPCVENIGGYIFMIVIFQYLLILGEKVQSIGSN  103

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             ++F  L TGIFGA++F  L+ +PRI+M   SG+  S+E AQ  V   +  N G+++ NLT
Sbjct  104   RLFSILDTGIFGASIFPALITWPRIVMAFVSGLLVSREQAQVSVSSALGSNVGSSVLNLT  163

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSl  1214
             VLWG+CVI+GR++ +    +S +Q +  S ++  +K L   GI T+  T + AG+M LSL
Sbjct  164   VLWGICVILGRQNISG---NSNTQSADSSSSTLKMKDLKRTGIITNDLTGYIAGVMFLSL  220

Query  1213  vpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL-  1037
              PF+++  V+++SS+ G+RI VLVALI++V  LL+YF YQ+ +P IQ++ L Y + ENL 
Sbjct  221   APFIIMLFVDIISSSVGKRITVLVALIVSVTLLLSYFAYQMWNPLIQEKCLEYIKHENLV  280

Query  1036  --------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ-  902
                           L + G+P+++ ++  F   D D +  ++  ELE+ +  + + +V+ 
Sbjct  281   KVFVEHIQRQARGNLFKGGRPDINALKGLFIKADKDRSNSITLTELEELVNQLESGKVKV  340

Query  901   -RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLL  803
                 A+ T+ +  D++G+ RI E+EF+ G + L+
Sbjct  341   DSNFALSTLSRIFDKNGDERINEEEFIEGCKKLI  374


 Score =   183 bits (464),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 105/286 (37%), Positives = 158/286 (55%), Gaps = 11/286 (4%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMK  872
             E LL  +G PN+  I+  F   D D N  ++  ELEK    +   EV      +++ ++K
Sbjct  425   EGLLKDDGSPNIEAIKRLFQKLDDDQNSYLTPSELEKLTENVKIREVHLDHQGSIEEIIK  484

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
             D D++ +++I E EFL+G++  L N                 +   +++  E +      
Sbjct  485   DFDQNKDNKIDENEFLDGVKYWLRNAKRTTEELQDKMIWGEVDKFLDEAKREKHKRFDYS  544

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
                 G       F  +VLQVILG AILT CA PLM N+I+ + A+G P+F +SFV++P+ 
Sbjct  545   LVLKGA------FCKSVLQVILGTAILTLCADPLMDNIIRLANAIGTPSFFLSFVIVPLA  598

Query  511   INGRMAIAAIFPASQKSSKAASLT---FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             IN R AI AI   S  S ++++ +   FSEIY  V ++N+ G+ ++L V+YA++LTW+YS
Sbjct  599   INARTAITAITLLSSTSQQSSTTSSLTFSEIYVRVILNNIMGMSTVLFVLYAKDLTWEYS  658

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
              EVL   V+    G  A+ +TTY LWT I AF LYP SL L Y+  
Sbjct  659   VEVLTSMVVCAVTGLFAFVRTTYPLWTCIIAFLLYPISLVLLYLFH  704



>ref|XP_001762095.1| predicted protein [Physcomitrella patens]
 gb|EDQ73199.1| predicted protein [Physcomitrella patens]
Length=573

 Score =   206 bits (523),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 151/532 (28%), Positives = 259/532 (49%), Gaps = 37/532 (7%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YG  PC+ ++ G    +VI+ Y+M  A QL+S  S+ +   +  GI G  +  I 
Sbjct  50    TCEEKYGVMPCSVSLGGNAALLVIYGYMMLQAAQLLSDGSELLLTVMSPGIIGGLLLPIF  109

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
               FP  ++   SG   +   AQ +VF G+ + AG+++  LT LWG C+IVGR D      
Sbjct  110   GAFPDALLITVSGFGANLAEAQEKVFVGMGLLAGSSVMLLTALWGSCLIVGRCDLVPHFA  169

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +S+     ++    +   L E G++TD  T + + +M+ +L+P+++ ++  ++   +   
Sbjct  170   NSKLVAKDRTLTKGF--HLTETGVTTDQQTKWASWIMMATLLPYIVAQIPRLLDWNAEGH  227

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSL--------------------HYSRFENL  1037
             + V +A +I V  L +Y GYQ++ P IQ+R +                    H   + +L
Sbjct  228   VFVAIAAVIAVIGLFSYCGYQLMAPRIQERRIAWAKHRYMRNHALHKVSHLSHEQNWGSL  287

Query  1036  LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--------VTDEVQRMVAVKT  881
              T N +PN   +   F  +D DN++ ++  EL   +  +        V DE +    ++ 
Sbjct  288   FTANSEPNEEVLLKLFRHFDPDNDEHLTMTELRGLILGLGIERDNGQVPDEEE----LQH  343

Query  880   MMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa  701
              M + D   ++RI+  EFL GI+  + ++ S       T      +  +  + E  +   
Sbjct  344   WMLEFDVSRDNRISVDEFLEGIKRWIKSSKSISLPKTNTVKVDRSSPSEHHADEANDDDD  403

Query  700   geveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
                  +   K         +  ++ G A+    A PL+  +  FS A G+  F ISF+  
Sbjct  404   ENESNSDPTKAQV--ITKAIFYLLSGAAVAAIFADPLVDAISGFSEASGISPFFISFIAT  461

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P+  N   AI+++  A +K  K  S+T+S+IY  VTM+N   L   LA+VY R L WD+S
Sbjct  462   PLATNSSEAISSLIFAKRKRKKNISMTYSQIYGAVTMNNTMCLGIFLAIVYFRSLQWDFS  521

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             AE+ V+F  +L +G +A  +TT+ LW +     LYP S+ L   L  + GW+
Sbjct  522   AEIFVIFFATLLMGSVAALRTTFPLWMAFIGIALYPASIGLVAFLDYVCGWH  573



>ref|XP_002893543.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69802.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1057

 Score =   210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 155/496 (31%), Positives = 249/496 (50%), Gaps = 31/496 (6%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
             Q    + FL+L  P     S S C H YGF PCA+NI GY+FQ+  F  L+ + E  +S 
Sbjct  41    QDRASNEFLSLDPPN--RISKSACVHVYGFLPCADNIGGYVFQVFSFCCLLIIGEYFLSK  98

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F     G FG  +F +L +FPRI + +S+G+  S + A + V   + V  G ++F
Sbjct  99    GRSKLFVIFEVGFFGGIIFPLLTMFPRIALILSTGLIGSSDIANSMVGNNVAVTVGYSVF  158

Query  1402  NLTVLWGLCVIVGR---RDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAG  1232
              LT+ WG CV+ G    R+  +   D+ S P  Q   SN LK L    +  D      AG
Sbjct  159   ALTMQWGACVVFGLSGVREDHSLTSDTTS-PRRQVKMSNLLKNLAGASVKADPKNKKAAG  217

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +MLL+L+PFVLV       S S    +VL+ LI + +  + YF Y   D   Q +SL ++
Sbjct  218   IMLLTLLPFVLVTFSETFHSKSWDDNMVLITLIFSGSATVLYFVYLYFDKADQVKSLEHA  277

Query  1051  RFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-LRLIV  917
             RFE +              L +NG+ +   ++  F  +D + + ++   EL+   +   V
Sbjct  278   RFELMSEVHKHLQNFSPQSLIRNGQLSRESLKSLFKKFDVNKDGKIQVSELKDLTVDFGV  337

Query  916   TDEVQRMVA--VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN  743
                V+  +     +++ D D + +  I E EF  GIE  L       ++         E+
Sbjct  338   LGRVKCDINELATSLLADFDSNRDGEIDETEFTIGIEKWLKQYKFGFDST--------ES  389

Query  742   DDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSG  563
               ++++ ++      ++      K+ T   +  V++V +G+ I++F A P M N+   S 
Sbjct  390   PREDRAEDDGVLKVEQLRGCLFTKLLTKRTLKAVIEVTIGITIVSFLAMPFMMNIELLSV  449

Query  562   AVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSL  383
             + G+P+F + F V+P+  N + A++A F   +  ++  S TFSEIY  VT++NL G   +
Sbjct  450   SAGIPSFYVVFAVIPLARNLKNALSAHFCRKKDKARITSDTFSEIYRDVTLNNLLGTTII  509

Query  382   LAVVYARELTWDYSAE  335
             LA+VY R LTWDYS E
Sbjct  510   LAIVYIRGLTWDYSTE  525


 Score =   203 bits (517),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 148/535 (28%), Positives = 248/535 (46%), Gaps = 88/535 (16%)
 Frame = -1

Query  1741  FLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFD  1562
             FL+L  PR  S + + C H YGF PCA+N+ GY+FQ+  F  L+ + E  ++     +F 
Sbjct  570   FLSLD-PRNGSITKNQCIHVYGFLPCADNVGGYVFQVFSFGCLLIIGEYFLTKGRSNLFL  628

Query  1561  TLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWG  1382
                 G +G  +F +L +FPRI + +S+G+  S+E A ++V   I V  G ++F LT+ WG
Sbjct  629   IFEVGFYGGIIFPLLTMFPRIALILSTGLVGSREMASSRVGNIIGVTVGYSVFALTMQWG  688

Query  1381  LCVIVGRRDRATQ------EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLL  1220
              C++ G      +      E    + P TQ +   W   LN           +  G + +
Sbjct  689   ACILFGLSGSKPEQPIESGENSDVNCPRTQVY---WKNLLN-----------YVFGFLFV  734

Query  1219  SlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN  1040
                                                      Q  D   Q++SL  +RFE 
Sbjct  735   KNS--------------------------------------QYFDRADQEKSLDLARFEL  756

Query  1039  L--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKF-----LRLIV  917
             +              L ++G+ N   ++      D + + ++   EL+       +   V
Sbjct  757   MSEFHKHLQIFSPKSLIRDGQLNEESLKRLSDRIDVNKDGKIQVSELKDLTVEFGMLGRV  816

Query  916   TDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDD  737
                + ++V   T++ D DRDG+  I E EF  GI+  L     + ++             
Sbjct  817   KCHIDKLVT--TLVADFDRDGDGEINEAEFKIGIKKWLNQYKFSFDSTVP--------PS  866

Query  736   QEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAV  557
             ++++ E       + +++   K+ +W  +   L+V LG+ I+ + A+P M N+   S + 
Sbjct  867   EDQAEENPILKIEKPKESLVTKLLSWKTLRAALEVTLGILIVLYLARPFMMNIQLLSESA  926

Query  556   GVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLA  377
             GVP+F + FV +P+  N +  ++A F   +  ++  S  FSEIY  VTM+NL G+  +LA
Sbjct  927   GVPSFYVVFVAIPLARNLKSTLSAHFCRKKDKARITSDAFSEIYKDVTMNNLMGVSIILA  986

Query  376   VVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFY  212
             +VYAREL WDY+ EVL++ ++ L IG  AY ++TY  W  + AF LY  SL + Y
Sbjct  987   IVYARELIWDYTTEVLIIVIVVLLIGVPAYVRSTYPFWICVLAFALYFISLVVVY  1041



>gb|KFK44728.1| hypothetical protein AALP_AA1G295100 [Arabis alpina]
Length=521

 Score =   204 bits (519),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 159/487 (33%), Positives = 251/487 (52%), Gaps = 45/487 (9%)
 Frame = -1

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             K+F     G++G  +F +L++FPRI++ +S+G+  S+E A + V   + V  G ++F LT
Sbjct  33    KLFVIFEVGLYGGIIFPLLVMFPRIVLILSTGLLGSREIANSMVGNNVGVTVGYSVFALT  92

Query  1393  VLWGLCVIVG----RRDRATQEKDSQSQ------PSTQSFASNWLKTLNECGISTDASTS  1244
             + WG CV+ G      D++T++++  +       P  Q + +N L ++ E  I  D    
Sbjct  93    MQWGACVVFGLTGLNSDQSTRKEEVHTLTTDAKCPRRQVYKNNLLISIAETSIEADPKNK  152

Query  1243  FTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRS  1064
               AG+MLL+L+PFV+V    +  S +   ++VL+ LII+    +AYF Y   D   Q +S
Sbjct  153   KAAGIMLLTLLPFVMVTFSAMFDSKAWDDLIVLITLIISGFASVAYFIYSYFDIADQAKS  212

Query  1063  LHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLR  926
             L  +RFE +              L +NG+ +   I+  F   D +N+ ++   EL+    
Sbjct  213   LDQARFELMSEVHKHLQNFSPQSLIRNGQLSKESIKSLFKKIDVNNDGKIQVSELKD---  269

Query  925   LIVTDEVQRMVAVK--------TMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaa  770
               +T E   +  +K        T + DLD D +  I E EF NGIE  L           
Sbjct  270   --LTVEFGMLGRMKCGIHELATTFLADLDSDKDGEIDEAEFENGIEKWLKQYKFTFTRT-  326

Query  769   atptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPL  590
                    +   + ++ EE        ++    K+ T   +  VL+VILG+ I+ F A P 
Sbjct  327   -------DCPTENRAEEEEVLKMEPPKECLLRKLLTKRALRAVLEVILGMLIVIFLAMPF  379

Query  589   MTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTM  410
             M N+   S + GVP+F + FVV+P+  N + A++A F   +   +  S  F EIY  VTM
Sbjct  380   MMNIELLSVSAGVPSFYVVFVVIPLARNLKNALSAHFCRKKDKKRVTSDKFLEIYKEVTM  439

Query  409   SNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPF  230
             +NL G+  +LA+VY R L WDYS EVL++ ++ L IG  AY ++TY +W  + AF LY F
Sbjct  440   NNLLGITIILAIVYTRGLRWDYSTEVLIIVIVGLIIGVPAYVRSTYPVWICVLAFTLYFF  499

Query  229   SLALFYV  209
             SL L YV
Sbjct  500   SLVLIYV  506



>ref|XP_002974272.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
 gb|EFJ24494.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
Length=525

 Score =   204 bits (518),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 151/531 (28%), Positives = 266/531 (50%), Gaps = 36/531 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C  +YG  PC+  + G L+ +  + ++M  A QL+S  S+ +   L  GI G  +  IL 
Sbjct  1     CSESYGMLPCSTRVVGNLYLLATYGFVMLKAAQLLSDGSELLLTVLNPGIIGGLLLPILG  60

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  +QE AQ+QV  G+ + AG+TI  LT+LWG C+ VGR D      D
Sbjct  61    SLPDALLILVSGLGGNQETAQSQVSVGMGLLAGSTIMLLTLLWGSCLFVGRCDLYPVHAD  120

Query  1333  --SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
               ++ +  T+ F      +L   GI+TD+ T+ +A +M+ ++ P+VL +L +++   S  
Sbjct  121   LVAKDRTLTRGF------SLTGTGITTDSQTTVSAWIMIATVFPYVLAQLPHLLHRPSYG  174

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE--------------------N  1040
                 +V+ +I+   L  Y GYQ++ P IQ+R ++++R                       
Sbjct  175   HPFAVVSCVISFCALFIYCGYQVVSPWIQQRRIYFARHRYRQSHALHRVHVYSTQQAWGG  234

Query  1039  LLTQNG-KPNVSRIRLFFHLYDSDNNQQMSSRELEKFL-RLIVTDEVQ--RMVAVKTMMK  872
             L  ++G  PN   +   F  +D +++  +S REL   +  L +T E        V+  +K
Sbjct  235   LFLEDGVTPNKDALLRIFGYFDENDDGHLSERELRGLIVGLGITHETHLPEEEEVQNWLK  294

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEE--TNgaag  698
             + D   + +++++EF+  I   + +  + D+          +  D   S +         
Sbjct  295   EFDTSRDDKVSQEEFVAAITKWMRSFRAKDSHRDNPEYWDSQAKDARSSLDALLEQQPDD  354

Query  697   eveqaggEKMGTWDFIVTVLQVIL-GVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
             + +    +K      I+     IL G  I    A PL+  +  FS A  +P+F ++FV  
Sbjct  355   DEDDDEQDKQNPKQVILKASAFILAGAVIAGVFADPLVDAIDNFSKASKIPSFFVAFVAT  414

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P+  N   A++++  A++K  +  S+T+S+IY  VT++N   L   LA+V AR L WD+S
Sbjct  415   PLATNSSEAVSSLMFAARKKKRNISMTYSQIYGAVTLNNTLCLGVFLAIVCARRLVWDFS  474

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGW  191
             +EV V+ V++  +G L   +TT++L+ ++    LYP S+AL   L   LGW
Sbjct  475   SEVTVIAVVTFLVGLLGGKRTTFRLYMALAVLSLYPLSIALVAGLDYGLGW  525



>ref|XP_002985644.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
 gb|EFJ13222.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
Length=528

 Score =   201 bits (510),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 147/532 (28%), Positives = 267/532 (50%), Gaps = 36/532 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C  +YG  PC+  + G ++ +  + ++M  A QL+S  S+ +   L  GI G  +  IL 
Sbjct  3     CSESYGMLPCSTRVVGNVYLLATYGFVMLKAAQLLSDGSELLLTVLNPGIIGGLLLPILG  62

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  +QE AQ+QV  G+ + AG+TI  LT+LWG C+ VGR D      D
Sbjct  63    SLPDALLILVSGLGGNQETAQSQVSVGMGLLAGSTIMLLTLLWGSCLFVGRCDLYPVNAD  122

Query  1333  --SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
               ++    T+ F      +L   GI+TD+ T+ +A +M+ ++ P+VL +L +++   S  
Sbjct  123   LVAKDGTLTRGF------SLTGTGITTDSQTTVSAWIMIATVFPYVLAQLPHLLHRPSYG  176

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE--------------------N  1040
                 +V+ +I+   L  Y GYQ++ P IQ+R ++++R                       
Sbjct  177   HPFAVVSCVISFCALFIYCGYQVVSPWIQQRRIYFARHRYRQSHALHRVHVYSTQQAWGG  236

Query  1039  LLTQNG-KPNVSRIRLFFHLYDSDNNQQMSSRELEKFL-RLIVTDEVQ--RMVAVKTMMK  872
             L  ++G  PN   +   F  +D +++  +S REL  F+  L +T E        V++ ++
Sbjct  237   LFLEDGVTPNKDVLLKIFGYFDENDDGHLSERELRGFIVGLGITHETHLPEEEEVQSWLR  296

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGE---ETNgaa  701
             + D   + +++ +EF+  I   + +  + D+          +  D   S +   E     
Sbjct  297   EFDTSRDDKVSREEFVAAITKWMRSFRAKDSHRDNPEYWHSQAKDARSSLDALLEQQPDD  356

Query  700   geveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
              + +    ++      +     ++ G  I    A PL+  +  FS A  +P+F ++FV  
Sbjct  357   DQDDDEQDKQAPKQVILKASAFILAGAVIAGVFADPLVDAIDNFSKASKIPSFFVAFVAT  416

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P+  N   A++++  A++K  +  S+T+S+IY  VT++N   L   LA+V AR L WD+S
Sbjct  417   PLATNSSEAVSSLMFAARKKKRNISMTYSQIYGAVTLNNTLCLGVFLAIVCARRLVWDFS  476

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
             +EV V+ V++  +G L   +TT++L+ ++    LYP S+AL   L   LGW+
Sbjct  477   SEVTVIAVVTFLVGLLGGRRTTFRLYMALAVLSLYPLSIALVAGLDYGLGWH  528



>gb|EAZ04370.1| hypothetical protein OsI_26513 [Oryza sativa Indica Group]
Length=502

 Score =   198 bits (504),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 146/441 (33%), Positives = 231/441 (52%), Gaps = 28/441 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+ +YGF PC     G LF ++ + +LM  +   +SS S+ +   LG GI G     IL 
Sbjct  63    CEMSYGFLPCTTTAWGNLFLVLAYGFLMFKSATYLSSGSEMLLQILGPGIVGGLFLPILG  122

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ + SG+  ++E AQ+QV  G+ + AG+T+  LT+LWG CV+VG+ D +     
Sbjct  123   ALPDALLILVSGLSGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTA  182

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               S+  T+ F      +L   G+STD  TS+ A +M +S++PF++V++  +    SG +I
Sbjct  183   IDSR-DTKGF------SLLGSGVSTDKQTSYAARIMAISILPFIIVQIPKIFKLHSGHQI  235

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNG  1022
              VL+ LI+    LL+Y  YQ+  P IQ+R L Y+R ++                LL   G
Sbjct  236   TVLIGLIVAALLLLSYCLYQVFQPWIQRRRLEYTRLKHVMSGLLRHAQKHSIGRLLDDEG  295

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNS  848
             +PNVS I   FH  D DN+ ++   EL+ F+  I  +++     +A   +M D D   N 
Sbjct  296   RPNVSVIEKLFHRIDQDNDGKLERGELQAFIVGINFEDIDWNSNLAADQVMADFDTSRNH  355

Query  847   RITEQEFLNGIENLLannssadnaaaatptstPENDDQEKS-GEETNgaageveqaggEK  671
              I + EF+NG+   L        + A +      ND   ++  E+T     + E+   + 
Sbjct  356   FIEKGEFVNGMLRWLDEAKRTVTSGAYSKKFL--NDFHARTRDEQTGLLDKDEEEGEADG  413

Query  670   MGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAI  491
               TW  I  +L ++LG A+    A PL+  V  FS A  +P+F ISF+V+P+  N   A+
Sbjct  414   NPTWTCIKAILLLLLGTAMAAASADPLVDAVHNFSNATHIPSFFISFIVMPLATNSSEAV  473

Query  490   AAIFPASQKSSKAASLTFSEI  428
             +AI  AS+K  +  SLTFSE+
Sbjct  474   SAIIFASRKKKRTLSLTFSEV  494



>ref|XP_002965139.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
 gb|EFJ33977.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
Length=546

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 158/548 (29%), Positives = 271/548 (49%), Gaps = 64/548 (12%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C  +YG FPC+E + G +F ++++ Y    A QL+ + S+ + +    GI G     I+
Sbjct  18    ACQESYGIFPCSEKLGGSVFLLIVYSYAFVKAAQLLLNGSELLLEIAHPGIVGGLCLPII  77

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD--RATQ  1343
                P   + + SGIF  +E AQ+QV  G+ V AG+T+  LT+LWG  +IVGR D      
Sbjct  78    CTIPDAAVILVSGIFGDKETAQSQVMIGMGVLAGSTVLLLTMLWGTALIVGRCDLYEING  137

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
              K ++ +  T+ F       L E G++    T++ A +++LS++P ++V+L  ++ + + 
Sbjct  138   HKYAREKTLTKGF------HLTETGVTLTKQTTYVAWILVLSVLPCIVVQLPQILGAPAL  191

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQK-------------RSLH----YSRFENL-  1037
              R+ V++   +     +AY  YQ++ P IQ+              +LH    YSR +   
Sbjct  192   SRVFVIIGSAMAFLGFVAYCVYQVMTPWIQQVMVDWHRHRYRRSHALHRAHIYSRQKRWG  251

Query  1036  -LTQNGKP--NVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI-VTDE--VQRMVAVKTMM  875
              L  NG+   N   +R  FH +D + +  +S REL+ F++ I +T +  +   +  K  M
Sbjct  252   DLLLNGEKLLNYEVLRRLFHFFDQNGDGLLSERELKNFIKTIGLTHDSNIPEGLEAKIWM  311

Query  874   KDLDRDGNSRITEQEFLNGIENLLannssad------------------naaaatptstP  749
             ++ D + + +++  EF  G+ N L ++                         A +     
Sbjct  312   EEFDHERDGKLSLVEFEEGMANWLNSSKLGLEFRYFHSWSAILFIYFFFVQEAQSSLYAL  371

Query  748   ENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQF  569
               D++  + E+T    G +  A    +G             G+A+    A PL+  +  F
Sbjct  372   LEDEEVHAPEDTEDPNGILVTATACLLG-------------GMALACIFAAPLVDTIDDF  418

Query  568   SGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLL  389
             S A  +P F +SFVV PI  +    I++I  AS+K  +  S+T+S++Y  V ++N   L 
Sbjct  419   SRASHIPAFFVSFVVTPIATSSSEVISSITFASKKQKRGISVTYSQLYGSVVLNNTLCLG  478

Query  388   SLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
               LA+V AR L WD+SAEVL++ + ++ +G +    TT  L+ +  AF LYP SL L  +
Sbjct  479   LFLAIVAARGLVWDFSAEVLIMALATMAMGCVGGIFTTIPLFMAFGAFLLYPLSLGLVVL  538

Query  208   L-QLLGWN  188
             L Q LGW+
Sbjct  539   LNQYLGWH  546



>ref|XP_001751608.1| predicted protein [Physcomitrella patens]
 gb|EDQ83925.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   197 bits (502),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 148/544 (27%), Positives = 257/544 (47%), Gaps = 52/544 (10%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YG  PC+ ++ G    +VI+ Y++  A QL+S  S+ +   +  GI G  V  IL 
Sbjct  43    CEEHYGILPCSVSLGGNAALLVIYGYMLLQAAQLLSDGSELLLTVMSPGIIGGLVLPILG  102

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
              FP  ++   SG+  SQ  AQ +V  G+ + AG+++  LT LWG C+I GR D      +
Sbjct  103   AFPDALLITVSGLGASQAEAQQEVLVGMGLVAGSSVMLLTALWGACLIFGRCDLIPHPAN  162

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
              +     ++    +  +L E G+++D  T + + +M+ +L+P+++ +L  ++   +    
Sbjct  163   GKLVAKDRTLTKGF--SLTETGVTSDEQTKWASWIMMATLLPYIVAQLPRLIGLNTEGNF  220

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSL--------------------HYSRFENLL  1034
              + +A II+   L+ Y  YQ++ P IQ+R +                    H   + NL 
Sbjct  221   FIALAAIISGLSLIGYCTYQLVAPWIQERRIMWAQHRYRRSHALHKVSHLTHQQNWGNLF  280

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA----VKTMMKDL  866
             T +G+PN   +   F  +D DN++ ++  EL+  +  +  +     V     ++  M + 
Sbjct  281   TASGEPNEEVLLKLFGHFDPDNDKHLTKTELKGLILGLGIERHNGQVPDEDELQHWMSEF  340

Query  865   DRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQE---------------  731
             D   ++RI+  EFL GI+  + ++S+A            ++ D                 
Sbjct  341   DVSRDNRISVDEFLQGIKRWMKSSSTATKKKNGAVAIDSQSSDHHGWDFEAQVWNQFRGH  400

Query  730   --KSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAV  557
               +  E+              K         +  +I G A+    A PL+  +  FS A 
Sbjct  401   SIEDEEDDESKGTPTRGQVIAK--------AICYLIAGAAVAAIFADPLVDAIGGFSKAS  452

Query  556   GVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLA  377
             G+  F ISF+  P+  N   AI+++  A +K  K  S+T+S+IY  VTM+N   L   L 
Sbjct  453   GISPFFISFIATPLATNSSEAISSLIFAKRKRKKNISMTYSQIYGAVTMNNTLCLGIFLT  512

Query  376   VVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQLL  197
             +VY R L WD+SAE+ V+F  +  +G +A F+TT+ LW +     LYP S+ L   L  +
Sbjct  513   IVYFRGLLWDFSAEISVIFFATFIMGTVAAFRTTFPLWMAFIGLALYPLSVGLVVFLDFV  572

Query  196   -GWN  188
              GW+
Sbjct  573   CGWH  576



>ref|XP_002962226.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
 gb|EFJ37486.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
Length=546

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 158/549 (29%), Positives = 272/549 (50%), Gaps = 66/549 (12%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
              C  +YG FPC+E + G +F ++++ Y    A QL+ + S+ + +    GI G     I+
Sbjct  18    ACQESYGIFPCSEKLGGSVFLLIVYSYAFVKAAQLLLNGSELLLEIAHPGIVGGLCLPII  77

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD--RATQ  1343
                P   + + SGIF  +E AQ+QV  G+ V AG+T+  LT+LWG  +IVGR D      
Sbjct  78    CTIPDAAVILVSGIFGDKETAQSQVMIGMGVLAGSTVLLLTMLWGTALIVGRCDLYEING  137

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
              K ++ +  T+ F       L E G++    T++ A +++LS++P ++V+L  ++ + + 
Sbjct  138   HKYAREKTLTKGF------HLTETGVTLTKQTTYVAWILVLSVLPCIVVQLPQILGAPAL  191

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQK-------------RSLH----YSRFENL-  1037
              R+ V++  ++     +AY  YQ++ P IQ+              +LH    YSR +   
Sbjct  192   SRVFVIIGSVMAFLGFVAYCVYQVMTPWIQQVMVDWHRHRYRRSHALHRAHIYSRQKRWG  251

Query  1036  -LTQNGKP--NVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI-VTDE--VQRMVAVKTMM  875
              L  NG+   N   +R  FH +D + +  +S REL+ F++ I +T +  +   +  K  M
Sbjct  252   DLLLNGEKLLNYEVLRRLFHFFDQNGDGLLSERELKNFIKTIGLTHDSNIPEGLEAKIWM  311

Query  874   KDLDRDGNSRITEQEFLNGIENLLannssad------------------naaaatptstP  749
             ++ D + + +++  EF  G+ N L ++                         A +     
Sbjct  312   EEFDHERDGKLSLVEFEEGMANWLNSSKLGLEFRYFHSWSAILFIYSFFVQEAQSSLYAL  371

Query  748   ENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVIL-GVAILTFCAQPLMTNVIQ  572
               D++  + E+T                    +VT    +L G+A+    A PL+  +  
Sbjct  372   LEDEEVHALEDTEDPN--------------GILVTATACLLGGMALACIFAAPLVDTIDD  417

Query  571   FSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGL  392
             FS A  +P F +SFVV PI  +    I++I  AS+K  +  S+T+S++Y  V ++N   L
Sbjct  418   FSRASHIPAFFVSFVVTPIATSSSEVISSITFASKKQKRGISVTYSQLYGSVVLNNTLCL  477

Query  391   LSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFY  212
                LA+V AR L WD+SAEVL++ + ++ +G +    TT  L+ +  AF LYP SL L  
Sbjct  478   GLFLAIVAARGLVWDFSAEVLIMALATMAMGCVGGLFTTIPLFMAFGAFLLYPLSLGLVV  537

Query  211   VL-QLLGWN  188
             +L Q LGW+
Sbjct  538   LLNQFLGWH  546



>gb|KFK44727.1| hypothetical protein AALP_AA1G295000 [Arabis alpina]
Length=550

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 158/551 (29%), Positives = 264/551 (48%), Gaps = 80/551 (15%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
             Q   +  F++L  P     S   C H YGF PCA+N+ GYLFQ+V F  L+ + E  +S 
Sbjct  40    QDGPEHGFISLDPPN--RVSKDACIHVYGFLPCADNVGGYLFQLVSFGTLLMIGEYFLSE  97

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
                K+F     G +G  VF +L +FPRI++ +S+G+  S E A + V   + V  G T+F
Sbjct  98    GRSKLFLIFEVGFYGGVVFPLLRMFPRIVLILSTGLMESPEIANSMVGNTVGVTVGYTVF  157

Query  1402  NLTVLWGLCVIVGRRDRATQEKDSQS------QPSTQSFASNWLKTLNECGISTDASTSF  1241
              LT+ WG CV+ G  D   + ++++S       P  +      LK L    I  D     
Sbjct  158   ALTIQWGACVVFGMTDSDRKVEEARSPPLALWDPRRRDVRKKMLKKLIGASIVADPKNKK  217

Query  1240  TAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSL  1061
              AG+MLL+++PF+++ L     S S + I+ L+ LI++ +  LAYF Y   D   Q++SL
Sbjct  218   AAGIMLLTILPFIMITLSEFFDSQSWRDIIGLITLIVSGSATLAYFIYSYFDEADQEKSL  277

Query  1060  HYSRFE--------------NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRL  923
              +++FE                L ++G+ +   ++  F  +D + + ++   EL   +RL
Sbjct  278   DHAKFELMSEVHKHLQIFSPKTLLRDGQLSQENLKKLFDRFDVNQDGKIQKSELNN-MRL  336

Query  922   IVTDEVQRMVAVKTMMKDL--------DRDGNSRITEQEFLNGIENLLannssadnaaaa  767
                 E +++  +K   +++        D D +  I + EF  GI   L            
Sbjct  337   ----EFEQLEGLKYNTQEVANKWLEYFDDDRDGEIDKNEFERGISKWL-----------D  381

Query  766   tptstPENDDQEKSGEETNgaageveqaggEKMGTWDF-----IVTVLQVILGVAILTFC  602
                 T +++D+ +S E  +  A  ++    ++   + F     +    +VILG+ IL F 
Sbjct  382   QYKLTFDSNDECQSDESPSELAKVLKVEEPKESLLFMFFSNKTLRAYGEVILGIGILMFL  441

Query  601   AQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYN  422
             A+P MTN+   S + GVP+F + F V+P+V N + A++A F  ++  ++  S TF+EIY+
Sbjct  442   ARPFMTNIELLSESAGVPSFYVVFAVIPLVRNLKSALSAHFCRNKDKARITSDTFAEIYS  501

Query  421   GVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFF  242
              VTM+NL G+  +                              AY ++TY  W  + AF 
Sbjct  502   DVTMNNLIGISCI-----------------------------PAYVRSTYPFWICVLAFA  532

Query  241   LYPFSLALFYV  209
             LY  SL L ++
Sbjct  533   LYFISLLLVFL  543



>ref|XP_002522529.1| calmodulin, putative [Ricinus communis]
 gb|EEF39829.1| calmodulin, putative [Ricinus communis]
Length=703

 Score =   198 bits (503),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 183/323 (57%), Gaps = 32/323 (10%)
 Frame = -1

Query  1099  YQIIDPTIQKRSLHYSRFENLLTQ---------------NGKPNVSRIRLFFHLYDSDNN  965
             ++++ P I+++    +  E  L+Q               +GKP+V +IR  F  +D D+N
Sbjct  394   HKMVQPLIERKKAKLAEIEQQLSQILNTAQNQQLAFLVTDGKPDVDKIRSLFAEFDKDDN  453

Query  964   QQMSSRELEKFLR-LIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannss  788
             ++M++REL+  ++    + ++     VK MMK  D D +  I  +EF +G++  L+ +  
Sbjct  454   KKMTARELKGMIKSKFGSAKLDHDDVVKKMMKVFDVDKDKEIHVEEFTDGMKKRLSGDFQ  513

Query  787   adnaaaatptstPENDDQEKS--GEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
                            D+  +S   E    +    ++   +KM       + + V+LGVAI
Sbjct  514   LI-------------DECIESLISESCISSLKLQKEKSIKKMSLRALTKSGILVVLGVAI  560

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
             ++    PL+ N    S  +G+ +F ISFVVLP  +N + A+A IFPASQK  +A+S+ FS
Sbjct  561   VSSLGMPLINNTQLLSERIGISSFYISFVVLPFAVNFKTAMATIFPASQKKEEASSIMFS  620

Query  433   EIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             EIY  V M+N++GLL+LLA+++AR  TWDYSAEV+V+ V+S  IG +A+ +  Y LWT +
Sbjct  621   EIYGAVFMNNVSGLLTLLALIWARGFTWDYSAEVIVLLVVSAIIGAIAFLRRIYPLWTCL  680

Query  253   FAFFLYPFSLALFYVLQ-LLGWN  188
              AF  YP SL LFYV++ +LGW 
Sbjct  681   LAFSFYPLSLVLFYVIRFVLGWK  703


 Score =   185 bits (469),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 186/319 (58%), Gaps = 24/319 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC H Y F PCA NIPG++FQIV+F+YL+ + ++ ++   +++F  LG GI+GAT+FRIL
Sbjct  57    TCVHYYSFLPCATNIPGFIFQIVVFEYLLILGDKFLTKGRQQLFSILGVGIYGATLFRIL  116

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ-E  1340
              V P  ++ ++SG+  ++E A+ ++  G  + AG+T+F LT+ WG+CV++GRR  A + E
Sbjct  117   AVLPTNVLILASGLAQNREDARARIENGAGLLAGSTVFCLTLQWGICVLLGRRKIAQESE  176

Query  1339  KDSQSQPSTQS--FASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
              + +S+  T+        L  L E G+ TD  T +TAG+MLLS    + V LV + S+  
Sbjct  177   PNQESKAPTKRCLMVKQRLSRLKEYGVRTDTKTKYTAGIMLLS---LIPVILVELASAFE  233

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE----------------NLL  1034
              +    +V L++  A L++YF +      IQ+RSL YSR +                 L+
Sbjct  234   SRPWSHIVTLVVVGAALVSYFLFLSRRQWIQERSLEYSREQLLLAGFLDHLQKFAKRRLV  293

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDR  860
              + GK +VS ++  F   D +N+  +S +EL+ FL+ + + +++     AV+ +M   D 
Sbjct  294   NKEGKVDVSCVKRTFRNIDKNNDNHISQKELKDFLKHMKSGDLEFDDAFAVQELMTQFDE  353

Query  859   DGNSRITEQEFLNGIENLL  803
             D N  ITE EF++G   ++
Sbjct  354   DSNRSITEDEFVSGCHKII  372



>ref|XP_010060649.1| PREDICTED: uncharacterized protein LOC104448505 [Eucalyptus grandis]
Length=727

 Score =   191 bits (485),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/310 (38%), Positives = 185/310 (60%), Gaps = 19/310 (6%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC+ +I G+LF I++++YL+   E  V+S S++IF  LG GIFGA+ F +L 
Sbjct  72    CEQMYGFLPCSYSIAGHLFLILVYEYLLFQGESCVASGSEQIFKMLGPGIFGASAFHVLG  131

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ ++SG+ NS+E AQ  V  G+ + AG++I  LT+LWG CV++G R + +   +
Sbjct  132   ALPEALILLASGLLNSEEVAQEYVVTGVGLLAGSSILLLTLLWGTCVLLGSR-KLSDGME  190

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               +  S++     +L +L   GI TD  TS+TA +M++S  PF+++++ ++ S  S QR+
Sbjct  191   PNTLNSSRFSWKKFLSSLKGSGIITDLETSYTARIMVISAFPFIMIQIPDIFSVYSAQRV  250

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQNG  1022
             ++L +L ++V  LL YF YQI +P IQKRSL Y +                 E LLT++G
Sbjct  251   MILCSLAVSVGLLLLYFFYQIFEPWIQKRSLEYVKHEQLMLRIIQHLQRHALERLLTEDG  310

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDRDGNS  848
              PNV  IR  F   D D +  +S  EL++ L+ I      V +  AV  +MK+ D  G+ 
Sbjct  311   APNVHAIRRLFEEIDQDGDDAISPSELKELLQEIKFKHMHVDKDKAVDEIMKEFDIAGDQ  370

Query  847   RITEQEFLNG  818
             RI++ EF+ G
Sbjct  371   RISKDEFVTG  380


 Score =   171 bits (433),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 159/266 (60%), Gaps = 3/266 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMK  872
             + L  +NG P++  IR  F   D + +  +S  EL++ +  I   ++   V   V  +++
Sbjct  440   KTLFAENGTPDLPAIRRLFEQIDRNGDNSISRAELKELMMGIKFGDISFDVDEVVSKVIE  499

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
               DR GNS+I E+EF+ G+ NLL  +       A+   ++ ++D  +++ EET+    E 
Sbjct  500   VFDRSGNSQINEEEFVAGLVNLLDTSGEGSKIQASKLNTS-QDDFYQRTWEETDKLVDED  558

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +  G  K  +W ++ ++  ++LGV IL   A+PL+++V  FS + G+P F ISF+++P+ 
Sbjct  559   KGKGDAKKASWIWVKSMSSLLLGVIILAVLAEPLISSVQSFSKSAGIPPFFISFILVPLA  618

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N R A AAI  A  K  +  SLT SEIY  V MSN+ G   LL+++Y R+LTW++SAEV
Sbjct  619   TNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGFCVLLSLIYVRDLTWEFSAEV  678

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSI  254
             LVV ++   +G +A F++T+ +WTSI
Sbjct  679   LVVLIVCSLVGLIASFRSTFPVWTSI  704



>ref|XP_002275985.2| PREDICTED: uncharacterized protein LOC100255777 [Vitis vinifera]
Length=541

 Score =   187 bits (476),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 147/488 (30%), Positives = 256/488 (52%), Gaps = 42/488 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   +PG +  I+++  LM  A +L+   S+ + + L  GI GA    +L
Sbjct  60    SCNQTYGFMPCTATVPGNILLILVYVSLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                   I+ I+S +  + E AQNQV  G+ +  G+T   LT+L G C+IV + D     +
Sbjct  120   SSLLDAIINIASRLCGNGETAQNQVSAGLGLLTGSTAILLTLLGGCCIIVDKCD-PENSR  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +  S+ + + F      +L    ISTD   S+TA +M++S++PF++V+L  V+ ++S   
Sbjct  179   EKASEETARGF------SLAGSAISTDIRASYTARIMVISVMPFIIVQLAQVLHTSSQIC  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQN  1025
               + ++LII+V+ LLAY  +Q+  P+I +R L Y++                 E LLT N
Sbjct  233   FAIFISLIISVSLLLAYCLHQVFHPSILRRKLAYAKQMHMTSRIVKQLKYSPLERLLTTN  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKDLDRDGN  851
             G+P++  IR+ F + D +++Q +S+ E+   +  I     +      V  +M+D+   G+
Sbjct  293   GEPDMEVIRMLFKMIDGNSDQLLSTSEIRALITGIQIKDKDSDIDDTVGDIMRDVHACGD  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptst---------PENDDQEKSGEETNgaag  698
             ++I  + F  GI   L    ++   ++     T           N + E+ G +++    
Sbjct  353   AKINIEAFTKGISKWLNKAKNSAVCSSYNHMKTRLVVDHFNLVSNKEHEQLGIQSD----  408

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
                +    +   W     V+ ++LG  I    A PL+  V +FS A  +P+F +SF+VLP
Sbjct  409   ---EVVKIESPKWSACKAVVMLLLGSLIAATFAGPLVNAVGKFSTATNIPSFFVSFLVLP  465

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
                +   A++A   ASQK  + ASLTFS+IY  ++M+N   +   L +VY R+LTW++++
Sbjct  466   FA-SFSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCMSVFLGLVYFRQLTWNFTS  524

Query  337   EVLVVFVI  314
             EVL+V +I
Sbjct  525   EVLIVLII  532



>gb|KDP21053.1| hypothetical protein JCGZ_21524 [Jatropha curcas]
Length=686

 Score =   187 bits (476),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 184/323 (57%), Gaps = 21/323 (7%)
 Frame = -1

Query  1723  PRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGI  1544
             P+  +S+  TC H YGF PCA N+PG++FQIVI +YL+ V +++++   +++F  LG GI
Sbjct  44    PKAINSTEHTCVHYYGFLPCATNVPGFIFQIVILEYLLLVGDKILTKGRQQLFSFLGVGI  103

Query  1543  FGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG  1364
             +GATVFRIL V P I++ ++SG+  ++E AQ ++  G    AG+T+F LT+ WG+CV++G
Sbjct  104   YGATVFRILAVLPTIVLVLASGLAQNKEAAQARIENGAGTLAGSTVFYLTLQWGICVVLG  163

Query  1363  RRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvn  1184
             R     +   S S  +  S     L    E G+ TD  TS+TA +MLLSL+P ++VE+ +
Sbjct  164   RTKVTKESPQSTSTTTGFSLVKKRLSIFKEYGVETDQKTSYTAKIMLLSLIPLIMVEIAD  223

Query  1183  vVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE-------------  1043
                S        +V L+++V+ L++YF +      IQ+RSL YSR +             
Sbjct  224   TFKSRPWSH---IVTLMVSVSALVSYFVFLSRHQWIQERSLEYSRDQLLLAGFLNHLQKF  280

Query  1042  ---NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTM  878
                 L+   G+ +VS I+  F   D DN+  +S  EL  FL  + +   E+      + +
Sbjct  281   AKRRLVNDEGQVDVSCIKRVFGTIDKDNDHFISKTELNAFLANMKSGDLELDEKFTKEEL  340

Query  877   MKDLDRDGNSRITEQEFLNGIEN  809
             MK  D+D N  ITE EF++G E 
Sbjct  341   MKHFDKDSNHLITEDEFVSGCEK  363


 Score =   186 bits (471),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 179/324 (55%), Gaps = 44/324 (14%)
 Frame = -1

Query  1099  YQIIDPTIQKRSLHYSRFENLLTQ---------------NGKPNVSRIRLFFHLYDSDNN  965
             ++++ P I+++    +  E  L++               +GKP+ ++IR  F  +D D +
Sbjct  387   HKMVQPWIERKKNKLAEMEKQLSEILNTAQNQQLACLLTDGKPDETKIRSLFDEFDKDGD  446

Query  964   QQMSSRELE----KFLRLIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLan  797
             ++M++ EL+    K  R +  D       V+ MMK  D + +  + E EF NG++  L++
Sbjct  447   KKMTASELKGMIMKKFRSVKLDHDD---LVEKMMKAFDVNNDKELHEDEFTNGLKKRLSS  503

Query  796   nssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVA  617
             + +  +             D+    E+ N            K+     +  +L+V++G+A
Sbjct  504   DGNNSHFI-----------DECIEKEKGNIK----------KLSLRSLMKALLRVVIGIA  542

Query  616   ILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTF  437
             I++    PL+ N    S  +G+P+F +SFVVLP  +N + A+A IFPASQK   A+S+ F
Sbjct  543   IVSSLGLPLVNNTQLLSERIGIPSFFVSFVVLPFAVNFKTAMATIFPASQKKEGASSIMF  602

Query  436   SEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTS  257
             SEIY  V M+N+ GL++L+ +++AR  TW YSAEVLV+ VIS  IG +A+ +  Y LWT 
Sbjct  603   SEIYGAVFMNNILGLVTLVGLIWARGFTWVYSAEVLVIVVISAIIGLIAFRRIKYPLWTC  662

Query  256   IFAFFLYPFSLALFYVLQ-LLGWN  188
             I AF LYP SL LFY+++ ++GW 
Sbjct  663   IVAFSLYPLSLLLFYIIRYIVGWK  686



>emb|CAN78650.1| hypothetical protein VITISV_033126 [Vitis vinifera]
Length=541

 Score =   186 bits (471),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 146/488 (30%), Positives = 255/488 (52%), Gaps = 42/488 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   +PG +  I+++  LM  A +L+   S+ + + L  GI GA    +L
Sbjct  60    SCNQTYGFMPCTATVPGNILLILVYVSLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                   I+ I+S +  + E AQNQV  G+ +  G+T   LT+L G C+IV + D     +
Sbjct  120   SSLLDAIINIASRLCGNGETAQNQVSAGLGLLTGSTAILLTLLGGCCIIVDKCD-PENSR  178

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +  S+ + + F      +L     STD   S+TA +M++S++PF++V+L  V+ ++S   
Sbjct  179   EKASEETARGF------SLAGSAXSTDIRASYTARIMVISVMPFIIVQLAQVLHTSSQIC  232

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQN  1025
               + ++LII+V+ LLAY  +Q+  P+I +R L Y++                 E LLT N
Sbjct  233   FAIFISLIISVSLLLAYCLHQVFHPSILRRKLAYAKQMHMTSRIVKQLKYSPLERLLTTN  292

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKDLDRDGN  851
             G+P++  IR+ F + D +++Q +S+ E+   +  I     +      V  +M+D+   G+
Sbjct  293   GEPDMEVIRMLFKMIDGNSDQLLSTSEIRALITGIQIKDKDSDIDDTVGDIMRDVHACGD  352

Query  850   SRITEQEFLNGIENLLannssadnaaaatptst---------PENDDQEKSGEETNgaag  698
             ++I  + F  GI   L    ++   ++     T           N + E+ G +++    
Sbjct  353   AKINIEAFTKGISKWLNKAKNSAVCSSYNHMKTRLVVDHFNLVSNKEHEQLGIQSD----  408

Query  697   eveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLP  518
                +    +   W     V+ ++LG  I    A PL+  V +FS A  +P+F +SF+VLP
Sbjct  409   ---EVVKIESPKWSACKAVVMLLLGSLIAATFAGPLVNAVGKFSTATNIPSFFVSFLVLP  465

Query  517   IVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSA  338
                +   A++A   ASQK  + ASLTFS+IY  ++M+N   +   L +VY R+LTW++++
Sbjct  466   FA-SFSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCMSVFLGLVYFRQLTWNFTS  524

Query  337   EVLVVFVI  314
             EVL+V +I
Sbjct  525   EVLIVLII  532



>ref|XP_010277716.1| PREDICTED: uncharacterized protein LOC104612096 [Nelumbo nucifera]
Length=688

 Score =   187 bits (475),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 135/379 (36%), Positives = 209/379 (55%), Gaps = 38/379 (10%)
 Frame = -1

Query  1882  LFILLL-AVVLVQGRFLsdddgevvsdgvhdhyhahahaANQSVDQSSFLALGGPRLsss  1706
             +F+LLL AVV V GRFL       +               +   D+S  L L       S
Sbjct  8     VFVLLLQAVVNVNGRFLRYRSSSQLVS-------------DGMDDESPMLLLKSQE--PS  52

Query  1705  ssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVF  1526
             SS  C+H YGF PC EN+ G+LF +V+++Y++ + E+ +SS SK +F+ LG G++GA+ F
Sbjct  53    SSEACEHMYGFLPCTENLAGHLFLVVVYEYMLFIGEKYLSSGSKLLFEILGEGVYGASFF  112

Query  1525  RILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRAT  1346
              IL   P  ++ + SG+ NS+E AQ  V  G+ +  G+T+ +LT++WG CVIVG+   + 
Sbjct  113   HILGTLPESMILLVSGLSNSKEIAQKNVLTGVGLLVGSTVLHLTIVWGTCVIVGKHKLSE  172

Query  1345  QE----KDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvV  1178
              E    +D QS  S        L+ L   GI+TD  TS+TA +M+LS +PF++V+L  + 
Sbjct  173   PECSATEDLQSSASKDLQCKRQLRCLTGSGITTDLKTSYTARIMVLSGIPFIVVQLPRIF  232

Query  1177  SSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--------------  1040
                S +R+++L +LI+  AFLL YF YQ+  P IQ+RSL+Y + E+              
Sbjct  233   RVFSWERVIILFSLIMCFAFLLFYFIYQLFRPWIQERSLNYVKHEHMRLQILKHVENQAL  292

Query  1039  --LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE--VQRMVAVKTMMK  872
               LL  +G PN S I+  F   D D +  +S  EL + ++ I      V +  A+  ++ 
Sbjct  293   EKLLADDGTPNTSAIKRLFEKIDLDADSYISYPELREMIKEIKFGRINVDKDDAIAEVIN  352

Query  871   DLDRDGNSRITEQEFLNGI  815
             + D D + +IT  EF+NG+
Sbjct  353   EFDTDDDHKITMDEFVNGL  371


 Score =   164 bits (416),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 108/319 (34%), Positives = 165/319 (52%), Gaps = 42/319 (13%)
 Frame = -1

Query  1099  YQIIDPTIQKRSL------HYSRF--ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRE  944
             Y++  P I+KR L      H +    E LL  +G PN+  I+  F  +D D +  ++  E
Sbjct  397   YKVFKPLIRKRKLTAMILAHLNSIAAERLLKSDGAPNLPIIKGLFKKFDQDGDNCITQSE  456

Query  943   LEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaa  770
             L++ +  +   ++Q  +   VK + ++LD + +  I+E+EF+ GIE  L           
Sbjct  457   LKELIFGVKFGKIQVDKDGLVKELFEELDTNHDHNISEEEFIGGIERWL-----------  505

Query  769   atptstPENDDQEKSGEETNgaageveqaggEKMGT----WDFIVTVLQVILGVAILTFC  602
                              E               +GT    W  I  VL ++LG+ IL+  
Sbjct  506   ----------------SEHKLHKQGFASKDRLDLGTVDHPWIRIKAVLLLLLGITILSLL  549

Query  601   AQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYN  422
             A+PL+ +V  FS +  +P+F +SFV++P+  N R A + I  AS+K S   S TFSEIY 
Sbjct  550   AEPLIESVQNFSSSANIPSFFVSFVMVPLATNSREAASRIISASRKKSTTTSWTFSEIYG  609

Query  421   GVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFF  242
             GV M+N+ GL  LL +++ R LTWD+S E LVV V+   +G  A F++T+ LWT   A+ 
Sbjct  610   GVFMNNILGLSVLLCLIFFRGLTWDFSTEALVVLVVCTVMGLFASFRSTFPLWTCFMAYL  669

Query  241   LYPFSLALFYVLQL-LGWN  188
             +YPFSL L YV    LGW+
Sbjct  670   MYPFSLVLVYVFNYALGWS  688



>ref|XP_001752917.1| predicted protein [Physcomitrella patens]
 gb|EDQ82421.1| predicted protein [Physcomitrella patens]
Length=601

 Score =   186 bits (472),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 148/550 (27%), Positives = 242/550 (44%), Gaps = 77/550 (14%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YG  PC+  + G    +VI+ +++  A QL+S  S+ +   +  GI G  V  IL 
Sbjct  81    CEEKYGILPCSTTLGGNASLLVIYGFMLLKAAQLLSDGSELLLAVMSPGIIGGLVLPILG  140

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ I SG+  SQ  AQ++V  G+ + AG++I  LT+LWG C+I+GR D       
Sbjct  141   ALPDAMLVIVSGLGASQAEAQHEVLVGMGLVAGSSIMVLTLLWGSCLILGRCDLVPHPTT  200

Query  1333  SQ----SQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSAS  1166
              Q     +  TQ F       L + G++ D  T + + +M+ + +   + +   +    +
Sbjct  201   GQLIAKDRTLTQGF------NLTKTGVTNDRQTKWASWIMMGTFLSLFVAQFPRLFRLNT  254

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE-------------------  1043
               R+ V    ++ V  L  Y  YQ++ P +Q++ +  +R                     
Sbjct  255   DGRMFVAAGAVVAVLSLCGYITYQLMVPWVQEKRIKRARHRYYKILTLNKAAQMTQSKQW  314

Query  1042  -NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--------VTDEVQRMVA  890
              +L   N +PN   ++  F  +D D +  ++  EL+  +  +        V DE      
Sbjct  315   GSLYNSNHEPNEEVLKKLFGHFD-DGDGLLTRAELKSLMVGLGLKRHNGQVPDEED----  369

Query  889   VKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETN  710
             ++  M + D D + +ITE EFL  I   +                  +N    K     N
Sbjct  370   LEHWMSEFDVDNDEKITEAEFLRAIRRWM------------------KNSSSRKPKRRAN  411

Query  709   gaageveqaggE-----------KMGTWDFIVTVLQVILGVAILTFCA----QPLMTNVI  575
                                    K G      T+ + I  +      A     PL+  + 
Sbjct  412   AKMHYTTLEDEANDDDDDDDEEGKGGAPSRKQTITKAICFLIAGAALAAIFADPLVDAID  471

Query  574   QFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTG  395
              FS A G+  F ISF+  P+  N   AI+++  A +K  K  S+T+S+IY  VTM+N   
Sbjct  472   GFSRASGISPFFISFIATPLATNSSEAISSLIFAKKKRKKNISMTYSQIYGAVTMNNTMC  531

Query  394   LLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALF  215
             L   L++VY R L WD+SAEV V+F  +L +G +A F+TT  LW +     LYP S+AL 
Sbjct  532   LGIFLSIVYFRHLLWDFSAEVSVIFFATLIMGSVAAFRTTLPLWMAFIGLALYPLSIALV  591

Query  214   YVLQ-LLGWN  188
               L  + GW+
Sbjct  592   AFLDYVCGWH  601



>gb|KCW69971.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=498

 Score =   184 bits (466),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 230/454 (51%), Gaps = 46/454 (10%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TCD  YGF PC  N  G LF I+++ YLM  A   +S  S+ + + LG G+ G  V  IL
Sbjct  58    TCDETYGFLPCTTNWIGNLFLILVYGYLMYTAATCLSGGSEMLLEILGPGLIGGLVLPIL  117

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  S E AQ+QV  G  + AG+T+  LTV+WG CV+VG+ D   Q+ 
Sbjct  118   GALPDALLILVSGLSGSTETAQSQVSVGKGLLAGSTVMLLTVIWGSCVLVGKCD--LQDS  175

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              +  +  T+ F      +L   GI+ D  T   A +M++S++PF++++L+ +++S SG+ 
Sbjct  176   TAVDKLDTKGF------SLTGSGITIDDLTRRAAWIMVISVIPFLVIQLLQLLNSTSGRH  229

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-SRFENL----------------LTQ  1028
             + VL+ALI++V  L++Y  YQ+  P I KR L Y  R   L                LT+
Sbjct  230   VAVLIALILSVVLLISYCLYQVFQPWILKRRLEYWQRRSALFLFLRHVKRHAPALARLTE  289

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDG  854
             +G+ N   +   F   D+D++++++  EL+ F   I  +E+      AV  +M   D   
Sbjct  290   DGEVNTEIVDQLFETIDTDDDKKLTCSELQAFAVGIRFEEIDLDANDAVDEIMAAFDTSR  349

Query  853   NSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggE  674
             + R+++ EF  GI+  L     A         +T +  D      +T             
Sbjct  350   DDRLSQDEFRKGIKKWLDEAVRAGKGFGLGRFNTTKIIDVADHRAKTEREQLLAG-----  404

Query  673   KMGTWDFIVTVLQ------------VILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISF  530
               G  D +V V++            +ILG  I    A PL+  V  FS A G+PTF ISF
Sbjct  405   --GQGDEVVKVVENAKMTSLKAVGLLILGTVIAAAFADPLVDAVDNFSDATGIPTFFISF  462

Query  529   VVLPIVINGRMAIAAIFPASQKSSKAASLTFSEI  428
             + LP+  N   A++AI  AS+K  + ASLTFSE+
Sbjct  463   IALPLATNSSEAVSAIIFASRKKQETASLTFSEV  496



>ref|XP_009794964.1| PREDICTED: uncharacterized protein LOC104241728 [Nicotiana sylvestris]
Length=510

 Score =   184 bits (466),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 160/286 (56%), Gaps = 11/286 (4%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMK  872
             E LL  +G PN+  I+  FH  D D N  ++  ELEK    +   E       +++ ++K
Sbjct  231   EGLLKDDGSPNIEAIKRLFHKLDDDQNSYLTPSELEKLTENVKIREAHLDHQGSIEEIIK  290

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
             D D++ +++I E EFL+G++  L N   +             +   +++  E +      
Sbjct  291   DFDQNKDNKIDENEFLDGVKYWLRNAKRSTEELQDKMIWGEVDKFLDEAKREKHKRFDYS  350

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
                 G       F  +VLQVILG AILT CA PLM N+I+ + A+G+P+F +SF+++P+ 
Sbjct  351   LVLKGA------FCKSVLQVILGTAILTLCADPLMDNIIRLANAIGMPSFFLSFIIVPLA  404

Query  511   INGRMAIAAIFPASQKSSKAASLT---FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             IN R AI AI   S  S ++++ +   FSEIY  V ++N+ G+ ++L V+YA++LTW+YS
Sbjct  405   INARTAITAISLLSSTSQQSSTTSSLTFSEIYVRVILNNIMGMSTVLFVLYAKDLTWEYS  464

Query  340   AEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
              EVL   V+    G  A+ +TTY LWT I AF LYP SL L Y+  
Sbjct  465   VEVLTSMVVCAVTGLFAFVRTTYPLWTCIIAFLLYPISLVLLYLFH  510


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 110/180 (61%), Gaps = 17/180 (9%)
 Frame = -1

Query  1291  LKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafll  1112
             +K L   GI T+  T + AG+M LSL PF+++  ++++SS+ G+RI +LVALI++V  LL
Sbjct  1     MKDLKSTGIITNDLTGYIAGVMFLSLAPFIIMLFIDIISSSVGKRITILVALIVSVTLLL  60

Query  1111  AYFGYQIIDPTIQKRSLHYSRFENL---------------LTQNGKPNVSRIRLFFHLYD  977
             +YF YQ+ +P IQ++ L Y R+ENL               L ++G+P+++ ++  F   D
Sbjct  61    SYFAYQMWNPLIQEKCLEYIRYENLVKVFVEHIQRQARGNLFKDGRPDINVLKGLFTKAD  120

Query  976   SDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLL  803
              D +  ++  ELE+ +  + + +V+     A+ T+ +  D++G+ RI E+EF+ G + L+
Sbjct  121   KDRSNSITLTELEELVNQLESGKVKVDSNFALSTLSRIFDKNGDERINEEEFIEGCKKLI  180



>gb|ACN36915.1| unknown [Zea mays]
Length=455

 Score =   182 bits (461),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 144/458 (31%), Positives = 225/458 (49%), Gaps = 54/458 (12%)
 Frame = -1

Query  1420  AGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSF  1241
             AG+T+F LT+LWG CV+VG+ D     +++     T+ F      +L   G++TD  TS+
Sbjct  5     AGSTVFLLTLLWGTCVVVGKCDLGPG-REAVDVTDTKGF------SLTGTGVTTDVQTSY  57

Query  1240  TAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSL  1061
              A +M LS++PF++ +   ++ +  GQR+ +L+AL+++ A +LAY  YQ+  P IQ+R L
Sbjct  58    AARIMGLSVIPFIIAQFPKMLKTHHGQRLAMLLALVVSFALVLAYCLYQVFQPWIQRRKL  117

Query  1060  HYSRFEN----------------LLTQNGKPNVSRIR-----------------------  998
              Y++ ++                LL  +G PN   IR                       
Sbjct  118   AYAKHKHVISGILRHAQMQSLGRLLNDDGTPNEQVIRKCDSFPLSQLLSVVWPVVRSLAH  177

Query  997   -----LFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRIT  839
                    F   D D ++ +S  EL   +  I  +EV   R  AV  +M D D   N  + 
Sbjct  178   CFRSCRLFRKIDMDESRSLSRAELHALIVGINFEEVDFDRTDAVDKVMDDFDTSRNDVVE  237

Query  838   EQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW  659
             E+EF+ G+   L     +     A  +       +    E         E     +   W
Sbjct  238   EEEFVQGMRKWLDEARRSVPVGGAFSSKFIHEYHERTRQEHDELVDRSDEAVESVENPGW  297

Query  658   DFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIF  479
                  V  ++LG A     A PL+  V  FS A  +P+F ISF+ LP+  N   A++AI 
Sbjct  298   CIAKAVALLLLGSAAAAAFADPLVDAVHGFSNATRIPSFFISFIALPLATNSSEAVSAII  357

Query  478   PASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIG  299
              AS+K  +  SLTFSE+Y GVTM+N   L   LA++Y R LTWD+S+EVL++ ++ + + 
Sbjct  358   FASRKKQRTCSLTFSEVYGGVTMNNTLCLGVFLALIYFRNLTWDFSSEVLIILLVCVVMA  417

Query  298   FLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
                 F+TT+ LWT + A+ LYP SL + Y+L  + GW+
Sbjct  418   LFTSFRTTFPLWTCLVAYTLYPLSLIIVYILDYVFGWS  455



>gb|KEH38643.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=443

 Score =   181 bits (459),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 136/389 (35%), Positives = 208/389 (53%), Gaps = 24/389 (6%)
 Frame = -1

Query  1282  LNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYF  1103
             L   G+STD  TS+ A +M++S++PF++V+L  ++ S SG+ + VL+  +++V  L++Y 
Sbjct  55    LTGSGVSTDIWTSYAARIMIISVIPFLIVQLPQILHSNSGRHLAVLIGFVVSVCLLISYC  114

Query  1102  GYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSD  971
              YQI  P IQ+R L Y + ++                LL  +G+P+   I+  F   D +
Sbjct  115   LYQIFQPWIQRRKLEYIKHKHVIVGLLRHLKMRSLGRLLKDDGQPDKEVIKKLFTTIDEN  174

Query  970   NNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLan  797
              +  ++  E+   +  I  +E+      AV  +M D D   N  I E EF+NG+   L  
Sbjct  175   KDGHLTHGEMRALVVGIQFEEIDLDHDDAVTKIMADFDTSRNQLIDEGEFVNGVCRWLLA  234

Query  796   nssadnaaaatptstPE-----NDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQV  632
                +  A+      T +     + + ++  +  +      E A G +   W  I   L +
Sbjct  235   TQRSRVASGDAGPHTVKFLSDFHTETKREHDLLDVGGQSDEGAEGVENARWISIKAGLFL  294

Query  631   ILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKA  452
             +LG  I    A PL+  V  FS A  +P F ISF+ LP+  N   A++AI  AS+   + 
Sbjct  295   LLGSLIAAAFADPLVDVVDNFSDATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQT  354

Query  451   ASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTY  272
             ASLTFSEIY  VTM+N+  L   LA+VY R LTWD+S+EVLV+ ++ + +G  A F+T +
Sbjct  355   ASLTFSEIYGAVTMNNVLCLSVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTVF  414

Query  271   QLWTSIFAFFLYPFSLALFYVLQL-LGWN  188
              LWTSI A  LYPFSLAL YVL    GW+
Sbjct  415   PLWTSITAILLYPFSLALVYVLDYQFGWS  443



>ref|XP_009340418.1| PREDICTED: uncharacterized protein LOC103932516 [Pyrus x bretschneideri]
Length=725

 Score =   185 bits (469),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 193/336 (57%), Gaps = 22/336 (7%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
             Q+    S L L G     S+ S+C+  YGF PC++++ G++F +V+++YL+   E  +++
Sbjct  49    QNQSSGSLLLLKGVENIDSTESSCEQLYGFLPCSDSVFGHVFLMVVYEYLLFHGESYLAA  108

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
               ++IF  LG G+FGA+ F ++   P  ++ ++SG FNS+E AQ  V+ G+ + AG++I 
Sbjct  109   GGEQIFKILGPGVFGASAFHVIGALPESLLLLASGFFNSKEVAQEYVYTGVGLLAGSSIL  168

Query  1402  NLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK---TLNECGISTDASTSFTAG  1232
             +LTVLWG CVIV  ++ +  +    S  S  S  S W +   +L +CGI+TD  TS  A 
Sbjct  169   SLTVLWGTCVIVSSQEFSDHQSSKASNESDSSLLS-WKRLPASLTDCGITTDLETSSLAK  227

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +M+ S+VPF+++++  +  S+SG+RI +L AL ++V FLL YF YQI  P +QKR L + 
Sbjct  228   IMICSVVPFLIMQMAKIFPSSSGERIAILTALSVSVVFLLLYFIYQIFHPWVQKRRLEFV  287

Query  1051  RFENL----------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI  920
             +  +L                LT  G PN+  IR  F   D D +  +S  E+++ L  I
Sbjct  288   KHGHLISSILQHVQKHALARVLTVKGAPNIPAIRRLFEEVDEDGDNYISLTEVKELLHEI  347

Query  919   --VTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNG  818
               ++ E  +      +MK  D D + +I + EF+NG
Sbjct  348   KFISTEDDKDKGTAEVMKQFDLDHDGKINKDEFING  383


 Score =   184 bits (468),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/317 (34%), Positives = 175/317 (55%), Gaps = 24/317 (8%)
 Frame = -1

Query  1099  YQIIDPTIQKRSLHYSRFENLL----------------TQNGKPNVSRIRLFFHLYDSDN  968
             Y++  P I+ R       +NL+                T +G P++  IR  F   D D 
Sbjct  407   YEVFQPWIENRRREREMKKNLMSEVLRHVQSNSLGSIVTNDGMPDIPNIRRLFEKIDLDG  466

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             N  +S  EL K +  I   ++   V  +V  ++++LD  G+  I+E+EF+ G+   +  +
Sbjct  467   NNCISQSELRKLIGDIKFGKIPGDVDESVVKLIEELDTSGDQLISEEEFVTGLTKWINKS  526

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqag-gEKMGTWDFIVTVLQVILGVA  617
             +     +  +     E+D  +++ +ET+    E   +G       W ++  +  +++G  
Sbjct  527   NDQAPPSLES-----EDDIYQRTWDETDKLVDEEYSSGGAVDKSKWAWMKAITYLVVGFV  581

Query  616   ILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTF  437
             +L   A+PL+ +V  FS A  +P+F +SFV++P+  N R A +AI  AS+K+ +  SLTF
Sbjct  582   VLAVLAEPLIDSVQDFSTAASIPSFFVSFVLVPLATNARQAASAIKAASRKTPRTTSLTF  641

Query  436   SEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTS  257
             SEIY GV M+N+ G   LLA++YARE+TWD+SAEVLVV ++   +G +A F +T+ LWTS
Sbjct  642   SEIYGGVFMNNVLGFSVLLAIIYAREMTWDFSAEVLVVLIVCTVMGLIASFVSTFSLWTS  701

Query  256   IFAFFLYPFSLALFYVL  206
               A+ LYP SL L Y+L
Sbjct  702   FLAYLLYPISLLLVYIL  718



>ref|XP_008386229.1| PREDICTED: uncharacterized protein LOC103448738 [Malus domestica]
 ref|XP_008359329.1| PREDICTED: uncharacterized protein LOC103423037 [Malus domestica]
Length=725

 Score =   184 bits (468),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/318 (34%), Positives = 174/318 (55%), Gaps = 24/318 (8%)
 Frame = -1

Query  1099  YQIIDPTIQKRSLHYSRFENLL----------------TQNGKPNVSRIRLFFHLYDSDN  968
             Y++  P I+ R       +NL+                T +G P++  IR  F   D D 
Sbjct  407   YEVFQPWIENRRREREMKKNLMSEVLRHVQSNSLGSIVTNDGMPDIPNIRRLFEKIDLDG  466

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             N  +S  EL K +  I   ++   V  +V  ++++LD  G+  I+E+EF+ G+   +  +
Sbjct  467   NNYISQSELRKLIGDIKFGKIPGDVDESVVKLIEELDTSGDQLISEEEFVTGLTKWINKS  526

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqag-gEKMGTWDFIVTVLQVILGVA  617
             +     +  +     E+D  +++ +ET+    E   +G       W ++  +  ++LG  
Sbjct  527   NDQAPPSLES-----EDDIYQRTWDETDKLVDEEYSSGGAVDKSKWAWMKAITYLVLGFV  581

Query  616   ILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTF  437
             +L   A+PL+ +V  FS A  +P+F +SFV++P+  N R A +AI  AS+K+ +  SLTF
Sbjct  582   VLAVLAEPLIDSVQDFSTAASIPSFFVSFVLVPLATNARQATSAIKAASRKTPRTTSLTF  641

Query  436   SEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTS  257
             SEIY GV M+N+ G   LLA++YARE+ WD+SAEVLVV ++   +G +A F +T+ LWTS
Sbjct  642   SEIYGGVFMNNVLGFSVLLAIIYAREMAWDFSAEVLVVLIVCTVMGLIASFVSTFSLWTS  701

Query  256   IFAFFLYPFSLALFYVLQ  203
               A+ LYP SL L Y+L 
Sbjct  702   FLAYLLYPISLLLVYILN  719


 Score =   183 bits (464),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 192/336 (57%), Gaps = 22/336 (7%)
 Frame = -1

Query  1762  QSVDQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSS  1583
             Q+    S L L G     S+ S+C+  YGF PC++++ G++F +V+++YL+   E  +++
Sbjct  49    QNQSSCSLLLLKGVENIDSTESSCEQLYGFLPCSDSVFGHVFLMVVYEYLLFHGESYLAA  108

Query  1582  SSKKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIF  1403
               ++IF  LG G+FGA+ F ++   P  ++ ++SG FNS+E AQ  V+ G+ + AG++I 
Sbjct  109   GGEQIFKILGPGVFGASAFHVIGALPESLLLLASGFFNSKEVAQEYVYTGVGLLAGSSIL  168

Query  1402  NLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK---TLNECGISTDASTSFTAG  1232
             +LT+LWG CVIV  ++ +  +    S  S  S  S W +   +L  CGI+TD  TS  A 
Sbjct  169   SLTILWGTCVIVSSQZFSDNQSSKASNESDSSLLS-WKRLPASLTXCGITTDLETSSLAK  227

Query  1231  LMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYS  1052
             +M+ S+VPF+++++  +  S+SG+RI +L AL ++V FLL YF YQI  P +QKR L + 
Sbjct  228   IMICSVVPFLIMQMAKIFPSSSGERIAILTALSVSVVFLLLYFIYQIFRPWVQKRRLEFV  287

Query  1051  RFENL----------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI  920
             +  +L                LT  G PN+  IR  F   D D +  +S  E+++ LR I
Sbjct  288   KHGHLISSILQHVQKHALARVLTVKGAPNIPAIRRLFEEVDEDGDNYISLTEVKELLREI  347

Query  919   --VTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNG  818
               ++ E         +MK  D D + +I + EF+NG
Sbjct  348   KFISTEDDTDKGTAEVMKQFDLDHDGKINKDEFING  383



>ref|XP_007213499.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
 gb|EMJ14698.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
Length=645

 Score =   182 bits (463),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 178/292 (61%), Gaps = 7/292 (2%)
 Frame = -1

Query  1069  RSLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV-  893
             R +  +   ++LT++G P++  IR  F   D D N  +S  EL++ +  I   ++   + 
Sbjct  350   RHVQSNSLGSILTEDGMPDIPNIRRLFEKIDLDGNNNISQAELKELIADIKFGKIPGDMD  409

Query  892   -AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEE  716
              +V  ++++LD +G+  I+E+EF+ G+   +  ++     +++  +   E+D  +++ EE
Sbjct  410   ESVVKLIEELDTNGDKMISEEEFVTGLTKWINKSNGTQPPSSSRES---EDDIYQRTWEE  466

Query  715   TNgaageveqaggEKMGT--WDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTF  542
             T+    E +  GG  +    W ++  +  ++LG  +L   A+PL+ +V  FS A G+P+F
Sbjct  467   TDRLVDEEKGEGGSSVDKSIWAWLKAITYLVLGFVVLAVLAEPLIDSVQAFSEAAGIPSF  526

Query  541   IISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAR  362
              ++FV++P+  N R A +AI  AS+K+ +  SLTFSEIY GV M+N+ G+  LLA++YAR
Sbjct  527   CVAFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGVSVLLAIIYAR  586

Query  361   ELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL  206
             E+TW++SAE+LVV ++   +G +A F +T+ LWT+   + LYP SL L Y+L
Sbjct  587   EMTWEFSAELLVVLIVCTVMGIIASFVSTFSLWTAFLTYLLYPVSLLLVYLL  638


 Score =   173 bits (438),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 187/319 (59%), Gaps = 29/319 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC+ ++ G +F +V++++L+   E  +++  ++IF  LG G+FGA+ F +L
Sbjct  3     TCEQLYGFLPCSNSVYGQVFLMVVYEFLLFHGESYLAAGGEQIFQILGPGVFGASAFHVL  62

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ ++SG+FNS++ A   V+ G+ + AG +I  LT+LWG CVIVG +D    E 
Sbjct  63    GALPESLLLLASGLFNSKDIAAEYVYTGVGLLAGTSILLLTILWGTCVIVGSQD-FPNEL  121

Query  1336  DSQSQPSTQSFAS---NWLK---TLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVS  1175
              S S+ S  S +S   +W +   +L  CGI+TD  TS  A +M+ S  PF+++++ N+  
Sbjct  122   SSDSEASKDSISSPPLSWKRLPASLTGCGITTDVETSRLARIMICSGAPFLIMQIANIFQ  181

Query  1174  SASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN---------------  1040
             S+S +RI +L+AL ++V FLL YF YQI  P +QKR L + +  +               
Sbjct  182   SSSKERIAILIALCVSVFFLLLYFIYQIFQPWVQKRRLEFVKHGHLVSSILQHVQKHALG  241

Query  1039  -LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL---RLIVTDEVQRMVAVKTMMK  872
              LLT  G PN+  IR  F   D D +  +S  E+++ L   + I T++ +     + M +
Sbjct  242   RLLTVQGAPNLYAIRRLFEEVDEDGDNYISLSEVKELLLEIKFISTEDDKDKGTAEVMKQ  301

Query  871   -DLDRDGNSRITEQEFLNG  818
              DLDRDG  +IT+ EF+NG
Sbjct  302   FDLDRDG--KITKDEFING  318



>gb|KCW44589.1| hypothetical protein EUGRSUZ_L01893 [Eucalyptus grandis]
Length=422

 Score =   179 bits (453),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 226/434 (52%), Gaps = 44/434 (10%)
 Frame = -1

Query  1399  LTVLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLL  1220
             LTV+WG CV+VG+ D   Q+  +  +  T+ F      +L   GI+ D  T   A +M++
Sbjct  3     LTVIWGSCVLVGKCD--LQDSTAVDKLDTKGF------SLTGSGITIDNLTRSAAWIMVI  54

Query  1219  SlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHY-----  1055
             S++PF++++L+ ++ S SG+ + VL+ALI++V  L++Y  YQ+    IQ R + Y     
Sbjct  55    SVIPFLVIQLLQLLDSTSGRHVAVLIALILSVVLLISYCLYQVFQRQIQVRRMKYWEERR  114

Query  1054  -----------SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDE  908
                             L+  +G+ N   +   F   D++N+  +++ EL+ F+  I  +E
Sbjct  115   VIFGFLGHVKKRAIGRLMKDDGEVNTEIVYKIFKTIDTNNDDHLTASELKAFVIGIRFEE  174

Query  907   VQRMVA-VKTMMKDLDRDGNSRITEQEFLNGIENLLannss------------adnaaaa  767
             +    +    +M   D   ++R++  EF  GI+  L                 A      
Sbjct  175   IDLDASDADKIMAAFDTSHDNRLSYDEFRKGIKKCLKKAVRSGKGSNLKNVVDAIKIIDH  234

Query  766   tptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLM  587
                      +Q   GE+++     VE      +        V  +ILG  I    A PL+
Sbjct  235   AGHQAKNEHEQLLEGEQSDVVVEIVENVKMTSLKA------VGLLILGTVIAAAFADPLV  288

Query  586   TNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMS  407
               V  FS A G+PTF ISF+VLP+  N   A++AI  AS+K  K ASLTFSE+Y  VT++
Sbjct  289   DAVDYFSDATGIPTFFISFIVLPLATNSSEAVSAIIFASRKKQKTASLTFSELYGAVTVN  348

Query  406   NLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFS  227
             NL  L   LA+VY R LTWD+++EV+V+ ++ + +G  A F+TT+ LWT   AF LYPFS
Sbjct  349   NLLCLAVFLALVYIRGLTWDFTSEVIVILIVCIVMGIFASFRTTFPLWTVSVAFILYPFS  408

Query  226   LALFYVLQ-LLGWN  188
             LAL YVL  +LGW+
Sbjct  409   LALVYVLDYVLGWS  422



>ref|XP_006370033.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
 gb|ERP66602.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
Length=632

 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/280 (38%), Positives = 162/280 (58%), Gaps = 7/280 (3%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKD  869
             NL+ ++G P+   IR  F   D D +  +S  EL++ ++ I   ++   V  A + +M+ 
Sbjct  350   NLIKEDGTPDSPTIRRLFEEIDRDADNCISKDELKELMKKIEIGKISWDVDEAAEKIMEA  409

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD  G+  I E+EF  GI + L N S      ++      ++D+  ++ EE +    + +
Sbjct  410   LDTSGDQMIDEKEFAEGIVSWLINTSENVTPVSSRS----QDDNNRRTWEEVDKLLKDEK  465

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                 +K  +W +   ++ ++LGVAIL+  A+PL+ +V  FS   G+P+F +SFV++P+  
Sbjct  466   TNAVDK-SSWAWFKAIMSMVLGVAILSVLAEPLIHSVQNFSEDAGIPSFFVSFVLVPLAT  524

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  A +K S   SLTFSEIY GV M+N+ G   LL +VYAR LTW++SAEVL
Sbjct  525   NARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSVLLFLVYARGLTWEFSAEVL  584

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             VV +    +  +  F + + LWTS  AF LYPFSL L YV
Sbjct  585   VVLITCAIMSLVVSFHSDFPLWTSFMAFLLYPFSLLLAYV  624


 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/309 (34%), Positives = 176/309 (57%), Gaps = 47/309 (15%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +KIF  LG G+FGA+ F++L 
Sbjct  9     CEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGEKIFRILGPGVFGASAFQVLG  68

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ ++SG+ N++E AQ  V  G+ + AG +I  LT+LWG CVI G          
Sbjct  69    ALPESLILLASGLLNTREVAQEYVSTGVGLLAGTSILLLTMLWGTCVIAG----------  118

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
                     SF           G++TD  TS+TA +M LS++PF+++++  + +S SG+ +
Sbjct  119   --------SF-----------GVTTDLETSYTARIMGLSVLPFLILQIPKIFNSNSGEYL  159

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFE----------------NLLTQNG  1022
              +L++L+++VA LL YF YQI +P IQKR L Y +++                ++LT  G
Sbjct  160   TILISLVVSVASLLIYFFYQIFEPWIQKRRLEYVKYDEALLRILQLVQERALGSILTGEG  219

Query  1021  KPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDRDGNS  848
              PN++ I+  F   D D +  +S  E+ K L  I +    + +  A + ++K LD + + 
Sbjct  220   APNINAIQRLFEEIDEDGDDCISPSEVRKLLLDIKSTGMNIDKDNASEELIKVLDLNDDK  279

Query  847   RITEQEFLN  821
             +IT++EF++
Sbjct  280   KITKEEFVH  288



>gb|KCW67430.1| hypothetical protein EUGRSUZ_F01186 [Eucalyptus grandis]
Length=649

 Score =   180 bits (457),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 114/311 (37%), Positives = 180/311 (58%), Gaps = 19/311 (6%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC+ +  G+LF I++++YL+   E  V+S++++IF+ LG GIFGA+ F +L   P 
Sbjct  2     YGFLPCSYSTAGHLFLILVYEYLLFHGESYVASATEQIFNMLGPGIFGASAFHVLGALPE  61

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQ  1322
              ++ ++SG+ NS+E AQ  V  G+ + AG++I  LT+LWG C+++G R+ +   + + S 
Sbjct  62    ALILLASGLLNSEEVAQEYVVTGVGLLAGSSILLLTLLWGTCILLGSREFSDGRESNPSN  121

Query  1321  PSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlv  1142
              S  S    ++ T    GI TD  TS+TA +M+ S +PF+++++  + S +S QRIV+L 
Sbjct  122   SSKLSL-KKFVSTFKGSGIITDLETSYTARIMVFSAIPFIMIQIPEIFSISSAQRIVILC  180

Query  1141  aliitvafllAYFGYQIIDPTIQKRSLHYSRF----------------ENLLTQNGKPNV  1010
              L ++V  LL YF YQI  P IQKR L Y +                 E LLT++G PN+
Sbjct  181   TLAVSVMLLLLYFFYQIFQPWIQKRRLEYVKHVHLIPRIIQHLQRKASERLLTEDGAPNL  240

Query  1009  SRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITE  836
               IR  F   D D +  +S  EL++ L  I    V   +  AV  ++K+ D D + RI +
Sbjct  241   RAIRRLFEDIDHDGDDALSPSELKELLLEIKFKNVHVDKDEAVDEVIKEFDIDSDQRIGK  300

Query  835   QEFLNGIENLL  803
              EF++G    L
Sbjct  301   DEFVDGFTKWL  311


 Score =   135 bits (339),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 150/274 (55%), Gaps = 24/274 (9%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV-------TDEVQRMVAV  887
             E L  +N  P++  IR  +  +D   +  +S  EL++ +  +         DEV     V
Sbjct  367   ETLFRENDTPDLPAIRRLYEQFDRSGDNTISQSELKELITGVKFGDTPFDIDEV-----V  421

Query  886   KTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNg  707
               +++  DR G+ +I E+EF+ G+  +    S ++ +          +D  +++ EET+ 
Sbjct  422   LKVIEVFDRSGDGQINEEEFIAGLVGIKNQASKSNTSL---------DDFYQETWEETDK  472

Query  706   aageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFV  527
                E    G E+     ++ ++L ++LGV I    A PL+++V  FS A GVP+F ISF+
Sbjct  473   VVDEENGKGHEEKSWQIWVESLLSLLLGVFISAVLADPLISSVQSFSKAAGVPSFFISFI  532

Query  526   VLPIVINGRMA---IAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYAREL  356
             ++P+  N R A   I AI  A  K ++  SLTFS+IY  V MSN+     LL ++YAR L
Sbjct  533   LVPLATNARGARGAIKAIKGARNKKARTTSLTFSKIYGEVFMSNVLSFSVLLLLIYARNL  592

Query  355   TWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             TW++SAEVLVV ++   +G  A F++T+ +WTSI
Sbjct  593   TWEFSAEVLVVLIVCGVVGLTASFRSTFPVWTSI  626



>ref|XP_008226451.1| PREDICTED: uncharacterized protein LOC103326025 [Prunus mume]
Length=725

 Score =   181 bits (458),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 104/318 (33%), Positives = 177/318 (56%), Gaps = 23/318 (7%)
 Frame = -1

Query  1099  YQIIDPTIQKRSLHYSRFENL----------------LTQNGKPNVSRIRLFFHLYDSDN  968
             Y++  P I+ R       +NL                LT++G P++  IR  F   D D 
Sbjct  404   YEVFQPWIENRRREREMKKNLMSEVLRHVQRNSLGSILTEDGMPDIPNIRRLFEKIDLDG  463

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             N  +S  EL++ +  I   ++   V  +V  ++++LD  G+  I+E+EF+ G+   +  +
Sbjct  464   NNNISQAELKELIADIKFGKIAGDVDESVVKLIEELDTSGDKMISEEEFVTGLTKWINKS  523

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqa--ggEKMGTWDFIVTVLQVILGV  620
                   +++  +   E+D  +++ EET+    E +           W ++  +  ++LG 
Sbjct  524   HGTQPPSSSHES---EDDIYQRTWEETDRLVDEEKSKGGSAVDKSIWAWLKAITYLVLGF  580

Query  619   AILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLT  440
              +L   A+PL+ +V  FS AV +P+F ++FV++P+  N R A +AI  AS+K+ +  SLT
Sbjct  581   VVLAVLAEPLIDSVQAFSTAVSIPSFCVAFVLVPLATNARQATSAIKAASRKTPRTTSLT  640

Query  439   FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWT  260
             FSEIY GV M+N+ G+  LLA++YARE+TW++SAE+LVV ++   +G  A   +T+ LWT
Sbjct  641   FSEIYGGVFMNNVLGVSVLLAIIYAREMTWEFSAELLVVLIVCTVMGVTASSVSTFSLWT  700

Query  259   SIFAFFLYPFSLALFYVL  206
             +  A+ LYP SL L Y+L
Sbjct  701   AFLAYLLYPVSLLLVYLL  718


 Score =   171 bits (432),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 186/318 (58%), Gaps = 27/318 (8%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC+ ++ G +F +V+++YL+   E  +++  ++IF  LG G+FGA+ F +L
Sbjct  65    TCEQLYGFLPCSNSVYGNVFLMVVYEYLLFHGESYLAAGGEQIFQILGPGVFGASAFHVL  124

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ-E  1340
                P  ++ ++SGIFNS++ A   V+ G+ + AG +I  LT+LWG C+IV  +D   +  
Sbjct  125   GALPESLLLLASGIFNSKDIAAEYVYTGVGLLAGTSILLLTILWGTCIIVSSQDFPNKLS  184

Query  1339  KDSQ-SQPSTQSFASNWLK---TLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSS  1172
              DS+ S+ S  S   +W +   +L  CGI+TD  TS  A +M+ S  PF+++++ N+  S
Sbjct  185   SDSEASRDSISSPPLSWKRLPASLTGCGITTDVETSRLARIMICSGAPFLIMQIANIFQS  244

Query  1171  ASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL---------------  1037
             +S +RI +LVAL ++V FLL YF YQI  P +QKR L + +  +L               
Sbjct  245   SSKERIAILVALCVSVFFLLLYFIYQIFQPWVQKRRLEFVKHGHLVSSILQHVQKHALGR  304

Query  1036  -LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL---RLIVTDEVQRMVAVKTMMK-  872
              LT  G PN+  IR  F   D D +  +S  E+++ L   + I T++ +     + M + 
Sbjct  305   VLTVQGAPNLYAIRRLFEEVDEDGDNYISLSEVKELLLEIKFISTEDDKDKGTAEVMKQF  364

Query  871   DLDRDGNSRITEQEFLNG  818
             DLDRDG  +IT+ EF+NG
Sbjct  365   DLDRDG--KITKDEFING  380



>emb|CDP05977.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   180 bits (456),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 174/319 (55%), Gaps = 31/319 (10%)
 Frame = -1

Query  1099  YQIIDPTIQKR----------------SLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDN  968
             Y+++ P IQK+                 +  S    LLT++G+P++  I+  F   D D 
Sbjct  402   YEVLQPWIQKKREEREIMKHIVSEILEHVQSSALGTLLTEDGEPDIIAIKRLFDSIDEDK  461

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             + ++S  EL+  L  I        V  AV  MM++LD DG+  + E+EF  G+   L  N
Sbjct  462   DNRISFSELKTLLTEIKFGPTSLSVDDAVAKMMEELDTDGDRMLNEEEFATGLSKWLQKN  521

Query  793   ssadnaaaatptstPENDDQ--EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGV  620
              +A   +        E++D+  +KS E+T+             +  W   + +L  +LG 
Sbjct  522   DNASTNSK-------ESEDEIFQKSWEQTDQLLEVESINK--SLLAWTKAIFLL--VLGT  570

Query  619   AILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLT  440
              +L   A+PL+ +V  FS A  +P+F ISF+++P+  N R+AI+AI  A +K  +  SLT
Sbjct  571   GMLGILAEPLIESVQNFSEAANMPSFFISFILVPLATNARVAISAISEARRKKPRTTSLT  630

Query  439   FSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWT  260
             FSEIY GV M+N+ G   LL+++Y R LTW +SAEVL+V ++S  +G L  F++   LWT
Sbjct  631   FSEIYGGVFMNNMLGFSVLLSLIYFRGLTWIFSAEVLIVLIVSAIMGLLGSFRSIIPLWT  690

Query  259   SIFAFFLYPFSLALFYVLQ  203
             S+ A+FLYP SL L Y+L 
Sbjct  691   SLVAYFLYPLSLVLVYLLH  709


 Score =   174 bits (440),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 120/335 (36%), Positives = 189/335 (56%), Gaps = 26/335 (8%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             + SSF+A  G      SS  C   YGF PC+  + G+LF IV+++YL+   E LV+S  +
Sbjct  47    ESSSFIAFKG----MDSSEGCKQLYGFLPCSNTLLGHLFLIVVYEYLLFRGESLVASGGE  102

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             +IF  LG GIFGA+ F +L   P  ++ ++SG+ NS+E AQ  V  G  + AG+TI  LT
Sbjct  103   RIFKILGPGIFGASAFHVLGSLPEALILLASGLLNSRETAQEYVLTGAGLLAGSTILLLT  162

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNEC---GISTDASTSFTAGLML  1223
             ++WG CVIV  ++    +K +    S+    S + +  +     G++ D  TS TA +M+
Sbjct  163   IVWGTCVIVASQEFPNGKKRTSFASSSTDNRSQFKRLFSRSKGYGLTMDTRTSHTARIMV  222

Query  1222  LSlvpfvlvelvnvVS-SASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF  1046
             LS++PF+ +++  V   S+SG+   ++++L+I+V FLL YF YQI  P IQ+R L Y + 
Sbjct  223   LSVMPFITIQVPVVFGLSSSGELAFIIISLLISVTFLLVYFFYQIFQPWIQRRRLEYIKH  282

Query  1045  ENL----------------LTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV-  917
             E+L                LT  G PNV+ IR  F   D D +  +S  EL++ L+ I  
Sbjct  283   EHLVVDILNHVQNHEIGAVLTPKGAPNVTAIRRLFRNTDHDGDNFISVTELQELLKEIKF  342

Query  916   -TDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGI  815
                E+ +  A   M++D D D + +I+  EF++G+
Sbjct  343   RNVELDKNEATAEMLRDFDLDADEKISIDEFVSGV  377



>gb|EYU26347.1| hypothetical protein MIMGU_mgv1a002045mg [Erythranthe guttata]
Length=723

 Score =   178 bits (452),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 114/319 (36%), Positives = 185/319 (58%), Gaps = 26/319 (8%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC++++ G+LF IV++++L+   E  V+S  ++IF  LG G+FGA+ F+++ 
Sbjct  69    CEQMYGFLPCSKSMTGHLFLIVVYEFLLFRGESYVASGGERIFKILGPGVFGASAFQVIG  128

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVG--RRDRATQE  1340
               P  ++ ++SG+ + +E A+  V  G+ + AG+TI  LT+LWG CVI+G  R    T  
Sbjct  129   SLPEALILLASGLLSKEESAEEFVVTGVGLLAGSTILILTLLWGTCVILGGQRFPHHTSS  188

Query  1339  KDSQSQ-PSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVS-SAS  1166
                ++Q P  +   S W       G+ TD  T++TA +MLLS+VP  L+++  V   S +
Sbjct  189   DHPKNQNPLEKILFSLW----PGYGVLTDTETNYTARIMLLSVVPLALMQVPKVFGFSPA  244

Query  1165  GQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT---------------  1031
             G+R+ V + L++++  LL+YF YQ  +P IQ+R L Y + E+L+                
Sbjct  245   GERVFVSIILVVSIVLLLSYFFYQFFEPWIQRRRLMYLKHEHLVVDILKHVQNQTKGKLI  304

Query  1030  -QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQR--MVAVKTMMKDLDR  860
              +NG PNVS IR  F   D D ++ +S  EL++FL+ I   ++Q         MMKD D 
Sbjct  305   GENGAPNVSTIRRLFEEKDQDMDKVISFHELKEFLQDIKFRKIQSGDDDTAAEMMKDFDL  364

Query  859   DGNSRITEQEFLNGIENLL  803
             D +++IT  EF+NG+   L
Sbjct  365   DNDAKITMDEFVNGMTKWL  383


 Score =   149 bits (376),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 167/322 (52%), Gaps = 27/322 (8%)
 Frame = -1

Query  1099  YQIIDPTIQKRS----------------LHYSRFENLLTQNGKPNVSRIRLFFHLYDSDN  968
             YQ++ P IQK+                 +  S + +LLT++  P++  I+  F   D D+
Sbjct  404   YQVLKPWIQKKKEEREMMKHLIPDVLEHIQTSMYGSLLTEDETPDIPAIKRLFKKIDLDD  463

Query  967   NQQMSSRELEKFLRLI---VTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLan  797
             +  +S  EL++ +  I   +       VA K +M++LD  G+  I+E+EF+ G+   L  
Sbjct  464   DNCLSYFELKELINNIKFGIIPYDADTVASK-IMEELDISGDHLISEEEFVTGLTKWLNT  522

Query  796   nssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVA  617
               +  + +             +K+ E+T+    +             ++  +  +ILG+ 
Sbjct  523   IYNLHHNSEENEEEDDS---YQKTWEQTDKLIEDKFI----DKSPLAWVKALALLILGIV  575

Query  616   ILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTF  437
             +L   A+PL+ +V  FS +  +P+F ++FV +P+    R+A++AI  A +K     SLT 
Sbjct  576   MLGVLAEPLIRSVRDFSKSANLPSFYVAFVFVPLATTARLAVSAISEARKKKLHTNSLTL  635

Query  436   SEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTS  257
             SEIY  V M+N+ GL+ LL+++Y R L+W +S EV +V V+S  +GFLA + T   +WT+
Sbjct  636   SEIYGTVFMNNVLGLIVLLSLIYFRGLSWSFSTEVTMVLVVSAVMGFLASYSTVLPVWTA  695

Query  256   IFAFFLYPFSLALFYVLQLLGW  191
               A+ +YP SL L YVL    W
Sbjct  696   FLAYLMYPLSLVLVYVLGENDW  717



>ref|XP_007021646.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY13171.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=714

 Score =   178 bits (451),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 193/318 (61%), Gaps = 21/318 (7%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC+ +I G+LF I++++YL+   E  ++S  +++F   G G FGA+ F+IL 
Sbjct  65    CEQMYGFLPCSNSIYGHLFLILVYEYLLFHGESYLASGGEQMFKIPGPGFFGASAFQILS  124

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
               P  ++ ++SG+ N++E AQ   + G+ + AG++I  LT++WG C+IVG  D +   + 
Sbjct  125   ALPEALILLASGLMNTKEVAQEYAYTGVGLLAGSSILLLTIIWGTCLIVGSHDLSNGAEY  184

Query  1333  S--QSQPSTQSFASN-WLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
             S   +  +++  + N  L +L+  GI TD  TS+TA +M+ S++PF +++L+N++ ++S 
Sbjct  185   SILSTNSNSRILSCNRLLHSLSGFGIITDQETSYTARIMVFSVIPFFIIQLLNMIPTSSA  244

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENL----------------LT  1031
             +++V+L+AL I+V FLL YF YQI  P IQKR L + + E+L                LT
Sbjct  245   KQVVILIALTISVIFLLLYFFYQIFQPWIQKRRLEFVKHEHLILKILQHVQKHAIGRILT  304

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKDLDRD  857
             ++G PNV  IR  F   D D +  +SS EL++ L  +      + +  A++ +MK+ D D
Sbjct  305   RDGSPNVYVIRRLFEEIDRDGDDYISSSELKELLLEVKFTRSHINKEKAIEEVMKEFDLD  364

Query  856   GNSRITEQEFLNGIENLL  803
             G+ +IT+ EF+NG    L
Sbjct  365   GDQKITKDEFVNGFTKWL  382


 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 140/248 (56%), Gaps = 6/248 (2%)
 Frame = -1

Query  1054  SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKT  881
             +R  +LLT++GKPN + IR  F   DSD +  +S  EL++ +  +   +V       V  
Sbjct  434   NRIGSLLTEDGKPNTAAIRRLFEKIDSDGDNCISQHELKELISDVKFGQVPLDANEVVTK  493

Query  880   MMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaa  701
             ++++LD  G+ RI +QEF+ GI   L  +    + ++       ++D   K+ EET+   
Sbjct  494   VIEELDTSGDRRIDQQEFVIGISKWLKTSEKEASPSSFES----QDDIYLKTWEETDKLV  549

Query  700   geveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVL  521
              E    G      W +I  ++ +++G+ IL   A+PL+ +V  FS A G+P+F  SF+++
Sbjct  550   DEESSNGVVDASKWAWIKAIMYMVIGIIILAVLAEPLIYSVQSFSEAAGIPSFFTSFILV  609

Query  520   PIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYS  341
             P   N R A +AI  A +K  +  SLTFSEIY GV M+N  G   L+A+VYAR LTW++S
Sbjct  610   PFATNARAATSAISAARRKKPRTTSLTFSEIYGGVFMNNTLGFSVLIALVYARGLTWEFS  669

Query  340   AEVLVVFV  317
              EVL V +
Sbjct  670   GEVLAVLL  677



>ref|XP_006594741.1| PREDICTED: uncharacterized protein LOC100798009 isoform X1 [Glycine 
max]
Length=712

 Score =   178 bits (451),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 131/379 (35%), Positives = 210/379 (55%), Gaps = 35/379 (9%)
 Frame = -1

Query  1882  LFILLLAVVLVQGRFLsdddgevvsdgvhdhyhahahaANQSVDQSSFLALGGPRLssss  1703
             +F+L+L  V VQGR+L +   E+VSDGVH+         N   +++S+L L G     S 
Sbjct  12    IFLLVLVTVEVQGRYLPERATELVSDGVHN---------NLQHNETSYLVLKGID-DESF  61

Query  1702  sSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFR  1523
                C   YGF PC  NI G+LF I++++YL+   E  ++   ++IF  LG GIFGA+ F+
Sbjct  62    EEPCKQMYGFLPCTNNIFGHLFLILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQ  121

Query  1522  ILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ  1343
             IL   P  ++ + SG+ +++E AQ   F G+ + AG++I  LTV+WG CVI G ++    
Sbjct  122   ILGALPESLILLVSGLVSNREIAQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEF---  178

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
             E DS   P++ S  ++    L  CGI+TD  TS+TA +M+ S++P  ++++ N+   +SG
Sbjct  179   EHDS---PTSNSAHTSLKALLTGCGITTDLETSYTARIMVCSVIPLAIMQIPNLFQFSSG  235

Query  1162  QRivvlvaliitvaf-llAYFGYQIIDPTIQKRSLHYSRFENLL----------------  1034
              R V LV  ++  +  L  YF YQI +P +QKR L Y + ++L+                
Sbjct  236   LRSVTLVIALLITSIFLFLYFVYQIFEPWVQKRRLEYVKHDHLILKILQHVQKNTLQRIF  295

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL--RLIVTDEVQRMVAVKTMMKDLDR  860
             T+NG PNVS IR  +   D D +  +S+ E++  L    +          +K ++K  D 
Sbjct  296   TKNGTPNVSAIRRLYREIDQDGSSGISASEVKDLLLKNKVTETNFDEEKEIKEVLKVFDL  355

Query  859   DGNSRITEQEFLNGIENLL  803
             DG+ +I ++EF++G    L
Sbjct  356   DGDKKINKEEFVSGFTKWL  374


 Score =   159 bits (401),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 94/288 (33%), Positives = 158/288 (55%), Gaps = 8/288 (3%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKD  869
             +LLT++GKP+   IR  F   D + +  +S  EL++ +  I  V   ++   AV  ++++
Sbjct  430   SLLTEDGKPDQHAIRGLFEKIDRNRDNFISQSELKELIMNIKFVKASMEVEEAVALVIEE  489

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD D +  I E+EF+ G E  L++ S+    + +        +D  ++ EE +    E +
Sbjct  490   LDIDKDRTINEKEFVAGFEKWLSSTSAPAPVSDSES-----QEDMFQTWEEADIVVEERQ  544

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                      W +I  +  V+LG+A+L+  A+PL  +V  FS + G   F +SF++ P+  
Sbjct  545   NNAVVDKSIWAWIKAITYVMLGIAMLSILAEPLTESVHNFSNSAGFHPFFMSFILAPLAT  604

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  AS K  +  SL  SEIY GV M+N+ G  ++  +++ RE+TW +SAE+L
Sbjct  605   NAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLIFVREVTWQFSAELL  664

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             VV ++    G  A F + + +W+S  A  LYP SL L ++L  +L +N
Sbjct  665   VVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVFILDHVLNYN  712



>ref|XP_011000237.1| PREDICTED: uncharacterized protein LOC105107867 isoform X3 [Populus 
euphratica]
Length=702

 Score =   176 bits (447),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/317 (35%), Positives = 166/317 (52%), Gaps = 23/317 (7%)
 Frame = -1

Query  1099  YQIIDPTIQ-KRSLHYSR---------------FENLLTQNGKPNVSRIRLFFHLYDSDN  968
             YQ+  P ++ KR  H  +                 NL+ ++G P+   IR  F   D D 
Sbjct  385   YQVFHPFVESKRKEHEMKRNLISEIVSHLQSDALGNLIKEDGTPDFLTIRRLFEEIDRDE  444

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             +  +S  EL + ++ I   ++   V  A + +M+ LD  G+  I E+EF  GI   L N 
Sbjct  445   DNCISKDELTELMKKIEIGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWLINT  504

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
             S      +        +D+   + EE +    + +    +K  +W +   ++ ++LG AI
Sbjct  505   SENVTPGSTRS----RDDNNRGTWEEVDKLLKDEKTNAVDK-SSWAWFKAIMSMVLGAAI  559

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
             L+  A+PL+ +V  FS   G+P+F +SFV+ P+  N R A +AI  A +K S   SLTFS
Sbjct  560   LSVLAEPLIHSVQNFSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFS  619

Query  433   EIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             EIY GV M+N+ G   LL ++YAR LTW++SAEVLVV +    +     F++ + LWTS 
Sbjct  620   EIYGGVFMNNVLGCSVLLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSF  679

Query  253   FAFFLYPFSLALFYVLQ  203
              AF LYPFSL L YVL 
Sbjct  680   MAFLLYPFSLLLVYVLN  696


 Score =   145 bits (366),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 107/334 (32%), Positives = 184/334 (55%), Gaps = 46/334 (14%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QSS L L G  + +SS   C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +
Sbjct  48    NQSSILLLKG--MDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGE  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             KIF  LG G+FGA+ F++L   P                 ++ +  G+ + AG +I  LT
Sbjct  106   KIFRILGPGVFGASAFQVLGALP-----------------ESLILLGVGLLAGTSILLLT  148

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK-----TLNECGISTDASTSFTAGL  1229
             VLWG CVIVG    + Q        ++ S   +WL      +  + G++TD  TS+TA +
Sbjct  149   VLWGTCVIVG----SIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETSYTARI  204

Query  1228  MLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR  1049
             M LS++PF+++++  + +S+SG+ + +L++L+++V  LL YF YQI +P IQKR L Y +
Sbjct  205   MGLSVIPFLILQIPKIFNSSSGEYLTILISLVVSVVSLLIYFFYQIFEPWIQKRRLQYVK  264

Query  1048  FEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV  917
             ++                 +LT  G PN++ I+  F   D D +  +S  E+ + L  I 
Sbjct  265   YDEALLRILQLVQERALGRILTVEGAPNINAIQRLFDEIDEDGDDSISPSEVRELLLDIK  324

Query  916   TD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
             +    + +  A + ++K LD + + +IT++EF++
Sbjct  325   STGMNINKDNASEELIKVLDLNDDKKITKEEFVH  358



>ref|XP_009603995.1| PREDICTED: uncharacterized protein LOC104098869 [Nicotiana tomentosiformis]
Length=303

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 156/228 (68%), Gaps = 3/228 (1%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QS +L+LG  +   +S   C H YGFFPCAENI GY++ I IFQYL+ + E+++S  S 
Sbjct  45    NQSDYLSLGSSKALITSGDQCKHIYGFFPCAENIGGYIYMIAIFQYLLILGEKVLSKGSN  104

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             ++F  L TGIFGA++F  L+ +PRI+M   SG+  ++E AQ  V   +  N G+++ NLT
Sbjct  105   RLFSILDTGIFGASIFPTLITWPRIVMAFVSGLLINREQAQVSVSSSLGSNVGSSVLNLT  164

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSl  1214
             VLWG+CVI+GR++ +    +S +Q +  S ++  LK L   GI T+  T + AG+M LSL
Sbjct  165   VLWGICVILGRQNISV---NSNTQSAESSSSTLKLKDLKITGIITNDLTGYIAGVMFLSL  221

Query  1213  vpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQK  1070
              PF+++  V+++SS+ G+RI +LVALI++V  LL+YF YQ+ +P IQ+
Sbjct  222   APFIIMLFVDIISSSVGKRITILVALIVSVTLLLSYFAYQMWNPLIQE  269



>ref|XP_011000235.1| PREDICTED: uncharacterized protein LOC105107867 isoform X1 [Populus 
euphratica]
Length=719

 Score =   176 bits (447),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/317 (35%), Positives = 166/317 (52%), Gaps = 23/317 (7%)
 Frame = -1

Query  1099  YQIIDPTIQ-KRSLHYSR---------------FENLLTQNGKPNVSRIRLFFHLYDSDN  968
             YQ+  P ++ KR  H  +                 NL+ ++G P+   IR  F   D D 
Sbjct  402   YQVFHPFVESKRKEHEMKRNLISEIVSHLQSDALGNLIKEDGTPDFLTIRRLFEEIDRDE  461

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             +  +S  EL + ++ I   ++   V  A + +M+ LD  G+  I E+EF  GI   L N 
Sbjct  462   DNCISKDELTELMKKIEIGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWLINT  521

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
             S      +        +D+   + EE +    + +    +K  +W +   ++ ++LG AI
Sbjct  522   SENVTPGSTRS----RDDNNRGTWEEVDKLLKDEKTNAVDK-SSWAWFKAIMSMVLGAAI  576

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
             L+  A+PL+ +V  FS   G+P+F +SFV+ P+  N R A +AI  A +K S   SLTFS
Sbjct  577   LSVLAEPLIHSVQNFSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFS  636

Query  433   EIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             EIY GV M+N+ G   LL ++YAR LTW++SAEVLVV +    +     F++ + LWTS 
Sbjct  637   EIYGGVFMNNVLGCSVLLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSF  696

Query  253   FAFFLYPFSLALFYVLQ  203
              AF LYPFSL L YVL 
Sbjct  697   MAFLLYPFSLLLVYVLN  713


 Score =   165 bits (418),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 113/334 (34%), Positives = 194/334 (58%), Gaps = 29/334 (9%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QSS L L G  + +SS   C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +
Sbjct  48    NQSSILLLKG--MDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGE  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             KIF  LG G+FGA+ F++L   P  ++ ++SG+  ++E AQ  V  G+ + AG +I  LT
Sbjct  106   KIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLLAGTSILLLT  165

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK-----TLNECGISTDASTSFTAGL  1229
             VLWG CVIVG    + Q        ++ S   +WL      +  + G++TD  TS+TA +
Sbjct  166   VLWGTCVIVG----SIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETSYTARI  221

Query  1228  MLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR  1049
             M LS++PF+++++  + +S+SG+ + +L++L+++V  LL YF YQI +P IQKR L Y +
Sbjct  222   MGLSVIPFLILQIPKIFNSSSGEYLTILISLVVSVVSLLIYFFYQIFEPWIQKRRLQYVK  281

Query  1048  FEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV  917
             ++                 +LT  G PN++ I+  F   D D +  +S  E+ + L  I 
Sbjct  282   YDEALLRILQLVQERALGRILTVEGAPNINAIQRLFDEIDEDGDDSISPSEVRELLLDIK  341

Query  916   TD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
             +    + +  A + ++K LD + + +IT++EF++
Sbjct  342   STGMNINKDNASEELIKVLDLNDDKKITKEEFVH  375



>ref|XP_011000236.1| PREDICTED: uncharacterized protein LOC105107867 isoform X2 [Populus 
euphratica]
Length=711

 Score =   176 bits (446),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/317 (35%), Positives = 166/317 (52%), Gaps = 23/317 (7%)
 Frame = -1

Query  1099  YQIIDPTIQ-KRSLHYSR---------------FENLLTQNGKPNVSRIRLFFHLYDSDN  968
             YQ+  P ++ KR  H  +                 NL+ ++G P+   IR  F   D D 
Sbjct  394   YQVFHPFVESKRKEHEMKRNLISEIVSHLQSDALGNLIKEDGTPDFLTIRRLFEEIDRDE  453

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             +  +S  EL + ++ I   ++   V  A + +M+ LD  G+  I E+EF  GI   L N 
Sbjct  454   DNCISKDELTELMKKIEIGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWLINT  513

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
             S      +        +D+   + EE +    + +    +K  +W +   ++ ++LG AI
Sbjct  514   SENVTPGSTRS----RDDNNRGTWEEVDKLLKDEKTNAVDK-SSWAWFKAIMSMVLGAAI  568

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
             L+  A+PL+ +V  FS   G+P+F +SFV+ P+  N R A +AI  A +K S   SLTFS
Sbjct  569   LSVLAEPLIHSVQNFSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFS  628

Query  433   EIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             EIY GV M+N+ G   LL ++YAR LTW++SAEVLVV +    +     F++ + LWTS 
Sbjct  629   EIYGGVFMNNVLGCSVLLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSF  688

Query  253   FAFFLYPFSLALFYVLQ  203
              AF LYPFSL L YVL 
Sbjct  689   MAFLLYPFSLLLVYVLN  705


 Score =   169 bits (428),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 194/330 (59%), Gaps = 29/330 (9%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QSS L L G  + +SS   C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +
Sbjct  48    NQSSILLLKG--MDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGE  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             KIF  LG G+FGA+ F++L   P  ++ ++SG+  ++E AQ  V  G+ + AG +I  LT
Sbjct  106   KIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLLAGTSILLLT  165

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWL-KTLNECGISTDASTSFTAGLMLLS  1217
             VLWG CVIVG            S P+  + +S+ L   L E G++TD  TS+TA +M LS
Sbjct  166   VLWGTCVIVGSI--------QSSLPTISNTSSSRLFSWLTEFGVTTDLETSYTARIMGLS  217

Query  1216  lvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN-  1040
             ++PF+++++  + +S+SG+ + +L++L+++V  LL YF YQI +P IQKR L Y +++  
Sbjct  218   VIPFLILQIPKIFNSSSGEYLTILISLVVSVVSLLIYFFYQIFEPWIQKRRLQYVKYDEA  277

Query  1039  ---------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--  911
                            +LT  G PN++ I+  F   D D +  +S  E+ + L  I +   
Sbjct  278   LLRILQLVQERALGRILTVEGAPNINAIQRLFDEIDEDGDDSISPSEVRELLLDIKSTGM  337

Query  910   EVQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
              + +  A + ++K LD + + +IT++EF++
Sbjct  338   NINKDNASEELIKVLDLNDDKKITKEEFVH  367



>ref|XP_006370034.1| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|ERP66603.1| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=499

 Score =   172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 159/280 (57%), Gaps = 6/280 (2%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKD  869
             NL+ ++G P++  IR  F   D D +  +S  EL++ ++ I   ++   V  A + +++ 
Sbjct  216   NLIKEDGTPDLLAIRRLFEDIDRDEDNCISKDELKELMKKIEIGKISWDVDEAAEKIIEA  275

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD  G+  I E+EF  GI   +  + +         T + +++++    EE +    + +
Sbjct  276   LDTSGDQMIDEKEFAEGI---VRWSINPPENVTPVSTRSQDDNNRRTPWEEVDKLLKDEK  332

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                 +K  +W +   ++ ++LGVAIL+  A+PL  +V  FS   G+P+F +SFV+ P+  
Sbjct  333   TNAVDK-SSWAWFKAIMSMVLGVAILSVLAEPLTQSVQNFSEDAGIPSFFVSFVLAPLAT  391

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  A +K S   SLTFSEIY GV M+N+ G   LL +VYAR LTW++SAEVL
Sbjct  392   NARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSVLLFLVYARGLTWEFSAEVL  451

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             VV +    +     F++ + LWTS  AF LYPFSL L YV
Sbjct  452   VVLITCAIMSLAVSFRSDFPLWTSFMAFLLYPFSLFLVYV  491


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 18/114 (16%)
 Frame = -1

Query  1108  YFGYQIIDPTIQKRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYD  977
             YF YQI +P IQKR L Y +                   +LT +G PN++ I+  F   D
Sbjct  41    YFFYQIFEPWIQKRRLEYVKCNEGLLRILQLVQERALGIILTGDGAPNINAIQRLFEEID  100

Query  976   SDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
              D +  +S  E+ K L  I +    + +  A + ++K LD + + +IT++EF++
Sbjct  101   EDGDDCISPSEVRKLLLDIKSTGMNINKDSASEELIKVLDLNDDKKITKEEFVH  154



>gb|KCW67438.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=345

 Score =   167 bits (424),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 171/331 (52%), Gaps = 34/331 (10%)
 Frame = -1

Query  1096  QIIDPTIQKRSLHYSRFEN----------------LLTQNGKPNVSRIRLFFHLYDSDNN  965
             Q++ P IQ+R L Y   ++                LLT +GK +       F   D + +
Sbjct  21    QVVQPWIQRRRLAYVEDKHVFFGFLRHIRTHPLGRLLTDDGKLDKDFAEKLFTTLDENGD  80

Query  964   QQMSSRELEKFLRLIVTDEVQ--RMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLanns  791
               +++ EL+  +  +  +E+      AV  +MKD D   +  +   EFL+GI   ++   
Sbjct  81    GYLNAAELKALVVGMQFEEIDLNEDGAVDRIMKDFDSSNDCLLELPEFLDGISKWVSRAR  140

Query  790   sadnaaaatptstPENDD---------QEKSGEETNgaageveqaggEKMGTWDFIVTVL  638
             S+ +      T    +D          Q KSG++T+     V      K+ T   +  VL
Sbjct  141   SSASGIKNFGTGKFLDDAHHQTTQEHAQLKSGDQTDEVTEGVGNP---KLTT---LKAVL  194

Query  637   QVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSS  458
              ++LG  I    A PL+  V  FS A G+PTF ISF+ LP+  N   A++AI  AS+K  
Sbjct  195   LLVLGTIIAGAFADPLVDAVDNFSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQ  254

Query  457   KAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKT  278
             + ASLTFSE+Y  VTM+NL  L   LA+VY R LTWD+S+EVLV+ ++   +G  A F+T
Sbjct  255   RTASLTFSELYGAVTMNNLLCLSVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRT  314

Query  277   TYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             T+ LWT   A  LYPFSLAL YVL  + GW+
Sbjct  315   TFPLWTFSLALLLYPFSLALVYVLDYIFGWS  345



>gb|KDP36272.1| hypothetical protein JCGZ_09837 [Jatropha curcas]
Length=522

 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 147/485 (30%), Positives = 237/485 (49%), Gaps = 54/485 (11%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +CD  YGF PC+ N  G L  I+ + YL  VA   +S+ S+ + + LG GI G  +   L
Sbjct  45    SCDQTYGFMPCSSNKFGNLILIIGYGYLFFVASTFLSNGSEILREILGPGIAGGLLLPQL  104

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                    + + SG+  S   AQ QV  G+ + AG+T+  LTV+WG CV+ G+        
Sbjct  105   GELADATLVLVSGLTGSTTTAQRQVSVGMGLLAGSTVTLLTVVWGSCVVAGK--------  156

Query  1336  DSQSQPSTQSFASNWLKTLNEC-GISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQ  1160
                                  C G++T   T ++A +M  S+VPF++++L  +  S  G+
Sbjct  157   ---------------------CSGVTTSIWTCYSARIMAASIVPFIVLQLPQLSDSVPGR  195

Query  1159  RivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQ  1028
              I +L+A ++++  L++Y  YQ+  P IQ+R L Y+++++                LL  
Sbjct  196   HIALLMAFVMSLLILISYCVYQVAQPRIQRRKLAYAKYKHLMAGILEHFRKRALGRLLDD  255

Query  1027  NGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDG  854
              G+PN+  ++  F   D + +  +S  EL+  +  I  +++      AV  +MKD D   
Sbjct  256   YGQPNIVLLKKLFCSIDENKDCVISEAELKALIIGIQFEDLHLNWNDAVDLIMKDFDVSR  315

Query  853   NSRITEQEFLNGIENLLannssadnaaaatptstPE---NDDQEKSGEET---Ngaagev  692
             ++ I  QEF+NGI   +     +  A++ +           D++   E T          
Sbjct  316   DNAIDRQEFVNGISKWIHKAKQSIAASSESSVGMRRFIYEFDKQTRKEHTLLGPQDVRSD  375

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             E     +   W+    +  ++LG AI+ F A PL+  V  FS    +P F ISF+ LP+ 
Sbjct  376   EVVEEVENPKWNTFKAIALLLLGAAIVAFFADPLVDVVDNFSKQTSIPPFFISFIALPLA  435

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N   A++AI  A +K  +AASLTFSEIY  +T+  L  L    A+VY R L WD+SAEV
Sbjct  436   TNSGDAVSAINFARRKKMRAASLTFSEIYGKITVKILLCLTVFFALVYFRGLEWDFSAEV  495

Query  331   LVVFV  317
             L  ++
Sbjct  496   LSHYI  500



>ref|XP_002298902.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|EEE83707.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=690

 Score =   172 bits (437),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 159/280 (57%), Gaps = 6/280 (2%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKD  869
             NL+ ++G P++  IR  F   D D +  +S  EL++ ++ I   ++   V  A + +++ 
Sbjct  407   NLIKEDGTPDLLAIRRLFEDIDRDEDNCISKDELKELMKKIEIGKISWDVDEAAEKIIEA  466

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD  G+  I E+EF  GI   +  + +         T + +++++    EE +    + +
Sbjct  467   LDTSGDQMIDEKEFAEGI---VRWSINPPENVTPVSTRSQDDNNRRTPWEEVDKLLKDEK  523

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                 +K  +W +   ++ ++LGVAIL+  A+PL  +V  FS   G+P+F +SFV+ P+  
Sbjct  524   TNAVDK-SSWAWFKAIMSMVLGVAILSVLAEPLTQSVQNFSEDAGIPSFFVSFVLAPLAT  582

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  A +K S   SLTFSEIY GV M+N+ G   LL +VYAR LTW++SAEVL
Sbjct  583   NARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSVLLFLVYARGLTWEFSAEVL  642

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYV  209
             VV +    +     F++ + LWTS  AF LYPFSL L YV
Sbjct  643   VVLITCAIMSLAVSFRSDFPLWTSFMAFLLYPFSLFLVYV  682


 Score =   157 bits (396),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 115/329 (35%), Positives = 185/329 (56%), Gaps = 49/329 (15%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QSS L L G  + SSS   C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +
Sbjct  48    NQSSILLLKG--MDSSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGE  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             KIF  LG G+FGA+ F++L   P  ++ ++SG+ N++E AQ  V  G+ + AG +I  LT
Sbjct  106   KIFRILGPGVFGASAFQVLGALPESLILLASGLLNTREVAQEYVSTGVGLLAGTSILLLT  165

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSl  1214
             +LWG CVIVG                  SF            ++TD  TS+TA +M LS+
Sbjct  166   MLWGTCVIVG------------------SFR-----------VTTDLQTSYTARIMGLSV  196

Query  1213  vpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--  1040
             +PF+++++  V +S SG+ + VL++L+++VA LL YF YQI +P IQKR L Y +     
Sbjct  197   IPFLILQIPKVFNSNSGEYLTVLISLVVSVASLLIYFFYQIFEPWIQKRRLEYVKCNEGL  256

Query  1039  --------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTD--E  908
                           +LT +G PN++ I+  F   D D +  +S  E+ K L  I +    
Sbjct  257   LRILQLVQERALGIILTGDGAPNINAIQRLFEEIDEDGDDCISPSEVRKLLLDIKSTGMN  316

Query  907   VQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
             + +  A + ++K LD + + +IT++EF++
Sbjct  317   INKDSASEELIKVLDLNDDKKITKEEFVH  345



>gb|KCW67433.1| hypothetical protein EUGRSUZ_F01189 [Eucalyptus grandis]
Length=502

 Score =   170 bits (430),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 159/266 (60%), Gaps = 3/266 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMK  872
             + L  +NG P++  IR  F   D + +  +S  EL++ +  I   ++   V   V  +++
Sbjct  215   KTLFAENGTPDLPAIRRLFEQIDRNGDNSISRAELKELMMGIKFGDISFDVDEVVSKVIE  274

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
               DR GNS+I E+EF+ G+ NLL  +       A+   ++ ++D  +++ EET+    E 
Sbjct  275   VFDRSGNSQINEEEFVAGLVNLLDTSGEGSKIQASKLNTS-QDDFYQRTWEETDKLVDED  333

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +  G  K  +W ++ ++  ++LGV IL   A+PL+++V  FS + G+P F ISF+++P+ 
Sbjct  334   KGKGDAKKASWIWVKSMSSLLLGVIILAVLAEPLISSVQSFSKSAGIPPFFISFILVPLA  393

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N R A AAI  A  K  +  SLT SEIY  V MSN+ G   LL+++Y R+LTW++SAEV
Sbjct  394   TNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGFCVLLSLIYVRDLTWEFSAEV  453

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSI  254
             LVV ++   +G +A F++T+ +WTSI
Sbjct  454   LVVLIVCSLVGLIASFRSTFPVWTSI  479


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 18/115 (16%)
 Frame = -1

Query  1108  YFGYQIIDPTIQKRSLHYSR----------------FENLLTQNGKPNVSRIRLFFHLYD  977
             YF YQI +P IQKRSL Y +                 E LLT++G PNV  IR  F   D
Sbjct  41    YFFYQIFEPWIQKRSLEYVKHEQLMLRIIQHLQRHALERLLTEDGAPNVHAIRRLFEEID  100

Query  976   SDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLNG  818
              D +  +S  EL++ L+ I      V +  AV  +MK+ D  G+ RI++ EF+ G
Sbjct  101   QDGDDAISPSELKELLQEIKFKHMHVDKDKAVDEIMKEFDIAGDQRISKDEFVTG  155



>emb|CBI20222.3| unnamed protein product [Vitis vinifera]
Length=661

 Score =   171 bits (433),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 181/322 (56%), Gaps = 30/322 (9%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC+ NI G+LF IV+++YLM   E  V+S  ++IF  LG G+FGA+VF++L 
Sbjct  8     CEQLYGFLPCSNNIFGHLFLIVVYEYLMFHGESYVASGGEQIFKILGPGVFGASVFQVLG  67

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD------R  1352
               P  ++ ++SG+ NS++ AQ  V   + + AG+TI  LTVLWG CVIVG  +       
Sbjct  68    ALPESLILLASGLLNSKDTAQEYVLTAVGLLAGSTILLLTVLWGTCVIVGSCEFPGAGSG  127

Query  1351  ATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSS  1172
             AT + +   +P  +      L  L   GI+TD  T + A +M LS++PF+++++  +   
Sbjct  128   ATVDANLLQKPYRKI-----LLMLTGSGIATDEETGYMARIMGLSIIPFIIIQITILFQL  182

Query  1171  ASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------  1040
             + G+R+V+L+ LI+++ FLL YF YQI  P IQ+R L Y + ++                
Sbjct  183   SYGERVVILITLIVSLIFLLLYFIYQIFQPWIQQRRLEYVKHDHLVIRILRYFQEHAVGK  242

Query  1039  LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL---RLIVTDEVQRMVAVKTMMKD  869
             LLT  G PN+S IR  F   D D +  +S  E+++ L   R      + +  AV  ++  
Sbjct  243   LLTDEGAPNISVIRGLFEETDLDGDDYISPAEIKELLLGIRFRKPHLINKEDAVLDVLGQ  302

Query  868   LDRDGNSRITEQEFLNGIENLL  803
              D DG+  IT+ EF+ GI   L
Sbjct  303   FDIDGDGTITKDEFIAGISKWL  324


 Score =   124 bits (310),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/277 (33%), Positives = 158/277 (57%), Gaps = 10/277 (4%)
 Frame = -1

Query  1069  RSLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV-  893
             R +  S   +LL ++  P+++ I+  F   D D +  +S  EL++ +  I   ++   V 
Sbjct  371   RHVQNSGLGSLLKEDNTPDIANIKSLFERIDLDGDNCISQAELKELIMSIKFGDMPLDVD  430

Query  892   -AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQ-EKSGE  719
              AV  +M+ LD +G+  I E+EF+ G+   +  +S     +         ND+   K+ +
Sbjct  431   EAVARIMEKLDVNGDRLIDEEEFIQGLAKWVNISSHQALQSPK------PNDEIFLKAWK  484

Query  718   ETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFI  539
             ET+    +      +K   W +   ++ ++ G+ IL+  A+PL+ +V  FS A  + +F 
Sbjct  485   ETDELVEQTSAGPVDK-SPWAWFKAIMLLLAGILILSVLAEPLIHSVQSFSTAANISSFF  543

Query  538   ISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARE  359
             I+F+++P+  N R A +AI  AS++  +  SLTFSEIY GV M+N+ G+  LL+++Y RE
Sbjct  544   IAFILVPLATNARAATSAISAASRRKERTTSLTFSEIYGGVFMNNVLGISVLLSIIYVRE  603

Query  358   LTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFA  248
             LTWD+SAEVLVV ++ + +G  A  ++T+ +WTSI A
Sbjct  604   LTWDFSAEVLVVMIVCVVMGMFASLRSTFPVWTSIVA  640



>ref|XP_010644148.1| PREDICTED: uncharacterized protein LOC100241883 [Vitis vinifera]
Length=718

 Score =   171 bits (433),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 181/322 (56%), Gaps = 30/322 (9%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YGF PC+ NI G+LF IV+++YLM   E  V+S  ++IF  LG G+FGA+VF++L 
Sbjct  65    CEQLYGFLPCSNNIFGHLFLIVVYEYLMFHGESYVASGGEQIFKILGPGVFGASVFQVLG  124

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD------R  1352
               P  ++ ++SG+ NS++ AQ  V   + + AG+TI  LTVLWG CVIVG  +       
Sbjct  125   ALPESLILLASGLLNSKDTAQEYVLTAVGLLAGSTILLLTVLWGTCVIVGSCEFPGAGSG  184

Query  1351  ATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSS  1172
             AT + +   +P  +      L  L   GI+TD  T + A +M LS++PF+++++  +   
Sbjct  185   ATVDANLLQKPYRKI-----LLMLTGSGIATDEETGYMARIMGLSIIPFIIIQITILFQL  239

Query  1171  ASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------  1040
             + G+R+V+L+ LI+++ FLL YF YQI  P IQ+R L Y + ++                
Sbjct  240   SYGERVVILITLIVSLIFLLLYFIYQIFQPWIQQRRLEYVKHDHLVIRILRYFQEHAVGK  299

Query  1039  LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL---RLIVTDEVQRMVAVKTMMKD  869
             LLT  G PN+S IR  F   D D +  +S  E+++ L   R      + +  AV  ++  
Sbjct  300   LLTDEGAPNISVIRGLFEETDLDGDDYISPAEIKELLLGIRFRKPHLINKEDAVLDVLGQ  359

Query  868   LDRDGNSRITEQEFLNGIENLL  803
              D DG+  IT+ EF+ GI   L
Sbjct  360   FDIDGDGTITKDEFIAGISKWL  381


 Score =   124 bits (310),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 91/277 (33%), Positives = 158/277 (57%), Gaps = 10/277 (4%)
 Frame = -1

Query  1069  RSLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV-  893
             R +  S   +LL ++  P+++ I+  F   D D +  +S  EL++ +  I   ++   V 
Sbjct  428   RHVQNSGLGSLLKEDNTPDIANIKSLFERIDLDGDNCISQAELKELIMSIKFGDMPLDVD  487

Query  892   -AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQ-EKSGE  719
              AV  +M+ LD +G+  I E+EF+ G+   +  +S     +         ND+   K+ +
Sbjct  488   EAVARIMEKLDVNGDRLIDEEEFIQGLAKWVNISSHQALQSPK------PNDEIFLKAWK  541

Query  718   ETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFI  539
             ET+    +      +K   W +   ++ ++ G+ IL+  A+PL+ +V  FS A  + +F 
Sbjct  542   ETDELVEQTSAGPVDK-SPWAWFKAIMLLLAGILILSVLAEPLIHSVQSFSTAANISSFF  600

Query  538   ISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARE  359
             I+F+++P+  N R A +AI  AS++  +  SLTFSEIY GV M+N+ G+  LL+++Y RE
Sbjct  601   IAFILVPLATNARAATSAISAASRRKERTTSLTFSEIYGGVFMNNVLGISVLLSIIYVRE  660

Query  358   LTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFA  248
             LTWD+SAEVLVV ++ + +G  A  ++T+ +WTSI A
Sbjct  661   LTWDFSAEVLVVMIVCVVMGMFASLRSTFPVWTSIVA  697



>ref|XP_011082730.1| PREDICTED: uncharacterized protein LOC105165425 [Sesamum indicum]
Length=724

 Score =   171 bits (432),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 112/324 (35%), Positives = 186/324 (57%), Gaps = 32/324 (10%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C   YGF PC+E++ G++F IV+++YL+   E  V+S  ++IF  LG G+FGA  F+++
Sbjct  75    SCSQMYGFLPCSESVWGHVFLIVVYEYLLFHGESYVASGGERIFKILGPGVFGACAFQLI  134

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD------  1355
                P  ++ ++SG+ NS+E AQ+ V  G+ + AG++I  LT+LWG CVI+G RD      
Sbjct  135   GSLPESLILLASGLLNSKEEAQDCVLTGVGLLAGSSILLLTLLWGTCVILGTRDFSDYLQ  194

Query  1354  ---RATQEKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvn  1184
                 ++ +  +Q  P  + F S W       G+ TD+ T +TA +ML+S++PF +++   
Sbjct  195   SDAASSSDCPNQKNPLERLFLSLW----PGYGLVTDSWTGYTARIMLVSVIPFTIIQFPR  250

Query  1183  vVS-SASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSL----------------HY  1055
             +   S   +R+ V++AL+++V FLL+YF YQ+  P IQKR L                 Y
Sbjct  251   LFRLSLFWERVFVVIALVVSVIFLLSYFFYQLFQPWIQKRQLLYLKHGHLVVDILKHVQY  310

Query  1054  SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKT  881
                 +L T +G PN+S IR  F   D D ++ +++ EL+ FLR I   ++   +    + 
Sbjct  311   QTMGSLFTDDGGPNLSVIRRIFEETDQDGDKYLTAAELKDFLREIKFRKLYSDKDKVTED  370

Query  880   MMKDLDRDGNSRITEQEFLNGIEN  809
             MMK+ D + + +IT  EF+ G+E 
Sbjct  371   MMKEFDANKDKKITVDEFVKGMEK  394


 Score =   157 bits (397),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 154/299 (52%), Gaps = 18/299 (6%)
 Frame = -1

Query  1072  KRSLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI----VTDEV  905
             K S+H S    LLT NG P++  I+  F   D D +  +S  EL+  +  I    + +++
Sbjct  439   KASVHGS----LLTGNGTPDLPAIKRLFKDIDHDKDDFVSHAELKDLMMDIKFGIIPNDI  494

Query  904   QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKS  725
                 A   MM++LD  G+  I E+EF+ G+   L ++             +   +  E++
Sbjct  495   D--AAASKMMEELDVSGDQLINEEEFVTGLSKWLKSSYVNQTTTPEIYKDSGYQEKWEQT  552

Query  724   GEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPT  545
              +       +       K         +  V+LG+ +L   A+PL+ +V   S A  +P+
Sbjct  553   EKLVEDKLIDKSVLAWTK--------AIALVVLGIVMLGLLAEPLIHSVQNLSEAANIPS  604

Query  544   FIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYA  365
             F I+F+ +P+  N R+AI+AI    +K     SLTFSEIY  V M+NL G   LL+++Y 
Sbjct  605   FFIAFIFVPLATNARIAISAISEVRRKKLNINSLTFSEIYGTVLMNNLLGFSVLLSLIYF  664

Query  364   RELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQLLGWN  188
             R L+WD+S EVL+V ++S  +G LA F T + +WTS  A+ LYP SL L  VL    W+
Sbjct  665   RGLSWDFSVEVLMVLIVSAVMGCLASFSTIFPVWTSFLAYLLYPMSLVLVNVLGDFKWS  723



>ref|XP_011083284.1| PREDICTED: uncharacterized protein LOC105165819 [Sesamum indicum]
Length=714

 Score =   169 bits (429),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 172/321 (54%), Gaps = 27/321 (8%)
 Frame = -1

Query  1099  YQIIDPTIQKR----------------SLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDN  968
             YQ++ P IQK+                 L  S + +LL  +G P+V  I+  F   D D 
Sbjct  401   YQVLKPWIQKKREEREMMKHLIPDILEHLQDSVYGSLLADDGTPDVPAIKRLFKDIDLDK  460

Query  967   NQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             +  +S  EL++ +  I    +     VA   +M++LD  G+  I E+EF+ G+   L   
Sbjct  461   DNCISYFELKELMTNIKFGIIPYDADVAASKIMEELDISGDQLIDEEEFVTGLSRWLNTA  520

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
              +    +  +     E++D +K+ E+T+    +           W   +T+L  +LG+ +
Sbjct  521   RNQSPNSDES-----EDNDYQKTWEQTDKLVEDKFIDKSPL--AWTKAITLL--VLGIIM  571

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
             L   A+PL+ +V  FS A  +P+F ++F+ +P+    R+A++AI  A +K     SLT S
Sbjct  572   LGVLAEPLIQSVHDFSKAARIPSFYVAFIFVPLATTARLAVSAINEARRKKLHTTSLTLS  631

Query  433   EIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSI  254
             EIY  V M+N+ GL  LL+++Y R L+W++SAEVL+V ++S  IGFLA F T + +WTSI
Sbjct  632   EIYGTVFMNNILGLAVLLSLIYFRGLSWNFSAEVLMVLLVSAIIGFLASFNTVFPVWTSI  691

Query  253   FAFFLYPFSLALFYVLQLLGW  191
              A+ LYP SL L Y+L    W
Sbjct  692   LAYMLYPLSLILVYILGDSDW  712


 Score =   167 bits (424),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 184/323 (57%), Gaps = 29/323 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PC++ IPG+LF I++++YL+  AE  V+S  ++IF  LG G+FGA+ F+++
Sbjct  62    TCEQMYGFLPCSKTIPGHLFLILVYEYLLFHAESYVASGGERIFKILGPGVFGASAFQVI  121

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ--  1343
                P  ++ ++SG+ +S E AQ  V  G+ + AG++I  LT++WG C+I+G +  ++   
Sbjct  122   GSLPEALILLASGLSSSDEIAQECVLTGVGLLAGSSILLLTIIWGTCIILGSQSFSSHLH  181

Query  1342  ---EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvn--vV  1178
                  + +  P  +   S W       G+ TD   S+T+ +MLLS++P  L+++     +
Sbjct  182   SNLSDNKRYNPLERLLFSLWPGH----GVVTDLGASYTSMIMLLSVIPLALIQIPRIFHL  237

Query  1177  SSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN--------------  1040
             S A  + I VL++L++++ FLL YF YQ   P IQ+R L Y + E+              
Sbjct  238   SYAPEEGIFVLISLVVSIMFLLCYFFYQFFQPWIQRRRLLYIKHEHLVVDILKHLQNETM  297

Query  1039  --LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVAVKT--MMK  872
               LLT NG PNVS IR  F   D D ++ +S  EL++FL+ I    +Q      T  +MK
Sbjct  298   GKLLTDNGSPNVSTIRRLFEEKDQDGDKVISFSELKEFLQEIKFRNLQSKDDNNTAEIMK  357

Query  871   DLDRDGNSRITEQEFLNGIENLL  803
             + D D + +IT  EF+NG+   L
Sbjct  358   EFDIDEDEKITMDEFVNGMTKWL  380



>gb|KCW67432.1| hypothetical protein EUGRSUZ_F01188 [Eucalyptus grandis]
Length=502

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 160/266 (60%), Gaps = 3/266 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMK  872
             + L  +NG P++  IR  F   D + +  +S  EL++ +  I   ++   V   V  +++
Sbjct  215   KTLFFENGTPDLPAIRRLFEQIDRNGDNSISRAELKELMMGIKFGDIPFDVDEVVSKVIE  274

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
               DR GN +I E+EF+ G+ NLL  +   +   A+   ++ ++D  +++ EE +    E 
Sbjct  275   VFDRSGNCQINEEEFVAGLVNLLDTSGEGNKIRASKLNTS-QDDFYQRTWEEIDKLVDED  333

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +  G  +  +W ++ ++  ++LGV IL   A+PL+++V  FS + G+P+F ISF+++P+ 
Sbjct  334   KGKGDAEKASWIWVKSMSSLLLGVIILAVLAEPLISSVQSFSKSAGIPSFFISFILVPLA  393

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N R A AAI  A  K  +  SLT SEIY  V MSN+ G   LL+++YAR+LTW++SAEV
Sbjct  394   TNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGFCVLLSLIYARDLTWEFSAEV  453

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSI  254
             LVV ++   +G +A F++T+ +WTSI
Sbjct  454   LVVLIVCGVVGLIASFRSTFPVWTSI  479


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 56/115 (49%), Gaps = 18/115 (16%)
 Frame = -1

Query  1108  YFGYQIIDPTIQKRSLHYSR----------------FENLLTQNGKPNVSRIRLFFHLYD  977
             YF YQI +P IQKR L Y +                 E LLT+NG PN   IR  F   D
Sbjct  41    YFFYQIFEPWIQKRRLEYVKHEQLMLRIIQHLQRHALERLLTENGAPNTHAIRRLFEEID  100

Query  976   SDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLNG  818
              D +  +S  +L++ L  I      V +  AV  +M++ D  G+ RI++ EF+ G
Sbjct  101   QDGDDAISPSDLKELLLEIKFKHMHVDKDKAVDEIMREFDIAGDHRISKDEFVTG  155



>ref|XP_006594743.1| PREDICTED: uncharacterized protein LOC100798009 isoform X3 [Glycine 
max]
Length=694

 Score =   167 bits (424),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 124/373 (33%), Positives = 200/373 (54%), Gaps = 51/373 (14%)
 Frame = -1

Query  1882  LFILLLAVVLVQGRFLsdddgevvsdgvhdhyhahahaANQSVDQSSFLALGGPRLssss  1703
             +F+L+L  V VQGR+L +   E+VSDGVH+         N   +++S+L L G     S 
Sbjct  12    IFLLVLVTVEVQGRYLPERATELVSDGVHN---------NLQHNETSYLVLKGID-DESF  61

Query  1702  sSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFR  1523
                C   YGF PC  NI G+LF I++++YL+   E  ++   ++IF  LG GIFGA+ F+
Sbjct  62    EEPCKQMYGFLPCTNNIFGHLFLILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQ  121

Query  1522  ILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ  1343
             IL   P  ++ + SG+ +++E AQ   F G+ + AG++I  LTV+WG CVI G ++    
Sbjct  122   ILGALPESLILLVSGLVSNREIAQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEF---  178

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
             E DS   P++ S  ++    L  CGI+TD  TS+TA +M+ S++P  ++++ N+   +SG
Sbjct  179   EHDS---PTSNSAHTSLKALLTGCGITTDLETSYTARIMVCSVIPLAIMQIPNLFQFSSG  235

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLL----------------T  1031
              R V L                 I +P +QKR L Y + ++L+                T
Sbjct  236   LRSVTL-----------------IFEPWVQKRRLEYVKHDHLILKILQHVQKNTLQRIFT  278

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL--RLIVTDEVQRMVAVKTMMKDLDRD  857
             +NG PNVS IR  +   D D +  +S+ E++  L    +          +K ++K  D D
Sbjct  279   KNGTPNVSAIRRLYREIDQDGSSGISASEVKDLLLKNKVTETNFDEEKEIKEVLKVFDLD  338

Query  856   GNSRITEQEFLNG  818
             G+ +I ++EF++G
Sbjct  339   GDKKINKEEFVSG  351


 Score =   159 bits (403),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/288 (33%), Positives = 158/288 (55%), Gaps = 8/288 (3%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKD  869
             +LLT++GKP+   IR  F   D + +  +S  EL++ +  I  V   ++   AV  ++++
Sbjct  412   SLLTEDGKPDQHAIRGLFEKIDRNRDNFISQSELKELIMNIKFVKASMEVEEAVALVIEE  471

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD D +  I E+EF+ G E  L++ S+    + +        +D  ++ EE +    E +
Sbjct  472   LDIDKDRTINEKEFVAGFEKWLSSTSAPAPVSDSES-----QEDMFQTWEEADIVVEERQ  526

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                      W +I  +  V+LG+A+L+  A+PL  +V  FS + G   F +SF++ P+  
Sbjct  527   NNAVVDKSIWAWIKAITYVMLGIAMLSILAEPLTESVHNFSNSAGFHPFFMSFILAPLAT  586

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  AS K  +  SL  SEIY GV M+N+ G  ++  +++ RE+TW +SAE+L
Sbjct  587   NAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLIFVREVTWQFSAELL  646

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             VV ++    G  A F + + +W+S  A  LYP SL L ++L  +L +N
Sbjct  647   VVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVFILDHVLNYN  694



>gb|KCW67434.1| hypothetical protein EUGRSUZ_F01190 [Eucalyptus grandis]
Length=493

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 159/266 (60%), Gaps = 3/266 (1%)
 Frame = -1

Query  1045  ENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMK  872
             + L  +NG P++  IR  F   D + +  +S  EL++ +  I   ++   V   V  +++
Sbjct  206   KTLFAENGTPDLPAIRRLFEQIDRNGDNSISQAELKELMMGIKFGDIPFDVDEVVSKVIE  265

Query  871   DLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaagev  692
               DR GNS+I E+EF+ G+ NLL  +   +   A+   ++ ++D  +++ EET+    E 
Sbjct  266   VFDRRGNSQINEEEFVAGLVNLLDTSGEGNKIRASKLNTS-QDDFYQRTWEETDKLVDED  324

Query  691   eqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIV  512
             +  G  +  +W ++ ++  ++LGV IL   A+PL+++V  FS + G+P F ISF+++P+ 
Sbjct  325   KGKGDAEKASWIWVKSMSSLLLGVIILAVLAEPLISSVQSFSKSAGIPPFFISFILVPLA  384

Query  511   INGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEV  332
              N R A  AI  A  K  +  SLT SEIY  V MSN+ G   LL+++YAR+LTW++SAE 
Sbjct  385   TNARGASLAIKAARHKKERTTSLTLSEIYGEVFMSNMLGFCVLLSLIYARDLTWEFSAEF  444

Query  331   LVVFVISLTIGFLAYFKTTYQLWTSI  254
             LVV ++   +G +A F++T+ +WTSI
Sbjct  445   LVVLIVCGLVGLIASFRSTFPVWTSI  470


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 58/115 (50%), Gaps = 18/115 (16%)
 Frame = -1

Query  1108  YFGYQIIDPTIQKRSLHYSR----------------FENLLTQNGKPNVSRIRLFFHLYD  977
             YF YQI +P IQKR L Y +                 E LLT++G PNV  IR  F   D
Sbjct  32    YFFYQIFEPWIQKRRLEYVKHEQLMLRIIQHLQRHALERLLTEDGAPNVHAIRRLFEEID  91

Query  976   SDNNQQMSSRELEKFLRLIVTD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLNG  818
              D +  +S  EL++ L+ I      V +  AV  +MK+ D  G+ RI++ EF+ G
Sbjct  92    QDGDDAISPSELKELLQEIKFKHMHVDKDKAVDEIMKEFDIAGDQRISKDEFVTG  146



>ref|XP_011000239.1| PREDICTED: uncharacterized protein LOC105107867 isoform X4 [Populus 
euphratica]
Length=652

 Score =   164 bits (416),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 113/334 (34%), Positives = 194/334 (58%), Gaps = 29/334 (9%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QSS L L G  + +SS   C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +
Sbjct  48    NQSSILLLKG--MDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGE  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             KIF  LG G+FGA+ F++L   P  ++ ++SG+  ++E AQ  V  G+ + AG +I  LT
Sbjct  106   KIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLLAGTSILLLT  165

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK-----TLNECGISTDASTSFTAGL  1229
             VLWG CVIVG    + Q        ++ S   +WL      +  + G++TD  TS+TA +
Sbjct  166   VLWGTCVIVG----SIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETSYTARI  221

Query  1228  MLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR  1049
             M LS++PF+++++  + +S+SG+ + +L++L+++V  LL YF YQI +P IQKR L Y +
Sbjct  222   MGLSVIPFLILQIPKIFNSSSGEYLTILISLVVSVVSLLIYFFYQIFEPWIQKRRLQYVK  281

Query  1048  FEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV  917
             ++                 +LT  G PN++ I+  F   D D +  +S  E+ + L  I 
Sbjct  282   YDEALLRILQLVQERALGRILTVEGAPNINAIQRLFDEIDEDGDDSISPSEVRELLLDIK  341

Query  916   TD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
             +    + +  A + ++K LD + + +IT++EF++
Sbjct  342   STGMNINKDNASEELIKVLDLNDDKKITKEEFVH  375


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 117/242 (48%), Gaps = 23/242 (10%)
 Frame = -1

Query  1099  YQIIDPTIQ-KRSLHYSR---------------FENLLTQNGKPNVSRIRLFFHLYDSDN  968
             YQ+  P ++ KR  H  +                 NL+ ++G P+   IR  F   D D 
Sbjct  402   YQVFHPFVESKRKEHEMKRNLISEIVSHLQSDALGNLIKEDGTPDFLTIRRLFEEIDRDE  461

Query  967   NQQMSSRELEKFLRLIVTDEVQRMV--AVKTMMKDLDRDGNSRITEQEFLNGIENLLann  794
             +  +S  EL + ++ I   ++   V  A + +M+ LD  G+  I E+EF  GI   L N 
Sbjct  462   DNCISKDELTELMKKIEIGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWLINT  521

Query  793   ssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAI  614
             S      +        +D+   + EE +    + +    +K  +W +   ++ ++LG AI
Sbjct  522   SENVTPGSTRS----RDDNNRGTWEEVDKLLKDEKTNAVDK-SSWAWFKAIMSMVLGAAI  576

Query  613   LTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFS  434
             L+  A+PL+ +V  FS   G+P+F +SFV+ P+  N R A +AI  A +K S   SLTFS
Sbjct  577   LSVLAEPLIHSVQNFSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFS  636

Query  433   EI  428
             E+
Sbjct  637   EV  638



>gb|EYU44996.1| hypothetical protein MIMGU_mgv1a025835mg [Erythranthe guttata]
Length=651

 Score =   164 bits (416),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/312 (36%), Positives = 183/312 (59%), Gaps = 24/312 (8%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC+++I G++F IV+++YL+   E  V++  ++IF  LG G+FGA  F+I+  FP 
Sbjct  2     YGFLPCSKSIWGHVFLIVVYEYLLFHGESYVAAGGERIFKILGPGVFGACAFQIIGAFPE  61

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRD--RATQEKDSQ  1328
              ++ + SG+ N++E AQ  V  G+ + AG++I  LT++WG CVI+G +    ++Q  DS 
Sbjct  62    ALILLVSGLLNNKEVAQECVLTGVGLLAGSSILLLTLVWGTCVILGSQHFPNSSQSSDST  121

Query  1327  SQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVS-SASGQRiv  1151
             +Q   Q+F   +L      G+ TD+ T +TA +ML+S +PF +++   +   S   +RI 
Sbjct  122   NQNPIQNF---FLSLWPGYGVVTDSWTGYTAWIMLISAIPFTIIQFPVLFDLSYFWERIF  178

Query  1150  vlvaliitvafllAYFGYQIIDPTIQKRSLHYSRF----------------ENLLTQNGK  1019
             V+VAL+++V FLL+YF YQ+  P IQ R L Y +                 E L + +G 
Sbjct  179   VVVALLVSVTFLLSYFFYQLFQPWIQGRQLLYLKHGHLVVDILKHVQNHTNETLFSDDGA  238

Query  1018  PNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRDGNSR  845
             P++S IR  F + D D ++ + + EL+ FL+ I   ++   +  A + MMK+ D D N +
Sbjct  239   PDLSVIRRIFKVTDRDGDETIDASELKGFLQEIKFRKMYSDKDKATQDMMKEFDVDDNKK  298

Query  844   ITEQEFLNGIEN  809
             I   EF+ G+E 
Sbjct  299   ININEFVKGMEK  310


 Score =   154 bits (389),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 150/303 (50%), Gaps = 14/303 (5%)
 Frame = -1

Query  1069  RSLHYSRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMV-  893
               L  S   +LLT++G P++  I+  F   D D +  +S  EL   +  I    +   + 
Sbjct  352   EHLQSSTHGSLLTEDGTPDIPAIKRLFKDIDHDKDDLISYSELRDLMMDIKFGSIPHDID  411

Query  892   -AVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQ------  734
              A   MM++LD  G+  I E EF+ G+ N L   S              +  +       
Sbjct  412   EAASKMMEELDISGDKLINEDEFVTGLSNWLNAISINQTPKPEQINEESDYHNHFLFIIT  471

Query  733   --EKSGEETNgaageveqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGA  560
               +++ EET+                + +I  +  ++LG+ +L   A+PL+ +V   S A
Sbjct  472   TMQQNWEETDKLVESKFV----DKSPFAWIKAISLLVLGIVMLGLLAEPLIHSVQSLSKA  527

Query  559   VGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLL  380
               +P+F I+F+ +P+  N R+ I+AI    +K     SLTFSEIY  V M+NL G   LL
Sbjct  528   ASIPSFFIAFIFVPLATNARITISAIGEVRRKKLNITSLTFSEIYGTVLMNNLLGFSVLL  587

Query  379   AVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQL  200
             +++Y R  +WD+S EVL+V ++   +G LA F T + +WT++FA  LYP SL L  VL  
Sbjct  588   SLIYFRGFSWDFSVEVLMVLIVCAVMGCLASFSTVFPVWTAVFACMLYPLSLVLVTVLGD  647

Query  199   LGW  191
               W
Sbjct  648   FNW  650



>ref|XP_011000240.1| PREDICTED: uncharacterized protein LOC105107867 isoform X5 [Populus 
euphratica]
Length=652

 Score =   164 bits (415),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 113/334 (34%), Positives = 194/334 (58%), Gaps = 29/334 (9%)
 Frame = -1

Query  1753  DQSSFLALGGPRLsssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSK  1574
             +QSS L L G  + +SS   C+  YGF PC+ NI G+LF I +++Y++   E  ++S  +
Sbjct  48    NQSSILLLKG--MDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGE  105

Query  1573  KIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLT  1394
             KIF  LG G+FGA+ F++L   P  ++ ++SG+  ++E AQ  V  G+ + AG +I  LT
Sbjct  106   KIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLLAGTSILLLT  165

Query  1393  VLWGLCVIVGRRDRATQEKDSQSQPSTQSFASNWLK-----TLNECGISTDASTSFTAGL  1229
             VLWG CVIVG    + Q        ++ S   +WL      +  + G++TD  TS+TA +
Sbjct  166   VLWGTCVIVG----SIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETSYTARI  221

Query  1228  MLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR  1049
             M LS++PF+++++  + +S+SG+ + +L++L+++V  LL YF YQI +P IQKR L Y +
Sbjct  222   MGLSVIPFLILQIPKIFNSSSGEYLTILISLVVSVVSLLIYFFYQIFEPWIQKRRLQYVK  281

Query  1048  FEN----------------LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIV  917
             ++                 +LT  G PN++ I+  F   D D +  +S  E+ + L  I 
Sbjct  282   YDEALLRILQLVQERALGRILTVEGAPNINAIQRLFDEIDEDGDDSISPSEVRELLLDIK  341

Query  916   TD--EVQRMVAVKTMMKDLDRDGNSRITEQEFLN  821
             +    + +  A + ++K LD + + +IT++EF++
Sbjct  342   STGMNINKDNASEELIKVLDLNDDKKITKEEFVH  375



>ref|XP_006594742.1| PREDICTED: uncharacterized protein LOC100798009 isoform X2 [Glycine 
max]
Length=705

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 127/374 (34%), Positives = 204/374 (55%), Gaps = 42/374 (11%)
 Frame = -1

Query  1882  LFILLLAVVLVQGRFLsdddgevvsdgvhdhyhahahaANQSVDQSSFLALGGPRLssss  1703
             +F+L+L  V VQGR+L +   E+VSDGVH+         N   +++S+L L G     S 
Sbjct  12    IFLLVLVTVEVQGRYLPERATELVSDGVHN---------NLQHNETSYLVLKGID-DESF  61

Query  1702  sSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFR  1523
                C   YGF PC  NI G+LF I++++YL+   E  ++   ++IF  LG GIFGA+ F+
Sbjct  62    EEPCKQMYGFLPCTNNIFGHLFLILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQ  121

Query  1522  ILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQ  1343
             IL   P  ++ + SG+ +++E AQ   F G+ + AG++I  LTV+WG CVI G ++    
Sbjct  122   ILGALPESLILLVSGLVSNREIAQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEF---  178

Query  1342  EKDSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
             E DS   P++ S  ++    L  CGI+TD  TS+TA +M+ S++P  ++++ N+   +SG
Sbjct  179   EHDS---PTSNSAHTSLKALLTGCGITTDLETSYTARIMVCSVIPLAIMQIPNLFQFSSG  235

Query  1162  QRivvlvaliitvaf-llAYFGYQIIDPTIQKRSLHYSRFENLL----------------  1034
              R V LV  ++  +  L  YF Y       QKR L Y + ++L+                
Sbjct  236   LRSVTLVIALLITSIFLFLYFVY-------QKRRLEYVKHDHLILKILQHVQKNTLQRIF  288

Query  1033  TQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFL--RLIVTDEVQRMVAVKTMMKDLDR  860
             T+NG PNVS IR  +   D D +  +S+ E++  L    +          +K ++K  D 
Sbjct  289   TKNGTPNVSAIRRLYREIDQDGSSGISASEVKDLLLKNKVTETNFDEEKEIKEVLKVFDL  348

Query  859   DGNSRITEQEFLNG  818
             DG+ +I ++EF++G
Sbjct  349   DGDKKINKEEFVSG  362


 Score =   159 bits (402),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/288 (33%), Positives = 158/288 (55%), Gaps = 8/288 (3%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKD  869
             +LLT++GKP+   IR  F   D + +  +S  EL++ +  I  V   ++   AV  ++++
Sbjct  423   SLLTEDGKPDQHAIRGLFEKIDRNRDNFISQSELKELIMNIKFVKASMEVEEAVALVIEE  482

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD D +  I E+EF+ G E  L++ S+    + +        +D  ++ EE +    E +
Sbjct  483   LDIDKDRTINEKEFVAGFEKWLSSTSAPAPVSDSES-----QEDMFQTWEEADIVVEERQ  537

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
                      W +I  +  V+LG+A+L+  A+PL  +V  FS + G   F +SF++ P+  
Sbjct  538   NNAVVDKSIWAWIKAITYVMLGIAMLSILAEPLTESVHNFSNSAGFHPFFMSFILAPLAT  597

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  AS K  +  SL  SEIY GV M+N+ G  ++  +++ RE+TW +SAE+L
Sbjct  598   NAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLIFVREVTWQFSAELL  657

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             VV ++    G  A F + + +W+S  A  LYP SL L ++L  +L +N
Sbjct  658   VVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVFILDHVLNYN  705



>ref|XP_002275961.1| PREDICTED: uncharacterized protein LOC100260847 [Vitis vinifera]
Length=539

 Score =   161 bits (408),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 140/480 (29%), Positives = 244/480 (51%), Gaps = 27/480 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C   +G  PC   + G +F I+++ YLM  A +L+   S+ + + L  GI G     +L
Sbjct  59    SCKQTHGVMPCTTTVFGNVFLILVYGYLMFFAARLLYDGSEILVELLSPGITGGVFLPLL  118

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ ++S +  +++ A +QV  G  +  G+T   LT+L G C+IVG+ D     +
Sbjct  119   SSLPDAIIILASRLCGNKDTASSQVSAGSALLGGSTAMLLTLLGGCCIIVGKCDL----E  174

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             + +++P  ++ A  +  +L     STD   S+TA +M++S++PF++++L  V+ + S   
Sbjct  175   NLRAKPVEKN-ARGF--SLVGSAASTDIRASYTARIMVISVMPFIIIQLSQVLHTTSQIC  231

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL++LII+++ LLAY  +Q+  P++ K  L +++ ++                LLT N
Sbjct  232   LAVLISLIISISLLLAYCLHQVFHPSVLKTRLTHAKDKHMMSRIVKHLKCCTLGRLLTAN  291

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRM-VAVKTMMKDLDRDGNS  848
             G+P+   I+  F +   D++QQ+S+ EL   +  I   E   +  AV  ++ D D  G+S
Sbjct  292   GEPDREVIKKLFEMIGEDSDQQLSASELRALITGIQIKEDSDIDEAVGKVLTDFDACGDS  351

Query  847   RITEQEFLNGIENLLannssadnaaaat--ptstPENDDQEKSGEETNgaageveqaggE  674
             +I    F+ GI         +   ++ +   T    +D    + +       +   A   
Sbjct  352   KINLDAFIIGISKWYDKAKHSAVCSSDSDFQTRIIIDDFNTPTSKGNELLGIQFYTAEKI  411

Query  673   KMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMA  494
             +   W     V  ++LG  I      PL+  V  F  A  +P F +SF+VLP   +    
Sbjct  412   ENPKWSAFKGVFILLLGTLIAATFVDPLVNAVGNFYSATNIPPFFVSFIVLPFASSSEAV  471

Query  493   IAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVI  314
              A IF ASQK  + A LT SEIY  V M+NL  L   L ++Y R LTW++++EVL++ +I
Sbjct  472   SALIF-ASQKKLRIAPLTVSEIYGAVNMNNLLCLSVFLGLLYFRHLTWNFTSEVLIILII  530



>ref|XP_002522528.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39828.1| conserved hypothetical protein [Ricinus communis]
Length=521

 Score =   161 bits (407),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/333 (31%), Positives = 165/333 (50%), Gaps = 45/333 (14%)
 Frame = -1

Query  1090  IDPTIQKRSLHY--------SRFENLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEK  935
             + P I++R L Y        +  + L T +GKP+ + ++  F   D ++N Q+S+ E+  
Sbjct  200   LTPWIRERRLQYLMRKYVQKNLLQALCTPDGKPDEANLKELFRKIDQNSNSQISASEMRA  259

Query  934   FLRLIVTDEV--QRMVAVKTMMKDLDRDGNSRITEQEFLNGIENLLannssadnaaaatp  761
              +  I  +E    +   V  +M++ D  G+S I+E EF+ G+   L+  + +        
Sbjct  260   LMLGIQIEEAGSSKDEFVSKVMEEFDISGDSSISENEFVQGLSKWLSEANVSG-------  312

Query  760   tstPENDDQEKSG----------------------EETNgaageveqaggEKMGTWDFIV  647
                  ND  +K+                       E+        E    +    WD+  
Sbjct  313   -----NDQTKKTNKKSSTATSNSTSTSSNSKGTTEEQQGLVTKSQESKDTDNSVLWDYAK  367

Query  646   TVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQ  467
              V  +I G A+    A PLMT +  F+ A+ +P+F++S+ V+P+ ++ + A  AI  A +
Sbjct  368   AVFLIISGTAVTFLIATPLMTTLQDFATAINIPSFLVSYFVVPLALSFKQAYRAITSARE  427

Query  466   KSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAY  287
             K+  AASLT SE+Y GV M+N+ GL   L +V  ++L+WD SAE+LVV +I   +G  A 
Sbjct  428   KTENAASLTLSELYGGVFMNNVMGLAIFLLLVCIKDLSWDVSAEILVVLIICSGMGIYAT  487

Query  286   FKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGW  191
             F T +  WTSI A+ LYP SLA  YVL    GW
Sbjct  488   FSTKFPFWTSIIAYALYPISLAFIYVLTTYCGW  520


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 74/130 (57%), Gaps = 1/130 (1%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGT-GIFGATVFRI  1520
             TC+  YGF PC   + G LF +++++YL+S++ + +S  S+   +T GT  IF A +F++
Sbjct  54    TCEPTYGFLPCTTEVWGQLFLMIVYEYLLSLSAKYISEGSELFLETSGTENIFSANLFQM  113

Query  1519  LMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQE  1340
             L +FP++I+ + + +    +  +     G+ + AG+ I NLT++WG  V  G  D +   
Sbjct  114   LGMFPQVILVLVAAVGGEADTVETMAEMGMGLLAGSVIMNLTLIWGSVVAFGSYDLSQTS  173

Query  1339  KDSQSQPSTQ  1310
               S ++   +
Sbjct  174   TSSNTESQNK  183



>ref|XP_001755925.1| predicted protein [Physcomitrella patens]
 gb|EDQ79210.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 139/530 (26%), Positives = 249/530 (47%), Gaps = 48/530 (9%)
 Frame = -1

Query  1693  CDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILM  1514
             C+  YG  PC+ +I G +F ++ + YL+  A +L+S  S+ + + +  G+ G  +  IL 
Sbjct  59    CEETYGVLPCSTSIGGNVFLMLAYGYLLFTAAKLISDGSELLLEVMNPGLLGGLLLPILG  118

Query  1513  VFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKD  1334
              FP  I+ + SG+  S + AQ +V  G+ V AG+++  LT+ W   ++ GR D      D
Sbjct  119   AFPDSILILVSGVGGSVQQAQEEVMVGVGVLAGSSVMLLTIAWAGSLLAGRCDL-----D  173

Query  1333  SQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRi  1154
               +  +T    +  L      G++TD  T   A +M+ S +P++ V+L  + +       
Sbjct  174   GPNGTATDLTLTRPLDPFG-TGVTTDEQTRVGAWIMMASTLPYLFVQLPLLPNHLIDGPK  232

Query  1153  vvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLT-------------QNGKPN  1013
               L   I+  A LL Y  YQ+  P +Q++ +  +R +   +             Q+ K  
Sbjct  233   GALEGCIVASAGLLLYSAYQVASPWLQQKQIEEARLQYFRSRALQRIPLPFPSAQDEKHG  292

Query  1012  --VSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRMVA---VKTMMKDLDRDGNS  848
               V  ++  F  +D + + ++   EL   +  I  +E   + A   V+T M++ D D + 
Sbjct  293   HLVETVKNLFSSFDHNKDGKIQQEELRGLIVGIGLEEAGFVPAEDQVETWMREFDLDVDG  352

Query  847   RITEQEFLNGI---------ENLLannssadnaaaatptstPENDDQEKSGEETNgaage  695
              I+E EFL GI         + L      A   +           D+ K+ +E +     
Sbjct  353   TISEHEFLTGIKKWSKRVAQDKLSLQAQRASAVSIRDSNFWAAKSDEAKTSDELDPPQI-  411

Query  694   veqaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPI  515
                          +    L ++ G A+    A P++  +  FS A  +P F ++FVV P 
Sbjct  412   -------------YKKAALLMLAGAAVAATFADPMVDTIGNFSAASKIPPFFVAFVVTPF  458

Query  514   VINGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAE  335
               N    +++I  A ++  +  SLTFS++Y  +TM+N   +   LA+VY R LTWD+S+E
Sbjct  459   ASNASELVSSIIFAKRRRKRNISLTFSQVYGAITMNNTLCMAIFLALVYIRGLTWDFSSE  518

Query  334   VLVVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
             V V+ + +  +G +   ++T+  W ++    LYP ++A   VL  +LGW+
Sbjct  519   VTVIVLCTFAVGMMGGTRSTFPSWFALPVLALYPLAIAGVAVLDNVLGWH  568



>emb|CBI21945.3| unnamed protein product [Vitis vinifera]
Length=892

 Score =   161 bits (407),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 139/480 (29%), Positives = 246/480 (51%), Gaps = 27/480 (6%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C   +G  PC   + G +F I+++ YLM  A +L+   S+ + + L  GI G     +L
Sbjct  116   SCKQTHGVMPCTTTVFGNVFLILVYGYLMFFAARLLYDGSEILVELLSPGITGGVFLPLL  175

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  I+ ++S +  +++ A +QV  G  +  G+T   LT+L G C+IVG+ D     +
Sbjct  176   SSLPDAIIILASRLCGNKDTASSQVSAGSALLGGSTAMLLTLLGGCCIIVGKCDL----E  231

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             + +++P  ++ A  +  +L     STD   S+TA +M++S++PF++++L  V+ + S   
Sbjct  232   NLRAKPVEKN-ARGF--SLVGSAASTDIRASYTARIMVISVMPFIIIQLSQVLHTTSQIC  288

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLTQN  1025
             + VL++LII+++ LLAY  +Q+  P++ K  L +++ ++                LLT N
Sbjct  289   LAVLISLIISISLLLAYCLHQVFHPSVLKTRLTHAKDKHMMSRIVKHLKCCTLGRLLTAN  348

Query  1024  GKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEVQRM-VAVKTMMKDLDRDGNS  848
             G+P+   I+  F +   D++QQ+S+ EL   +  I   E   +  AV  ++ D D  G+S
Sbjct  349   GEPDREVIKKLFEMIGEDSDQQLSASELRALITGIQIKEDSDIDEAVGKVLTDFDACGDS  408

Query  847   RITEQEFLNGIENLLannssadnaaaat--ptstPENDDQEKSGEETNgaageveqaggE  674
             +I    F+ GI         +   ++ +   T    +D    + +       +   A   
Sbjct  409   KINLDAFIIGISKWYDKAKHSAVCSSDSDFQTRIIIDDFNTPTSKGNELLGIQFYTAEKI  468

Query  673   KMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMA  494
             +   W     V  ++LG  I      PL+  V  F  A  +P F +SF+VLP   +   A
Sbjct  469   ENPKWSAFKGVFILLLGTLIAATFVDPLVNAVGNFYSATNIPPFFVSFIVLPFASSSE-A  527

Query  493   IAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVI  314
             ++A+  ASQK  + A LT SEIY  V M+NL  L   L ++Y R LTW++++EVL++ +I
Sbjct  528   VSALIFASQKKLRIAPLTVSEIYGAVNMNNLLCLSVFLGLLYFRHLTWNFTSEVLIILII  587


 Score =   101 bits (252),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 137/251 (55%), Gaps = 23/251 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC   +PG +  I+++  LM  A +L+   S+ + + L  GI GA    +L
Sbjct  638   SCNQTYGFMPCTATVPGNILLILVYVSLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLL  697

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                   I+ I+S +  + E AQNQV  G+ +  G+T   LT+L G C+IV + D     +
Sbjct  698   SSLLDAIINIASRLCGNGETAQNQVSAGLGLLTGSTAILLTLLGGCCIIVDKCD-PENSR  756

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
             +  S+ + + F      +L    ISTD   S+TA +M++S++PF++V+L  V+ ++S   
Sbjct  757   EKASEETARGF------SLAGSAISTDIRASYTARIMVISVMPFIIVQLAQVLHTSSQIC  810

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSR----------------FENLLTQN  1025
               + ++LII+V+ LLAY  +Q+  P+I +R L Y++                 E LLT N
Sbjct  811   FAIFISLIISVSLLLAYCLHQVFHPSILRRKLAYAKQMHMTSRIVKQLKYSPLERLLTTN  870

Query  1024  GKPNVSRIRLF  992
             G+P++  IR+ 
Sbjct  871   GEPDMEVIRML  881



>ref|XP_002893544.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69803.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=521

 Score =   156 bits (394),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 136/540 (25%), Positives = 238/540 (44%), Gaps = 108/540 (20%)
 Frame = -1

Query  1753  DQSSFLALGGPRL-sssssSTCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSS  1577
             +Q  FL+L  P++  + +   C H YGF PCAEN+ GY FQ+  F  L+ V +  +S   
Sbjct  43    NQLQFLSLEPPKINVTLTREACVHLYGFLPCAENVIGYAFQVFSFGSLLIVGDYFLSQGR  102

Query  1576  KKIFDTLGTGIFGATVFRILMVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNL  1397
              ++ D    G++G T                 G+    E AQ+ +   +    G+++F L
Sbjct  103   AELLDIFEVGLYGVT-----------------GLSTRPEVAQSMIVDFVGATVGSSVFAL  145

Query  1396  TVLWGLCVIVGRR-------DRATQEKDSQSQPS----TQSF----ASNWLKTL-NECG-  1268
             T+ WG C+I G         D+  Q++++ ++P     T+ F    +S++     N+CG 
Sbjct  146   TIQWGACIIFGTTGVFDTGCDQLVQKEENPTKPRPGLLTRLFDLRPSSDYFSICRNKCGN  205

Query  1267  ------ISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliitvafllAY  1106
                     TD ++   +     +        L     S          +           
Sbjct  206   RFKNQERRTDHASHINSFSHCATFRAIRFAILETHYCSTDADSFYFRNS-----------  254

Query  1105  FGYQIIDPTIQKRSLHYSRFENL--------------LTQNGKPNVSRIRLFFHLYDSDN  968
             F     D + QK SL  +RFE +              + Q+G+     ++  F  +D+DN
Sbjct  255   FALDSFDTSGQKNSLDKARFELMSEVKKKLQRYSLERILQDGQLTRESLKNLFDKFDNDN  314

Query  967   NQQMSSRELEKFLRLIVTDEVQRM--------VAVKTMMKDLDRDGNSRITEQEFLNGIE  812
             + +M   EL +F     T E  ++           KT++K+ D+D +  + E EF  GI 
Sbjct  315   DGKMEISELNEF-----TLEFGKLGKLKCDMNALAKTVLKEFDKDNDGMVNEDEFAKGIT  369

Query  811   NLLannss-adnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTWDFIVTVLQ  635
               L    +     AAA    + + ++Q+KS   T                    ++  ++
Sbjct  370   KWLKERKAGLVTCAAAAVAPSLKVEEQKKSVGYT--------------------LIATIK  409

Query  634   VILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSK  455
             VI G+ I+ F A+P M N+   S + G+P+F ++F V+P+  N + A++  F A ++  +
Sbjct  410   VIAGILIVVFLAKPFMMNISLLSASAGIPSFYVAFAVIPLARNLKNALSLHFCAKREKQE  469

Query  454   AASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYFKTT  275
             AASLTFS+++          ++S+LA+VYA+ LT + S EVL+V  + L +G  A   +T
Sbjct  470   AASLTFSQVH--------ITIVSILAIVYAKGLTCNCSTEVLIVVFLGLIVGLPASITST  521



>gb|KCW67441.1| hypothetical protein EUGRSUZ_F011931, partial [Eucalyptus grandis]
Length=242

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 101/153 (66%), Gaps = 1/153 (1%)
 Frame = -1

Query  643  VLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQK  464
            VL ++LG  I    A PL+  V  FS A G+PTF ISF+ LP+  N   A++AI  AS+K
Sbjct  90   VLLLVLGTIIAGVFADPLVDAVDNFSDATGIPTFFISFIALPLATNSSEAVSAIIFASRK  149

Query  463  SSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLVVFVISLTIGFLAYF  284
              + ASLTFSE+Y  VTM+NL  L   LA+VY + LTWD+S+EVLV+ ++   +G  A F
Sbjct  150  KQRTASLTFSELYGAVTMNNLLCLSVFLAIVYIKGLTWDFSSEVLVILIVCFVMGTFASF  209

Query  283  KTTYQLWTSIFAFFLYPFSLALFYVLQ-LLGWN  188
            +TT+ LWT   A  LYPFSLAL Y+L  + GW+
Sbjct  210  RTTFPLWTFSLALLLYPFSLALVYILDYIFGWS  242



>ref|XP_004295570.1| PREDICTED: uncharacterized protein LOC101307679 [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   153 bits (387),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 131/430 (30%), Positives = 230/430 (53%), Gaps = 21/430 (5%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             TC+  YGF PCA +  G  F +++++ L+ +A   ++S S+  F   G+  FGA+VF +L
Sbjct  58    TCEPIYGFLPCATSFWGLAFLVIVYEILLYLANSFITSGSELFFKMYGSKFFGASVFHLL  117

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P++ +     +  + E A+      + + AG+ I  LT++WG  V+ G  D  ++  
Sbjct  118   GTVPQVGI-----VLGTAETAEAMATMNMSMVAGSGIMLLTLVWGSVVVFGSSD-VSESP  171

Query  1336  DSQSQPSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQR  1157
              S +Q   + F++ +      C ++TDA T  TA +M++S++PF+++++  V+SS SG R
Sbjct  172   GSLNQGLKKFFSTCY------C-VTTDAETRSTARIMMVSVIPFLILQVAKVLSSTSGIR  224

Query  1156  ivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFENLLTQNGKPNVSRIRLFFHLYD  977
             IV+LV+L++++A L+ Y  YQ+  P IQ R L +      L  NG PNVS I   F   D
Sbjct  225   IVILVSLLVSIALLVTYCIYQVFTPWIQDRRLDF-LLPGFLNANGDPNVSYILEVFSRID  283

Query  976   SDNNQQMSSRELEKF-LRLIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEFLNGIE---N  809
              ++N+ +S  EL    L + + D    +  ++  MK+ D+ G+SRI+E+EF++GI    N
Sbjct  284   QNHNKYISEYELRALILGIQIRDVGLEIDYLEKAMKNFDKSGDSRISEKEFVDGISKWVN  343

Query  808   LLannssadnaaaatptstPENDDQEKSGEETNgaageveqaggEKMGTW-DFIVTVLQV  632
                + +      A        +  +E   E+      +++    +K  TW + +     +
Sbjct  344   ATPSANGQGQGQAQGQRRFLSSKSKEALDEQQKQVPKKMKNKHMDK--TWRNQLKAACFL  401

Query  631   ILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVINGRMAIAAIFPASQKSSKA  452
             I+G+ I+   A PLM  +  FS A  +P+F+ S+V++P  IN   A+  +  A  K+  A
Sbjct  402   IIGIGIMILLATPLMETIQDFSTAASIPSFLSSYVLIPFAINIGQALQLVTSAQHKTENA  461

Query  451   ASLTFSEIYN  422
              SLT SE+ +
Sbjct  462   ISLTLSEMQD  471



>ref|XP_007021649.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
 gb|EOY13174.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
Length=452

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 177/316 (56%), Gaps = 30/316 (9%)
 Frame = -1

Query  1696  TCDHAYGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRIL  1517
             +C+  YGF PC     G LF I+++  LM +A   +S+ S+ +   LG GI G     IL
Sbjct  60    SCEQTYGFLPCTTTALGNLFLIIVYGCLMFLAATYLSNGSELLLQILGPGIVGGLFLPIL  119

Query  1516  MVFPRIIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEK  1337
                P  ++ + SG+  + E AQ+QV  G+ + AG+T+  LTV+WG CV+VGR D     +
Sbjct  120   GALPDAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDL----R  175

Query  1336  DSQSQPS--TQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASG  1163
             DS +     T+ F      +L E G+STD  T + A +M +S++PF++V+L  ++SS SG
Sbjct  176   DSVAVDGTITKGF------SLTETGVSTDIWTCYAARIMAISVIPFIIVQLPQILSSTSG  229

Query  1162  QRivvlvaliitvafllAYFGYQIIDPTIQKRSLHYSRFEN----------------LLT  1031
             + + VL+ALI++++ L++Y  YQ+  P IQ+R L +++ ++                LL 
Sbjct  230   RHLAVLIALIVSLSMLVSYCLYQVFQPWIQRRRLAFAKHKHVISGILRHLKKTALGKLLD  289

Query  1030  QNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV--QRMVAVKTMMKDLDRD  857
              NG PN   IR  F   D +++  +S+ EL+ F+  I  +E+   R  AV+ +M D D  
Sbjct  290   DNGDPNTEIIRKLFDTIDENHDGSLSNSELKAFIIGIRFEEIDLDRDDAVRKVMADFDTS  349

Query  856   GNSRITEQEFLNGIEN  809
              +S + E EF+ GI+ 
Sbjct  350   HDSLVQEGEFVRGIQK  365



>ref|XP_006594744.1| PREDICTED: uncharacterized protein LOC100799062 [Glycine max]
Length=503

 Score =   152 bits (383),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 155/281 (55%), Gaps = 14/281 (5%)
 Frame = -1

Query  1039  LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV-QRMVAVKTMMKDLD  863
             L   +G+P+ + IR  F   D + +  +S  ELEK ++ I   +V +   AV  +++DLD
Sbjct  229   LRQDDGRPDKTAIRRLFEEIDVNRDNHISRSELEKIVKDIHFGKVVETEEAVTKLVQDLD  288

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN-DDQEKSGEETNgaageveq  686
              + ++ I+E EF+ G    + +NSS    + ++     +  +D EK  EE          
Sbjct  289   LNRDNEISETEFVEGFTKWMDSNSSQAANSKSSSHEIHQTWEDVEKVMEENQTK------  342

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                   G   ++  +  V+LGV IL   A+PL+ +V +FS   G+ +F ISF+++P+  N
Sbjct  343   ------GASAWLTAIAYVVLGVTILALLAEPLIASVQKFSEEAGISSFFISFILVPLATN  396

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
              R A +AI  AS K S   S T  EIY  V M+N+ G + +  ++Y RE+TW++SA+VLV
Sbjct  397   FREATSAIKEASHKKSSNTSQTMYEIYGAVFMNNILGFVVISILIYMREITWEFSADVLV  456

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             V ++   +G  A F+ T+ LWTS  A+ +Y  +L L +VL+
Sbjct  457   VAIVCAVMGLTASFRPTFPLWTSFPAYLMYLIALLLVFVLK  497



>gb|KHN36865.1| hypothetical protein glysoja_001596 [Glycine soja]
Length=640

 Score =   152 bits (384),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 155/281 (55%), Gaps = 14/281 (5%)
 Frame = -1

Query  1039  LLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLIVTDEV-QRMVAVKTMMKDLD  863
             L   +G+P+ + IR  F   D + +  +S  ELEK ++ I   +V +   AV  +++DLD
Sbjct  366   LRQDDGRPDKTAIRRLFEEIDVNRDNHISRSELEKIVKDIHFGKVVETEEAVTKLVQDLD  425

Query  862   RDGNSRITEQEFLNGIENLLannssadnaaaatptstPEN-DDQEKSGEETNgaageveq  686
              + ++ I+E EF+ G    + +NSS    + ++     +  +D EK  EE          
Sbjct  426   LNRDNEISETEFVEGFTKWMDSNSSQAANSKSSSHEIHQTWEDVEKVMEENQTK------  479

Query  685   aggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVIN  506
                   G   ++  +  V+LGV IL   A+PL+ +V +FS   G+ +F ISF+++P+  N
Sbjct  480   ------GASAWLTAIAYVVLGVTILALLAEPLIASVQKFSEEAGISSFFISFILVPLATN  533

Query  505   GRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVLV  326
              R A +AI  AS K S   S T  EIY  V M+N+ G + +  ++Y RE+TW++SA+VLV
Sbjct  534   FREATSAIKEASHKKSSNTSQTMYEIYGAVFMNNILGFVVISILIYMREITWEFSADVLV  593

Query  325   VFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVLQ  203
             V ++   +G  A F+ T+ LWTS  A+ +Y  +L L +VL+
Sbjct  594   VAIVCAVMGLTASFRPTFPLWTSFPAYLMYLIALLLVFVLK  634


 Score =   137 bits (344),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/307 (30%), Positives = 166/307 (54%), Gaps = 22/307 (7%)
 Frame = -1

Query  1681  YGFFPCAENIPGYLFQIVIFQYLMSVAEQLVSSSSKKIFDTLGTGIFGATVFRILMVFPR  1502
             YGF PC+ NI G+LF I++++YL+   E  +++  ++IF  LG G+FGA+ F IL   P 
Sbjct  2     YGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFDILGALPE  61

Query  1501  IIMTISSGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQ  1322
              ++ + +G+ + +E AQ     G+ + AG++I  LTV+WG CVI+G++    + K+    
Sbjct  62    SLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVIIGKQ----KLKNDPDS  117

Query  1321  PSTQSFASNWLKTLNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlv  1142
               T S      ++L   GI+ D  T   A +M+ S++P +++++ N+ + +S  R V L+
Sbjct  118   FGTNSSNGGIKESLTGYGITMDVETRKMARIMVFSVIPLLIMQIPNLFNFSSTPRNVTLM  177

Query  1141  aliitvaf-llAYFGYQIIDPTIQKRSLHYSRFENL----------------LTQNGKPN  1013
               +      L++YF YQ+  P I+K  L Y + ++L                LT +G PN
Sbjct  178   VSLTVAVAFLISYFIYQVFKPQIEKTRLEYIKHDDLILRIFQRVEKQTLQKILTDDGTPN  237

Query  1012  VSRIRLFFHLYDSDNNQQMSSRELEKFL-RLIVTDEVQRMVAVKTMMKDLDRDGNSRITE  836
             V+ I   +H       + + + E+++ L    + D   +   +  M+K  DR+G+  IT+
Sbjct  238   VAAISGLYHEISQSGGKDLLASEVKELLFGNKLNDTNIKEEQITDMLKVFDRNGDQIITK  297

Query  835   QEFLNGI  815
             +EF+ G+
Sbjct  298   EEFVTGL  304



>ref|XP_007149413.1| hypothetical protein PHAVU_005G068200g, partial [Phaseolus vulgaris]
 gb|ESW21407.1| hypothetical protein PHAVU_005G068200g, partial [Phaseolus vulgaris]
Length=578

 Score =   150 bits (380),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 156/288 (54%), Gaps = 8/288 (3%)
 Frame = -1

Query  1042  NLLTQNGKPNVSRIRLFFHLYDSDNNQQMSSRELEKFLRLI--VTDEVQRMVAVKTMMKD  869
             +LLT +GKP+   IR  F   D + +  +S  EL + +  I  V   ++   AV  ++K+
Sbjct  296   SLLTVDGKPDEHAIRGLFLKIDRNRDNFISQSELRELIMNIKFVKASMEVEEAVALVIKE  355

Query  868   LDRDGNSRITEQEFLNGIENLLannssadnaaaatptstPENDDQEKSGEETNgaageve  689
             LD D +  I E EF+ G    L++ S+    + +        +D  ++ EE +    E +
Sbjct  356   LDIDNDRIINEDEFVAGFHKWLSSTSAPAPVSHSES-----QEDMYQTWEEADMVVEERQ  410

Query  688   qaggEKMGTWDFIVTVLQVILGVAILTFCAQPLMTNVIQFSGAVGVPTFIISFVVLPIVI  509
             +       TW +   +L V+LG+ +L+   +PL  +V  FS +VG+  F +SF+++P+  
Sbjct  411   RKAVVDKSTWAWFKAILYVMLGIVMLSILTEPLTESVHNFSNSVGLHPFFMSFILVPLAT  470

Query  508   NGRMAIAAIFPASQKSSKAASLTFSEIYNGVTMSNLTGLLSLLAVVYARELTWDYSAEVL  329
             N R A +AI  AS K  +  SL  SEIY GV M+N+ G  ++  ++   ++TW YSAE+L
Sbjct  471   NAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLISVGQVTWQYSAELL  530

Query  328   VVFVISLTIGFLAYFKTTYQLWTSIFAFFLYPFSLALFYVL-QLLGWN  188
             VV ++    G  A F + + L +S FA  LYP SL L +VL Q+L +N
Sbjct  531   VVGIVCAIAGLTASFLSIFPLCSSFFAILLYPLSLVLVFVLDQVLRYN  578


 Score =   100 bits (250),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 131/242 (54%), Gaps = 27/242 (11%)
 Frame = -1

Query  1483  SGIFNSQEGAQNQVFFGIRVNAGATIFNLTVLWGLCVIVGRRDRATQEKDSQSQPSTQSF  1304
             SG+ +++E A+     GI + AG++I  LTV+WG CVI G      QE +  S PS    
Sbjct  1     SGLVSNKETAKEYAMSGIGLLAGSSILLLTVVWGSCVIAG-----NQEFEHHSPPSNSHH  55

Query  1303  ASNWLKT-LNECGISTDASTSFTAGLMLLSlvpfvlvelvnvVSSASGQRivvlvaliit  1127
              +  +KT     GI+TD  TS++A +M+ S++PF ++++ N+   +SG R V L+  +I 
Sbjct  56    KT--IKTFFTGYGITTDLETSYSARIMVCSVIPFAIMQVPNLFHFSSGLRNVTLLIALII  113

Query  1126  vafll-AYFGYQIIDPTIQKRSLHYSRFENLL----------------TQNGKPNVSRIR  998
              + LL  YF YQI +P +QKR L Y + ++L+                T+NG PNVS IR
Sbjct  114   TSILLFLYFAYQIFEPWVQKRRLEYVKHDHLILRILQHVQKNTLQRIFTKNGTPNVSAIR  173

Query  997   LFFHLYDSDNNQQMSSRELEKFL--RLIVTDEVQRMVAVKTMMKDLDRDGNSRITEQEFL  824
               +   D D +  +S+ E++  L    +          VK +++  D DG+ +I ++EF+
Sbjct  174   RLYREIDQDGSSGISASEVKDLLLKNKVTETNFDEEREVKEVLQIFDLDGDKKINKEEFV  233

Query  823   NG  818
             +G
Sbjct  234   SG  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5845906598316