BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c302_g1_i2 len=1154 path=[1132:0-320 1453:321-1153]

Length=1154
                                                                      Score     E

ref|XP_011090788.1|  PREDICTED: probable aquaporin NIP7-1               282   4e-89   
gb|EYU41531.1|  hypothetical protein MIMGU_mgv1a012148mg                278   9e-88   
ref|XP_009596229.1|  PREDICTED: probable aquaporin NIP7-1               270   2e-84   
ref|XP_009787413.1|  PREDICTED: probable aquaporin NIP7-1               270   4e-84   
ref|NP_001289837.1|  probable aquaporin NIP7-1                          266   5e-83   
ref|XP_006349237.1|  PREDICTED: probable aquaporin NIP7-1-like is...    263   1e-81   
ref|XP_006349238.1|  PREDICTED: probable aquaporin NIP7-1-like is...    253   2e-78   
ref|XP_002277721.3|  PREDICTED: probable aquaporin NIP7-1               243   5e-74   Vitis vinifera
ref|XP_004495131.1|  PREDICTED: probable aquaporin NIP7-1-like is...    243   6e-74   
ref|XP_010107830.1|  putative aquaporin NIP7-1                          243   1e-73   
ref|XP_004495130.1|  PREDICTED: probable aquaporin NIP7-1-like is...    243   2e-73   
ref|XP_002517178.1|  Aquaporin NIP1.1, putative                         242   3e-73   Ricinus communis
ref|XP_006489314.1|  PREDICTED: probable aquaporin NIP7-1-like          239   7e-73   
ref|XP_006419834.1|  hypothetical protein CICLE_v10005554mg             239   3e-72   
gb|KDO74787.1|  hypothetical protein CISIN_1g039196mg                   239   4e-72   
ref|XP_010094007.1|  putative aquaporin NIP7-1                          236   6e-72   
ref|XP_008340963.1|  PREDICTED: probable aquaporin NIP7-1               237   2e-71   
gb|KCW60848.1|  hypothetical protein EUGRSUZ_H03586                     236   3e-71   
ref|XP_010026989.1|  PREDICTED: probable aquaporin NIP7-1               236   1e-70   
ref|XP_008222994.1|  PREDICTED: probable aquaporin NIP7-1               235   2e-70   
ref|XP_011011194.1|  PREDICTED: probable aquaporin NIP7-1 isoform X1    234   4e-70   
ref|XP_004296938.1|  PREDICTED: probable aquaporin NIP7-1-like          233   4e-70   
ref|XP_002311835.2|  hypothetical protein POPTR_0008s20750g             233   5e-70   Populus trichocarpa [western balsam poplar]
gb|KHN32334.1|  Putative aquaporin NIP7-1                               229   4e-69   
gb|KEH42598.1|  P-loop nucleoside triphosphate hydrolase superfam...    243   4e-69   
ref|XP_006575039.1|  PREDICTED: probable aquaporin NIP7-1-like is...    231   1e-68   
ref|XP_007223194.1|  hypothetical protein PRUPE_ppa009284mg             230   1e-68   
ref|XP_003520186.2|  PREDICTED: probable aquaporin NIP7-1-like is...    231   2e-68   
ref|XP_006589815.1|  PREDICTED: probable aquaporin NIP7-1-like          226   7e-67   
ref|XP_007144705.1|  hypothetical protein PHAVU_007G178300g             225   7e-67   
ref|XP_007034632.1|  Aquaporin NIP1.1, putative                         223   9e-66   
emb|CDO99001.1|  unnamed protein product                                219   4e-65   
gb|KHN03851.1|  Putative aquaporin NIP7-1                               212   1e-62   
ref|XP_010256208.1|  PREDICTED: probable aquaporin NIP7-1               212   7e-62   
gb|KDP40116.1|  hypothetical protein JCGZ_02114                         219   3e-61   
gb|KFK38046.1|  hypothetical protein AALP_AA3G063100                    209   1e-60   
ref|XP_002884559.1|  hypothetical protein ARALYDRAFT_477911             207   4e-60   
gb|AAF30303.1|AC018907_3  putative major intrinsic protein              206   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566271.1|  putative aquaporin NIP7-1                             205   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28544.1|  unknown                                                 205   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65333.1|  putative major intrinsic protein                        205   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546840.1|  PREDICTED: probable aquaporin NIP7-1               204   7e-59   
ref|XP_006299499.1|  hypothetical protein CARUB_v10015668mg             203   1e-58   
ref|XP_009129640.1|  PREDICTED: probable aquaporin NIP7-1               202   3e-58   
ref|XP_010694010.1|  PREDICTED: probable aquaporin NIP7-1               202   5e-58   
emb|CDY05231.1|  BnaC05g45720D                                          201   8e-58   
ref|XP_010435915.1|  PREDICTED: probable aquaporin NIP7-1               200   1e-57   
ref|XP_010486097.1|  PREDICTED: probable aquaporin NIP7-1 isoform X1    200   2e-57   
ref|XP_010464176.1|  PREDICTED: probable aquaporin NIP7-1               199   4e-57   
ref|XP_006407983.1|  hypothetical protein EUTSA_v10021311mg             189   2e-53   
ref|XP_004134455.1|  PREDICTED: probable aquaporin NIP7-1-like          177   5e-49   
gb|KGN57016.1|  hypothetical protein Csa_3G149960                       177   1e-48   
ref|XP_008438714.1|  PREDICTED: probable aquaporin NIP7-1               173   2e-47   
ref|XP_004170712.1|  PREDICTED: probable aquaporin NIP7-1-like          169   3e-46   
ref|XP_011011195.1|  PREDICTED: probable aquaporin NIP7-1 isoform X2    162   4e-43   
gb|KCW60849.1|  hypothetical protein EUGRSUZ_H03586                     157   4e-42   
ref|XP_010040111.1|  PREDICTED: aquaporin NIP1-1-like                   158   1e-41   
ref|XP_004309631.1|  PREDICTED: aquaporin NIP1-2-like                   158   1e-41   
ref|XP_010057160.1|  PREDICTED: aquaporin NIP1-1-like                   158   2e-41   
ref|XP_004234073.1|  PREDICTED: aquaporin NIP1-1-like                   157   4e-41   
ref|XP_006356091.1|  PREDICTED: aquaporin NIP1-1-like                   156   8e-41   
ref|XP_009590978.1|  PREDICTED: aquaporin NIP1-1-like                   155   1e-40   
ref|XP_009785425.1|  PREDICTED: aquaporin NIP1-1-like                   155   2e-40   
gb|EYU42698.1|  hypothetical protein MIMGU_mgv1a019443mg                154   2e-40   
ref|XP_009419139.1|  PREDICTED: aquaporin NIP2-1-like                   154   1e-39   
emb|CDP14867.1|  unnamed protein product                                153   1e-39   
ref|XP_004309391.1|  PREDICTED: aquaporin NIP1-2-like                   152   2e-39   
ref|XP_009590733.1|  PREDICTED: probable aquaporin NIP5-1               152   3e-39   
ref|XP_010680949.1|  PREDICTED: probable aquaporin NIP5-1               151   4e-39   
ref|XP_010088000.1|  Aquaporin NIP1-2                                   151   5e-39   
ref|XP_004309620.1|  PREDICTED: aquaporin NIP1-2-like                   151   5e-39   
dbj|BAJ96213.1|  predicted protein                                      152   5e-39   
ref|XP_006358084.1|  PREDICTED: aquaporin NIP1-1-like                   151   8e-39   
gb|AFW77428.1|  aquaporin NIP-type                                      151   8e-39   
ref|NP_001151947.1|  LOC100285584                                       151   8e-39   Zea mays [maize]
gb|EMT30274.1|  Aquaporin NIP1-3                                        151   9e-39   
gb|AAQ11827.1|  nodulin-like intrinsic protein NIP1-2                   151   9e-39   Atriplex nummularia
emb|CDP12262.1|  unnamed protein product                                151   1e-38   
ref|XP_009624261.1|  PREDICTED: aquaporin NIP1-1-like isoform X1        151   1e-38   
ref|XP_006434369.1|  hypothetical protein CICLE_v10001994mg             151   1e-38   
dbj|BAI66444.1|  nodulin-26 like intrinsic protein                      152   1e-38   Hordeum vulgare subsp. vulgare [barley]
gb|AEY75255.1|  nodulin-like intrinsic protein                          151   1e-38   
ref|XP_009624262.1|  PREDICTED: aquaporin NIP1-1-like isoform X2        149   1e-38   
ref|XP_006472916.1|  PREDICTED: probable aquaporin NIP5-1-like          150   1e-38   
gb|AAQ11826.1|  nodulin-like intrinsic protein NIP1-1                   150   2e-38   Atriplex nummularia
ref|XP_010088003.1|  Aquaporin NIP1-2                                   150   2e-38   
ref|NP_001274704.1|  aquaporin NIP1-1-like                              150   2e-38   
gb|KHN17043.1|  Putative aquaporin NIP5-1                               149   2e-38   
gb|ABY19373.1|  major intrinsic protein NIP5;1                          150   2e-38   Lotus japonicus
ref|XP_009804207.1|  PREDICTED: aquaporin NIP1-1-like                   150   2e-38   
ref|XP_010056097.1|  PREDICTED: probable aquaporin NIP5-1               149   4e-38   
ref|XP_010665679.1|  PREDICTED: aquaporin NIP1-1-like                   149   4e-38   
ref|XP_006851308.1|  hypothetical protein AMTR_s00050p00166160          147   4e-38   
ref|XP_010555246.1|  PREDICTED: probable aquaporin NIP5-1               150   4e-38   
gb|AFN37617.1|  boron transporter                                       149   5e-38   
gb|AAM61294.1|  major intrinsic protein (MIP)- like                     149   5e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009803208.1|  PREDICTED: probable aquaporin NIP5-1               149   5e-38   
ref|XP_003535560.1|  PREDICTED: probable aquaporin NIP5-1-like          149   8e-38   
ref|NP_001274288.1|  probable aquaporin NIP5-1-like                     149   8e-38   
ref|XP_002276319.1|  PREDICTED: probable aquaporin NIP5-1               149   9e-38   Vitis vinifera
gb|KHN46385.1|  Putative aquaporin NIP5-1                               148   1e-37   
ref|XP_010680950.1|  PREDICTED: probable aquaporin NIP5-1               148   1e-37   
ref|NP_001274996.1|  probable aquaporin NIP5-1-like                     148   1e-37   
ref|XP_002874623.1|  hypothetical protein ARALYDRAFT_911337             148   2e-37   
ref|XP_002264957.2|  PREDICTED: aquaporin NIP1-1                        147   2e-37   Vitis vinifera
gb|KDP21151.1|  hypothetical protein JCGZ_21622                         147   2e-37   
ref|XP_010529699.1|  PREDICTED: probable aquaporin NIP5-1               147   3e-37   
ref|XP_002453573.1|  hypothetical protein SORBIDRAFT_04g008360          147   3e-37   Sorghum bicolor [broomcorn]
ref|XP_007139574.1|  hypothetical protein PHAVU_008G041100g             147   4e-37   
ref|XP_002867962.1|  hypothetical protein ARALYDRAFT_492953             147   4e-37   
ref|XP_011101921.1|  PREDICTED: aquaporin NIP1-1-like                   146   4e-37   
ref|XP_002522274.1|  Aquaporin NIP1.1, putative                         146   4e-37   Ricinus communis
emb|CDO96878.1|  unnamed protein product                                146   6e-37   
ref|XP_011009650.1|  PREDICTED: aquaporin NIP1-2-like                   145   6e-37   
ref|XP_004496427.1|  PREDICTED: probable aquaporin NIP5-1-like          146   6e-37   
ref|XP_004302297.1|  PREDICTED: aquaporin NIP1-2-like                   145   6e-37   
ref|XP_003621222.1|  Aquaporin NIP2-1                                   145   6e-37   
gb|ADK56129.1|  nodulin 26-like intrinsic protein                       145   6e-37   
ref|XP_002518973.1|  Nodulin-26, putative                               146   6e-37   Ricinus communis
emb|CAA68906.1|  NLM1 protein (NodLikeMip1)                             145   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143584.1|  hypothetical protein PHAVU_007G084000g             146   7e-37   
ref|NP_567572.1|  aquaporin NIP1-1                                      146   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193626.1|  NOD26-like intrinsic protein 1;2                      146   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434480.1|  PREDICTED: aquaporin NIP1-2-like                   145   9e-37   
ref|XP_003592016.1|  Aquaporin NIP3-1                                   146   9e-37   
ref|XP_002870013.1|  hypothetical protein ARALYDRAFT_492969             145   1e-36   
ref|XP_010455436.1|  PREDICTED: probable aquaporin NIP5-1 isoform X2    145   1e-36   
gb|AGE09576.1|  NOD-like protein                                        144   1e-36   
ref|XP_010449446.1|  PREDICTED: aquaporin NIP1-2-like                   145   2e-36   
ref|XP_002440774.1|  hypothetical protein SORBIDRAFT_09g006390          145   2e-36   Sorghum bicolor [broomcorn]
ref|XP_010094419.1|  putative aquaporin NIP5-1                          145   2e-36   
gb|EYU31217.1|  hypothetical protein MIMGU_mgv1a010890mg                145   2e-36   
ref|XP_004309493.1|  PREDICTED: probable aquaporin NIP5-1-like          145   2e-36   
ref|XP_009774307.1|  PREDICTED: nodulin-26-like                         146   2e-36   
ref|XP_011083233.1|  PREDICTED: probable aquaporin NIP5-1               145   2e-36   
ref|XP_010054000.1|  PREDICTED: probable aquaporin NIP5-1               144   2e-36   
gb|AHJ09606.1|  aquaporin protein 25                                    144   2e-36   
ref|XP_003571857.1|  PREDICTED: aquaporin NIP1-1                        144   3e-36   
ref|XP_010437147.1|  PREDICTED: probable aquaporin NIP5-1               145   3e-36   
ref|XP_009605352.1|  PREDICTED: nodulin-26-like                         145   3e-36   
ref|XP_002305717.2|  hypothetical protein POPTR_0004s06160g             144   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008239293.1|  PREDICTED: probable aquaporin NIP5-1               144   3e-36   
ref|XP_006397069.1|  hypothetical protein EUTSA_v10028842mg             144   3e-36   
ref|XP_002298990.1|  hypothetical protein POPTR_0001s45920g             144   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010439792.1|  PREDICTED: aquaporin NIP1-2                        144   3e-36   
ref|XP_004309621.1|  PREDICTED: aquaporin NIP1-2-like                   143   4e-36   
ref|XP_010499739.1|  PREDICTED: aquaporin NIP3-1                        144   4e-36   
ref|XP_009128716.1|  PREDICTED: probable aquaporin NIP5-1               144   5e-36   
ref|XP_010478611.1|  PREDICTED: aquaporin NIP3-1-like                   144   5e-36   
emb|CDX94261.1|  BnaC02g29210D                                          144   5e-36   
ref|XP_007209472.1|  hypothetical protein PRUPE_ppa010013mg             143   6e-36   
ref|NP_192776.1|  putative aquaporin NIP5-1                             144   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28128.1|  hypothetical protein MIMGU_mgv1a011383mg                143   7e-36   
gb|KFK28559.1|  hypothetical protein AALP_AA7G012100                    143   7e-36   
ref|XP_007159494.1|  hypothetical protein PHAVU_002G242300g             142   9e-36   
ref|XP_011039373.1|  PREDICTED: aquaporin NIP1-2-like                   142   1e-35   
ref|XP_010058835.1|  PREDICTED: aquaporin NIP1-1-like                   142   1e-35   
ref|XP_010461016.1|  PREDICTED: aquaporin NIP3-1-like                   143   1e-35   
ref|XP_009389176.1|  PREDICTED: probable aquaporin NIP5-1               143   1e-35   
ref|XP_009360260.1|  PREDICTED: probable aquaporin NIP5-1               143   1e-35   
ref|XP_010058378.1|  PREDICTED: probable aquaporin NIP5-1               141   1e-35   
ref|XP_008437497.1|  PREDICTED: probable aquaporin NIP5-1               143   1e-35   
ref|XP_010554965.1|  PREDICTED: aquaporin NIP2-1-like                   142   1e-35   
ref|XP_004145889.1|  PREDICTED: probable aquaporin NIP5-1-like          143   1e-35   
ref|XP_004960601.1|  PREDICTED: aquaporin NIP1-3-like                   142   1e-35   
ref|XP_007216752.1|  hypothetical protein PRUPE_ppa024808mg             140   1e-35   
ref|XP_008356814.1|  PREDICTED: probable aquaporin NIP5-1               142   1e-35   
ref|XP_006431151.1|  hypothetical protein CICLE_v10012382mg             142   2e-35   
ref|XP_006415281.1|  hypothetical protein EUTSA_v10008205mg             143   2e-35   
ref|XP_010251728.1|  PREDICTED: probable aquaporin NIP5-1               142   2e-35   
ref|XP_010058381.1|  PREDICTED: probable aquaporin NIP5-1               140   2e-35   
ref|XP_006482598.1|  PREDICTED: aquaporin NIP2-1-like                   142   2e-35   
ref|XP_006284229.1|  hypothetical protein CARUB_v10005388mg             142   2e-35   
ref|XP_002317387.2|  hypothetical protein POPTR_0011s06770g             142   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002454982.1|  hypothetical protein SORBIDRAFT_03g002490          141   2e-35   Sorghum bicolor [broomcorn]
ref|XP_009373676.1|  PREDICTED: probable aquaporin NIP5-1 isoform X1    142   2e-35   
ref|XP_004163347.1|  PREDICTED: aquaporin NIP1-2-like                   141   2e-35   
ref|XP_010274649.1|  PREDICTED: probable aquaporin NIP-type             141   2e-35   
ref|XP_008348330.1|  PREDICTED: probable aquaporin NIP5-1               141   3e-35   
ref|XP_010421957.1|  PREDICTED: probable aquaporin NIP5-1               142   3e-35   
ref|XP_008380091.1|  PREDICTED: probable aquaporin NIP5-1               141   3e-35   
ref|XP_008225242.1|  PREDICTED: aquaporin NIP1-1                        141   3e-35   
ref|XP_009360304.1|  PREDICTED: probable aquaporin NIP5-1               142   3e-35   
ref|XP_006303503.1|  hypothetical protein CARUB_v10010843mg             142   3e-35   
ref|NP_001266068.1|  aquaporin NIP2-1-like                              141   3e-35   
ref|XP_007025281.1|  NOD26-like intrinsic protein 1,2 isoform 2         141   3e-35   
ref|XP_008360732.1|  PREDICTED: probable aquaporin NIP5-1               142   3e-35   
ref|XP_008439707.1|  PREDICTED: aquaporin NIP1-1                        141   3e-35   
ref|XP_006288313.1|  hypothetical protein CARUB_v10001558mg             141   4e-35   
ref|XP_006449563.1|  hypothetical protein CICLE_v10016171mg             141   4e-35   
ref|XP_002324057.1|  hypothetical protein POPTR_0017s11960g             140   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009132304.1|  PREDICTED: aquaporin NIP1-2-like                   141   5e-35   
ref|XP_006467589.1|  PREDICTED: aquaporin NIP1-2-like                   140   5e-35   
gb|KHG22884.1|  putative aquaporin NIP5-1 -like protein                 141   5e-35   
ref|XP_003568755.1|  PREDICTED: aquaporin NIP1-3-like                   140   5e-35   
ref|XP_009136970.1|  PREDICTED: aquaporin NIP1-2                        141   5e-35   
ref|XP_006361154.1|  PREDICTED: multicystatin-like                      145   5e-35   
ref|NP_001274279.1|  nodulin-26-like                                    142   5e-35   
emb|CDX78905.1|  BnaA01g09720D                                          141   5e-35   
emb|CDX98596.1|  BnaA03g43810D                                          141   5e-35   
gb|KDO77955.1|  hypothetical protein CISIN_1g023184mg                   140   6e-35   
ref|XP_010455435.1|  PREDICTED: probable aquaporin NIP5-1 isoform X1    141   6e-35   
emb|CDY05100.1|  BnaC03g28980D                                          141   6e-35   
ref|XP_011038068.1|  PREDICTED: probable aquaporin NIP5-1               140   7e-35   
emb|CDY01565.1|  BnaC07g35550D                                          140   8e-35   
ref|XP_007211782.1|  hypothetical protein PRUPE_ppa009698mg             140   9e-35   
gb|KHG20522.1|  Aquaporin NIP1-2 -like protein                          140   9e-35   
ref|NP_174472.2|  aquaporin NIP3-1                                      141   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006643882.1|  PREDICTED: aquaporin NIP1-2-like                   139   1e-34   
ref|XP_009140163.1|  PREDICTED: putative aquaporin NIP4-1               140   1e-34   
ref|XP_007147986.1|  hypothetical protein PHAVU_006G171000g             139   1e-34   
ref|XP_010486098.1|  PREDICTED: probable aquaporin NIP7-1 isoform X2    138   1e-34   
ref|XP_011035752.1|  PREDICTED: aquaporin NIP2-1-like                   139   1e-34   
gb|KCW73998.1|  hypothetical protein EUGRSUZ_E02616                     139   1e-34   
ref|XP_003534451.1|  PREDICTED: aquaporin NIP2-1-like                   140   1e-34   
ref|XP_004485943.1|  PREDICTED: aquaporin NIP1-2-like                   139   1e-34   
ref|XP_008383590.1|  PREDICTED: aquaporin NIP1-1-like                   139   2e-34   
ref|XP_003593792.1|  Aquaporin NIP1-2                                   139   2e-34   
gb|KHG08004.1|  Aquaporin NIP2-1                                        139   2e-34   
gb|KCW73713.1|  hypothetical protein EUGRSUZ_E02324                     138   2e-34   
ref|XP_010056835.1|  PREDICTED: aquaporin NIP1-1-like                   139   2e-34   
ref|XP_006414041.1|  hypothetical protein EUTSA_v10025855mg             139   2e-34   
ref|XP_008794153.1|  PREDICTED: aquaporin NIP1-1-like                   139   2e-34   
ref|XP_009762968.1|  PREDICTED: probable aquaporin NIP-type isofo...    139   2e-34   
gb|KFK31988.1|  hypothetical protein AALP_AA6G185600                    139   2e-34   
gb|KHN13616.1|  Aquaporin NIP2-1                                        139   2e-34   
ref|XP_007147984.1|  hypothetical protein PHAVU_006G170900g             138   3e-34   
emb|CDX67591.1|  BnaA07g16310D                                          139   3e-34   
ref|XP_007039259.1|  NOD26-like intrinsic protein 5,1                   139   3e-34   
ref|NP_001240190.1|  uncharacterized protein LOC100788071               139   3e-34   
ref|NP_001242005.1|  uncharacterized protein LOC100812577               138   3e-34   
ref|XP_004231994.1|  PREDICTED: probable aquaporin NIP-type             138   3e-34   
ref|XP_009352714.1|  PREDICTED: aquaporin NIP1-1-like                   138   3e-34   
dbj|BAO18645.1|  nodulin26-like intrinsic protein 4;1                   138   3e-34   
gb|AFK48191.1|  unknown                                                 137   4e-34   
ref|XP_001759426.1|  predicted protein                                  137   4e-34   
gb|EYU40831.1|  hypothetical protein MIMGU_mgv1a025179mg                138   4e-34   
ref|XP_009381416.1|  PREDICTED: aquaporin NIP2-1-like                   138   5e-34   
ref|XP_010058935.1|  PREDICTED: nodulin-26-like                         139   5e-34   
ref|XP_007150811.1|  hypothetical protein PHAVU_005G182400g             138   5e-34   
gb|KHN47385.1|  Aquaporin NIP1-2                                        137   5e-34   
emb|CDY01700.1|  BnaC04g30520D                                          138   6e-34   
tpg|DAA33874.1|  TPA: aquaporin NIP1;1                                  137   6e-34   
ref|XP_010110421.1|  putative aquaporin NIP5-1                          138   6e-34   
ref|XP_010088155.1|  Aquaporin NIP2-1                                   138   6e-34   
emb|CDM82127.1|  unnamed protein product                                137   6e-34   
ref|XP_010052152.1|  PREDICTED: nodulin-26-like                         137   7e-34   
ref|XP_011004393.1|  PREDICTED: probable aquaporin NIP5-1               138   7e-34   
gb|EYU31219.1|  hypothetical protein MIMGU_mgv1a018295mg                137   7e-34   
gb|KEH36650.1|  major intrinsic protein (MIP) family transporter        137   8e-34   
ref|XP_010058934.1|  PREDICTED: aquaporin NIP1-1-like                   139   8e-34   
ref|XP_003546049.1|  PREDICTED: nodulin-26-like                         137   8e-34   
gb|EPS64810.1|  hypothetical protein M569_09969                         137   9e-34   
ref|XP_009134192.1|  PREDICTED: probable aquaporin NIP5-1               137   1e-33   
ref|XP_009139751.1|  PREDICTED: putative aquaporin NIP4-1               137   1e-33   
ref|XP_010052151.1|  PREDICTED: nodulin-26-like                         137   1e-33   
ref|XP_006828763.1|  hypothetical protein AMTR_s00001p00081940          137   1e-33   
emb|CAA16760.2|  nodulin-26-like protein                                137   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593789.1|  Aquaporin NIP1-2                                   137   1e-33   
ref|XP_002317642.1|  hypothetical protein POPTR_0011s14990g             137   1e-33   Populus trichocarpa [western balsam poplar]
emb|CDX99411.1|  BnaC01g11410D                                          137   1e-33   
ref|XP_010058382.1|  PREDICTED: probable aquaporin NIP5-1               135   1e-33   
ref|XP_009108004.1|  PREDICTED: aquaporin NIP3-1                        137   1e-33   
ref|XP_009403165.1|  PREDICTED: aquaporin NIP2-1-like                   137   1e-33   
gb|AFK41455.1|  unknown                                                 136   2e-33   
gb|KDP25192.1|  hypothetical protein JCGZ_20348                         137   2e-33   
ref|XP_003629863.1|  Aquaporin NIP1-2                                   136   2e-33   
gb|KHN06915.1|  Nodulin-26                                              136   2e-33   
ref|XP_010058113.1|  PREDICTED: probable aquaporin NIP5-1               135   2e-33   
ref|XP_006647103.1|  PREDICTED: aquaporin NIP1-1-like                   136   2e-33   
ref|XP_009401397.1|  PREDICTED: aquaporin NIP2-1-like                   137   2e-33   
gb|ADE76805.1|  unknown                                                 137   2e-33   
ref|XP_009617191.1|  PREDICTED: probable aquaporin NIP-type             136   2e-33   
sp|P49173.1|NIP1_NICAL  RecName: Full=Probable aquaporin NIP-type...    136   2e-33   Nicotiana alata [flowering tobacco]
ref|XP_009762967.1|  PREDICTED: probable aquaporin NIP-type isofo...    136   2e-33   
ref|XP_006405829.1|  hypothetical protein EUTSA_v10028303mg             136   2e-33   
gb|KDO77957.1|  hypothetical protein CISIN_1g023184mg                   135   2e-33   
ref|XP_009351781.1|  PREDICTED: aquaporin NIP1-1-like                   136   2e-33   
ref|XP_004304304.1|  PREDICTED: aquaporin NIP2-1-like                   136   2e-33   
ref|XP_010925587.1|  PREDICTED: aquaporin NIP1-1-like                   136   2e-33   
ref|XP_009777199.1|  PREDICTED: aquaporin NIP1-1-like isoform X1        135   2e-33   
emb|CDX99688.1|  BnaC04g34450D                                          136   2e-33   
gb|ABK27103.1|  unknown                                                 136   2e-33   
ref|XP_009777259.1|  PREDICTED: aquaporin NIP1-1-like isoform X2        135   3e-33   
ref|XP_009388143.1|  PREDICTED: probable aquaporin NIP5-1               135   3e-33   
emb|CDP02709.1|  unnamed protein product                                136   3e-33   
emb|CDY65403.1|  BnaC06g42210D                                          135   3e-33   
ref|XP_004305876.1|  PREDICTED: probable aquaporin NIP5-1-like          135   4e-33   
gb|KDO77954.1|  hypothetical protein CISIN_1g023184mg                   135   4e-33   
ref|XP_007147985.1|  hypothetical protein PHAVU_006G170900g             135   4e-33   
ref|XP_006405831.1|  hypothetical protein EUTSA_v10028080mg             135   4e-33   
gb|KFK28558.1|  hypothetical protein AALP_AA7G012000                    136   4e-33   
gb|KHG09072.1|  Aquaporin NIP1-2 -like protein                          135   4e-33   
emb|CAD67694.1|  Nod26-like protein                                     135   4e-33   
dbj|BAB12437.1|  MIP                                                    135   4e-33   
ref|XP_009404528.1|  PREDICTED: aquaporin NIP1-1-like                   135   5e-33   
ref|XP_011102069.1|  PREDICTED: aquaporin NIP1-1-like                   135   5e-33   
ref|XP_002278054.2|  PREDICTED: aquaporin NIP2-1                        135   5e-33   
ref|XP_010032492.1|  PREDICTED: aquaporin NIP2-1-like isoform X1        135   5e-33   
ref|XP_006405830.1|  hypothetical protein EUTSA_v10027876mg             135   5e-33   
ref|XP_006827236.1|  hypothetical protein AMTR_s00010p00260950          134   5e-33   
gb|KHN11607.1|  Aquaporin NIP2-1                                        135   5e-33   
ref|XP_010253143.1|  PREDICTED: probable aquaporin NIP-type             135   6e-33   
ref|XP_003593786.1|  Aquaporin NIP1-2                                   135   6e-33   
ref|XP_006285157.1|  hypothetical protein CARUB_v10006501mg             135   6e-33   
ref|XP_010939491.1|  PREDICTED: aquaporin NIP2-1-like                   135   6e-33   
gb|EEC78689.1|  hypothetical protein OsI_18834                          135   7e-33   
ref|XP_010518828.1|  PREDICTED: aquaporin NIP1-2-like                   135   7e-33   
gb|EEC70128.1|  hypothetical protein OsI_00806                          137   7e-33   
ref|NP_198598.1|  putative aquaporin NIP4-2                             135   7e-33   
ref|XP_006286127.1|  hypothetical protein CARUB_v10007677mg             134   7e-33   
ref|XP_010246843.1|  PREDICTED: probable aquaporin NIP5-1 isoform X1    135   8e-33   
ref|XP_008443412.1|  PREDICTED: aquaporin NIP2-1-like                   134   9e-33   
ref|XP_002868544.1|  predicted protein                                  134   9e-33   
gb|AAS48064.1|  NIP2                                                    134   9e-33   
ref|XP_010056836.1|  PREDICTED: aquaporin NIP1-1-like                   134   1e-32   
dbj|BAK09175.1|  silicon transporter 1                                  134   1e-32   
ref|XP_010052153.1|  PREDICTED: nodulin-26-like                         134   1e-32   
emb|CDY71538.1|  BnaA04g27980D                                          132   1e-32   
ref|XP_004504263.1|  PREDICTED: nodulin-26-like                         134   1e-32   
ref|XP_003593788.1|  Aquaporin NIP1-2                                   134   1e-32   
ref|XP_008802606.1|  PREDICTED: aquaporin NIP2-1-like                   134   1e-32   
ref|XP_008784026.1|  PREDICTED: aquaporin NIP2-1-like                   134   1e-32   
ref|XP_007032542.1|  NOD26-like intrinsic protein 4,2                   134   1e-32   
ref|XP_010248404.1|  PREDICTED: aquaporin NIP1-1-like                   134   1e-32   
emb|CDP02234.1|  unnamed protein product                                134   1e-32   
emb|CCI55660.1|  EaNIP3,3                                               133   1e-32   
emb|CDO96880.1|  unnamed protein product                                134   1e-32   
gb|KDP27150.1|  hypothetical protein JCGZ_19849                         134   1e-32   
ref|XP_004485944.1|  PREDICTED: nodulin-26-like                         134   1e-32   
emb|CAB45652.1|  nodulin26-like intrinsic protein                       134   1e-32   
ref|XP_009786583.1|  PREDICTED: probable aquaporin NIP-type             134   1e-32   
ref|XP_010915460.1|  PREDICTED: aquaporin NIP1-1-like                   134   1e-32   
ref|XP_004485942.1|  PREDICTED: aquaporin NIP1-2-like                   133   2e-32   
ref|NP_198597.1|  putative aquaporin NIP4-1                             134   2e-32   
dbj|BAI66443.1|  nodulin-26 like intrinsic protein                      134   2e-32   
ref|XP_010450543.1|  PREDICTED: putative aquaporin NIP4-1 isoform X2    134   2e-32   
ref|XP_004486614.1|  PREDICTED: aquaporin NIP6-1-like                   134   2e-32   
ref|XP_002890955.1|  predicted protein                                  133   2e-32   
ref|XP_010518941.1|  PREDICTED: aquaporin NIP3-1                        134   2e-32   
ref|NP_001046375.1|  Os02g0232900                                       133   2e-32   
ref|XP_010435691.1|  PREDICTED: putative aquaporin NIP4-1               133   3e-32   
ref|XP_003547292.1|  PREDICTED: aquaporin NIP6-1-like                   134   3e-32   
ref|XP_010088158.1|  Aquaporin NIP2-1                                   133   3e-32   
ref|XP_002985233.1|  hypothetical protein SELMODRAFT_121922             131   3e-32   
gb|KCW76055.1|  hypothetical protein EUGRSUZ_D004222                    132   4e-32   
ref|XP_010242173.1|  PREDICTED: aquaporin NIP1-1-like                   133   4e-32   
ref|XP_002970043.1|  hypothetical protein SELMODRAFT_92918              131   4e-32   
ref|XP_010258345.1|  PREDICTED: aquaporin NIP2-1-like                   133   4e-32   
gb|KHN22407.1|  Aquaporin NIP6-1                                        133   4e-32   
gb|EYU34069.1|  hypothetical protein MIMGU_mgv1a011289mg                132   5e-32   
ref|XP_010246844.1|  PREDICTED: probable aquaporin NIP5-1 isoform X2    132   5e-32   
ref|XP_009589055.1|  PREDICTED: probable aquaporin NIP-type             132   5e-32   
ref|XP_011073345.1|  PREDICTED: aquaporin NIP6-1-like                   133   5e-32   
ref|NP_001042328.1|  Os01g0202800                                       131   5e-32   
gb|AES64038.2|  major intrinsic protein (MIP) family transporter        132   5e-32   
ref|XP_001779449.1|  predicted protein                                  131   6e-32   
ref|XP_002868543.1|  hypothetical protein ARALYDRAFT_330314             132   6e-32   
ref|XP_011098628.1|  PREDICTED: aquaporin NIP2-1-like                   132   6e-32   
ref|XP_004147473.1|  PREDICTED: aquaporin NIP2-1-like                   132   7e-32   
gb|EYU44580.1|  hypothetical protein MIMGU_mgv1a011367mg                132   7e-32   
ref|XP_004145968.1|  PREDICTED: probable aquaporin NIP5-1-like          131   8e-32   
emb|CDY41749.1|  BnaA08g07040D                                          132   8e-32   
ref|XP_003629862.1|  Aquaporin NIP1-2                                   132   8e-32   
ref|NP_001267699.1|  aquaporin NIP2-1-like                              132   8e-32   
ref|XP_008443411.1|  PREDICTED: aquaporin NIP2-1-like                   132   8e-32   
gb|KHN48031.1|  Nodulin-26                                              131   9e-32   
sp|Q0JPT5.2|NIP12_ORYSJ  RecName: Full=Aquaporin NIP1-2; AltName:...    132   9e-32   
dbj|BAK09176.1|  silicon transporter 1                                  132   1e-31   
ref|XP_008437496.1|  PREDICTED: probable aquaporin NIP5-1               130   1e-31   
ref|XP_008803617.1|  PREDICTED: probable aquaporin NIP5-1               132   1e-31   
ref|XP_004306145.1|  PREDICTED: aquaporin NIP2-1-like                   131   1e-31   
ref|XP_008790053.1|  PREDICTED: aquaporin NIP1-1-like isoform X1        131   1e-31   
ref|XP_006847785.1|  hypothetical protein AMTR_s00162p00078280          131   1e-31   
ref|XP_010088157.1|  Aquaporin NIP2-2                                   131   1e-31   
ref|XP_007226210.1|  hypothetical protein PRUPE_ppa016457mg             130   1e-31   
ref|XP_004486280.1|  PREDICTED: aquaporin NIP1-2-like                   130   1e-31   
ref|XP_006357696.1|  PREDICTED: aquaporin NIP2-1-like                   131   1e-31   
ref|XP_010677474.1|  PREDICTED: probable aquaporin NIP5-1               130   2e-31   
gb|KDP22646.1|  hypothetical protein JCGZ_02488                         130   2e-31   
ref|XP_010677699.1|  PREDICTED: probable aquaporin NIP5-1               132   2e-31   
ref|XP_004306143.1|  PREDICTED: aquaporin NIP2-1-like                   130   2e-31   
emb|CDO96885.1|  unnamed protein product                                129   2e-31   
ref|XP_001767204.1|  predicted protein                                  129   2e-31   
ref|XP_002973287.1|  hypothetical protein SELMODRAFT_99369              130   2e-31   
gb|ACU29604.1|  Si transport-like protein 2                             130   2e-31   
ref|XP_003593787.1|  Aquaporin NIP1-2                                   132   2e-31   
ref|XP_006389830.1|  hypothetical protein EUTSA_v10018924mg             131   2e-31   
ref|XP_009385167.1|  PREDICTED: probable aquaporin NIP5-1               130   2e-31   
ref|XP_002976617.1|  hypothetical protein SELMODRAFT_105574             130   3e-31   
ref|XP_011101927.1|  PREDICTED: aquaporin NIP1-1-like                   130   3e-31   
ref|NP_001274283.1|  Lsi-1                                              130   3e-31   
ref|NP_178191.1|  aquaporin NIP6-1                                      131   3e-31   
ref|XP_002887811.1|  hypothetical protein ARALYDRAFT_477170             131   3e-31   
gb|KFK33271.1|  hypothetical protein AALP_AA6G353400                    130   3e-31   
gb|ABY19374.1|  major intrinsic protein NIP6;1                          131   3e-31   
gb|AFK43636.1|  unknown                                                 130   3e-31   
emb|CCI55659.1|  EaNIP3,2                                               129   4e-31   
ref|XP_006344325.1|  PREDICTED: probable aquaporin NIP-type-like        130   4e-31   
ref|XP_009341014.1|  PREDICTED: aquaporin NIP2-1-like                   130   4e-31   
ref|XP_002534417.1|  Silicon transporter, putative                      130   4e-31   
ref|NP_001235870.1|  nodulin-26 precursor                               129   4e-31   
ref|XP_003633704.1|  PREDICTED: probable aquaporin NIP-type             130   4e-31   
ref|WP_008479677.1|  Predicted protein                                  128   4e-31   
ref|XP_001754375.1|  predicted protein                                  128   5e-31   
ref|XP_007025280.1|  NOD26-like intrinsic protein 1,2 isoform 1         130   5e-31   
ref|XP_004504265.1|  PREDICTED: nodulin-26-like                         129   5e-31   
ref|XP_008243360.1|  PREDICTED: probable aquaporin NIP-type             129   6e-31   
ref|XP_007216227.1|  hypothetical protein PRUPE_ppa016771mg             130   6e-31   
ref|XP_008790055.1|  PREDICTED: aquaporin NIP1-1-like isoform X2        128   6e-31   
ref|XP_004982621.1|  PREDICTED: aquaporin NIP3-1-like                   130   6e-31   
ref|XP_006842671.1|  hypothetical protein AMTR_s00147p00033730          129   7e-31   
ref|XP_006853156.1|  hypothetical protein AMTR_s00038p00182030          127   7e-31   
ref|XP_011099481.1|  PREDICTED: probable aquaporin NIP-type             129   8e-31   
ref|XP_010693872.1|  PREDICTED: probable aquaporin NIP-type             129   9e-31   
emb|CCI55658.1|  EaNIP3,1                                               128   9e-31   
ref|XP_003531732.1|  PREDICTED: aquaporin NIP6-1-like                   129   1e-30   
ref|XP_008782364.1|  PREDICTED: probable aquaporin NIP-type             129   1e-30   
ref|XP_007159493.1|  hypothetical protein PHAVU_002G242200g             129   1e-30   
ref|XP_006433983.1|  hypothetical protein CICLE_v10003256mg             129   1e-30   
ref|XP_010451721.1|  PREDICTED: probable aquaporin NIP4-2               129   1e-30   
ref|XP_006662508.1|  PREDICTED: aquaporin NIP3-1-like                   128   1e-30   
ref|XP_010436733.1|  PREDICTED: probable aquaporin NIP4-2               129   1e-30   
sp|Q0IWF3.2|NIP31_ORYSJ  RecName: Full=Aquaporin NIP3-1; AltName:...    129   1e-30   
ref|XP_002302297.1|  hypothetical protein POPTR_0002s09740g             129   1e-30   
ref|WP_008686711.1|  MIP family channel protein                         127   1e-30   
dbj|BAO01152.1|  nodulin-26 like Intrinsic Protein 3;1                  129   1e-30   
ref|XP_010450542.1|  PREDICTED: putative aquaporin NIP4-1 isoform X1    127   1e-30   
ref|XP_008787977.1|  PREDICTED: probable aquaporin NIP-type             128   1e-30   
gb|AAG13499.1|AC068924_4  putative nodulin-26                           127   1e-30   
gb|EAZ16668.1|  hypothetical protein OsJ_32143                          129   2e-30   
ref|XP_006357778.1|  PREDICTED: probable aquaporin NIP-type-like        128   2e-30   
ref|XP_006301084.1|  hypothetical protein CARUB_v10021476mg             129   2e-30   
ref|XP_009145220.1|  PREDICTED: aquaporin NIP3-1-like                   129   2e-30   
gb|AFK49372.1|  unknown                                                 127   2e-30   
gb|ABR17555.1|  unknown                                                 128   2e-30   
ref|XP_006372594.1|  hypothetical protein POPTR_0017s03060g             128   2e-30   
ref|XP_006472602.1|  PREDICTED: aquaporin NIP1-1-like                   128   2e-30   
ref|XP_008229796.1|  PREDICTED: probable aquaporin NIP5-1               128   2e-30   
emb|CDY39946.1|  BnaC06g40240D                                          128   2e-30   
gb|AAG50717.1|AC079041_10  major intrinsic protein, putative            127   2e-30   
gb|AAL05942.1|  early embryogenesis aquaglyceroporin                    127   2e-30   
ref|NP_001048108.1|  Os02g0745100                                       128   2e-30   
ref|XP_004134594.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin NI...    127   2e-30   
emb|CDX84114.1|  BnaC08g07910D                                          129   2e-30   
sp|Q0DK16.2|NIP13_ORYSJ  RecName: Full=Aquaporin NIP1-3; AltName:...    128   2e-30   
emb|CDX87340.1|  BnaA07g35330D                                          128   3e-30   
ref|XP_006647882.1|  PREDICTED: aquaporin NIP2-1-like                   128   3e-30   
ref|XP_011001595.1|  PREDICTED: probable aquaporin NIP-type             127   3e-30   
gb|EAY79189.1|  hypothetical protein OsI_34300                          128   3e-30   
ref|XP_010472881.1|  PREDICTED: aquaporin NIP6-1-like                   128   3e-30   
emb|CBI33542.3|  unnamed protein product                                130   3e-30   
ref|XP_006346988.1|  PREDICTED: probable aquaporin NIP-type-like        127   4e-30   
ref|XP_010919364.1|  PREDICTED: probable aquaporin NIP5-1               127   4e-30   
ref|XP_009775917.1|  PREDICTED: probable aquaporin NIP-type isofo...    127   4e-30   
gb|ACF85788.1|  unknown                                                 127   5e-30   
emb|CCI55662.1|  EaNIP3,5                                               126   5e-30   
ref|XP_009801656.1|  PREDICTED: aquaporin NIP2-1-like                   127   5e-30   
ref|XP_009356145.1|  PREDICTED: probable aquaporin NIP-type             127   6e-30   
ref|XP_010088004.1|  Aquaporin NIP1-2                                   126   6e-30   
emb|CCI55665.1|  EaNIP3,8                                               126   6e-30   
emb|CCI55663.1|  EaNIP3,6                                               126   6e-30   
ref|XP_009106719.1|  PREDICTED: aquaporin NIP6-1                        127   6e-30   
ref|XP_002527308.1|  Aquaporin NIP1.1, putative                         127   6e-30   
ref|XP_010417667.1|  PREDICTED: aquaporin NIP6-1                        127   7e-30   
gb|KDP41985.1|  hypothetical protein JCGZ_27003                         127   7e-30   
ref|XP_006284208.1|  hypothetical protein CARUB_v10005365mg             127   7e-30   
ref|XP_009415805.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    126   7e-30   
ref|XP_002464380.1|  hypothetical protein SORBIDRAFT_01g017230          127   7e-30   
ref|XP_010429912.1|  PREDICTED: aquaporin NIP6-1-like isoform X1        127   8e-30   
ref|XP_008360033.1|  PREDICTED: probable aquaporin NIP-type             126   8e-30   
ref|NP_001105721.1|  aquaporin NIP1-1                                   126   8e-30   
ref|XP_010538580.1|  PREDICTED: aquaporin NIP1-2-like                   126   9e-30   
ref|XP_006427592.1|  hypothetical protein CICLE_v10026151mg             127   1e-29   
emb|CDY66949.1|  BnaA02g36290D                                          126   1e-29   
ref|XP_006465199.1|  PREDICTED: aquaporin NIP6-1-like                   126   1e-29   
ref|XP_004149794.1|  PREDICTED: probable aquaporin NIP-type-like        125   1e-29   
ref|XP_008230983.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin NI...    126   1e-29   
gb|AAF82791.1|AF275316_1  multifunctional transport intrinsic mem...    125   1e-29   
gb|AAT35231.1|  nodulin 26-like protein                                 126   1e-29   
ref|XP_007135806.1|  hypothetical protein PHAVU_010G160200g             126   1e-29   
ref|XP_009588453.1|  PREDICTED: probable aquaporin NIP-type isofo...    125   1e-29   
ref|XP_009145221.1|  PREDICTED: aquaporin NIP3-1-like                   127   1e-29   
ref|XP_010540546.1|  PREDICTED: aquaporin NIP2-1                        126   1e-29   
gb|KFK42456.1|  hypothetical protein AALP_AA2G259100                    126   1e-29   
dbj|BAM44346.1|  plasma membrane aluminum transporter                   126   1e-29   
ref|XP_002973832.1|  hypothetical protein SELMODRAFT_173700             125   1e-29   
emb|CCI55664.1|  EaNIP3,6                                               125   1e-29   
ref|XP_002976312.1|  hypothetical protein SELMODRAFT_105221             124   2e-29   
gb|ACF22778.1|  aquaporin NIP-3                                         125   2e-29   
ref|XP_003571490.2|  PREDICTED: aquaporin NIP3-2                        125   2e-29   
ref|XP_004974438.1|  PREDICTED: aquaporin NIP3-2-like                   125   2e-29   
gb|AFK33334.1|  unknown                                                 125   2e-29   
emb|CDY53224.1|  BnaA02g19440D                                          126   2e-29   
ref|XP_009128393.1|  PREDICTED: aquaporin NIP6-1-like                   126   2e-29   
ref|XP_008796885.1|  PREDICTED: probable aquaporin NIP5-1               125   2e-29   
ref|XP_003604209.1|  Aquaporin NIP6-1                                   124   2e-29   
ref|XP_006469313.1|  PREDICTED: probable aquaporin NIP-type-like        125   2e-29   
ref|XP_001765419.1|  predicted protein                                  123   2e-29   
ref|XP_004951368.1|  PREDICTED: aquaporin NIP1-1-like                   125   2e-29   



>ref|XP_011090788.1| PREDICTED: probable aquaporin NIP7-1 [Sesamum indicum]
Length=291

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -3

Query  762  NKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPIS  583
            N   +R+++AEALGT+IL+FCI GI++NM+ MGV+ GLLEYAATA LTV V+VFSIG IS
Sbjct  54   NTSLVRKVLAEALGTFILMFCIGGIVANMRFMGVEAGLLEYAATAGLTVTVIVFSIGSIS  113

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGC  403
            GAH+NP+VT+AFA++GPFPW +VPFY++AQVGGSV AT + +L+Y ++ E MMTRPLHGC
Sbjct  114  GAHVNPAVTIAFAAVGPFPWSEVPFYVLAQVGGSVLATYTGKLVYSIKPEVMMTRPLHGC  173

Query  402  NAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARS  223
             +AF VE ++TFIILFL++SL S+PQ  G L+GFV GV I LGVLISGPVSGGSMNPARS
Sbjct  174  TSAFCVELISTFIILFLSTSLISEPQSLGPLSGFVAGVAISLGVLISGPVSGGSMNPARS  233

Query  222  LGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            LGPA+ SW FD  LWIY VAPT GA+AGV  YR+LRLQGW+CKP
Sbjct  234  LGPALVSWRFD-HLWIYVVAPTIGAIAGVLTYRILRLQGWSCKP  276



>gb|EYU41531.1| hypothetical protein MIMGU_mgv1a012148mg [Erythranthe guttata]
Length=260

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 196/238 (82%), Gaps = 5/238 (2%)
 Frame = -3

Query  762  NKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPIS  583
            +   +R ++AEA+GT++L+FCI GI++N++LMG++ GL+EYA TA LTV+V+VFSIG IS
Sbjct  24   DSTLVRMVLAEAIGTFVLIFCIGGIVANLRLMGIEGGLMEYAVTAGLTVVVIVFSIGSIS  83

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGC  403
            GAH+NP+VT+AFA++GPFPW KVPFY++AQVGGS+ AT + RL+YG+E E M+TRPLHG 
Sbjct  84   GAHVNPAVTIAFAAVGPFPWFKVPFYVIAQVGGSILATYTVRLVYGIESELMVTRPLHGL  143

Query  402  NAAFWVEFLATfiilflasslsSDPQFTGK-LAgfvvgvciglgvlISGPVSGGSMNPAR  226
             AAFWVE +ATFI+LFL +SL ++PQ  G+ L+GF+ GV I LGVLI+GPVSGGSMNPAR
Sbjct  144  KAAFWVELIATFIVLFLTTSLFNEPQSLGQHLSGFLAGVAICLGVLITGPVSGGSMNPAR  203

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCK---PADASPNTPLH  61
            S+GPAI SW FD  +WIY V PT GA+AGVF+YR+LRLQGW CK   PA  S  + LH
Sbjct  204  SIGPAIVSWRFD-HVWIYIVGPTIGAIAGVFVYRVLRLQGWACKLSNPASQSAISSLH  260



>ref|XP_009596229.1| PREDICTED: probable aquaporin NIP7-1 [Nicotiana tomentosiformis]
Length=280

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 199/237 (84%), Gaps = 1/237 (0%)
 Frame = -3

Query  768  IFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            + N   IR ++AEALGT++L+FCICGI+++M++MGV+ GL+EYAATA+LTV+VVVFSIGP
Sbjct  43   LINPTLIRMVLAEALGTFMLMFCICGIMASMEIMGVRAGLMEYAATAALTVVVVVFSIGP  102

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLH  409
            ISGAHINP+VTLAFA++G FPW KVPFY++AQVGGS+ AT + +L+YG++ E ++TRPLH
Sbjct  103  ISGAHINPAVTLAFAAVGHFPWSKVPFYVVAQVGGSILATYTGKLVYGLKAEFVITRPLH  162

Query  408  GCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPA  229
            GC +AF+VE LATFI+LFL +SL++DPQ TG L+GFVVGV IGL VLISGP+SGGSMNPA
Sbjct  163  GCTSAFFVELLATFIVLFLTASLTNDPQSTGPLSGFVVGVAIGLAVLISGPISGGSMNPA  222

Query  228  RSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHN  58
            RSLGPAI S  F   LWIY VAP  GAVAGV LYRLLRLQGW+CKP      T  HN
Sbjct  223  RSLGPAIVSLKFG-GLWIYVVAPILGAVAGVVLYRLLRLQGWSCKPNSTPTTTHQHN  278



>ref|XP_009787413.1| PREDICTED: probable aquaporin NIP7-1 [Nicotiana sylvestris]
Length=293

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 199/237 (84%), Gaps = 1/237 (0%)
 Frame = -3

Query  768  IFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            + N   +  ++AEALGT++L+FCICGI+++M++MGV+VGL+EYAATA+LTV+VVVFSIGP
Sbjct  56   LINPTLLHMVLAEALGTFMLMFCICGIMASMEIMGVRVGLMEYAATAALTVVVVVFSIGP  115

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLH  409
            ISGAHINP+VTLAFA++G FPW KVPFY++AQVGGS+ AT + +L+YG++ E ++TRPLH
Sbjct  116  ISGAHINPAVTLAFAAVGHFPWSKVPFYVVAQVGGSILATYTGKLVYGLKAEFVITRPLH  175

Query  408  GCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPA  229
            G  +AF+VE LATFI+LFL +SL++DPQ TG L+GFVVGV IGL VLISGP+SGGSMNPA
Sbjct  176  GSTSAFFVELLATFIVLFLTASLTNDPQSTGPLSGFVVGVAIGLAVLISGPISGGSMNPA  235

Query  228  RSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHN  58
            RSLGPAI SW F   LWIY VAP  GAVAGV LYRLLRLQGW+CKP      T  HN
Sbjct  236  RSLGPAIVSWKFG-GLWIYVVAPILGAVAGVVLYRLLRLQGWSCKPNSTPTTTHQHN  291



>ref|NP_001289837.1| probable aquaporin NIP7-1 [Solanum lycopersicum]
 dbj|BAO18648.1| nodulin26-like intrinsic protein 7;1 [Solanum lycopersicum]
Length=286

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 200/246 (81%), Gaps = 3/246 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTV  616
            ++ +C+     + IF+R ++AEALGT++L+FCICG++++M++MGVQVGL+EYA TA+LTV
Sbjct  42   RRNVCNSILGIDPIFLRMVLAEALGTFLLMFCICGMMASMEIMGVQVGLMEYATTAALTV  101

Query  615  IVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY  436
            +VVVFSIGPISGAHINP+VTLAFA++G FPW KVP Y++AQVGGS+ AT + +L+YG++ 
Sbjct  102  VVVVFSIGPISGAHINPAVTLAFAAVGHFPWSKVPLYVVAQVGGSILATYTGKLVYGLKA  161

Query  435  EHMMTRPLHGCNAAFWVEFLAT-fiilflasslsSDPQFTGKLAgfvvgvciglgvlISG  259
            E + T+PLH C +AF+VE LAT  ++   AS  + DPQ TG L+GF+VGV IGL VLISG
Sbjct  162  EFVTTKPLHSCTSAFFVELLATFIVLFLSASLTNYDPQSTGPLSGFLVGVAIGLAVLISG  221

Query  258  PVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADAS  79
            PVSGGSMNPARSLGPAI +W F+ +LWIY +AP  GAVAGV  YR LRLQGW+CKP +++
Sbjct  222  PVSGGSMNPARSLGPAIVAWKFN-NLWIYVIAPIIGAVAGVVFYRFLRLQGWSCKP-NST  279

Query  78   PNTPLH  61
            P T  H
Sbjct  280  PTTHQH  285



>ref|XP_006349237.1| PREDICTED: probable aquaporin NIP7-1-like isoform X1 [Solanum 
tuberosum]
Length=287

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 199/243 (82%), Gaps = 3/243 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTV  616
            ++ +C+     + IF+R ++AEALGT++L+FCICG++++M++MGVQVGL+EYA TA+LTV
Sbjct  42   RRNVCNSILGIDPIFLRMVLAEALGTFLLMFCICGMMASMEIMGVQVGLMEYATTAALTV  101

Query  615  IVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY  436
            +VVVFSIGPISGAHINP+VTLAFA++G FPW KVP Y++AQVGGS+ AT + +++YG++ 
Sbjct  102  VVVVFSIGPISGAHINPAVTLAFAAVGHFPWSKVPLYVVAQVGGSIVATYTGKMVYGLKA  161

Query  435  EHMMTRPLHGCNAAFWVEFLAT-fiilflasslsSDPQFTGKLAgfvvgvciglgvlISG  259
            E + T+PLH C +AF+VE LAT  ++   AS  + DPQ TG L+GF+VGV IGL VLISG
Sbjct  162  EFVTTKPLHSCTSAFFVELLATFIVLFLSASLTNYDPQSTGPLSGFLVGVAIGLAVLISG  221

Query  258  PVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADAS  79
            PVSGGSMNPARSLGPAI +W F+ +LWIY +AP  GAVAGV  YR LR+QGW+CKP +++
Sbjct  222  PVSGGSMNPARSLGPAIVAWKFN-NLWIYVIAPIIGAVAGVVFYRFLRIQGWSCKP-NST  279

Query  78   PNT  70
            P T
Sbjct  280  PTT  282



>ref|XP_006349238.1| PREDICTED: probable aquaporin NIP7-1-like isoform X2 [Solanum 
tuberosum]
Length=229

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 189/225 (84%), Gaps = 3/225 (1%)
 Frame = -3

Query  741  MMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPS  562
            ++AEALGT++L+FCICG++++M++MGVQVGL+EYA TA+LTV+VVVFSIGPISGAHINP+
Sbjct  2    VLAEALGTFLLMFCICGMMASMEIMGVQVGLMEYATTAALTVVVVVFSIGPISGAHINPA  61

Query  561  VTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWVE  382
            VTLAFA++G FPW KVP Y++AQVGGS+ AT + +++YG++ E + T+PLH C +AF+VE
Sbjct  62   VTLAFAAVGHFPWSKVPLYVVAQVGGSIVATYTGKMVYGLKAEFVTTKPLHSCTSAFFVE  121

Query  381  FLAT-fiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIA  205
             LAT  ++   AS  + DPQ TG L+GF+VGV IGL VLISGPVSGGSMNPARSLGPAI 
Sbjct  122  LLATFIVLFLSASLTNYDPQSTGPLSGFLVGVAIGLAVLISGPVSGGSMNPARSLGPAIV  181

Query  204  SWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNT  70
            +W F+ +LWIY +AP  GAVAGV  YR LR+QGW+CKP +++P T
Sbjct  182  AWKFN-NLWIYVIAPIIGAVAGVVFYRFLRIQGWSCKP-NSTPTT  224



>ref|XP_002277721.3| PREDICTED: probable aquaporin NIP7-1 [Vitis vinifera]
 emb|CBI26190.3| unnamed protein product [Vitis vinifera]
Length=293

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 181/231 (78%), Gaps = 2/231 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE +GT+ILVFC+ GI +  QLM  +VGLLEYA T  LTV+V+VFSIG ISGAH+N
Sbjct  62   RMILAEMVGTFILVFCVYGIEAVTQLMKGEVGLLEYAVTGGLTVVVLVFSIGSISGAHVN  121

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            PSVT+ FA+L  FPW KVP+YI AQ+ GSV AT   R IYG++ E + T+PL GC++AFW
Sbjct  122  PSVTITFATLCQFPWSKVPYYISAQIVGSVLATYVGRSIYGIKPELITTKPLQGCSSAFW  181

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VEF+ATFII+FLA SL+S PQ    L+GFVVG+ IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  182  VEFIATFIIMFLAVSLTSQPQSVSHLSGFVVGIAIGLAVLITGPVSGGSMNPARSLGPAI  241

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNN  55
             SW FD D+WIY +APT GAVAG  L+ LLRL+   C P ++SPNT L +N
Sbjct  242  VSWKFD-DIWIYTIAPTLGAVAGGHLFHLLRLRHQPCTP-NSSPNTILLSN  290



>ref|XP_004495131.1| PREDICTED: probable aquaporin NIP7-1-like isoform X2 [Cicer arietinum]
Length=290

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 182/234 (78%), Gaps = 6/234 (3%)
 Frame = -3

Query  777  FFPIFNKI---FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVV  607
            F P  NKI   F R +MAE +GT+IL+FC+CGII++ Q     VGLLEYAATA LTV+V+
Sbjct  52   FLP--NKIDLNFARMVMAEVVGTFILMFCVCGIIASTQHQNGAVGLLEYAATAGLTVVVI  109

Query  606  VFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM  427
            +FSIGPIS AH+NP+VT+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ + M
Sbjct  110  IFSIGPISCAHVNPAVTIAFATIGQFPWFKVPVYIIAQTIGSLMATYIGSLVYGIKSDVM  169

Query  426  MTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSG  247
            MT+PL GCN+AFWVE +ATFII+FL S+L+S+ Q  G L+GFV G+ IGL VLI+GPVSG
Sbjct  170  MTQPLQGCNSAFWVEVIATFIIMFLVSALTSEHQSVGHLSGFVAGIAIGLAVLITGPVSG  229

Query  246  GSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD  85
            GSMNPARSLGPAI SW F+  +WIY +AP++GA+AG  ++R LRLQ   C  ++
Sbjct  230  GSMNPARSLGPAIVSWKFNY-IWIYIIAPSSGAIAGALMFRFLRLQDQQCTSSN  282



>ref|XP_010107830.1| putative aquaporin NIP7-1 [Morus notabilis]
 gb|EXC54663.1| putative aquaporin NIP7-1 [Morus notabilis]
Length=294

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 177/236 (75%), Gaps = 2/236 (1%)
 Frame = -3

Query  762  NKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPIS  583
            N+ F R ++AEA+GT+IL+FCICGII++ Q    +VGLLEYAATA LTVIVV+FSIG IS
Sbjct  54   NRNFARAVVAEAVGTFILMFCICGIIASTQTTSGEVGLLEYAATAGLTVIVVIFSIGSIS  113

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGC  403
            GAH+NP+VTLAFA  G FPWP+VP YI AQ  GS  AT + + IY ++ + ++TRPL GC
Sbjct  114  GAHVNPAVTLAFAIFGHFPWPRVPLYIFAQTFGSTTATYAGKFIYNLKSDLVLTRPLQGC  173

Query  402  NAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARS  223
             +AFWVE +ATF+I+FL +SL+   Q  G LAGFVVG  IGL VLI+GPVSGGSMNPARS
Sbjct  174  ASAFWVELIATFVIMFLVASLTHQAQSVGHLAGFVVGSAIGLAVLITGPVSGGSMNPARS  233

Query  222  LGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNN  55
            +G AI SW+F+ D+WIY  APT GAV G  L++ L+ Q   C  +  SPNT L + 
Sbjct  234  MGAAIVSWNFN-DIWIYITAPTIGAVGGALLFQFLKTQHRPCS-SLTSPNTSLFHQ  287



>ref|XP_004495130.1| PREDICTED: probable aquaporin NIP7-1-like isoform X1 [Cicer arietinum]
Length=339

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 182/234 (78%), Gaps = 6/234 (3%)
 Frame = -3

Query  777  FFPIFNKI---FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVV  607
            F P  NKI   F R +MAE +GT+IL+FC+CGII++ Q     VGLLEYAATA LTV+V+
Sbjct  52   FLP--NKIDLNFARMVMAEVVGTFILMFCVCGIIASTQHQNGAVGLLEYAATAGLTVVVI  109

Query  606  VFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM  427
            +FSIGPIS AH+NP+VT+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ + M
Sbjct  110  IFSIGPISCAHVNPAVTIAFATIGQFPWFKVPVYIIAQTIGSLMATYIGSLVYGIKSDVM  169

Query  426  MTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSG  247
            MT+PL GCN+AFWVE +ATFII+FL S+L+S+ Q  G L+GFV G+ IGL VLI+GPVSG
Sbjct  170  MTQPLQGCNSAFWVEVIATFIIMFLVSALTSEHQSVGHLSGFVAGIAIGLAVLITGPVSG  229

Query  246  GSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD  85
            GSMNPARSLGPAI SW F+  +WIY +AP++GA+AG  ++R LRLQ   C  ++
Sbjct  230  GSMNPARSLGPAIVSWKFNY-IWIYIIAPSSGAIAGALMFRFLRLQDQQCTSSN  282



>ref|XP_002517178.1| Aquaporin NIP1.1, putative [Ricinus communis]
 gb|EEF45341.1| Aquaporin NIP1.1, putative [Ricinus communis]
Length=298

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 186/228 (82%), Gaps = 2/228 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE +GT+IL+FC+CGI+++ QL G QVGLLEYAATA LTVIV+VF+IGPISGAH+N
Sbjct  63   RMVLAEFMGTFILMFCVCGIMASTQLTGGQVGLLEYAATAGLTVIVLVFAIGPISGAHVN  122

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA+ G FPW KVPFY++AQ  GSV AT +++L+YG++ + M+TRP+ GCN+AF 
Sbjct  123  PAVTIAFATFGHFPWSKVPFYVVAQTVGSVLATYAAKLVYGIKADLMVTRPVQGCNSAFS  182

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VEF+ TF+++FLA+SL+     T  L+GFV+G+ IGL VLISGPVSGGS+NPARSLGPAI
Sbjct  183  VEFITTFLMMFLAASLAYQAA-TRHLSGFVIGLSIGLAVLISGPVSGGSLNPARSLGPAI  241

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPL  64
             SW+F  D+W+Y +APTTGAVAG  ++ +LR+Q   C P   SPNT L
Sbjct  242  VSWNFK-DIWVYIIAPTTGAVAGALMFHVLRIQRPPCSPTTPSPNTGL  288



>ref|XP_006489314.1| PREDICTED: probable aquaporin NIP7-1-like [Citrus sinensis]
Length=255

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 179/231 (77%), Gaps = 2/231 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE +GT+IL+ C+CGI+++  L   +VGLLEYAATA LT+IV+V+SIGPISGAH+N
Sbjct  21   RMVIAELVGTFILMLCVCGIMASTVLTRGEVGLLEYAATAGLTIIVLVYSIGPISGAHVN  80

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA +G FP  KVPFYIMAQ  GSV  T    L+YG++   M+TRP   C +AFW
Sbjct  81   PAVTIAFAVVGHFPLSKVPFYIMAQTAGSVLGTYIGILVYGIKSNLMITRPAQHCVSAFW  140

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE LAT II+FLA+SL+ + Q  G L+GFVVGV IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  141  VELLATSIIVFLAASLACEAQCFGNLSGFVVGVAIGLAVLITGPVSGGSMNPARSLGPAI  200

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNN  55
             SW+F SD+WIY + PT GAVAG F+YR LRL+   C P+  SPNT L ++
Sbjct  201  VSWNF-SDIWIYIIGPTIGAVAGGFVYRFLRLRPRACSPST-SPNTSLLSH  249



>ref|XP_006419834.1| hypothetical protein CICLE_v10005554mg [Citrus clementina]
 gb|ESR33074.1| hypothetical protein CICLE_v10005554mg [Citrus clementina]
Length=290

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 2/228 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE +GT+IL+ C+CGI+++  L   +VGLLEYAATA LT+IV+V+SIGPISGAH+N
Sbjct  56   RMVIAELVGTFILMLCVCGIMASTVLTRGEVGLLEYAATAGLTIIVLVYSIGPISGAHVN  115

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA +G FP  KVPFYIMAQ  GSV  T    L+YG++   M+TRP   C +AFW
Sbjct  116  PAVTIAFAVVGHFPLSKVPFYIMAQTAGSVLGTYIGILVYGIKSNLMITRPAQHCVSAFW  175

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE LAT II+FLA+SL+ + Q  G L+GFVVGV IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  176  VELLATSIIVFLAASLACEAQCFGNLSGFVVGVAIGLAVLITGPVSGGSMNPARSLGPAI  235

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPL  64
             SW+F SD+WIY + PT GAVAG F+YR LRL+   C P+  SPNT L
Sbjct  236  VSWNF-SDIWIYIIGPTIGAVAGGFVYRFLRLRPRACSPS-TSPNTSL  281



>gb|KDO74787.1| hypothetical protein CISIN_1g039196mg [Citrus sinensis]
Length=288

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 2/228 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE +GT+IL+ C+CGI+++  L   +VGLLEYAATA LT+IV+V+SIGPISGAH+N
Sbjct  54   RMVIAELVGTFILMLCVCGIMASTVLTRGEVGLLEYAATAGLTIIVLVYSIGPISGAHVN  113

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA +G FP  KVPFYIMAQ  GSV  T    L+YG++   M+TRP   C +AFW
Sbjct  114  PAVTIAFAVVGHFPLSKVPFYIMAQTAGSVLGTYIGILVYGIKSNLMITRPAQHCVSAFW  173

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE LAT II+FLA+SL+ + Q  G L+GFVVGV IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  174  VELLATSIIVFLAASLACEAQCFGNLSGFVVGVAIGLAVLITGPVSGGSMNPARSLGPAI  233

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPL  64
             SW+F SD+WIY + PT GAVAG F+YR LRL+   C P+  SPNT L
Sbjct  234  VSWNF-SDIWIYIIGPTIGAVAGGFVYRFLRLRPRACSPS-TSPNTSL  279



>ref|XP_010094007.1| putative aquaporin NIP7-1 [Morus notabilis]
 gb|EXB55022.1| putative aquaporin NIP7-1 [Morus notabilis]
Length=236

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 174/230 (76%), Gaps = 2/230 (1%)
 Frame = -3

Query  744  EMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINP  565
            +++AEA+GT+IL+FCICGII++ Q    +VGLLEYAATA LTVIVV+FSIG ISGAH+NP
Sbjct  2    QVVAEAVGTFILMFCICGIIASTQTTSGEVGLLEYAATAGLTVIVVIFSIGSISGAHVNP  61

Query  564  SVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWV  385
            +VTLAFA  G FPWP+VP YI AQ  GS  AT + + IY ++ + ++TRPL GC +AFWV
Sbjct  62   AVTLAFAIFGHFPWPRVPLYIFAQTFGSTTATYAGKFIYNLKSDLVLTRPLQGCASAFWV  121

Query  384  EFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIA  205
            E +ATF+I+FL +SL+   Q  G LAGFVVG  IGL VLI+GPVSGGSMNPARS+G AI 
Sbjct  122  ELIATFVIMFLVASLTHQAQSVGHLAGFVVGSAIGLAVLITGPVSGGSMNPARSMGAAIV  181

Query  204  SWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNN  55
            SW+F+ D+WIY  APT GAV G  L++ L+ Q   C  +  SPNT L + 
Sbjct  182  SWNFN-DIWIYITAPTIGAVGGALLFQFLKTQHRPCS-SLTSPNTSLFHQ  229



>ref|XP_008340963.1| PREDICTED: probable aquaporin NIP7-1 [Malus domestica]
 ref|XP_008368376.1| PREDICTED: probable aquaporin NIP7-1 [Malus domestica]
Length=299

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPI-FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP+  N   +R ++AE +GT+IL+FC+CGII++ QLM  +VGLLEYAATA LTV+VV+FS
Sbjct  52   FPLQINPNLVRAVLAEMVGTFILMFCVCGIIASTQLMKGEVGLLEYAATAGLTVVVVIFS  111

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
            IG ISGAH+NP+VTLAFA+ G FPW +VP Y +AQ  GSV AT   RLIYG++ + + TR
Sbjct  112  IGSISGAHVNPAVTLAFATFGHFPWSRVPLYTLAQTLGSVLATXIGRLIYGIKPDLLTTR  171

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            PL  C +AFWVE +ATF+I+FLA+SL+   Q  G L+GFVVG+ IGL VLI+GP+SGGSM
Sbjct  172  PLQSCASAFWVELIATFMIMFLAASLTHQAQ-VGHLSGFVVGIAIGLAVLITGPISGGSM  230

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NPARSLGPAI SW+F  D+WIY   PT GAVAG  LY++L L+
Sbjct  231  NPARSLGPAIVSWNFK-DIWIYICGPTVGAVAGALLYQILHLR  272



>gb|KCW60848.1| hypothetical protein EUGRSUZ_H03586 [Eucalyptus grandis]
Length=272

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 181/245 (74%), Gaps = 2/245 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFI-REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLT  619
            K +I   FP   K+   R ++AEA+GT+IL++CI  I+S  QL+  +VGL+ YAATA +T
Sbjct  21   KDFILGHFPQGAKLNTARMVLAEAIGTFILMYCISAILSMTQLLKGEVGLMGYAATAGMT  80

Query  618  VIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVE  439
            +++++FS+GPIS AH+NP++T+AFA  G FPW +VP YI+AQ+ GSV AT    ++YGVE
Sbjct  81   IVIIIFSLGPISDAHVNPAITIAFAIYGHFPWSRVPLYIIAQLTGSVLATYVGAMVYGVE  140

Query  438  YEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISG  259
               M+TRPL G  +AFWVEFLATFI++FL + L+ + Q  G L+GFV+G+ IGL V+I+G
Sbjct  141  SSLMITRPLGGLASAFWVEFLATFIMVFLIAGLTYNHQSVGPLSGFVIGIGIGLAVVIAG  200

Query  258  PVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADAS  79
            PVSG SMNPARSLGPAI SW F+S +WIY +AP  GA+   F+YRLLRLQG       +S
Sbjct  201  PVSGASMNPARSLGPAILSWDFES-IWIYIMAPVIGAIVAAFVYRLLRLQGRESSSTASS  259

Query  78   PNTPL  64
            PNT L
Sbjct  260  PNTSL  264



>ref|XP_010026989.1| PREDICTED: probable aquaporin NIP7-1 [Eucalyptus grandis]
Length=328

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 181/245 (74%), Gaps = 2/245 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFI-REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLT  619
            K +I   FP   K+   R ++AEA+GT+IL++CI  I+S  QL+  +VGL+ YAATA +T
Sbjct  77   KDFILGHFPQGAKLNTARMVLAEAIGTFILMYCISAILSMTQLLKGEVGLMGYAATAGMT  136

Query  618  VIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVE  439
            +++++FS+GPIS AH+NP++T+AFA  G FPW +VP YI+AQ+ GSV AT    ++YGVE
Sbjct  137  IVIIIFSLGPISDAHVNPAITIAFAIYGHFPWSRVPLYIIAQLTGSVLATYVGAMVYGVE  196

Query  438  YEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISG  259
               M+TRPL G  +AFWVEFLATFI++FL + L+ + Q  G L+GFV+G+ IGL V+I+G
Sbjct  197  SSLMITRPLGGLASAFWVEFLATFIMVFLIAGLTYNHQSVGPLSGFVIGIGIGLAVVIAG  256

Query  258  PVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADAS  79
            PVSG SMNPARSLGPAI SW F+S +WIY +AP  GA+   F+YRLLRLQG       +S
Sbjct  257  PVSGASMNPARSLGPAILSWDFES-IWIYIMAPVIGAIVAAFVYRLLRLQGRESSSTASS  315

Query  78   PNTPL  64
            PNT L
Sbjct  316  PNTSL  320



>ref|XP_008222994.1| PREDICTED: probable aquaporin NIP7-1 [Prunus mume]
Length=327

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 178/231 (77%), Gaps = 2/231 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
             +R + AE +GT++L+FC+CGII++ QLM  +VGL+EYAATA LTV+VV+FSIG ISGAH
Sbjct  88   LVRAVFAEMVGTFMLMFCVCGIIASTQLMRGEVGLMEYAATAGLTVVVVIFSIGSISGAH  147

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+VT+AFA+ G FPW +VP YI+AQ  GSV AT   RL+YG++ + M TRP+    +A
Sbjct  148  VNPAVTVAFATFGHFPWCRVPVYILAQTMGSVLATYIGRLVYGIKPDLMTTRPIQSSASA  207

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            FWVE +ATF+I+FLA+SL+      G L+GFVVG+ IGL VLI+GPVSGGSMNPARSLGP
Sbjct  208  FWVELIATFMIMFLAASLTHQAHAVGYLSGFVVGIAIGLSVLITGPVSGGSMNPARSLGP  267

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD-ASPNTPL  64
            AI +W+F  DLWIY   PT GAVAG  L+++LRLQ   C P++  SPN  L
Sbjct  268  AIVAWNFK-DLWIYICGPTIGAVAGARLFQILRLQLQPCSPSNTTSPNIHL  317



>ref|XP_011011194.1| PREDICTED: probable aquaporin NIP7-1 isoform X1 [Populus euphratica]
 ref|XP_011014494.1| PREDICTED: probable aquaporin NIP7-1 isoform X1 [Populus euphratica]
Length=307

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 182/244 (75%), Gaps = 2/244 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTV  616
            K   CSF    +    R ++AE +GT++L+FC+CGI++  Q++  +VGL+EYA+ A LT+
Sbjct  56   KSSFCSFLQGMDLNPARMVLAEMVGTFLLLFCVCGIVACTQILRGEVGLMEYASVAGLTI  115

Query  615  IVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY  436
            IVV+FSIG ISGAH+NP+VT+AFA+ G FPW KVP YI+AQ  GSV AT     +YGV+ 
Sbjct  116  IVVIFSIGSISGAHVNPAVTIAFATFGHFPWSKVPLYILAQTVGSVLATYVGSSVYGVKT  175

Query  435  EHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            E M TRP  GC++AFWVEF+ATF+++FLA+SL+S  +  G L+GF+ G+ IGL VLI+GP
Sbjct  176  ELMTTRPAIGCSSAFWVEFMATFMLMFLAASLTSQSRSIGPLSGFLYGIAIGLAVLITGP  235

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASP  76
            VSGGS+NPARSLGPAI SW F  D+W+Y  APT GAVAG  ++ LLR++   C  A++SP
Sbjct  236  VSGGSLNPARSLGPAIISWDFK-DIWVYITAPTIGAVAGALIFHLLRIRPHACS-ANSSP  293

Query  75   NTPL  64
            +  L
Sbjct  294  DDDL  297



>ref|XP_004296938.1| PREDICTED: probable aquaporin NIP7-1-like [Fragaria vesca subsp. 
vesca]
Length=291

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 185/237 (78%), Gaps = 3/237 (1%)
 Frame = -3

Query  774  FPI-FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP+  N   +R ++AE +GT+IL+FC+CGII++ QL+  +VGL+EYA+TA LTV+VV+FS
Sbjct  52   FPLEINLNLLRAVVAEMVGTFILMFCVCGIIASTQLLRGEVGLMEYASTAGLTVVVVIFS  111

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
            IG ISGAH+NP+VT+AFA+LG FPW +VP Y MAQ  GSV A +  +L+YG++ + M+T+
Sbjct  112  IGTISGAHVNPAVTVAFATLGHFPWSRVPLYTMAQTLGSVLAALVGKLVYGIKSDLMLTK  171

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P+  C +AFWVE +ATFI+LFLA+S+    Q  G L+GFV+G+ IGL VLI+GPVSGGS+
Sbjct  172  PVQSCVSAFWVELIATFIVLFLAASMIHHAQAVGPLSGFVLGIAIGLAVLITGPVSGGSL  231

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPA-DASPNT  70
            NPARSLGPAI SW+F  D+WIY  APT GAV+G  L+++L+L+     P+  +SP+T
Sbjct  232  NPARSLGPAIVSWNFK-DIWIYVCAPTIGAVSGALLFQVLKLRVPPSNPSLTSSPDT  287



>ref|XP_002311835.2| hypothetical protein POPTR_0008s20750g [Populus trichocarpa]
 gb|EEE89202.2| hypothetical protein POPTR_0008s20750g [Populus trichocarpa]
Length=300

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 182/244 (75%), Gaps = 2/244 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTV  616
            K   CSF    +    R ++AE +GT++L+FC+CGI++  Q++  +VGL+EYA+ A LT+
Sbjct  49   KSSFCSFLHGMDLNPARMVLAEMVGTFLLLFCVCGIVACTQILRGEVGLMEYASVAGLTI  108

Query  615  IVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY  436
            IVV+FSIG ISGAH+NP+VT+AFA+ G FPW KVP YI+AQ  GSV AT     +YGV+ 
Sbjct  109  IVVIFSIGSISGAHVNPAVTIAFATFGHFPWSKVPLYILAQTVGSVSATYVGSSVYGVKT  168

Query  435  EHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            E M TRP  GC++AFWVEF+ATF+++FLA+SL+S  +  G L+GF+ G+ IGL VLI+GP
Sbjct  169  ELMTTRPAIGCSSAFWVEFMATFMLMFLAASLTSQSRSIGPLSGFLYGIAIGLAVLITGP  228

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASP  76
            VSGGS+NPARSLGPAI SW F  D+W+Y  APT GAVAG  ++ LLR++   C  A++SP
Sbjct  229  VSGGSLNPARSLGPAIVSWDFK-DIWVYITAPTIGAVAGALMFHLLRIRPQACS-ANSSP  286

Query  75   NTPL  64
            +  L
Sbjct  287  DDDL  290



>gb|KHN32334.1| Putative aquaporin NIP7-1 [Glycine soja]
Length=233

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = -3

Query  738  MAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPSV  559
            MAE +GT+IL+FC+CGI ++ +     VGLLEYAATA LTV+V++FSIGPIS AH+NP+V
Sbjct  1    MAEVVGTFILMFCVCGITASTRFQNGAVGLLEYAATAGLTVVVIIFSIGPISCAHVNPAV  60

Query  558  TLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWVEF  379
            T+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ + MMT PL GCN+AFWVE 
Sbjct  61   TIAFATIGQFPWLKVPVYIIAQTVGSMSATYVGSLVYGIKSDAMMTMPLQGCNSAFWVEV  120

Query  378  LATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIASW  199
            +ATFII+FL ++L+S+ Q  G L+GFV G+ IGL VLI+GPVSGGSMNPARSLGPAI SW
Sbjct  121  IATFIIMFLVAALTSESQSVGHLSGFVAGMAIGLAVLITGPVSGGSMNPARSLGPAILSW  180

Query  198  SFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
             F  ++WIY VAP+ GA+AG  ++R LRL+
Sbjct  181  KFK-NIWIYMVAPSGGAIAGAAMFRFLRLR  209



>gb|KEH42598.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=813

 Score =   243 bits (621),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 184/248 (74%), Gaps = 15/248 (6%)
 Frame = -3

Query  762  NKI---FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            NKI   F R +MAE +GT+IL+FC+CGII++ Q     VGLLEYAATA LTV+V++FSIG
Sbjct  54   NKIDLNFARMVMAEVVGTFILMFCVCGIIASTQHQNGAVGLLEYAATAGLTVVVIIFSIG  113

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPL  412
            PIS AH+NP++T+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ E MMT+PL
Sbjct  114  PISCAHVNPAITIAFATIGHFPWFKVPIYIIAQTIGSLMATYIGSLVYGIKSEVMMTQPL  173

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
             GCN+AFWVE +ATFII+FL ++L+S+ Q  G L+GFV G+ IGL VLI+GPVSGGSMNP
Sbjct  174  QGCNSAFWVEVIATFIIMFLVTALTSEHQSVGHLSGFVAGIAIGLAVLITGPVSGGSMNP  233

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNT------  70
            ARSLGPAI SW F  ++WIY +AP+ GAVAG  ++  LRL+   C     SPNT      
Sbjct  234  ARSLGPAIVSWKF-KNIWIYILAPSGGAVAGALMFHFLRLKDQHC----TSPNTSEVGHP  288

Query  69   -PLHNNYN  49
             P   NYN
Sbjct  289  IPFCANYN  296



>ref|XP_006575039.1| PREDICTED: probable aquaporin NIP7-1-like isoform X2 [Glycine 
max]
Length=332

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 174/225 (77%), Gaps = 2/225 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R +MAE +GT+IL+FC+CGI ++ +     VGLLEYAATA LTV+V++FSIGPIS AH+N
Sbjct  61   RMVMAEVVGTFILMFCVCGITASTRFQNGAVGLLEYAATAGLTVVVIIFSIGPISCAHVN  120

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ + MMT PL GCN+AFW
Sbjct  121  PAVTIAFATIGQFPWLKVPVYIIAQTVGSMSATYVGSLVYGIKSDAMMTMPLQGCNSAFW  180

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE +ATFII+FL ++L+S+ Q  G L+GFV G+ IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  181  VEVIATFIIMFLVAALTSESQSVGHLSGFVAGMAIGLAVLITGPVSGGSMNPARSLGPAI  240

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPN  73
             SW F  ++WIY VAP+ GA+AG  ++R LRL+        +SPN
Sbjct  241  LSWKFK-NIWIYMVAPSGGAIAGAAMFRFLRLRDQHSSTL-SSPN  283



>ref|XP_007223194.1| hypothetical protein PRUPE_ppa009284mg [Prunus persica]
 gb|EMJ24393.1| hypothetical protein PRUPE_ppa009284mg [Prunus persica]
Length=298

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 181/242 (75%), Gaps = 6/242 (2%)
 Frame = -3

Query  801  NCKKWICSFFPIFNKI-FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATAS  625
            N   + C  FP    +  +R + AE +GT++L+FC+CGII++ QLM  +VGL+EYAATA 
Sbjct  46   NNSAFFC--FPFHMDLNLVRAVFAEMVGTFMLMFCVCGIIASTQLMRGEVGLMEYAATAG  103

Query  624  LTVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYG  445
            LTV+VV+FSIG ISGAH+NP+VT+AFA+LG FPW +VP YI+AQ  GSV AT   RL+YG
Sbjct  104  LTVVVVIFSIGSISGAHVNPAVTVAFATLGHFPWCRVPVYILAQTMGSVLATYIGRLVYG  163

Query  444  VEYEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlI  265
            ++ + M TRPL    AAF VE +ATF+I+FLA+SL+      G L+GFVVG+ IGL VLI
Sbjct  164  IKPDLMTTRPLQSPAAAFCVELIATFMIMFLAASLTHQAHAVGYLSGFVVGIAIGLSVLI  223

Query  264  SGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD  85
            +GPVSGGSMNPARSLGPAI +W+F  DLWIY   PT GAVAG  L+++LRLQ   C P++
Sbjct  224  TGPVSGGSMNPARSLGPAIVAWNFQ-DLWIYICGPTIGAVAGARLFQILRLQ--PCSPSN  280

Query  84   AS  79
             S
Sbjct  281  TS  282



>ref|XP_003520186.2| PREDICTED: probable aquaporin NIP7-1-like isoform X1 [Glycine 
max]
Length=340

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 174/225 (77%), Gaps = 2/225 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R +MAE +GT+IL+FC+CGI ++ +     VGLLEYAATA LTV+V++FSIGPIS AH+N
Sbjct  61   RMVMAEVVGTFILMFCVCGITASTRFQNGAVGLLEYAATAGLTVVVIIFSIGPISCAHVN  120

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ + MMT PL GCN+AFW
Sbjct  121  PAVTIAFATIGQFPWLKVPVYIIAQTVGSMSATYVGSLVYGIKSDAMMTMPLQGCNSAFW  180

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE +ATFII+FL ++L+S+ Q  G L+GFV G+ IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  181  VEVIATFIIMFLVAALTSESQSVGHLSGFVAGMAIGLAVLITGPVSGGSMNPARSLGPAI  240

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPN  73
             SW F  ++WIY VAP+ GA+AG  ++R LRL+        +SPN
Sbjct  241  LSWKFK-NIWIYMVAPSGGAIAGAAMFRFLRLRDQHSSTL-SSPN  283



>ref|XP_006589815.1| PREDICTED: probable aquaporin NIP7-1-like [Glycine max]
Length=326

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 168/213 (79%), Gaps = 1/213 (0%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R + AE +GT+IL+FC+CGI ++ +     VGLLEYAA A LTV+V++FSIGPIS AH+N
Sbjct  47   RMVTAELVGTFILMFCVCGITASTRFQNGAVGLLEYAAIAGLTVVVIIFSIGPISCAHVN  106

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA++G FPW KVP YI+AQ  GS+ AT    L+YG++ E MMT PL GCN+AFW
Sbjct  107  PAVTIAFATIGQFPWFKVPVYIIAQTVGSMSATYIGSLVYGIKSEAMMTMPLQGCNSAFW  166

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE +ATFII+FL ++L+S+ Q  G L+GFV G+ IGL VLI+GPVSGGSMNPARSLGPAI
Sbjct  167  VEVIATFIIMFLIAALTSESQSVGHLSGFVAGMAIGLAVLITGPVSGGSMNPARSLGPAI  226

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
             SW F  ++WIY VAP+ GAVAG  ++R LRL+
Sbjct  227  LSWKFK-NIWIYMVAPSGGAVAGAAMFRFLRLR  258



>ref|XP_007144705.1| hypothetical protein PHAVU_007G178300g [Phaseolus vulgaris]
 gb|ESW16699.1| hypothetical protein PHAVU_007G178300g [Phaseolus vulgaris]
Length=297

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 175/230 (76%), Gaps = 2/230 (1%)
 Frame = -3

Query  795  KKWICSFFPI-FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLT  619
             K +  FF I  +  + R  MAE +GT+IL+FC+CGI ++ Q     VGL EYAATA LT
Sbjct  44   NKSVLHFFSIKIDLNYARMAMAEMVGTFILMFCVCGISASTQFQKGAVGLPEYAATAGLT  103

Query  618  VIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVE  439
            V+V++FSIGPIS AH+NP+VT+AFA++G FPW KVP YI+AQ+ GS+ AT    L+YG++
Sbjct  104  VVVIIFSIGPISCAHVNPAVTIAFATMGQFPWFKVPVYIIAQIVGSMSATYIGCLVYGIK  163

Query  438  YEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISG  259
             + +MT PL GC +AFWVE +ATFII+FL ++L+S+ Q  G L+GFV G+ IGL VLI+G
Sbjct  164  SDAIMTMPLQGCTSAFWVELIATFIIMFLVAALTSESQSVGHLSGFVAGIAIGLAVLITG  223

Query  258  PVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            PVSGGSMNPARSLGPAI SW F  ++WIY VAP+ GAVAG  ++R LRL+
Sbjct  224  PVSGGSMNPARSLGPAILSWKFK-NIWIYMVAPSGGAVAGAAMFRFLRLR  272



>ref|XP_007034632.1| Aquaporin NIP1.1, putative [Theobroma cacao]
 gb|EOY05558.1| Aquaporin NIP1.1, putative [Theobroma cacao]
Length=302

 Score =   223 bits (567),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 161/214 (75%), Gaps = 1/214 (0%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE LGT+IL+F ICGII++ +L G    LLEYA TA LT++V++FSIG ISGAH+N
Sbjct  67   RAILAEMLGTFILMFSICGIITSTRLTGGGAALLEYATTAGLTIVVLIFSIGSISGAHVN  126

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            P+VT+AFA+ G F W +VP YI+AQ+ GSV AT +   IYG++ + M+TRP  GC AAFW
Sbjct  127  PAVTIAFAAFGHFQWSRVPLYILAQILGSVLATFTGEFIYGIKSDLMVTRPGQGCEAAFW  186

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            VE +A FI++F+ ++L+   Q  G ++G V+G+ I L VLI+GP+SGGS+NPARSLGPAI
Sbjct  187  VELIANFIVVFVLAALTHQSQSVGPVSGLVIGIAIVLAVLITGPISGGSLNPARSLGPAI  246

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQG  106
             S +F+  LWIY  AP  GAV G  LYR LRLQG
Sbjct  247  VSRNFE-RLWIYLTAPVIGAVTGALLYRFLRLQG  279



>emb|CDO99001.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 183/222 (82%), Gaps = 2/222 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R+++AEA+GT+ILVFCICGII++M+LM  ++GL+EYA TA+LTV+VVV++IG ISGAH+
Sbjct  30   LRKVLAEAVGTFILVFCICGIIASMELMKGRIGLMEYATTAALTVVVVVYAIGTISGAHV  89

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN-AA  394
            NP++T+AFA++GPFPW  VP Y+ AQ+GGSV AT + + +YG++ + ++T+P HG + AA
Sbjct  90   NPAITIAFATVGPFPWSTVPLYLSAQLGGSVLATYAGKFVYGLQTDLVLTKPFHGRSAAA  149

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            F VEF+AT +++FLA++L++ P+    L+GFVVG  IGLGVLI+GPVSG SMNPARSLGP
Sbjct  150  FSVEFIATSMVVFLAAALANAPESVQNLSGFVVGGAIGLGVLITGPVSGASMNPARSLGP  209

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPA  88
            AI S  F + LWIY  APT GA+ G  LYRL+RLQGW C+P+
Sbjct  210  AIVSGDF-AFLWIYLAAPTLGAIFGAILYRLIRLQGWPCEPS  250



>gb|KHN03851.1| Putative aquaporin NIP7-1 [Glycine soja]
Length=223

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 158/200 (79%), Gaps = 1/200 (1%)
 Frame = -3

Query  708  VFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPSVTLAFASLGPF  529
            +FC+CGI ++ +     VGLLEYAA A LT++V++FSIGPIS AH+NP+VT+AFA++G F
Sbjct  1    MFCVCGITASTRFQNGAVGLLEYAAIAGLTMVVIIFSIGPISCAHVNPAVTIAFATIGQF  60

Query  528  PWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWVEFLATfiilfla  349
            PW KVP YI+AQ  GS+ AT    L+YG++ E MMT PL GCN+AFWVE +ATFII+FL 
Sbjct  61   PWFKVPVYIIAQTVGSMSATYIGSLVYGIKSEAMMTMPLQGCNSAFWVEVIATFIIMFLI  120

Query  348  sslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIASWSFDSDLWIYF  169
            ++L+S+ Q  G L+GFV G+ IGL VLI+GPVSGGSMNPARSLGPAI SW F  ++WIY 
Sbjct  121  AALTSESQSVGHLSGFVAGMAIGLAVLITGPVSGGSMNPARSLGPAILSWKFK-NIWIYM  179

Query  168  VAPTTGAVAGVFLYRLLRLQ  109
            VAP+ GAVAG  ++R LRL+
Sbjct  180  VAPSGGAVAGAAMFRFLRLR  199



>ref|XP_010256208.1| PREDICTED: probable aquaporin NIP7-1 [Nelumbo nucifera]
Length=291

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 158/214 (74%), Gaps = 1/214 (0%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            IR ++AE +GT+IL+FC+CGII+  +L    +GLLEYAAT  L+V +++F +GPISG H+
Sbjct  58   IRMVLAEMIGTFILMFCVCGIIAGRELTKGDMGLLEYAATGGLSVTILMFCVGPISGGHL  117

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPSVT+AFA++G FPW KVP YI AQ+ GSVFAT     +YG++ + + TRPL     AF
Sbjct  118  NPSVTIAFATVGHFPWSKVPLYISAQMVGSVFATYVGESVYGIKADILTTRPLQSRATAF  177

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
            W E +AT I LFLASSL        + +GFVVG+ I L VLI+GPVSGGS+NPARS GPA
Sbjct  178  WAELMATSITLFLASSLCHQAHAVAQASGFVVGIAIALAVLITGPVSGGSLNPARSFGPA  237

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            + SW F+ DLW+Y  APT GAVAG  L+++LRLQ
Sbjct  238  VVSWRFN-DLWLYLFAPTVGAVAGALLFKVLRLQ  270



>gb|KDP40116.1| hypothetical protein JCGZ_02114 [Jatropha curcas]
Length=618

 Score =   219 bits (557),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 173/227 (76%), Gaps = 3/227 (1%)
 Frame = -3

Query  744  EMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINP  565
            +++AE +GT++L+ C+CGII   QL   Q+GLLEYA TA LTVIV+VFSIGPISGAH+NP
Sbjct  381  QVIAEMMGTFVLMICVCGIIGTTQLTRDQLGLLEYATTAGLTVIVLVFSIGPISGAHVNP  440

Query  564  SVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWV  385
            ++T+AFA+ G FPW +VPFY+ AQ+ GS  A+ +   IYG++ + M TRP HGC++AFWV
Sbjct  441  AITIAFATFGHFPWSRVPFYVSAQIVGSALASYAGGSIYGIKPDLMTTRPFHGCSSAFWV  500

Query  384  EFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIA  205
            EF+ATFII+F+A+SL+       +L+GFV+GV I L VLI+GP+SGGS+NPARSLGPAI 
Sbjct  501  EFIATFIIMFVAASLAYQTSVR-QLSGFVLGVAIALAVLITGPLSGGSLNPARSLGPAIV  559

Query  204  SWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPL  64
            S +F  D+W+Y  AP  G++ G  ++ +LR+Q   C  + +SP+T L
Sbjct  560  SRNF-KDIWVYITAPILGSITGALMFHVLRIQRRPCS-STSSPDTGL  604



>gb|KFK38046.1| hypothetical protein AALP_AA3G063100 [Arabis alpina]
Length=276

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 165/229 (72%), Gaps = 6/229 (3%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+I++ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  46   LRIVMAELVGTFILMFSVCGVIASTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  105

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  106  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADLMATKPAFSCVSAF  165

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
             VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  166  CVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  225

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTP  67
            A+ +W F+ DLW+Y  AP  GA+ GV  YRL+ L+   C     SP++P
Sbjct  226  AVVAWDFE-DLWVYMTAPVIGAIIGVLTYRLISLKTRPCP----SPHSP  269



>ref|XP_002884559.1| hypothetical protein ARALYDRAFT_477911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60818.1| hypothetical protein ARALYDRAFT_477911 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            IR +MAE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  45   IRIVMAEFVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADIMATKPALSCVSAF  164

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  165  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  224

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  225  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLKTRPC  262



>gb|AAF30303.1|AC018907_3 putative major intrinsic protein [Arabidopsis thaliana]
Length=274

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+IS+ QL G  VGLLEYA TA L+V+VVV+SIG ISGAH+
Sbjct  45   LRIVMAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADIMATKPALSCVSAF  164

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
            +VE +AT I++FLAS+L  D    G L GFV+G  I LGVLI+GP+SGGSMNPARSLGPA
Sbjct  165  FVELIATSIVVFLASALHCDFVQLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGPA  224

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            + +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  225  VVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLKTRPC  261



>ref|NP_566271.1| putative aquaporin NIP7-1 [Arabidopsis thaliana]
 sp|Q8LAI1.2|NIP71_ARATH RecName: Full=Probable aquaporin NIP7-1; AltName: Full=NOD26-like 
intrinsic protein 7-1; Short=AtNIP7;1 [Arabidopsis thaliana]
 gb|ABE65919.1| major intrinsic family protein/MIP family protein [Arabidopsis 
thaliana]
 gb|AEE74343.1| putative aquaporin NIP7-1 [Arabidopsis thaliana]
Length=275

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+IS+ QL G  VGLLEYA TA L+V+VVV+SIG ISGAH+
Sbjct  45   LRIVMAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADIMATKPALSCVSAF  164

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  165  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  224

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  225  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLKTRPC  262



>gb|ABK28544.1| unknown [Arabidopsis thaliana]
Length=276

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+IS+ QL G  VGLLEYA TA L+V+VVV+SIG ISGAH+
Sbjct  45   LRIVMAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADIMATKPALSCVSAF  164

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  165  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  224

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  225  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLKTRPC  262



>gb|AAM65333.1| putative major intrinsic protein [Arabidopsis thaliana]
Length=275

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+IS+ QL G  VGLLEYA TA L+V+VVV+SIG ISGAH+
Sbjct  45   LRIVMAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADIMATKPALSCVSAF  164

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  165  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  224

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  225  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLKTRPC  262



>ref|XP_010546840.1| PREDICTED: probable aquaporin NIP7-1 [Tarenaya hassleriana]
Length=288

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+I+  +L G   GLLEYAATA  +V+VV++++G ISGAH+
Sbjct  58   LRIVMAEMVGTFILMFSVCGVIATTRLTGGHGGLLEYAATAGFSVVVVIYAVGHISGAHV  117

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NP++T+AFA+ G FPW +VPFYI AQ  GSV AT+    IYGV+ E M TRP  GC +AF
Sbjct  118  NPAITIAFAAFGGFPWSRVPFYIGAQTLGSVVATLMGMWIYGVKAEVMATRPAFGCASAF  177

Query  390  WVEFLATfiilflasslsSDPQFT-GKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
             VE +AT I++FLAS+L+  P  +  KL+GF++G  I LGVLISGP+SGGSMNPARS+GP
Sbjct  178  CVELIATGIVVFLASALNCGPDHSESKLSGFIIGTVIALGVLISGPISGGSMNPARSMGP  237

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W    D+W+Y  AP  GA  GV  YR L L+   C
Sbjct  238  AVVAWDLK-DVWVYLTAPVIGACVGVITYRSLSLKATAC  275



>ref|XP_006299499.1| hypothetical protein CARUB_v10015668mg [Capsella rubella]
 gb|EOA32397.1| hypothetical protein CARUB_v10015668mg [Capsella rubella]
Length=275

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  45   LRTVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+   L+YGV  + M T+P     +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVLVYGVNADLMATKPALSWVSAF  164

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  165  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  224

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+
Sbjct  225  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLK  258



>ref|XP_009129640.1| PREDICTED: probable aquaporin NIP7-1 [Brassica rapa]
 emb|CDY27709.1| BnaA05g31180D [Brassica napus]
Length=272

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  44   LRIVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  103

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YIMAQ  G+  AT++   +YGV  + M+T+P   C +AF
Sbjct  104  NPSITIAFALFGGFPWSQVPLYIMAQTLGATAATLAGVSVYGVNPDLMITKPALSCVSAF  163

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q +  L G V+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  164  FVELVATSIVVFLASALHCGPHQNSSNLTGLVIGAVISLGVLITGPISGGSMNPARSLGP  223

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            A+ +W F+  +W+Y  AP  GA+ GV  YR + L+
Sbjct  224  AVVAWDFEY-IWVYMTAPVIGAIMGVLTYRTISLK  257



>ref|XP_010694010.1| PREDICTED: probable aquaporin NIP7-1 [Beta vulgaris subsp. vulgaris]
Length=289

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 161/214 (75%), Gaps = 2/214 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            R ++AE LGT+IL+F ICGI+ +M+L+G QVGL+EYA TA   ++V++F++G ISGAH+N
Sbjct  61   RIIIAEGLGTFILMFSICGIMGSMELLGNQVGLVEYAITAGTAIVVIIFTLGDISGAHVN  120

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHG-CNAAF  391
            P+VT+AFA  G FPW KVPFY+ AQ+ GS+ AT   RL++GV  E +MT P+     AAF
Sbjct  121  PAVTIAFAVFGHFPWKKVPFYVTAQLSGSILATYVGRLVFGVNPELIMTVPVKDRALAAF  180

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              EF+ATFI+ FLA+SL+ D +  G L+GFV+G+ I L VLI+GP+SGGS+NPARSLGPA
Sbjct  181  TAEFIATFIVTFLAASLARDAKSVGHLSGFVLGIAIALAVLITGPLSGGSLNPARSLGPA  240

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            + +W  +  +WIYFVAP  GAV GV +   L LQ
Sbjct  241  VLAWKLNY-IWIYFVAPIAGAVLGVLIVHALCLQ  273



>emb|CDY05231.1| BnaC05g45720D [Brassica napus]
Length=272

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  44   LRIVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  103

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YIMAQ  G+  AT++   +YGV  + M+T+P   C +AF
Sbjct  104  NPSITIAFALFGGFPWSQVPLYIMAQTLGATAATLAGVSVYGVNPDLMITKPALSCVSAF  163

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q    L G V+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  164  FVELVATSIVVFLASALHCGPHQNLSNLTGLVIGAVISLGVLITGPISGGSMNPARSLGP  223

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            A+ +W F+  +W+Y  AP  GA+ GV  YR + L+
Sbjct  224  AVVAWDFEY-IWVYMTAPVIGAIMGVLTYRTISLK  257



>ref|XP_010435915.1| PREDICTED: probable aquaporin NIP7-1 [Camelina sativa]
Length=276

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  46   LRIVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  105

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P     +AF
Sbjct  106  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADLMATKPALSWVSAF  165

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  166  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  225

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  226  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLKTRPC  263



>ref|XP_010486097.1| PREDICTED: probable aquaporin NIP7-1 isoform X1 [Camelina sativa]
Length=276

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  46   LRIVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  105

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P     +AF
Sbjct  106  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADLMATKPALSWVSAF  165

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  166  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  225

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTC  97
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+   C
Sbjct  226  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLRTRPC  263



>ref|XP_010464176.1| PREDICTED: probable aquaporin NIP7-1 [Camelina sativa]
Length=276

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 158/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  46   LRIVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  105

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P     +AF
Sbjct  106  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADLMATKPALSWVSAF  165

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
            +VE +AT I++FLAS+L   P Q  G L GFV+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  166  FVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGP  225

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            A+ +W F+ DLWIY  AP  GA+ GV  YR + L+
Sbjct  226  AVVAWDFE-DLWIYMTAPVIGAIIGVLTYRSISLK  259



>ref|XP_006407983.1| hypothetical protein EUTSA_v10021311mg [Eutrema salsugineum]
 gb|ESQ49436.1| hypothetical protein EUTSA_v10021311mg [Eutrema salsugineum]
Length=275

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 158/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R +MAE +GT+IL+F +CG+IS+ Q+ G  VGLLEYAATA L+V+VVV+S+G ISGAH+
Sbjct  45   LRIVMAELVGTFILMFSVCGVISSTQISGGHVGLLEYAATAGLSVVVVVYSVGHISGAHL  104

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P   C +AF
Sbjct  105  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADLMATKPTLSCVSAF  164

Query  390  WVEFLATfiilflasslsSDP-QFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
             VE +AT I++FLAS+L   P Q +G L G V+G  I LGVLI+GP+SGGSMNPARSLGP
Sbjct  165  CVELVATGIVVFLASALHCGPHQNSGNLTGLVIGTVISLGVLITGPISGGSMNPARSLGP  224

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            A+ +W F+ D+W+Y  AP  GA+ GV  YR + L+
Sbjct  225  AVVAWDFE-DIWVYLTAPVIGAIIGVLTYRTISLK  258



>ref|XP_004134455.1| PREDICTED: probable aquaporin NIP7-1-like [Cucumis sativus]
Length=245

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 155/227 (68%), Gaps = 4/227 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
             +R ++ E +G+++L+ C+ G+ +  QL G Q+G+L+YA  A LTV V+ F   PISGAH
Sbjct  5    LVRPVLGEMVGSFLLILCVSGVTATGQLTGSQMGILDYAVAAGLTVGVLTFCFAPISGAH  64

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN--  400
             NP++TLA A  G FPW +V  Y++AQ  G V AT ++  ++G++ + ++TRPL+  +  
Sbjct  65   FNPAITLASAISGHFPWSRVMAYVVAQTTGCVMATYAAMFVFGIKPQQLITRPLYNYSSP  124

Query  399  -AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARS  223
             +AF++E L TFI++FL SSLS   Q   + +GFV+G+ I L V I+GP+SG SMNPARS
Sbjct  125  FSAFFLELLLTFILMFLLSSLSHQSQLVRQFSGFVIGMAIALAVFIAGPISGASMNPARS  184

Query  222  LGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA  82
            LGPAI SW+FD D+WIY  AP  GA+ G F+   LRL     +P++A
Sbjct  185  LGPAIVSWAFD-DIWIYITAPAIGAITGAFISDFLRLSPPPPQPSNA  230



>gb|KGN57016.1| hypothetical protein Csa_3G149960 [Cucumis sativus]
Length=268

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 155/227 (68%), Gaps = 4/227 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
             +R ++ E +G+++L+ C+ G+ +  QL G Q+G+L+YA  A LTV V+ F   PISGAH
Sbjct  28   LVRPVLGEMVGSFLLILCVSGVTATGQLTGSQMGILDYAVAAGLTVGVLTFCFAPISGAH  87

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN--  400
             NP++TLA A  G FPW +V  Y++AQ  G V AT ++  ++G++ + ++TRPL+  +  
Sbjct  88   FNPAITLASAISGHFPWSRVMAYVVAQTTGCVMATYAAMFVFGIKPQQLITRPLYNYSSP  147

Query  399  -AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARS  223
             +AF++E L TFI++FL SSLS   Q   + +GFV+G+ I L V I+GP+SG SMNPARS
Sbjct  148  FSAFFLELLLTFILMFLLSSLSHQSQLVRQFSGFVIGMAIALAVFIAGPISGASMNPARS  207

Query  222  LGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA  82
            LGPAI SW+FD D+WIY  AP  GA+ G F+   LRL     +P++A
Sbjct  208  LGPAIVSWAFD-DIWIYITAPAIGAITGAFISDFLRLSPPPPQPSNA  253



>ref|XP_008438714.1| PREDICTED: probable aquaporin NIP7-1 [Cucumis melo]
Length=268

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 154/226 (68%), Gaps = 4/226 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
             +R ++ E +G+++L+ C+ G+ +  QL G Q+G+L+YA  A LTV V+ F   PISGAH
Sbjct  28   LVRPVLGEMVGSFLLIVCVSGVTATGQLTGSQMGVLDYAIAAGLTVGVLTFCFAPISGAH  87

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN--  400
             NP++TLA A  G FPW +V  Y++AQ  G V AT ++  ++G++ + ++TRPLH  +  
Sbjct  88   FNPAITLASAIFGHFPWSRVMAYVVAQTTGCVMATYAAMFVFGIKPQQLITRPLHNYSSP  147

Query  399  -AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARS  223
             +AF++E L TFI++FL SSLS   Q   + +GFV+G+ I L V I+GP+SG SMNPARS
Sbjct  148  FSAFFLELLLTFILMFLLSSLSYQSQSVRQFSGFVIGMAIALAVFIAGPISGASMNPARS  207

Query  222  LGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD  85
            LGPAI SW+FD D+WIY  AP  GA+ G F+   LRL     +P+D
Sbjct  208  LGPAIVSWAFD-DIWIYITAPCIGAITGAFISDFLRLCPPPLQPSD  252



>ref|XP_004170712.1| PREDICTED: probable aquaporin NIP7-1-like, partial [Cucumis sativus]
Length=236

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 148/217 (68%), Gaps = 4/217 (2%)
 Frame = -3

Query  723  GTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPSVTLAFA  544
            G ++L+ C+ G+ +  QL G Q+G+L+YA  A LTV V+ F   PISGAH NP++TLA A
Sbjct  6    GEFLLILCVSGVTATGQLTGSQMGILDYAVAAGLTVGVLTFCFAPISGAHFNPAITLASA  65

Query  543  SLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN---AAFWVEFLA  373
              G FPW +V  Y++AQ  G V AT ++  ++G++ + ++TRPL+  +   +AF++E L 
Sbjct  66   ISGHFPWSRVMAYVVAQTTGCVMATYAAMFVFGIKPQQLITRPLYNYSSPFSAFFLELLL  125

Query  372  TfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIASWSF  193
            TFI++FL SSLS   Q   + +GFV+G+ I L V I+GP+SG SMNPARSLGPAI SW+F
Sbjct  126  TFILMFLLSSLSHQSQLVRQFSGFVIGMAIALAVFIAGPISGASMNPARSLGPAIVSWAF  185

Query  192  DSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA  82
            D D+WIY  AP  GA+ G F+   LRL     +P++A
Sbjct  186  D-DIWIYITAPAIGAITGAFISDFLRLSPPPPQPSNA  221



>ref|XP_011011195.1| PREDICTED: probable aquaporin NIP7-1 isoform X2 [Populus euphratica]
 ref|XP_011014495.1| PREDICTED: probable aquaporin NIP7-1 isoform X2 [Populus euphratica]
Length=272

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTV  616
            K   CSF    +    R ++AE +GT++L+FC+CGI++  Q++  +VGL+EYA+ A LT+
Sbjct  56   KSSFCSFLQGMDLNPARMVLAEMVGTFLLLFCVCGIVACTQILRGEVGLMEYASVAGLTI  115

Query  615  IVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY  436
            IVV+FSIG ISGAH+NP+VT+AFA+ G FPW KVP YI+AQ  GSV AT     +YGV+ 
Sbjct  116  IVVIFSIGSISGAHVNPAVTIAFATFGHFPWSKVPLYILAQTVGSVLATYVGSSVYGVKT  175

Query  435  EHMMTRPLHGCNAAFWVEFLAT  370
            E M TRP  GC++AFWVEF+AT
Sbjct  176  ELMTTRPAIGCSSAFWVEFMAT  197



>gb|KCW60849.1| hypothetical protein EUGRSUZ_H03586 [Eucalyptus grandis]
Length=200

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 120/164 (73%), Gaps = 1/164 (1%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFI-REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLT  619
            K +I   FP   K+   R ++AEA+GT+IL++CI  I+S  QL+  +VGL+ YAATA +T
Sbjct  21   KDFILGHFPQGAKLNTARMVLAEAIGTFILMYCISAILSMTQLLKGEVGLMGYAATAGMT  80

Query  618  VIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVE  439
            +++++FS+GPIS AH+NP++T+AFA  G FPW +VP YI+AQ+ GSV AT    ++YGVE
Sbjct  81   IVIIIFSLGPISDAHVNPAITIAFAIYGHFPWSRVPLYIIAQLTGSVLATYVGAMVYGVE  140

Query  438  YEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLA  307
               M+TRPL G  +AFWVEFLATFI++FL + L+ + Q  G L+
Sbjct  141  SSLMITRPLGGLASAFWVEFLATFIMVFLIAGLTYNHQSVGPLS  184



>ref|XP_010040111.1| PREDICTED: aquaporin NIP1-1-like [Eucalyptus grandis]
 gb|KCW45472.1| hypothetical protein EUGRSUZ_L00814 [Eucalyptus grandis]
Length=274

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/239 (46%), Positives = 154/239 (64%), Gaps = 9/239 (4%)
 Frame = -3

Query  801  NCKKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATAS  625
            N K+ I S F  F+  FI++++AE  GTY L+F  CG ++ N+    V V L   +    
Sbjct  23   NAKEEIRSTF--FSFPFIQKLIAEVFGTYFLIFAGCGSVAVNLDYDKV-VTLPGISMVWG  79

Query  624  LTVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYG  445
            L V+V+V+S+G ISGAH NP+VT+AFA+   FPW +VP YI+AQV GS  A  + RL++ 
Sbjct  80   LAVMVLVYSVGHISGAHFNPAVTIAFATCKRFPWKQVPPYILAQVLGSTLANGTLRLLFT  139

Query  444  VEYEHMM-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvl  268
             +  H + T+P      AF  EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+
Sbjct  140  GKLNHFLGTQPAGSDGQAFVFEFIITFYLMFIISGVATDNRAIGELAGLAVGATVLLNVM  199

Query  267  ISGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
             +GPV+G SMNPARSLGPAI    +D  LWIY VAPT GA+AG ++Y L+R   +T KP
Sbjct  200  FAGPVTGASMNPARSLGPAIVFHHYD-KLWIYIVAPTVGAIAGAWIYNLVR---FTDKP  254



>ref|XP_004309631.1| PREDICTED: aquaporin NIP1-2-like [Fragaria vesca subsp. vesca]
Length=270

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 148/230 (64%), Gaps = 7/230 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            FI++++AE LGTY L+F  CG +I N+    + V     + T  LTV+V+V+S+G ISGA
Sbjct  36   FIQKVIAEVLGTYFLIFAGCGSVIVNLSTDKL-VSFPGISITWGLTVMVMVYSVGHISGA  94

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN-  400
            H NP+VTLAFA +  FPW +VP YI+AQV GS  A+V+ RL++    +H       G N 
Sbjct  95   HFNPAVTLAFAIIHRFPWKQVPAYIIAQVLGSTLASVALRLLFQHRQDHFAGTDPSGSNL  154

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPARSL
Sbjct  155  QAFVLEFIITFYLMFVVSGVATDSRAVGELAGLAVGSTVLLNVMFAGPITGASMNPARSL  214

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNT  70
            GPAI  WS    LWIY V+P  GA+ G  +Y ++R   +T KP +    T
Sbjct  215  GPAIV-WSHYKGLWIYLVSPILGALCGALVYNVIR---FTDKPLNELTKT  260



>ref|XP_010057160.1| PREDICTED: aquaporin NIP1-1-like [Eucalyptus grandis]
 gb|KCW74187.1| hypothetical protein EUGRSUZ_E02836 [Eucalyptus grandis]
Length=274

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 151/238 (63%), Gaps = 7/238 (3%)
 Frame = -3

Query  801  NCKKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASL  622
            N K+ I S F  F+  FI++++AE  GTY L+F  CG ++        V L   +    L
Sbjct  23   NAKEEIRSTF--FSFPFIQKLIAEVFGTYFLIFAGCGSVAVNVDYDKVVTLPGISMVWGL  80

Query  621  TVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGV  442
             V+V+V+S+G ISGAH NP+VT+AFA+   FPW +VP YI+AQ+ GS  A  + RL++  
Sbjct  81   AVMVLVYSVGHISGAHFNPAVTIAFATCKRFPWKQVPPYILAQILGSTLANGTLRLLFTG  140

Query  441  EYEHMM-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlI  265
            +  H + T+P      AF  EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ 
Sbjct  141  KLNHFLGTQPAGSDGQAFVFEFIITFYLMFIISGVATDNRAIGELAGLAVGATVLLNVMF  200

Query  264  SGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +GPV+G SMNPARSLGPAI    +D  LWIY VAPT GA+AG ++Y L+R   +T KP
Sbjct  201  AGPVTGASMNPARSLGPAIVFHHYD-KLWIYIVAPTVGAIAGAWIYNLIR---FTDKP  254



>ref|XP_004234073.1| PREDICTED: aquaporin NIP1-1-like [Solanum lycopersicum]
Length=277

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 150/225 (67%), Gaps = 12/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEY---AATASLTVIVVVFSIGPIS  583
            FI++++AE +GTY L+F  CG +    ++    G++ +   A T  L V+V+V+S+G IS
Sbjct  43   FIQKVIAEMIGTYFLIFAGCGSV----VVNADKGMITFPGVAITWGLVVMVMVYSVGHIS  98

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NPSVT+AFAS+  FPW +VP Y+ AQV G+  A+ + RLI+  +++H   T P   
Sbjct  99   GAHFNPSVTIAFASVKRFPWKQVPAYVAAQVLGATLASGTLRLIFNGKHDHFAGTLPSGT  158

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +F +EF+ TF ++F+ S +++D +  G+LAG  VG  I L V+ +GP+SG SMNPAR
Sbjct  159  DFQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVMFTGPISGASMNPAR  218

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI S  +   LWIY V+PT GA+AG ++Y ++R   +T KP
Sbjct  219  SLGPAIVSSHYKG-LWIYLVSPTLGAIAGAWVYNIIR---FTDKP  259



>ref|XP_006356091.1| PREDICTED: aquaporin NIP1-1-like [Solanum tuberosum]
Length=277

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 150/225 (67%), Gaps = 12/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEY---AATASLTVIVVVFSIGPIS  583
            FI++++AE +GTY L+F  CG +    ++    G++ +   A T  L V+V+V+S+G IS
Sbjct  43   FIQKIIAEMIGTYFLIFAGCGSV----VVNADKGMITFPGIAITWGLVVMVMVYSVGHIS  98

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT+AFAS+  FPW +VP Y+ AQV G+  A+ + RLI+  +++H   T P   
Sbjct  99   GAHFNPAVTIAFASVKRFPWKQVPAYVAAQVLGATLASGTLRLIFNGKHDHFAGTLPSGT  158

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +F VEF+ TF ++F+ S +++D +  G+LAG  VG  I L V+ +GP+SG SMNPAR
Sbjct  159  DFQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVMFTGPISGASMNPAR  218

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI S  +   LWIY V+PT GA+AG ++Y ++R   +T KP
Sbjct  219  SLGPAIVSSHYKG-LWIYLVSPTLGAIAGAWVYNIIR---FTDKP  259



>ref|XP_009590978.1| PREDICTED: aquaporin NIP1-1-like [Nicotiana tomentosiformis]
Length=275

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 154/235 (66%), Gaps = 15/235 (6%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEY---AATASLTVI  613
            CSF  +    FI++++AE +GTY L+F  CG +    ++    G++ +   A T  L V+
Sbjct  34   CSFLTV---PFIQKVIAEMIGTYFLIFAGCGSV----VVNADKGMVTFPGIAITWGLVVM  86

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            V+++S+G ISGAH NPSVT+AFA++  FPW +VP Y+ AQ+ G+  A+ + RLI+  +++
Sbjct  87   VMIYSVGHISGAHFNPSVTIAFATVKRFPWKQVPAYVAAQILGATLASGTLRLIFNGKHD  146

Query  432  HMM-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            H   T P      +F VEF+ TF ++F+ S +++D +  G+LAG  VG  I L V+ +GP
Sbjct  147  HFAGTLPTGTEFQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVMFAGP  206

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +SG SMNPARSLGPAI S  +   LWIY V+PT GA+AG ++Y ++R   +T KP
Sbjct  207  ISGASMNPARSLGPAIVSTHYRG-LWIYLVSPTLGAIAGAWVYNIIR---FTDKP  257



>ref|XP_009785425.1| PREDICTED: aquaporin NIP1-1-like [Nicotiana sylvestris]
Length=275

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 154/235 (66%), Gaps = 15/235 (6%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEY---AATASLTVI  613
            CSF  +    FI++++AE +GTY L+F  CG +    ++    G++ +   A T  L V+
Sbjct  34   CSFLTV---PFIQKVIAEMIGTYFLIFAGCGSV----VVNSDKGMVTFPGIAITWGLVVM  86

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            V+V+S+G ISGAH NPSVT+AFA++  FPW +VP Y+ AQV G+  A+ + RLI+  +++
Sbjct  87   VMVYSVGHISGAHFNPSVTIAFATVKRFPWKQVPAYVAAQVLGATLASGTLRLIFNGKHD  146

Query  432  HMM-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            H   T P      +F VEF+ TF ++F+ S +++D +  G+LAG  VG  I L V+ +GP
Sbjct  147  HFAGTLPTGTEFQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVMFAGP  206

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +SG SMNPARSLGPAI S  +   LWIY V+PT GA+AG ++Y ++R   +T KP
Sbjct  207  ISGASMNPARSLGPAIVSTHYRG-LWIYLVSPTLGAIAGAWVYNIIR---FTDKP  257



>gb|EYU42698.1| hypothetical protein MIMGU_mgv1a019443mg, partial [Erythranthe 
guttata]
Length=250

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 148/227 (65%), Gaps = 3/227 (1%)
 Frame = -3

Query  768  IFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            + N    R++ AE +GTYIL+F  + G I N +  GV+  L+  A  A L V+VV+ SIG
Sbjct  16   VRNTSLARKVGAEFVGTYILIFAAVGGPIVNEKYNGVET-LIGNALCAGLAVMVVILSIG  74

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPL  412
             ISGAH+NPSVT+AFASL  FPW +VP Y++AQ+  S+ A+ S + ++       +T P 
Sbjct  75   HISGAHLNPSVTVAFASLRHFPWAEVPAYVVAQISASICASFSLKAVFHPFLSGGVTVPS  134

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 AF +EFL TF +LF+  ++++D +  G+LAG  +G  + L +L++GP +G SMNP
Sbjct  135  VTTAQAFALEFLTTFFLLFVIIAVATDTRAVGELAGLAIGAVVMLDILVAGPSTGASMNP  194

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            AR+LGPAIA+ ++ S +WIYFVAPT GA+AG   Y L++L      P
Sbjct  195  ARTLGPAIAAGNYKS-IWIYFVAPTLGAIAGAATYTLVKLPAQDDLP  240



>ref|XP_009419139.1| PREDICTED: aquaporin NIP2-1-like [Musa acuminata subsp. malaccensis]
Length=301

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 148/247 (60%), Gaps = 6/247 (2%)
 Frame = -3

Query  804  INCKKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATA  628
            ++ ++ +   FP F     R++++E + T++LVF  CG  + N    GV V  L  +   
Sbjct  36   VHRRRNLKELFPPF---LPRKVVSEMIATFLLVFVTCGAGALNKNNPGV-VSQLGQSVAG  91

Query  627  SLTVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY  448
             L V V+++++G ISGAH+NP+VTLAFA    FPW +VPFY++AQ+ GS  A+   R + 
Sbjct  92   GLIVTVMIYAVGHISGAHMNPAVTLAFAVARHFPWIQVPFYMLAQIAGSTTASYILRELL  151

Query  447  GVEYEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvl  268
               ++   T P H    A   E + TF ++F+ +++++D +  G+LAG  VG  + +  +
Sbjct  152  DPIHDLGTTTPSHTAAKALVAEIVVTFNMMFVTAAVATDTKAVGELAGLAVGSAVCITSI  211

Query  267  ISGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPA  88
            ++GP+SGGSMNPAR+LGPA+AS  FDS LW+YFV P  G VAG   Y  +RL   +    
Sbjct  212  LAGPISGGSMNPARTLGPALASNKFDS-LWVYFVGPPVGTVAGALAYSFIRLDEHSLSSQ  270

Query  87   DASPNTP  67
              S  +P
Sbjct  271  KDSQKSP  277



>emb|CDP14867.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 150/224 (67%), Gaps = 3/224 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE LGT+IL+F    G I N +  G +  L+  AA A L V++V+ +
Sbjct  59   FPAPDISLPRKVGAEFLGTFILIFGATAGPIVNQKYDGAET-LIGNAACAGLAVLIVILA  117

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NP+VT+AFA+L  FPW +VP YI AQV GS+ A+ + + ++       +T 
Sbjct  118  TGHISGAHLNPAVTIAFAALRHFPWAQVPAYIAAQVSGSICASFALKAVFNPFMSGGVTV  177

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  178  PSVGNAQAFALEFIVTFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPASGGSM  237

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQG  106
            NP R+LGPA+A+ ++ S +W+Y VAPT GA+AG   Y +++LQG
Sbjct  238  NPVRTLGPAVAAGNYTS-VWVYLVAPTLGALAGAGAYTMVKLQG  280



>ref|XP_004309391.1| PREDICTED: aquaporin NIP1-2-like [Fragaria vesca subsp. vesca]
Length=272

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 146/230 (63%), Gaps = 7/230 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE LGTY L+F  CG +I N+    + V     + T  LTV+V+V+S+G ISGA
Sbjct  38   FMQKVIAEVLGTYFLIFAGCGSVIVNLSTDKL-VSFPGISITWGLTVMVMVYSVGHISGA  96

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN-  400
            H NP+VTLAFA    FPW +VP YI+AQV GS  A+ + RL++    +H       G N 
Sbjct  97   HFNPAVTLAFAITHRFPWKEVPAYIIAQVLGSTLASGTLRLLFQHSQDHFAGTDPSGSNL  156

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPARSL
Sbjct  157  QAFVLEFIITFYLMFVVSGVATDSRAVGELAGLAVGSTVLLNVMFAGPITGASMNPARSL  216

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNT  70
            GPAI  WS    LWIY V+P  GA+ G  +Y ++R   +T KP +    T
Sbjct  217  GPAIV-WSHYKGLWIYLVSPILGALCGALVYNVIR---FTDKPLNELAKT  262



>ref|XP_009590733.1| PREDICTED: probable aquaporin NIP5-1 [Nicotiana tomentosiformis]
Length=297

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 153/239 (64%), Gaps = 9/239 (4%)
 Frame = -3

Query  780  SFFPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVV  604
            S FP  +    R++ AE +GT+IL+F    G I N +  GV+  L+  AA A L V++V+
Sbjct  59   SDFPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYSGVE-SLIGNAACAGLAVMIVI  117

Query  603  FSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM  424
             S G ISGAH+NPS+T+AFA+L  FPW +VP Y+ AQV  SV A+ + + ++       +
Sbjct  118  LSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSASVCASFALKGVFHPFMSGGV  177

Query  423  TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGG  244
            T P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SG 
Sbjct  178  TVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGA  237

Query  243  SMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTP  67
            SMNP R+LGPA+A+ ++ S LWIY VAPT GA+AG  +Y L++L+G      D S  TP
Sbjct  238  SMNPVRTLGPAVAAGNYKS-LWIYLVAPTLGALAGAAVYTLVKLRG------DDSTETP  289



>ref|XP_010680949.1| PREDICTED: probable aquaporin NIP5-1 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 150/222 (68%), Gaps = 3/222 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
             I++++AE +GT+IL+F    G I N +  GV+  L+  AA A L V++++ SIG ISGA
Sbjct  33   LIQKLIAEFVGTFILIFSATAGPIVNEKYNGVE-SLIGNAACAGLAVMIIILSIGHISGA  91

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + +L++       +T P      
Sbjct  92   HLNPSLTIAFAALRHFPWIQVPAYIAAQVLASILASFTLKLVFHPFMSGGVTVPSVNLKQ  151

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EF  TF ++F+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LG
Sbjct  152  AFTLEFFITFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLG  211

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAIA+ ++ + +W+Y VAPT GA+ G  +Y+L++L+    +P
Sbjct  212  PAIAAGNYKA-VWLYMVAPTLGALGGAGIYKLVQLEEREDEP  252



>ref|XP_010088000.1| Aquaporin NIP1-2 [Morus notabilis]
 gb|EXB31116.1| Aquaporin NIP1-2 [Morus notabilis]
Length=275

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 149/233 (64%), Gaps = 7/233 (3%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVV  607
            C+  P  +  FI++++AE LGTY L+F  CG ++ N+    V V     +    L V+V+
Sbjct  30   CNTNPCVSVPFIQKLLAEVLGTYFLIFAGCGSVVVNLDYEKV-VTAPGISMVWGLVVMVM  88

Query  606  VFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM  427
            ++S+G ISGAH NP+VT+AFAS   FP+ +VP YI AQV GS  A+ + RL++    +H 
Sbjct  89   IYSVGHISGAHFNPAVTIAFASTKRFPYKQVPAYIAAQVLGSTLASGTLRLLFNGRDDHF  148

Query  426  M-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P+     +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+S
Sbjct  149  TGTLPVGSDIQSFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPIS  208

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNPARSLGPA+    +   LWIY VAPT GA+AG ++Y L+R   +T KP
Sbjct  209  GASMNPARSLGPAVVHSHYKG-LWIYLVAPTLGAIAGAWVYNLIR---FTDKP  257



>ref|XP_004309620.1| PREDICTED: aquaporin NIP1-2-like [Fragaria vesca subsp. vesca]
Length=270

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 141/222 (64%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE LGTY L+F  CG +         V     A    L V+V+++S+G ISGAH
Sbjct  36   FMQKVIAEVLGTYFLIFAGCGAVVVNLNTDKTVSFPGIAIVWGLVVMVMIYSVGHISGAH  95

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FPW +VP Y++AQV GS  A+ + RLI+    +H   T P      
Sbjct  96   FNPAVTIAFATTKRFPWKQVPPYVVAQVLGSTLASGTLRLIFNNHQDHFAGTSPKGTPLQ  155

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSLG
Sbjct  156  SFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNPARSLG  215

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  +  +LWIY VAPT GAV G  +Y ++R   +T KP
Sbjct  216  PAIVSSHYK-NLWIYLVAPTLGAVCGALVYNVIR---FTDKP  253



>dbj|BAJ96213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 148/228 (65%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++AE LGTY+L+F  C  ++  +     V       T  L V+V+V+S+G
Sbjct  58   PMISVQFVQKVLAEILGTYLLIFAGCAAVAVNKRTAGTVTFPGICITWGLAVMVMVYSVG  117

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRP  415
             ISGAH+NP+VTLAFA+ G FPW +VP Y  AQV GS  A+++ RL++G E EH   T P
Sbjct  118  HISGAHLNPAVTLAFATCGRFPWRQVPAYAAAQVVGSTAASLTLRLLFGSEPEHFFGTVP  177

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMN
Sbjct  178  AGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVLFAGPISGASMN  237

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR++GPA+ +  + S +W+Y V P +GAVAG + Y L+R   +T KP
Sbjct  238  PARTIGPAMVAGRYTS-IWLYIVGPISGAVAGAWAYNLIR---FTNKP  281



>ref|XP_006358084.1| PREDICTED: aquaporin NIP1-1-like [Solanum tuberosum]
Length=290

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 150/235 (64%), Gaps = 15/235 (6%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATA---SLTVI  613
            CSF  I    FI++++AE LGTY L+F  CG ++    +    G++ +   +    L V+
Sbjct  45   CSFVTI---PFIQKIIAETLGTYFLIFAGCGSVA----VNADKGMVTFPGISIVWGLVVM  97

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            V+V+S+G ISGAH NP+VT+AFAS   FPW +VP Y+ AQV GS  A+ + RLI+  +++
Sbjct  98   VMVYSVGHISGAHFNPAVTIAFASNKRFPWKQVPAYVAAQVIGSTLASGTLRLIFNGKHD  157

Query  432  HMM-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            H + T P      +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP
Sbjct  158  HFVGTSPTGSDIQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGP  217

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +SG SMNPARSLGPAI S  +   LW+Y + P  GA+AG ++Y ++R   +T KP
Sbjct  218  ISGASMNPARSLGPAIVSSHYKG-LWVYMLGPIAGAIAGAWVYNIIR---FTDKP  268



>gb|AFW77428.1| aquaporin NIP-type [Zea mays]
Length=284

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 146/228 (64%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+F+  F+++++AEALGTY L+F  C  ++     G  V      A   L V+V+V+S+G
Sbjct  42   PMFSVPFVQKILAEALGTYFLIFAGCAAVAVNLRTGGTVTFPGICAVWGLAVMVMVYSVG  101

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPL  412
             ISGAH+NP+V+LAFA+ G FPW +VP Y  AQV G+  A+++ RL++G   EH      
Sbjct  102  HISGAHLNPAVSLAFATCGRFPWRQVPAYAAAQVTGATAASLTLRLLFGSAREHFFGTVP  161

Query  411  HGCNA-AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
             G +A +  VEF+ +F ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMN
Sbjct  162  AGSDAQSLVVEFIISFNLMFVVSGVATDNRAIGELAGLAVGATVLLNVLFAGPISGASMN  221

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR+LGPA+    + + +W+YF  P  G VAG + Y L+R   +T KP
Sbjct  222  PARTLGPALVVGRY-AGIWVYFAGPICGTVAGAWAYNLIR---FTDKP  265



>ref|NP_001151947.1| LOC100285584 [Zea mays]
 gb|ACG45109.1| aquaporin NIP-type [Zea mays]
Length=284

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 146/228 (64%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+F+  F+++++AEALGTY L+F  C  ++     G  V      A   L V+V+V+S+G
Sbjct  42   PMFSVPFVQKILAEALGTYFLIFAGCAAVAVNLRTGGTVTFPGICAVWGLAVMVMVYSVG  101

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPL  412
             ISGAH+NP+V+LAFA+ G FPW +VP Y  AQV G+  A+++ RL++G   EH      
Sbjct  102  HISGAHLNPAVSLAFATCGRFPWRQVPAYAAAQVTGATAASLTLRLLFGSAREHFFGTVP  161

Query  411  HGCNA-AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
             G +A +  VEF+ +F ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMN
Sbjct  162  AGSDAQSLVVEFIISFNLMFVVSGVATDNRAIGELAGLAVGATVLLNVLFAGPISGASMN  221

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR+LGPA+    + + +W+YF  P  G VAG + Y L+R   +T KP
Sbjct  222  PARTLGPALVVGRY-AGIWVYFAGPICGTVAGAWAYNLIR---FTDKP  265



>gb|EMT30274.1| Aquaporin NIP1-3 [Aegilops tauschii]
Length=288

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 147/228 (64%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++AE LGTY+L+F  C  ++  Q     V          L V+V+V+S+G
Sbjct  48   PMISVQFVQKVLAEILGTYLLIFAGCAAVAVNQRTAGPVPFPGVCIPWGLAVVVMVYSVG  107

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRP  415
             ISGAH+NP+VTLAFA+ G FPW +VP Y  AQV GS  A+++ RL++G E EH   T P
Sbjct  108  HISGAHLNPAVTLAFATCGRFPWRQVPAYAAAQVTGSTAASLTLRLLFGSEPEHFFGTVP  167

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMN
Sbjct  168  SGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVLFAGPISGASMN  227

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR++GPA+ +  + + +W+Y V P TGAVAG + Y L+R   +T KP
Sbjct  228  PARTIGPAMVAGRY-TGIWVYIVGPITGAVAGAWAYNLIR---FTNKP  271



>gb|AAQ11827.1| nodulin-like intrinsic protein NIP1-2, partial [Atriplex nummularia]
Length=294

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 151/229 (66%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            F + +    R+++AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  59   FKVPDVTLTRKLLAEFVGTFILIFAATAGPIVNEKYNGAET-LIGNAACAGLAVMIIILS  117

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+++ + ++       +T 
Sbjct  118  TGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVAASILASLALKGVFHPFMAGGVTV  177

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EFL TF ++F+ +++++D +  G+LAG  VG  + L +L++GP SG SM
Sbjct  178  PSVGIGQAFALEFLITFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGASM  237

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + +WIY VAPT GA+ G  +Y+L++LQ    +P
Sbjct  238  NPVRTLGPAVAAGNYRA-VWIYLVAPTLGALGGAAIYKLVQLQEHEVEP  285



>emb|CDP12262.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 150/224 (67%), Gaps = 3/224 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ +
Sbjct  62   FPAPDVSLTRKLGAEFVGTFILIFGAAAGPIVNQKYNGAET-LIGNAACAGLAVMIVILA  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV GS+ A+ + + ++       +T 
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSGSICASFALKGVFHPFMSGGVTV  180

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EF+ TF++LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  181  PSVGNGQAFALEFVITFVLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  240

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQG  106
            NP R+LGPAIA+ ++ S +W+Y +APT GA+AG  +Y  ++LQG
Sbjct  241  NPVRTLGPAIAAGNYKS-IWVYLLAPTLGALAGAAVYTFVKLQG  283



>ref|XP_009624261.1| PREDICTED: aquaporin NIP1-1-like isoform X1 [Nicotiana tomentosiformis]
Length=303

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 147/225 (65%), Gaps = 12/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATA---SLTVIVVVFSIGPIS  583
            FI++++AE LGTY L+F  CG ++    +    G++ +   +    L V+V+V+S+G IS
Sbjct  69   FIQKIIAETLGTYFLIFAGCGSVA----VNADKGMVTFPGISIVWGLVVMVMVYSVGHIS  124

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT++FA+   FPW +VP Y+ AQV GS  A+ + RLI+  +++H + T P   
Sbjct  125  GAHFNPAVTISFATCKRFPWKQVPAYVAAQVIGSTLASGTLRLIFNGKHDHFLGTSPSGS  184

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPAR
Sbjct  185  DIQSLVLEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPAR  244

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI  WS    +W+Y + PT GA++G ++Y ++R   +T KP
Sbjct  245  SLGPAIV-WSHYRSIWVYMLGPTAGAISGAWVYNIIR---FTDKP  285



>ref|XP_006434369.1| hypothetical protein CICLE_v10001994mg [Citrus clementina]
 gb|ESR47609.1| hypothetical protein CICLE_v10001994mg [Citrus clementina]
Length=300

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 151/234 (65%), Gaps = 5/234 (2%)
 Frame = -3

Query  783  CSF--FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVI  613
            CSF   P+ N    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V+
Sbjct  60   CSFPDIPVPNVSLTRKVGAEFVGTFILIFAATAGPIVNQKYSGAET-LIGNAACAGLAVM  118

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            +++ S G ISGAH+NPS+T+AFA+L  FPW +VP YIMAQV  S+ A+ + + ++     
Sbjct  119  IIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIMAQVSASICASFALKAVFHPFMS  178

Query  432  HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPV  253
              +T P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP 
Sbjct  179  GGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPS  238

Query  252  SGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SGGSMNP R+LGPA+A+ +++  LWI+ +APT GA+AG   Y +++L+     P
Sbjct  239  SGGSMNPVRTLGPAVAAGNYE-KLWIFLLAPTLGALAGATTYTVVKLRDNETDP  291



>dbj|BAI66444.1| nodulin-26 like intrinsic protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 148/228 (65%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++AE LGTY+L+F  C  ++  +     V       T  L V+V+V+S+G
Sbjct  93   PMISVQFVQKVLAEILGTYLLIFAGCAAVAVNKRTAGTVTFPGICITWGLAVMVMVYSVG  152

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRP  415
             ISGAH+NP+VTLAFA+ G FPW +VP Y  AQV GS  A+++ RL++G E EH   T P
Sbjct  153  HISGAHLNPAVTLAFATCGRFPWRQVPAYAAAQVVGSTAASLTLRLLFGSEPEHFFGTVP  212

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMN
Sbjct  213  AGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVLFAGPISGASMN  272

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR++GPA+ +  + S +W+Y V P +GAVAG + Y L+R   +T KP
Sbjct  273  PARTIGPAMVAGRYTS-IWLYIVGPISGAVAGAWAYNLIR---FTNKP  316



>gb|AEY75255.1| nodulin-like intrinsic protein [Atriplex canescens]
Length=300

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 151/229 (66%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            F + +    R+++AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  65   FKVPDVTLTRKLVAEFVGTFILIFAATAGPIVNEKYNGAET-LIGNAACAGLAVMIIILS  123

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+++ + ++       +T 
Sbjct  124  TGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVAASILASLALKGVFHPFMAGGVTV  183

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EFL TF ++F+ +++++D +  G+LAG  VG  + L +L++GP SG SM
Sbjct  184  PSVGVGQAFALEFLITFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGASM  243

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + +WIY VAPT GA+ G  +Y+L++LQ    +P
Sbjct  244  NPVRTLGPAVAAGNYRA-VWIYLVAPTLGALGGAAIYKLVQLQEHEVEP  291



>ref|XP_009624262.1| PREDICTED: aquaporin NIP1-1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009624263.1| PREDICTED: aquaporin NIP1-1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009624264.1| PREDICTED: aquaporin NIP1-1-like isoform X2 [Nicotiana tomentosiformis]
Length=258

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 147/225 (65%), Gaps = 12/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATA---SLTVIVVVFSIGPIS  583
            FI++++AE LGTY L+F  CG ++    +    G++ +   +    L V+V+V+S+G IS
Sbjct  24   FIQKIIAETLGTYFLIFAGCGSVA----VNADKGMVTFPGISIVWGLVVMVMVYSVGHIS  79

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT++FA+   FPW +VP Y+ AQV GS  A+ + RLI+  +++H + T P   
Sbjct  80   GAHFNPAVTISFATCKRFPWKQVPAYVAAQVIGSTLASGTLRLIFNGKHDHFLGTSPSGS  139

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPAR
Sbjct  140  DIQSLVLEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPAR  199

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI  WS    +W+Y + PT GA++G ++Y ++R   +T KP
Sbjct  200  SLGPAIV-WSHYRSIWVYMLGPTAGAISGAWVYNIIR---FTDKP  240



>ref|XP_006472916.1| PREDICTED: probable aquaporin NIP5-1-like [Citrus sinensis]
Length=300

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 151/234 (65%), Gaps = 5/234 (2%)
 Frame = -3

Query  783  CSF--FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVI  613
            CSF   P+ N    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V+
Sbjct  60   CSFPDIPVPNVSLTRKVGAEFVGTFILIFAATAGPIVNQKYSGAET-LIGNAACAGLAVM  118

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            +++ S G ISGAH+NPS+T+AFA+L  FPW +VP YIMAQV  S+ A+ + + ++     
Sbjct  119  IIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIMAQVSASICASFALKAVFHPFMS  178

Query  432  HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPV  253
              +T P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP 
Sbjct  179  GGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPS  238

Query  252  SGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SGGSMNP R+LGPA+A+ +++  LWI+ +APT GA+AG   Y +++L+     P
Sbjct  239  SGGSMNPVRTLGPAVAAGNYE-KLWIFLLAPTLGALAGATTYTVVKLRDNETDP  291



>gb|AAQ11826.1| nodulin-like intrinsic protein NIP1-1 [Atriplex nummularia]
Length=300

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 151/229 (66%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            F + +    R+++AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  65   FKVPDVTLTRKLVAEFVGTFILIFAATAGPIVNEKYNGAET-LIGNAACAGLAVMIIILS  123

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+++ + ++       +T 
Sbjct  124  TGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVAASILASLALKGVFHPFMAGGVTV  183

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EFL TF ++F+ +++++D +  G+LAG  VG  + L +L++GP SG SM
Sbjct  184  PSVGIGQAFALEFLITFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGASM  243

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + +WIY VAPT GA+ G  +Y+L++LQ    +P
Sbjct  244  NPVRTLGPAVAAGNYRA-VWIYLVAPTLGALGGAAIYKLVQLQEHEVEP  291



>ref|XP_010088003.1| Aquaporin NIP1-2 [Morus notabilis]
 gb|EXB31119.1| Aquaporin NIP1-2 [Morus notabilis]
Length=275

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 148/233 (64%), Gaps = 7/233 (3%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVV  607
            C+  P  +  FI++++AE LGTY L+F  CG ++ N+    V V     +    L V+V+
Sbjct  30   CNTNPCVSVPFIQKLLAEVLGTYFLIFAGCGSVVVNLDNEKV-VTAPGISIVWGLVVMVM  88

Query  606  VFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM  427
            ++S+G ISGAH NP+VT+AFAS   FP+ +VP YI AQV GS  A+ + RL++    +H 
Sbjct  89   IYSVGHISGAHFNPAVTIAFASTKRFPYKQVPAYIAAQVLGSTLASGTLRLLFNGRDDHF  148

Query  426  M-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+S
Sbjct  149  TGTLPAGSDIQSFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPIS  208

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNPARSLGPA+    +   LWIY VAPT GA+AG ++Y L+R   +T KP
Sbjct  209  GASMNPARSLGPAVVHSHYKG-LWIYLVAPTLGAIAGAWVYNLIR---FTDKP  257



>ref|NP_001274704.1| aquaporin NIP1-1-like [Solanum lycopersicum]
 dbj|BAO18642.1| nodulin26-like intrinsic protein 1;2 [Solanum lycopersicum]
Length=290

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 150/235 (64%), Gaps = 15/235 (6%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATA---SLTVI  613
            CSF  +    FI++++AE LGTY L+F  CG ++    +    G++ +   +    L V+
Sbjct  45   CSFVTV---PFIQKIIAETLGTYFLIFAGCGSVA----VNADKGMVTFPGISIVWGLVVM  97

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            V+V+S+G ISGAH NP+VT+AFAS   FPW +VP Y+ AQV GS  A+ + RLI+  +++
Sbjct  98   VMVYSVGHISGAHFNPAVTIAFASNKRFPWKQVPAYVAAQVIGSTLASGTLRLIFNGKHD  157

Query  432  HMM-TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            H + T P      +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP
Sbjct  158  HFVGTSPTGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGP  217

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +SG SMNPARSLGPAI S  +   LW+Y + P  GA+AG ++Y ++R   +T KP
Sbjct  218  ISGASMNPARSLGPAIVSSHYKG-LWVYMLGPIGGAIAGAWVYNIIR---FTDKP  268



>gb|KHN17043.1| Putative aquaporin NIP5-1 [Glycine soja]
Length=257

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 147/228 (64%), Gaps = 3/228 (1%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSI  595
            P+ N    +++ AE +GT+IL+F    G I N +  GV+  L+  AA A LTV+ ++ SI
Sbjct  23   PLPNVSLTQKVGAEFVGTFILIFAATAGPIVNNKYNGVE-SLMGNAACAGLTVMFIILSI  81

Query  594  GPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRP  415
            G ISGAH+NPS+T+AFA+   FPW  VP YI AQV  S+ A  + + +Y       +T P
Sbjct  82   GHISGAHLNPSLTIAFAAFRHFPWTHVPAYIAAQVSASICACYALKGVYHPFLSGGVTVP  141

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  AF  EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +LISGP SGGSMN
Sbjct  142  TVSVAQAFATEFIITFILLFVVTAVATDTRAVGELAGIAVGATVLLNILISGPTSGGSMN  201

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            P R+LGPA+A+ ++   +WIY VAPT GA+AG  +Y L++L+    +P
Sbjct  202  PVRTLGPAVAAGNYK-HIWIYLVAPTLGALAGAGVYTLVKLRDEEAEP  248



>gb|ABY19373.1| major intrinsic protein NIP5;1 [Lotus japonicus]
Length=302

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            ++++AE +GT+IL+F    G I N +  G + GL+  AATA LTV+ ++ SIG ISGAH+
Sbjct  76   QKILAEFVGTFILIFAATAGPIVNNKYDGAE-GLMGNAATAGLTVMFIILSIGHISGAHL  134

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA+   FPW +VP YI AQV  S+ A  + + +Y       +T P      AF
Sbjct  135  NPSLTIAFAAFRHFPWSQVPAYIAAQVSASICACFALKYVYHPFLSGGVTVPTVDIGQAF  194

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              EF+ TFI++F+ +++++D +  G+LAG  VG  + L +LISGP SGGSMNP R+LGPA
Sbjct  195  ATEFIITFILMFVVTAVATDSRAVGELAGIAVGATVLLNILISGPTSGGSMNPVRTLGPA  254

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +A+ ++   +WIY VAPT GA+AG  +Y L++L+     P
Sbjct  255  VAAGNYK-HIWIYLVAPTLGALAGAGVYTLVKLRDDGAGP  293



>ref|XP_009804207.1| PREDICTED: aquaporin NIP1-1-like [Nicotiana sylvestris]
Length=287

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 147/225 (65%), Gaps = 12/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATA---SLTVIVVVFSIGPIS  583
            FI++++AE LGTY L+F  CG ++    +    G++ +   +    L V+V+V+S+G IS
Sbjct  47   FIQKIIAETLGTYFLIFAGCGSVA----VNADKGMVTFPGISIVWGLVVMVMVYSVGHIS  102

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT++FA+   FPW +VP Y+ AQV GS  A+ + RLI+  +++H + T P   
Sbjct  103  GAHFNPAVTISFATCKRFPWKQVPAYVAAQVIGSTLASGTLRLIFNGKHDHFLGTSPSGS  162

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPAR
Sbjct  163  DIQSLVLEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPAR  222

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI  WS    +W+Y + PT GA++G ++Y ++R   +T KP
Sbjct  223  SLGPAIV-WSHYRGIWVYMLGPTAGAISGAWVYNIIR---FTDKP  263



>ref|XP_010056097.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=280

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 146/222 (66%), Gaps = 3/222 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
             +R++ AE +GT+ LV C + G I N +  GV+  L+  A  A + V V+VFSIG ISGA
Sbjct  51   LLRKVGAEFVGTFFLVLCAVAGPIVNQKYGGVET-LIGNAVCAGVAVTVIVFSIGHISGA  109

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPSVT+AFA    FPW +VP Y+ AQVGGS+ A+   + ++       +T PL     
Sbjct  110  HLNPSVTIAFAVTRHFPWIQVPGYVAAQVGGSMCASYVLKGVFHPFANGGVTVPLVNVRQ  169

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EFLATF+++F+  ++++D +  G LAG  +G  + +G+L++G  +G SMNP R+LG
Sbjct  170  AFALEFLATFLLMFVIVAVATDARAVGDLAGIAIGATVLVGILVAGMSTGASMNPVRTLG  229

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+A+ ++   LW+Y VAP  GA+AG   Y +L+L+G+  +P
Sbjct  230  PAVAAGNYKG-LWMYMVAPPLGAIAGAATYTVLKLRGYEAEP  270



>ref|XP_010665679.1| PREDICTED: aquaporin NIP1-1-like [Beta vulgaris subsp. vulgaris]
Length=292

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 144/223 (65%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATA-SLTVIVVVFSIGPISGA  577
            F+++M+AE LGTY L+F  C  ++ + L G +V  L   A    L V+V+V+S+G ISGA
Sbjct  49   FLQKMIAEVLGTYFLIFAGCAAVT-VNLDGDKVITLPGIAIVWGLAVMVMVYSVGHISGA  107

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+AFA    FPW +VP Y++ QV GS  A+ + RLI+ G + +   T P     
Sbjct  108  HFNPAVTIAFAVCRRFPWKQVPAYVVCQVVGSTLASGTLRLIFNGHQTQFAGTSPAGSSL  167

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSL
Sbjct  168  QSLVIEFIITFYLMFVISGVATDTRAIGELAGLAVGSTVLLNVMFAGPISGASMNPARSL  227

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  ++  +WIY V PT GAVAG  +Y L+R   +T KP
Sbjct  228  GPAIVSHHYEG-IWIYLVGPTVGAVAGAMVYNLIR---FTDKP  266



>ref|XP_006851308.1| hypothetical protein AMTR_s00050p00166160 [Amborella trichopoda]
 gb|ERN12889.1| hypothetical protein AMTR_s00050p00166160 [Amborella trichopoda]
Length=227

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 136/230 (59%), Gaps = 7/230 (3%)
 Frame = -3

Query  726  LGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPSVTLAF  547
            +GT++L+F +CG +   Q      G LE A    L  +VVV +  PISG HINP++T+A 
Sbjct  2    VGTFVLMFSLCGAVGAGQ------GFLESACVGGLATVVVVIATYPISGGHINPAITIAL  55

Query  546  ASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWVEFLATf  367
                PFP      Y+ AQ+ GS+  TV  + ++ +  E +MT PLHG   A + E +AT 
Sbjct  56   TVSTPFPKFLASIYVFAQIVGSMLGTVMGKYVHQIPLELIMTAPLHGLEQAIFAELIATS  115

Query  366  iilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIASWSFDS  187
            +I+FLASSLS D     +  GF +G  + L VL  GPVSGGSMNPARSLGPA+ +W F  
Sbjct  116  VIMFLASSLSYDVYPMRQTPGFAIGAAVSLAVLTIGPVSGGSMNPARSLGPALVAWRFK-  174

Query  186  DLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNNYNNPSN  37
            D W Y  AP  GAVAG FLY+LLR    +  P+   P++  H  +  PS+
Sbjct  175  DQWAYIAAPIAGAVAGAFLYKLLRFSQPSPHPSPTHPSSLPHQQFELPSS  224



>ref|XP_010555246.1| PREDICTED: probable aquaporin NIP5-1 [Tarenaya hassleriana]
Length=331

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 151/240 (63%), Gaps = 4/240 (2%)
 Frame = -3

Query  804  INCKKWIC-SFFPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAAT  631
            +  KK  C S FP  N    R++ AE +GT+IL+F    G I N +  G +  L+  AA 
Sbjct  85   VTIKKISCFSDFPAPNVSLTRKIGAEFVGTFILIFAATAGPIVNQKYNGAET-LIGNAAC  143

Query  630  ASLTVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLI  451
            A L V++++ S G ISGAH+NPS+T+AFA+L  FPW  VP Y+ AQV  S+ A+ + + +
Sbjct  144  AGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYVAAQVSASICASFALKGV  203

Query  450  YGVEYEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgv  271
            +       +T P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +
Sbjct  204  FHPFMSGGVTVPSVSIGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNI  263

Query  270  lISGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            L++GP SGGSMNP R+LGPA+A+ ++ + LWIY +APT GAVAG  +Y  ++L+     P
Sbjct  264  LVAGPSSGGSMNPVRTLGPAVAAGNYRA-LWIYLLAPTLGAVAGAAVYTSVKLEDTETDP  322



>gb|AFN37617.1| boron transporter [Citrus trifoliata]
Length=300

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 150/234 (64%), Gaps = 5/234 (2%)
 Frame = -3

Query  783  CSF--FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVI  613
            C F   P+ N    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V+
Sbjct  60   CGFPDIPVPNVSLTRKVGAEFVGTFILIFAATAGPIVNQKYSGAET-LIGNAACAGLAVM  118

Query  612  VVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE  433
            +++ S G ISGAH+NPS+T+AFA+L  FPW +VP YIMAQV  S+ A+ + + ++     
Sbjct  119  IIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIMAQVSASICASFALKAVFHPFMS  178

Query  432  HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPV  253
              +T P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP 
Sbjct  179  GGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILMAGPS  238

Query  252  SGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SGGSMNP R+LGPA+A+ +++  LWI+ +APT GA+AG   Y +++L+     P
Sbjct  239  SGGSMNPVRTLGPAVAAGNYE-KLWIFLLAPTLGALAGATTYTVVKLRDNETDP  291



>gb|AAM61294.1| major intrinsic protein (MIP)- like [Arabidopsis thaliana]
Length=293

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 147/229 (64%), Gaps = 12/229 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++MAE LGTY L+F  C  ++        V LL  A    LTV+V+V+S+G ISGAH
Sbjct  49   FLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLLGIAIVWGLTVMVLVYSLGHISGAH  108

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM---TR  418
             NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H +   T 
Sbjct  109  FNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTL  168

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVSG SM
Sbjct  169  PSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASM  228

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+  +S    LWIY V+P  GAV+G ++Y ++R   +T KP
Sbjct  229  NPGRSLGPAMV-YSCYRGLWIYIVSPIVGAVSGAWVYNMVR---YTDKP  273



>ref|XP_009803208.1| PREDICTED: probable aquaporin NIP5-1 [Nicotiana sylvestris]
Length=297

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 152/239 (64%), Gaps = 9/239 (4%)
 Frame = -3

Query  780  SFFPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVV  604
            S FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA + L V++V+
Sbjct  59   SDFPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNGAE-SLIGNAACSGLAVMIVI  117

Query  603  FSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM  424
             S G ISGAH+NPS+T+AFA+L  FPW +VP Y+ AQV  SV A+ + + ++       +
Sbjct  118  LSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSASVCASFALKGVFHPFMSGGV  177

Query  423  TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGG  244
            T P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SG 
Sbjct  178  TVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGA  237

Query  243  SMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTP  67
            SMNP R+LGPA+A+ ++ S LWIY VAPT GA+AG  +Y L++L+G      D S  TP
Sbjct  238  SMNPVRTLGPAVAAGNYKS-LWIYIVAPTLGALAGAAVYTLVKLRG------DDSSETP  289



>ref|XP_003535560.1| PREDICTED: probable aquaporin NIP5-1-like [Glycine max]
Length=299

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 147/228 (64%), Gaps = 3/228 (1%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSI  595
            P+ N    +++ AE +GT+IL+F    G I N +  GV+  L+  AA A LTV+ ++ SI
Sbjct  65   PLPNVSLTQKVGAEFVGTFILIFAATAGPIVNNKYNGVE-SLMGNAACAGLTVMFIILSI  123

Query  594  GPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRP  415
            G ISGAH+NPS+T+AFA+   FPW  VP YI AQV  S+ A  + + +Y       +T P
Sbjct  124  GHISGAHLNPSLTIAFAAFRHFPWTHVPAYIAAQVSASICACYALKGVYHPFLSGGVTVP  183

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  AF  EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +LISGP SGGSMN
Sbjct  184  TVSVAQAFATEFIITFILLFVVTAVATDTRAVGELAGIAVGATVLLNILISGPTSGGSMN  243

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            P R+LGPA+A+ ++   +WIY VAPT GA+AG  +Y L++L+    +P
Sbjct  244  PVRTLGPAVAAGNYK-HIWIYLVAPTLGALAGAGVYTLVKLRDEEAEP  290



>ref|NP_001274288.1| probable aquaporin NIP5-1-like [Solanum lycopersicum]
 dbj|BAO18646.1| nodulin26-like intrinsic protein 5;1 [Solanum lycopersicum]
Length=295

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 149/228 (65%), Gaps = 3/228 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA + L V++V+ S
Sbjct  60   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNGAE-SLIGNAACSGLAVMIVILS  118

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP Y+ AQV  S+ A+ + + ++       +T 
Sbjct  119  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSASICASFALKGVFHPFMSGGVTV  178

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SG SM
Sbjct  179  PSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGASM  238

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCK  94
            NP R+LGPA+A+ ++ S LWIY VAPT GA+AG  +Y L++L+G T +
Sbjct  239  NPVRTLGPAVAAGNYKS-LWIYLVAPTLGALAGAAVYTLVKLRGDTTE  285



>ref|XP_002276319.1| PREDICTED: probable aquaporin NIP5-1 [Vitis vinifera]
 emb|CBI34648.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 147/223 (66%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  GV+  L+  AA A L V++V+ S
Sbjct  63   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYSGVET-LIGNAACAGLAVMIVILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKAVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  182  PSVSIGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + +WIY VAPT GAVAG  +Y  ++L+
Sbjct  242  NPVRTLGPAVAAGNYRA-IWIYLVAPTLGAVAGAAIYTAVKLR  283



>gb|KHN46385.1| Putative aquaporin NIP5-1 [Glycine soja]
Length=299

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 147/228 (64%), Gaps = 3/228 (1%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSI  595
            P+ N    +++ AE +GT+IL+F    G I N +  GV+  L+  AA A LTV+ ++ SI
Sbjct  65   PLPNVSLTQKVGAEFVGTFILIFAATAGPIVNNKYNGVET-LMGNAACAGLTVMFIILSI  123

Query  594  GPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRP  415
            G ISGAH+NPS+T+AFA+   FPW  VP YI AQV  S+ A  + + +Y       +T P
Sbjct  124  GHISGAHLNPSLTIAFAAFRHFPWAHVPAYIAAQVSASICACYALKGVYHPFLSGGVTVP  183

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  AF  EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +LISGP SGGSMN
Sbjct  184  TVSVAQAFATEFIITFILLFVVTAVATDTRAVGELAGIAVGATVLLNILISGPTSGGSMN  243

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            P R+LGPA+A+ ++   +WIY VAPT GA+AG  +Y L++L+    +P
Sbjct  244  PVRTLGPAVAAGNYK-HIWIYLVAPTLGALAGAGVYTLVKLRDNEAEP  290



>ref|XP_010680950.1| PREDICTED: probable aquaporin NIP5-1 [Beta vulgaris subsp. vulgaris]
Length=298

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 149/229 (65%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            F   +    R+++AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  63   FKASDVTLTRKLVAEFVGTFILIFAATAGPIVNQKYNGAE-SLIGNAACAGLAVMIIILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+++ + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAALRHFPWVQVPGYIAAQVAASILASLTLKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF ++F+ +++++D +  G+LAG  VG  + L +L++GP SG SM
Sbjct  182  PSVSIGQAFALEFLITFNLMFVVTAVATDSRAVGELAGIAVGATVMLNILVAGPSSGASM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + +WIY VAPT GA+ G  +Y+L++LQ    +P
Sbjct  242  NPVRTLGPAVAAGNYRA-VWIYMVAPTLGALGGAAIYKLVQLQEHEAEP  289



>ref|NP_001274996.1| probable aquaporin NIP5-1-like [Solanum tuberosum]
 gb|AFD96389.1| nodulin 26-like intrinsic protein [Solanum tuberosum]
Length=296

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 147/224 (66%), Gaps = 3/224 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA + L V++V+ S
Sbjct  60   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNGAE-SLIGNAACSGLAVMIVILS  118

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP Y+ AQV  S+ A+ + + ++       +T 
Sbjct  119  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSASICASFALKGVFHPFMSGGVTV  178

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SG SM
Sbjct  179  PSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGASM  238

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQG  106
            NP R+LGPA+A+ ++ S LWIY VAPT GA+AG  +Y L++L+G
Sbjct  239  NPVRTLGPAVAAGNYKS-LWIYLVAPTLGAIAGAAVYTLVKLRG  281



>ref|XP_002874623.1| hypothetical protein ARALYDRAFT_911337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50882.1| hypothetical protein ARALYDRAFT_911337 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 147/229 (64%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +GGSM
Sbjct  188  PSVGVGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGGSM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LW+Y VAPT GA+AG  +Y  ++L      P
Sbjct  248  NPVRTLGPAVASGNYRS-LWVYLVAPTLGAIAGAAVYTGVKLNDSVTDP  295



>ref|XP_002264957.2| PREDICTED: aquaporin NIP1-1 [Vitis vinifera]
 emb|CBI30735.3| unnamed protein product [Vitis vinifera]
Length=282

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 144/222 (65%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE LGTY L+F  C  +         V L   +    L V+V+V+S+G ISGAH
Sbjct  45   FVQKLIAEVLGTYFLIFAGCAAVVVNSDKDSVVTLPGISIVWGLVVMVMVYSVGHISGAH  104

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM-MTRPLHGCNA  397
             NP+VT+AFA+   FPW +VP Y++AQV GS  A+ + RLI+  + +H   T P      
Sbjct  105  FNPAVTIAFATCKRFPWKQVPAYVVAQVIGSTLASGTLRLIFNGKQDHFPGTLPAGSDLQ  164

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSLG
Sbjct  165  SFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPARSLG  224

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S ++   +WIY +APT GA++G ++Y ++R   +T KP
Sbjct  225  PAIVSNTYRG-IWIYLLAPTCGAISGAWVYNIIR---FTDKP  262



>gb|KDP21151.1| hypothetical protein JCGZ_21622 [Jatropha curcas]
Length=275

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIIS---NMQLMGVQVGLLEYAATASLTVIVVVFSIGPIS  583
            F+++M+AE  GTY L+F  C  ++   N   +    G+   +    L V+V+V+S+G IS
Sbjct  41   FMQKMIAEVAGTYFLIFAGCTAVAVNLNFDKVVTHPGI---SIVWGLAVMVLVYSVGHIS  97

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VTLAFA+   FPW +VP YI+ QV GS  A  + RLI+  + +H + T P   
Sbjct  98   GAHFNPAVTLAFATCKRFPWKQVPAYIVCQVIGSTLAAGTIRLIFTGKQDHFVGTMPAGS  157

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPAR
Sbjct  158  NMQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVIFAGPISGASMNPAR  217

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI S  F   LWIY V+PT GA AG ++Y ++R   +T KP
Sbjct  218  SLGPAIVSCKFKG-LWIYLVSPTLGAQAGAWVYNMIR---YTDKP  258



>ref|XP_010529699.1| PREDICTED: probable aquaporin NIP5-1 [Tarenaya hassleriana]
Length=304

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 146/229 (64%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDVSLSRKLGAEFVGTFILIFAATAGPIVNQKYNGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  188  PSVGIGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + +WIY VAPT GAVAG  +Y  ++L      P
Sbjct  248  NPVRTLGPAVAAGNYKA-IWIYLVAPTLGAVAGAAVYTGVKLSDSEADP  295



>ref|XP_002453573.1| hypothetical protein SORBIDRAFT_04g008360 [Sorghum bicolor]
 gb|EES06549.1| hypothetical protein SORBIDRAFT_04g008360 [Sorghum bicolor]
Length=287

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 143/222 (64%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            FI++++AE  GTY L+F  CG ++       Q+     A    L V+V+V+++G ISGAH
Sbjct  46   FIQKIIAEIFGTYFLMFAGCGAVTINASKNGQITFPGVAIVWGLAVMVMVYAVGHISGAH  105

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM-MTRPLHGCNA  397
             NP+VT AFA+ G FPW ++P Y++AQ+ G+V A+ + RL++G  +EH   T P      
Sbjct  106  FNPAVTFAFATSGRFPWRQLPAYVLAQMLGAVLASGTLRLMFGGRHEHFPGTLPTGSDVQ  165

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +  +E + TF ++F+ S +++D +  G+LAG  VG  I L VLI+GPVSG SMNPARS+G
Sbjct  166  SLVIEIITTFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPVSGASMNPARSVG  225

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+ S  + S +W+Y V P  GAVAG + Y L+R   +T KP
Sbjct  226  PALVSGEYRS-IWVYVVGPLVGAVAGAWAYNLIR---FTNKP  263



>ref|XP_007139574.1| hypothetical protein PHAVU_008G041100g [Phaseolus vulgaris]
 gb|ESW11568.1| hypothetical protein PHAVU_008G041100g [Phaseolus vulgaris]
Length=324

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 139/213 (65%), Gaps = 1/213 (0%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F R++ AE +GTY+LVF   G      +   +V  L  +  A L V V+++SIG ISGAH
Sbjct  76   FSRKVFAEVIGTYLLVFVGSGSAGLSVIDESRVSKLAASLAAGLIVTVLIYSIGHISGAH  135

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+V+LAFA++  FPWP++PFY+ AQ+ GS+ A+ + R ++    E   T P      A
Sbjct  136  MNPAVSLAFAAVRHFPWPQLPFYVAAQLTGSISASYTLRELFQPSNEIGGTSPAGSHIQA  195

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E + T+ ++F++ ++++D   TG+L+G  VG  + +  +++GP+SGGSMNPAR+LGP
Sbjct  196  LIMEMVTTYTMVFISMAVATDTNATGQLSGVAVGCSVSISSIVAGPISGGSMNPARTLGP  255

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            AIA+ S+   LW+YFV P TGA+   + Y ++R
Sbjct  256  AIATSSYK-GLWLYFVGPITGAILAAWSYNVIR  287



>ref|XP_002867962.1| hypothetical protein ARALYDRAFT_492953 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44221.1| hypothetical protein ARALYDRAFT_492953 [Arabidopsis lyrata subsp. 
lyrata]
Length=295

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 150/230 (65%), Gaps = 14/230 (6%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE+LGTY LVF  C  ++ NMQ   V V L   A    LT++V+++S+G ISGA
Sbjct  52   FLQKLIAESLGTYFLVFTGCASVVVNMQNDNV-VTLPGIAIVWGLTIMVLIYSLGHISGA  110

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE--------HMMT  421
            HINP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++++         + +
Sbjct  111  HINPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHDVCSGKHDVFIGS  170

Query  420  RPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGS  241
             P+     AF +EF+ TF ++F+ S +++D +  G+LAG  +G  + L VLI+ PVS  S
Sbjct  171  SPVGSDLQAFVMEFIVTFYLMFIISGVATDNRAIGELAGLAIGSTVLLNVLIAAPVSSAS  230

Query  240  MNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            MNP RSLGPA+    +   +WIY VAPT GA+AG ++Y  +R   +T KP
Sbjct  231  MNPGRSLGPAMVYGCYKG-IWIYIVAPTLGAIAGAWVYNTVR---YTDKP  276



>ref|XP_011101921.1| PREDICTED: aquaporin NIP1-1-like [Sesamum indicum]
Length=282

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 144/232 (62%), Gaps = 8/232 (3%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVV  604
            C F  I    FI++++AEALGTY L+F  C  +         V L   +    L V+V+V
Sbjct  38   CGFLTI---PFIQKIIAEALGTYFLIFAGCAAVVVNADKDKVVTLPGISIVWGLVVMVMV  94

Query  603  FSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM  424
            +S+G ISGAH NP+VT+AFA+   FPW +VP YI AQV  +  A+ + RL++   ++H  
Sbjct  95   YSVGHISGAHFNPAVTIAFATCKRFPWKQVPAYIAAQVLAATLASGTLRLLFKGRHDHFA  154

Query  423  -TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSG  247
             T P      +  VEF+ TF ++F+ S +++D +  G+LAG  VG  I L V+ +GP+SG
Sbjct  155  GTLPTGSDVQSLVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVMFAGPISG  214

Query  246  GSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
             SMNPARSLGPAI S ++   LWIY + PT GA+AG ++Y ++R   +T KP
Sbjct  215  ASMNPARSLGPAIVSSNYRG-LWIYMLGPTAGAIAGAWVYNIIR---FTDKP  262



>ref|XP_002522274.1| Aquaporin NIP1.1, putative [Ricinus communis]
 gb|EEF40132.1| Aquaporin NIP1.1, putative [Ricinus communis]
Length=271

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 145/227 (64%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F+++++AE +GTY L+F  C  ++ N+    V V L   +    L V+V+V+S+G 
Sbjct  33   FSVPFMQKLIAEMVGTYFLIFAGCTSVAVNLNFDKV-VTLPGISIVWGLAVMVLVYSVGH  91

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPL  412
            ISGAH NP+VTLAFA+   FPW +VP YI  QV GS  A  + RLI+  + +H   T P 
Sbjct  92   ISGAHFNPAVTLAFATCKRFPWKQVPAYIACQVIGSTLAAGTIRLIFTGKQDHFTGTMPA  151

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNP
Sbjct  152  GSDMQSFVVEFIITFYLMFIISGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNP  211

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPAI S  +   LWIY V+PT GA AG ++Y ++R   +T KP
Sbjct  212  ARSLGPAIVSHKYKG-LWIYIVSPTLGAQAGAWVYNMIR---YTDKP  254



>emb|CDO96878.1| unnamed protein product [Coffea canephora]
Length=284

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 148/242 (61%), Gaps = 7/242 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE  GTY L+F  CG +    +    +     +    L V+VVV+S+G ISGAH
Sbjct  47   FMQKLIAEIAGTYFLIFAGCGAVVINAVRNNTITAPGISIVWGLAVMVVVYSVGHISGAH  106

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA-  397
            +NP+VT+AFA+   FPW +VP YI AQV GS+ A+ + RL++    +H      +G +  
Sbjct  107  LNPAVTIAFATCKRFPWKQVPAYISAQVLGSILASGTLRLLFNGHQDHFSGTLPNGSDVQ  166

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSLG
Sbjct  167  SLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPARSLG  226

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD--ASPNTPLHNNYNNP  43
            PAI S  + S LW+Y + PT GA+ G ++Y ++R   +T KP        + L N   N 
Sbjct  227  PAIVSSKYKS-LWVYILGPTAGAIGGAWVYNIIR---FTDKPLREITKSGSFLKNAARNN  282

Query  42   SN  37
            SN
Sbjct  283  SN  284



>ref|XP_011009650.1| PREDICTED: aquaporin NIP1-2-like [Populus euphratica]
 ref|XP_011010920.1| PREDICTED: aquaporin NIP1-2-like [Populus euphratica]
Length=276

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 144/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F+++++AE  GTY L+F  C  ++ N+    V V L   + T  L V+V+V+S+G 
Sbjct  38   FSVPFMQKLLAEIAGTYFLIFAGCSSVAVNLNFDKV-VTLPGISLTWGLAVMVLVYSVGH  96

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLH  409
            ISGAH NP+VTLAFA+   FPW +VP Y+  QV GS  A  + RL++  + +H       
Sbjct  97   ISGAHFNPAVTLAFATCKRFPWKQVPAYVACQVIGSTLAAGTIRLLFQGDQDHFTGTLPA  156

Query  408  GCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
            G N  +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNP
Sbjct  157  GSNLQSFVVEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNP  216

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPAI S  +   LWIY V+P  GA AG ++Y L+R   +T KP
Sbjct  217  ARSLGPAIVSHQYKG-LWIYIVSPILGAQAGAWVYNLMR---YTDKP  259



>ref|XP_004496427.1| PREDICTED: probable aquaporin NIP5-1-like [Cicer arietinum]
Length=297

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +++ AE +GT+IL++    G I N +  G +  L+  AA A LTV+ ++ SIG ISGAH+
Sbjct  71   QKIGAEFVGTFILIYAATAGPIVNNKYNGAE-SLMGNAACAGLTVMFIILSIGHISGAHL  129

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA+   FPW  VP YI AQV  S+ A  + +++Y       +T P      AF
Sbjct  130  NPSLTIAFAAFRHFPWAHVPAYIAAQVSASICACYALKVVYHPFLTGGVTVPTVSIGQAF  189

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +LISGP SGGSMNP R+LGPA
Sbjct  190  ATEFIITFILLFVVTAVATDTRAVGELAGIAVGATVLLNILISGPTSGGSMNPVRTLGPA  249

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA  82
            +A+ ++   +WIY VAPT GA+AG  +Y L++L+     PA +
Sbjct  250  VAAGNYK-HIWIYLVAPTLGALAGSGVYTLVKLRDNEANPAQS  291



>ref|XP_004302297.1| PREDICTED: aquaporin NIP1-2-like [Fragaria vesca subsp. vesca]
Length=271

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 140/222 (63%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE LGTY L+F  CG +         V     A    L V+V+++S+G ISGAH
Sbjct  37   FMQKVIAEVLGTYFLIFAGCGAVVVNLNTDKTVSSPGIAIVWGLVVMVMIYSVGHISGAH  96

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FP  +VP Y++AQV GS  A+ + RLI+    +H   T P      
Sbjct  97   FNPAVTIAFATTKRFPLKQVPPYVVAQVLGSTLASGTLRLIFNNHQDHFAGTSPNGTPLQ  156

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSLG
Sbjct  157  SFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNPARSLG  216

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  +  +LWIY VAPT GAV G  +Y ++R   +T KP
Sbjct  217  PAIVSSHYK-NLWIYLVAPTLGAVCGALVYNVIR---FTDKP  254



>ref|XP_003621222.1| Aquaporin NIP2-1 [Medicago truncatula]
 gb|AES77440.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=274

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 148/239 (62%), Gaps = 3/239 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F +++ AE +GTY+LVF   G  +   +   +V  L  +      V V++++IG ISGAH
Sbjct  35   FSKKVFAEVIGTYLLVFVGSGAAAMNSIDENKVSKLGASLAGGFIVTVMIYAIGHISGAH  94

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+V+LAFA++  FPW +VPFYI AQ+ G++ A+ + R++     +   T P      A
Sbjct  95   MNPAVSLAFATVKHFPWKQVPFYIAAQLTGAISASYTLRVLLEPSKQLGATSPSGSNIQA  154

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E + TF ++F+++++++D + TG+LAG  VG  + +  +++GP+SGGSMNPAR+LGP
Sbjct  155  LIIEIVTTFTMVFISTAVATDSKATGELAGVAVGSSVTIASIVAGPISGGSMNPARTLGP  214

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNNYNNPSN  37
            AIA+ S+   +WIY V P TGA+ G + Y  + +Q    K   A+  +PL    +N  N
Sbjct  215  AIATSSYK-GIWIYMVGPITGALLGAWSY--VVIQETDHKQDLATSQSPLSVKIHNEMN  270



>gb|ADK56129.1| nodulin 26-like intrinsic protein [Fragaria chiloensis]
Length=271

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 140/222 (63%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AEALGTY L+F  CG +         V     A    L V+V+++S+G ISG H
Sbjct  37   FMQKVIAEALGTYFLIFAGCGAVVVNLNTDKTVSSPGIAIVWGLVVMVMIYSVGHISGGH  96

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FP  +VP Y++AQV GS  A+ + RLI+    +H   T P      
Sbjct  97   FNPAVTIAFATTKRFPLKQVPPYVVAQVLGSTLASGTLRLIFNNHQDHFAGTSPNGTPLQ  156

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSLG
Sbjct  157  SFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNPARSLG  216

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  +  +LWIY VAPT GAV G  +Y ++R   +T KP
Sbjct  217  PAIVSSHYK-NLWIYLVAPTLGAVCGALVYNVIR---FTDKP  254



>ref|XP_002518973.1| Nodulin-26, putative [Ricinus communis]
 gb|EEF43506.1| Nodulin-26, putative [Ricinus communis]
Length=298

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 147/229 (64%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  GV+  L+  AA A L V++++ S
Sbjct  63   FPAPDISLTRKLGAEFVGTFILIFAATAGPIVNQKYNGVET-LIGNAACAGLAVMIIILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  182  PSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y  ++L+     P
Sbjct  242  NPVRTLGPAVAAGNYRA-LWIYLVAPTLGAIAGAGTYSAVKLREEEVDP  289



>emb|CAA68906.1| NLM1 protein (NodLikeMip1) [Arabidopsis thaliana]
Length=279

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 149/230 (65%), Gaps = 14/230 (6%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE LGTY LVF  C  ++ NMQ   V V L   A    LT++V+++S+G ISGA
Sbjct  36   FLQKLIAEFLGTYFLVFTGCASVVVNMQNDNV-VTLPGIAIVWGLTIMVLIYSLGHISGA  94

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE--------HMMT  421
            HINP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++++         + +
Sbjct  95   HINPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHDVCSGKHDVFIGS  154

Query  420  RPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGS  241
             P+     AF +EF+ TF ++F+ S +++D +  G+LAG  +G  + L VLI+ PVS  S
Sbjct  155  SPVGSDLQAFTMEFIVTFYLMFIISGVATDNRAIGELAGLAIGSTVLLNVLIAAPVSSAS  214

Query  240  MNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            MNP RSLGPA+    +   +WIY VAPT GA+AG ++Y  +R   +T KP
Sbjct  215  MNPGRSLGPALVYGCYKG-IWIYLVAPTLGAIAGAWVYNTVR---YTDKP  260



>ref|XP_007143584.1| hypothetical protein PHAVU_007G084000g [Phaseolus vulgaris]
 gb|ESW15578.1| hypothetical protein PHAVU_007G084000g [Phaseolus vulgaris]
Length=299

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 145/225 (64%), Gaps = 3/225 (1%)
 Frame = -3

Query  762  NKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            N    +++ AE +GT+IL+F    G I N +  GV+  L+  AA A LTV+ ++ SIG I
Sbjct  68   NVSLTQKVGAEFVGTFILIFAATAGPIVNNKYNGVET-LMGNAACAGLTVMFIILSIGHI  126

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHG  406
            SGAH+NPS+T+AFA+   FPW  VP YI AQV  S+ A  + + +Y       +T P   
Sbjct  127  SGAHLNPSLTIAFAAFRHFPWTHVPAYIAAQVSASICACFALKGVYHPFLSGGVTVPSVS  186

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               AF  EF+ TFI+LF+ +++++D +  G++AG  VG  + L +LISGP SGGSMNP R
Sbjct  187  VGQAFATEFIITFILLFVVTAVATDTRAVGEMAGIAVGATVLLNILISGPTSGGSMNPVR  246

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +LGPA+A+ ++   +WIY VAPT GA+AG  +Y L++L+    +P
Sbjct  247  TLGPAVAAGNYK-HIWIYLVAPTLGALAGAGVYTLVKLRDNEAEP  290



>ref|NP_567572.1| aquaporin NIP1-1 [Arabidopsis thaliana]
 sp|Q8VZW1.1|NIP11_ARATH RecName: Full=Aquaporin NIP1-1; AltName: Full=NOD26-like intrinsic 
protein 1-1; Short=AtNIP1;1; AltName: Full=Nodulin-26-like 
major intrinsic protein 1; Short=NodLikeMip1; Short=Protein 
NLM1; Contains: RecName: Full=Aquaporin NIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAL36152.1| putative nodulin-26 protein [Arabidopsis thaliana]
 gb|AAM51272.1| putative nodulin-26 protein [Arabidopsis thaliana]
 gb|AAM61066.1| nodulin-26-like protein [Arabidopsis thaliana]
 gb|AEE84127.1| aquaporin NIP1-1 [Arabidopsis thaliana]
Length=296

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 149/230 (65%), Gaps = 14/230 (6%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE LGTY LVF  C  ++ NMQ   V V L   A    LT++V+++S+G ISGA
Sbjct  53   FLQKLIAEFLGTYFLVFTGCASVVVNMQNDNV-VTLPGIAIVWGLTIMVLIYSLGHISGA  111

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE--------HMMT  421
            HINP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++++         + +
Sbjct  112  HINPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHDVCSGKHDVFIGS  171

Query  420  RPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGS  241
             P+     AF +EF+ TF ++F+ S +++D +  G+LAG  +G  + L VLI+ PVS  S
Sbjct  172  SPVGSDLQAFTMEFIVTFYLMFIISGVATDNRAIGELAGLAIGSTVLLNVLIAAPVSSAS  231

Query  240  MNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            MNP RSLGPA+    +   +WIY VAPT GA+AG ++Y  +R   +T KP
Sbjct  232  MNPGRSLGPALVYGCYKG-IWIYLVAPTLGAIAGAWVYNTVR---YTDKP  277



>ref|NP_193626.1| NOD26-like intrinsic protein 1;2 [Arabidopsis thaliana]
 sp|Q8LFP7.2|NIP12_ARATH RecName: Full=Aquaporin NIP1-2; AltName: Full=NOD26-like intrinsic 
protein 1-2; Short=AtNIP1;2; AltName: Full=Nodulin-26-like 
major intrinsic protein 2; Short=NodLikeMip2; Short=Protein 
NLM2; Contains: RecName: Full=Aquaporin NIP1-2, N-terminally 
processed [Arabidopsis thaliana]
 emb|CAA16748.1| major intrinsic protein (MIP)-like [Arabidopsis thaliana]
 emb|CAB78893.1| major intrinsic protein (MIP)-like [Arabidopsis thaliana]
 emb|CAC14597.1| aquaglyceroporin [Arabidopsis thaliana]
 gb|AAL62372.1| major intrinsic protein (MIP)- like [Arabidopsis thaliana]
 gb|AAN15415.1| major intrinsic protein (MIP)- like [Arabidopsis thaliana]
 gb|AEE84106.1| NOD26-like intrinsic protein 1;2 [Arabidopsis thaliana]
Length=294

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 146/229 (64%), Gaps = 12/229 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G ISGAH
Sbjct  50   FLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAH  109

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM---TR  418
             NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H +   T 
Sbjct  110  FNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTL  169

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVSG SM
Sbjct  170  PSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASM  229

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+  +S    LWIY V+P  GAV+G ++Y ++R   +T KP
Sbjct  230  NPGRSLGPAMV-YSCYRGLWIYIVSPIVGAVSGAWVYNMVR---YTDKP  274



>ref|XP_010434480.1| PREDICTED: aquaporin NIP1-2-like [Camelina sativa]
Length=289

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 147/233 (63%), Gaps = 12/233 (5%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G I
Sbjct  41   FSVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHI  100

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H + 
Sbjct  101  SGAHFNPAVTIAFASSGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVF  160

Query  423  --TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ISGPVS
Sbjct  161  VGTLPSGTNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIISGPVS  220

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNP RSLGPA+  +S    LWIY V+P  GAV+G ++Y  +R   +T KP
Sbjct  221  GASMNPGRSLGPALV-YSCYKGLWIYMVSPILGAVSGAWVYNTVR---YTDKP  269



>ref|XP_003592016.1| Aquaporin NIP3-1 [Medicago truncatula]
 ref|XP_003592038.1| Aquaporin NIP3-1 [Medicago truncatula]
 gb|AES62267.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=300

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 144/222 (65%), Gaps = 3/222 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
              +++ AE +GT+IL++    G I N +  GV+  L+  AA A LTV+ ++ SIG ISGA
Sbjct  72   LTQKIGAEFVGTFILIYAATAGPIVNNKYNGVET-LMGNAACAGLTVMFIILSIGHISGA  130

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPS+T+AFA+   FPW  VP YI AQV  S+ A  + + +Y       +T P      
Sbjct  131  HLNPSLTIAFAAFRHFPWAHVPAYIAAQVSASICACYALKGVYHPFLSGGVTVPTVSVGQ  190

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF  EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +LISGP SGGSMNP R+LG
Sbjct  191  AFATEFIITFILLFVVTAVATDSRAVGELAGIAVGATVLLNILISGPTSGGSMNPVRTLG  250

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+A+ ++   LWIY VAPT GA+AG  +Y L++L+    +P
Sbjct  251  PAVAAGNYK-HLWIYLVAPTLGALAGSGVYTLIKLRDNGAEP  291



>ref|XP_002870013.1| hypothetical protein ARALYDRAFT_492969 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46272.1| hypothetical protein ARALYDRAFT_492969 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 146/229 (64%), Gaps = 12/229 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G ISGAH
Sbjct  54   FLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAH  113

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM---TR  418
             NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H +   T 
Sbjct  114  FNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTL  173

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVSG SM
Sbjct  174  PSGSDLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASM  233

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+  +S    LWIY V+P  GAV+G ++Y ++R   +T KP
Sbjct  234  NPGRSLGPAMV-YSCYRGLWIYIVSPIVGAVSGAWVYNMVR---YTDKP  278



>ref|XP_010455436.1| PREDICTED: probable aquaporin NIP5-1 isoform X2 [Camelina sativa]
Length=304

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 146/229 (64%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDISLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +GGSM
Sbjct  188  PSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGGSM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LWIY VAPT GA+AG  +Y  ++L      P
Sbjct  248  NPVRTLGPAVASGNYRS-LWIYLVAPTLGAIAGAAVYTGVKLNDSETDP  295



>gb|AGE09576.1| NOD-like protein [Eucalyptus cladocalyx]
Length=227

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 143/219 (65%), Gaps = 3/219 (1%)
 Frame = -3

Query  744  EMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++ AE +GT+IL+F    G I N +    +  L+  AA A L V++++ S G ISGAH+N
Sbjct  2    QLGAEFVGTFILIFAATAGPIVNQKYTNSET-LIGNAACAGLAVMIIILSTGHISGAHLN  60

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            PS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T P  G   AF 
Sbjct  61   PSLTIAFAALRHFPWTQVPAYIAAQVSASICASFALKGVFHPYMSGGVTLPTVGHGQAFA  120

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LGPA+
Sbjct  121  LEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAV  180

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            A+ ++ + LWIY VAPT GA+AG   Y +++L+     P
Sbjct  181  AAGNYRA-LWIYLVAPTLGALAGAGAYTVVKLRDDETDP  218



>ref|XP_010449446.1| PREDICTED: aquaporin NIP1-2-like [Camelina sativa]
Length=295

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 147/233 (63%), Gaps = 12/233 (5%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G I
Sbjct  47   FSVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHI  106

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H + 
Sbjct  107  SGAHFNPAVTIAFASSGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVF  166

Query  423  --TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVS
Sbjct  167  VGTLPSGTNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVS  226

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNP RSLGPA+  +S    LWIY V+PT GAV G ++Y  +R   +T KP
Sbjct  227  GASMNPGRSLGPALV-YSCYKGLWIYMVSPTLGAVLGAWVYNTVR---YTDKP  275



>ref|XP_002440774.1| hypothetical protein SORBIDRAFT_09g006390 [Sorghum bicolor]
 gb|EES19204.1| hypothetical protein SORBIDRAFT_09g006390 [Sorghum bicolor]
Length=283

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 143/228 (63%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+F+  F+++++AE LGTY L+F  C  ++     G  V          L V+V+V+S+G
Sbjct  43   PMFSVPFVQKIVAEVLGTYFLIFAGCAAVAVNLRTGGTVTFPGICIVWGLAVMVMVYSVG  102

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRP  415
             ISGAH+NP+V++AFA+ G FPW +VP Y  AQV G+  A+++ RL++G   EH   T P
Sbjct  103  HISGAHLNPAVSVAFATCGRFPWKQVPAYAAAQVMGATAASLTLRLLFGNAREHFFGTVP  162

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  +  +EF+ +F ++F+ S +++D +  G+LAG  VG  + L VL +GPVSG SMN
Sbjct  163  AGSDVQSLVIEFIISFNLMFVVSGVATDNRAIGELAGLAVGATVLLNVLFAGPVSGASMN  222

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR+LGPAI    + + +W+YF  P  G VAG + Y L+R   +T KP
Sbjct  223  PARTLGPAIVVGRY-AGIWVYFAGPICGTVAGAWAYNLIR---FTDKP  266



>ref|XP_010094419.1| putative aquaporin NIP5-1 [Morus notabilis]
 gb|EXB56000.1| putative aquaporin NIP5-1 [Morus notabilis]
Length=298

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  N    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  62   FPAPNVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNGAET-LIGNAACAGLAVMIVILS  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI+AQV GS+ A+   + ++       +T 
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWAHVPGYIVAQVSGSICASFLLKAVFHPFMSGGVTV  180

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ +F +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSM
Sbjct  181  PTTSDGQAFVLEFVISFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPASGGSM  240

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LWI+ VAPT GA+AG   Y  ++L+
Sbjct  241  NPVRTLGPAVAAGNYRA-LWIFMVAPTLGALAGAATYTTVKLR  282



>gb|EYU31217.1| hypothetical protein MIMGU_mgv1a010890mg [Erythranthe guttata]
Length=298

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 144/221 (65%), Gaps = 3/221 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            F + +    R++ AE +GT+IL+F      I N +  G +  L+  AA A L V++V+ S
Sbjct  63   FAVPDISLTRKLGAEFVGTFILIFGATAAPIVNQKYAGSET-LIGNAACAGLAVMIVILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP +G SM
Sbjct  182  PSVGNGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGASM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            NPARSLGPAIA+ ++ S +WIY VAPT GAV+G   Y L+R
Sbjct  242  NPARSLGPAIAAGNYKS-IWIYIVAPTLGAVSGATTYSLIR  281



>ref|XP_004309493.1| PREDICTED: probable aquaporin NIP5-1-like [Fragaria vesca subsp. 
vesca]
Length=301

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 144/224 (64%), Gaps = 3/224 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  65   FPSPDVSLTRKIGAEFVGTFILMFAATAGPIVNQKYNGAE-SLIGNAACAGLGVMIVILS  123

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA L  FPW +VP YI AQV  S+ A  + + +Y       +T 
Sbjct  124  TGHISGAHLNPSLTIAFACLRHFPWTQVPAYIAAQVSASICACFALKGVYHPYMSGGVTV  183

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSM
Sbjct  184  PSVSDGQAFALEFIITFNLLFVVTAVATDTRAVGELAGLAVGATVMLNILIAGPSSGGSM  243

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQG  106
            NP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y  ++LQG
Sbjct  244  NPVRTLGPAVAAGNYRA-LWIYLVAPTLGALAGAGTYTAVKLQG  286



>ref|XP_009774307.1| PREDICTED: nodulin-26-like [Nicotiana sylvestris]
Length=347

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE +GTY+L+F  C  I+ N+    V V L   A+   L V+V+++S+G +SGA
Sbjct  45   FVQKLIAELVGTYMLIFAGCAAIVLNINKDNV-VTLPGIASVWGLVVMVLIYSVGHVSGA  103

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+AFAS   FPW +VP YI+ QV GS  A+ S RLI+ G E + + T P     
Sbjct  104  HFNPAVTIAFASCKRFPWNQVPAYILVQVIGSTLASGSLRLIFNGKEDQFVGTVPAGTNM  163

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF +EF+ATF ++F+ S +++D +     +G  +G  + L +L SGP++G SMNPARSL
Sbjct  164  QAFILEFIATFYLMFVISGVATDDRAMKHFSGVAIGATVSLDILFSGPLTGASMNPARSL  223

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL  112
            GPAI +  +   LWIY + PT GA+ G + Y L+RL
Sbjct  224  GPAIVTGHYKG-LWIYIIGPTLGAIFGAWTYNLMRL  258



>ref|XP_011083233.1| PREDICTED: probable aquaporin NIP5-1 [Sesamum indicum]
Length=300

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
              R++ AE +GT+IL+F      I N +  G +  L+  AA A L V++V+ S G ISGA
Sbjct  72   LTRKLGAEFVGTFILIFGATAAPIVNQKYNGAET-LIGNAACAGLAVMIVILSTGHISGA  130

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T P      
Sbjct  131  HLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTVPSVTTGQ  190

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LG
Sbjct  191  AFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLG  250

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            PA+A+ ++ S +WIY VAPT GAVAG  +Y L++L+
Sbjct  251  PAVAAGNYKS-IWIYLVAPTLGAVAGAAIYTLVKLR  285



>ref|XP_010054000.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
 gb|KCW78377.1| hypothetical protein EUGRSUZ_D02548 [Eucalyptus grandis]
Length=294

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 146/229 (64%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +    +  L+  AA A L V++++ S
Sbjct  59   FPAPDISLTRKLGAEFVGTFILIFAATAGPIVNQKYTNSET-LIGNAACAGLAVMIIILS  117

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  118  TGHISGAHLNPSLTIAFAALRHFPWTQVPAYIAAQVSASICASFALKGVFHPYMSGGVTL  177

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  178  PTVSHGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  237

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y +++L+     P
Sbjct  238  NPVRTLGPAVAAGNYRA-LWIYLVAPTLGALAGAGTYTVVKLRDDETDP  285



>gb|AHJ09606.1| aquaporin protein 25 [Camellia sinensis]
Length=282

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 138/222 (62%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            FI++++AE LGTY L+F  C  +         V     +    L V+V+V+S+G I GAH
Sbjct  43   FIQKVIAEVLGTYFLIFTGCAAVVVDAASNNAVSHAGVSVVWGLVVMVMVYSVGHIPGAH  102

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FPW +VP Y+ AQ+ GS  A+ + RLI+     H   T P      
Sbjct  103  FNPAVTIAFATCKRFPWKQVPAYLAAQILGSTLASGTLRLIFSGTQNHFAGTLPTGSDMQ  162

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  I L V+ +GP+SG SMNPARSLG
Sbjct  163  SFVLEFVITFYLMFVISGVATDNRAIGELAGLAVGSTILLNVMFAGPISGASMNPARSLG  222

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  +   +WIY VAPT GAVAG ++Y ++R   +T KP
Sbjct  223  PAIVSSQYKG-IWIYLVAPTCGAVAGAWVYNIIR---FTDKP  260



>ref|XP_003571857.1| PREDICTED: aquaporin NIP1-1 [Brachypodium distachyon]
Length=280

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 143/222 (64%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE  GTY L+F  CG ++       Q+     A    L V+V+++++G ISGAH
Sbjct  41   FVQKIIAEIFGTYFLIFAGCGAVTINASRNGQITFPGVAIVWGLAVMVMIYAVGHISGAH  100

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM-MTRPLHGCNA  397
             NP+VT AFA++G FPW +VP Y++AQ+ G+  A+ + RL++G  +EH   T P      
Sbjct  101  FNPAVTFAFATVGRFPWRQVPAYVLAQMLGATLASGTLRLMFGGRHEHFPGTLPGGSEVQ  160

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +  +EF+ TF ++F+ S +++D +  G+LAG  VG  I L VLI+GP+SG SMNPAR++G
Sbjct  161  SLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPISGASMNPARTVG  220

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+    + S +W+Y V P  GAVAG + Y L+R   +T KP
Sbjct  221  PALVGSEYRS-IWVYVVGPVAGAVAGAWSYNLIR---FTNKP  258



>ref|XP_010437147.1| PREDICTED: probable aquaporin NIP5-1 [Camelina sativa]
Length=304

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 145/229 (63%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L+SGP +G SM
Sbjct  188  PSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVSGPSTGASM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LWIY VAPT GA+AG  +Y  ++L      P
Sbjct  248  NPVRTLGPAVASGNYRS-LWIYLVAPTLGAIAGAAVYTGVKLNDSETDP  295



>ref|XP_009605352.1| PREDICTED: nodulin-26-like [Nicotiana tomentosiformis]
Length=347

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE +GTY+L+F  C  I+ N+    V V L   A+   L V+V+++S+G +SGA
Sbjct  45   FVQKLIAELVGTYMLIFAGCAAIVLNINKDNV-VTLPGIASVWGLVVMVLIYSVGHVSGA  103

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+AFAS   FPW +VP YI+ QV GS  A+ S RLI+ G E + + T P     
Sbjct  104  HFNPAVTIAFASCKRFPWNQVPTYILVQVIGSTLASGSLRLIFNGKEDQFVGTVPAGTNM  163

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             A  +EF+ATF ++F+ S +++D +    L+G  +G  + L +L SGP++G SMNPARSL
Sbjct  164  QALVLEFIATFYLMFVISGVATDDRAMKHLSGVAIGATVSLDILFSGPLTGASMNPARSL  223

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL  112
            GPAI +  +   LWIY + PT GA+ G + Y L+RL
Sbjct  224  GPAIVTGHYKG-LWIYIIGPTLGAIFGAWTYNLMRL  258



>ref|XP_002305717.2| hypothetical protein POPTR_0004s06160g [Populus trichocarpa]
 gb|EEE86228.2| hypothetical protein POPTR_0004s06160g [Populus trichocarpa]
Length=276

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 142/223 (64%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE  GTY L+F  C  ++ N+    V V L   + T  L V+V+V+S+G ISGA
Sbjct  42   FMQKLVAEIAGTYFLIFAGCSSVAVNLNFDKV-VTLPGISITWGLAVMVLVYSVGHISGA  100

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VTLAFA+   FPW +VP Y+  QV G+  A  + RL++  + +H   T P     
Sbjct  101  HFNPAVTLAFATCKRFPWKQVPAYVACQVIGATLAAGTIRLLFQGDQDHFTGTMPAGSNL  160

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSL
Sbjct  161  QSFVVEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNPARSL  220

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  +   LWIY V+P  GA AG ++Y L+R   +T KP
Sbjct  221  GPAIVSHQYKG-LWIYIVSPILGAQAGAWVYNLIR---YTDKP  259



>ref|XP_008239293.1| PREDICTED: probable aquaporin NIP5-1 [Prunus mume]
Length=298

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 148/238 (62%), Gaps = 8/238 (3%)
 Frame = -3

Query  804  INCKKWICSF-----FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLE  643
            +N + W  S      FP       R++ AE +GT+IL+F    G I N +  G +  L+ 
Sbjct  47   VNARTWGQSHTCFTDFPTPTVSLTRKLGAEFVGTFILMFAASAGPIVNQKYNGAET-LIG  105

Query  642  YAATASLTVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVS  463
             AA A L V++V+ S G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV GS+ A+ +
Sbjct  106  NAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSGSICASFA  165

Query  462  SRLIYGVEYEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvci  283
             +  +        T P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  +
Sbjct  166  LKGAFHPYMSGGTTVPTVSTGQAFALEFIITFNLLFVVTAVATDTRALGELAGLAVGATV  225

Query  282  glgvlISGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
             L +LI+GP SGGSMNP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y  ++L+
Sbjct  226  MLNILIAGPSSGGSMNPVRTLGPAVAAGNY-TKLWIYLVAPTLGALAGAGTYTAVKLR  282



>ref|XP_006397069.1| hypothetical protein EUTSA_v10028842mg [Eutrema salsugineum]
 gb|ESQ38522.1| hypothetical protein EUTSA_v10028842mg [Eutrema salsugineum]
Length=301

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 145/229 (63%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  66   FPAPGVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  124

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  125  TGHISGAHLNPSLTIAFAALRHFPWSHVPAYIAAQVSASICASFALKAVFHPFMSGGVTV  184

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ +FI+LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  185  PSSSIGQAFALEFIISFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  244

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  245  NPVRTLGPAVASGNYRS-LWVYLVAPTLGAISGAAVYTGVKLNDSEIDP  292



>ref|XP_002298990.1| hypothetical protein POPTR_0001s45920g [Populus trichocarpa]
 gb|EEE83795.1| hypothetical protein POPTR_0001s45920g [Populus trichocarpa]
Length=299

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 144/229 (63%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +    +  L+  AA A L V++++ S
Sbjct  64   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNNAET-LIGNAACAGLAVMIIILS  122

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  123  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  182

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  183  PSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  242

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+A+ ++  D+WIY VAPT GA+ G   Y  ++L+     P
Sbjct  243  NPVRSLGPAVAAGTYK-DIWIYLVAPTLGALVGAATYTAVKLREEEADP  290



>ref|XP_010439792.1| PREDICTED: aquaporin NIP1-2 [Camelina sativa]
Length=293

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 147/233 (63%), Gaps = 12/233 (5%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G I
Sbjct  45   FSVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHI  104

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H + 
Sbjct  105  SGAHFNPAVTIAFASSGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVF  164

Query  423  --TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVS
Sbjct  165  VGTLPSGTNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVS  224

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNP RSLGPA+  +S    LWIY V+P  GAV+G ++Y  +R   +T KP
Sbjct  225  GASMNPGRSLGPALV-YSCYKGLWIYMVSPILGAVSGAWVYNTVR---YTDKP  273



>ref|XP_004309621.1| PREDICTED: aquaporin NIP1-2-like [Fragaria vesca subsp. vesca]
Length=271

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 141/223 (63%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE LGTY L+F  CG +I N       V     A    L V+V+ +S+G ISGA
Sbjct  37   FMQKVIAEVLGTYFLIFAGCGAVIVNFN-TDKTVSSPAVAIVWGLVVMVLNYSVGHISGA  95

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VT+AFA+   FPW +V  YI AQV GS+ A+ + RLI+    +H + T P     
Sbjct  96   HFNPAVTIAFAATKRFPWKQVLPYIAAQVFGSILASGTLRLIFNHHEDHFVGTSPSGTQL  155

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             +F +EF+ TF ++F+ S +++D + TG+LAG  VG  I L V+ +GPV+G SMNPARSL
Sbjct  156  QSFVIEFIITFYLMFVVSGVATDNRATGELAGLAVGSTILLNVMFAGPVTGASMNPARSL  215

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI  WS    LWIY V+P  GA+ G  +Y ++R   +T KP
Sbjct  216  GPAIV-WSQYKGLWIYLVSPILGALCGALVYNVIR---FTDKP  254



>ref|XP_010499739.1| PREDICTED: aquaporin NIP3-1 [Camelina sativa]
Length=323

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 142/227 (63%), Gaps = 9/227 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++ E +GT+ ++F  C  I   +  G  V L   A    LTV+V+++SIG
Sbjct  35   PLISVSFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLTVMVMIYSIG  94

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-------  433
             +SGAH NP+V++AFAS   FP+ +VP YI AQV GS  A  + RL++ +          
Sbjct  95   HVSGAHFNPAVSIAFASSKRFPFNQVPGYIAAQVLGSTLAAATLRLVFNLNDNVCSLKGD  154

Query  432  -HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
             ++ T P +    +F +EF+ATF ++F+ S++++D + TG  AG  +G  + L +L SGP
Sbjct  155  VYVGTYPSNSNTTSFIMEFIATFNLMFVISAVATDKRATGSFAGIAIGATVVLDILFSGP  214

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            +SG SMNPARSLGPA+  W    DLW+Y V+P  GA++G + Y +LR
Sbjct  215  ISGASMNPARSLGPALI-WGCYKDLWLYIVSPIIGALSGAWTYDMLR  260



>ref|XP_009128716.1| PREDICTED: probable aquaporin NIP5-1 [Brassica rapa]
 emb|CDY25253.1| BnaA02g22030D [Brassica napus]
Length=301

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 143/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S G ISGAH+
Sbjct  75   RKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILSTGHISGAHL  133

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T P      AF
Sbjct  134  NPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKAVFHPFMSGGVTVPSVSVGQAF  193

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
             +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LGPA
Sbjct  194  ALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPA  253

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  254  LASGNYRS-LWVYLVAPTLGAISGAAVYTGVKLNDSATDP  292



>ref|XP_010478611.1| PREDICTED: aquaporin NIP3-1-like [Camelina sativa]
Length=324

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 142/227 (63%), Gaps = 9/227 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++ E +GT+ ++F  C  I   +  G  V L   A    LTV+V+++SIG
Sbjct  36   PLVSVSFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLTVMVMIYSIG  95

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-------  433
             +SGAH NP+V++AFAS   FP+ +VP YI AQV GS  A  + RL++ +          
Sbjct  96   HVSGAHFNPAVSIAFASSKRFPFNQVPGYIAAQVLGSTLAAATLRLVFNLNDNVCSLKGD  155

Query  432  -HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
             ++ T P +    +F +EF+ATF ++F+ S++++D + TG  AG  +G  + L +L SGP
Sbjct  156  VYVGTYPSNSNTTSFIMEFIATFNLMFVISAVATDKRATGSFAGVAIGATVVLDILFSGP  215

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            +SG SMNPARSLGPA+  W    DLW+Y V+P  GA++G + Y +LR
Sbjct  216  ISGASMNPARSLGPALI-WGCYKDLWLYIVSPIIGALSGAWTYDMLR  261



>emb|CDX94261.1| BnaC02g29210D [Brassica napus]
Length=301

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 143/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S G ISGAH+
Sbjct  75   RKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILSTGHISGAHL  133

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T P      AF
Sbjct  134  NPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKAVFHPFMSGGVTVPSVSVGQAF  193

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
             +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LGPA
Sbjct  194  ALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPA  253

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  254  LASGNYRS-LWVYLVAPTLGAISGAAVYTGVKLNDSATDP  292



>ref|XP_007209472.1| hypothetical protein PRUPE_ppa010013mg [Prunus persica]
 gb|EMJ10671.1| hypothetical protein PRUPE_ppa010013mg [Prunus persica]
Length=267

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 147/238 (62%), Gaps = 8/238 (3%)
 Frame = -3

Query  804  INCKKWICSF-----FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLE  643
            +N   W  S      FP       R++ AE +GT+IL+F    G I N +  G +  L+ 
Sbjct  16   VNAPTWGQSHTCFTDFPTPTVSLTRKLGAEFVGTFILMFAASAGPIVNQKYNGAET-LIG  74

Query  642  YAATASLTVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVS  463
             AA A L V++V+ S G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV GS+ A+ +
Sbjct  75   NAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSGSICASFA  134

Query  462  SRLIYGVEYEHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvci  283
             +  +        T P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  +
Sbjct  135  LKGAFHPYMSGGTTVPTVSTGQAFALEFIITFNLLFVVTAVATDTRALGELAGLAVGATV  194

Query  282  glgvlISGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
             L +LI+GP SGGSMNP R+LGPA+A+ ++ + LW+Y VAPT GA+AG   Y  ++L+
Sbjct  195  MLNILIAGPSSGGSMNPVRTLGPAVAAGNY-TKLWVYLVAPTLGALAGAGTYTAVKLR  251



>ref|NP_192776.1| putative aquaporin NIP5-1 [Arabidopsis thaliana]
 sp|Q9SV84.1|NIP51_ARATH RecName: Full=Probable aquaporin NIP5-1; AltName: Full=NOD26-like 
intrinsic protein 5-1; Short=AtNIP5;1; AltName: Full=Nodulin-26-like 
major intrinsic protein 6; Short=NodLikeMip6; 
Short=Protein NLM6 [Arabidopsis thaliana]
 emb|CAB39791.1| major intrinsic protein (MIP)-like [Arabidopsis thaliana]
 emb|CAB78161.1| major intrinsic protein (MIP)-like [Arabidopsis thaliana]
 gb|AAM65102.1| major intrinsic protein (MIP)-like protein [Arabidopsis thaliana]
 gb|ABO09890.1| At4g10380 [Arabidopsis thaliana]
 gb|AEE82874.1| putative aquaporin NIP5-1 [Arabidopsis thaliana]
Length=304

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 146/229 (64%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTI  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +GGSM
Sbjct  188  PSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGGSM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  248  NPVRTLGPAVASGNYRS-LWVYLVAPTLGAISGAAVYTGVKLNDSVTDP  295



>gb|EYU28128.1| hypothetical protein MIMGU_mgv1a011383mg [Erythranthe guttata]
Length=283

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 142/223 (64%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            FI++++AE LGTY L+F  C  ++ N     V V L   +    L V+V+V+S+G ISGA
Sbjct  45   FIQKIIAETLGTYFLIFAGCASVVVNSDKEKV-VTLPGISIVWGLAVMVMVYSVGHISGA  103

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VT+AFA+   FPW +VP Y+ AQV GS  A+ + RL++   ++H   T P     
Sbjct  104  HFNPAVTIAFATCKRFPWKQVPAYVSAQVVGSTLASGTLRLLFSGTHDHFAGTLPTGSDV  163

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             +  VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARSL
Sbjct  164  QSLVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPARSL  223

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  +   +WIY + P  GA++G ++Y ++R   +T KP
Sbjct  224  GPAIVSTHYKG-IWIYLLGPIAGAISGAWVYNIIR---FTNKP  262



>gb|KFK28559.1| hypothetical protein AALP_AA7G012100 [Arabis alpina]
Length=293

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 150/234 (64%), Gaps = 14/234 (6%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F++++MAE LGTY L+F  C  ++ N Q   V V L   AA   LTV+V+V+S+G 
Sbjct  45   FSVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHEKV-VTLPGIAAVWGLTVMVLVYSLGH  103

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM  424
            ISGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + R ++G++ +     H +
Sbjct  104  ISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAATTLRFLFGLDQDVCSGKHDV  163

Query  423  ---TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPV  253
               T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GP+
Sbjct  164  FVGTLPSGSDLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPI  223

Query  252  SGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SG SMNP RSLGPA+  +S    LWIY V+P  GAV+G ++Y  +R   +T KP
Sbjct  224  SGASMNPGRSLGPAMV-FSCYRGLWIYIVSPILGAVSGAWVYNTVR---YTDKP  273



>ref|XP_007159494.1| hypothetical protein PHAVU_002G242300g [Phaseolus vulgaris]
 gb|ESW31488.1| hypothetical protein PHAVU_002G242300g [Phaseolus vulgaris]
Length=272

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 143/226 (63%), Gaps = 7/226 (3%)
 Frame = -3

Query  762  NKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            N  F ++++AE +GTY L+F  C  ++ N     V V L   +    L V V+V+S+G I
Sbjct  31   NVFFWQKLVAEVVGTYFLIFAGCASVVVNKSKENV-VTLPGISIVWGLVVTVLVYSVGHI  89

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLH  409
            SGAH NP+VT+AFAS   FPW +VP Y++AQV GS+ A+ + RLI+ G E +   T P  
Sbjct  90   SGAHFNPAVTIAFASTKRFPWKQVPVYVLAQVVGSILASGTLRLIFTGNENQFPGTLPSG  149

Query  408  GCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPA  229
                AF VEF+ TF ++F+ S +++D +  G+LAG  +G  + L V+++GP++G SMNPA
Sbjct  150  THAQAFVVEFIITFFLMFVISGVATDNRAIGELAGIAIGATVLLNVMLAGPITGASMNPA  209

Query  228  RSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            RSLGPA+    F   +WIY V+PT GA  G ++Y  +R   +T KP
Sbjct  210  RSLGPALVHNEFRG-IWIYLVSPTFGAFVGAWVYNSIR---YTDKP  251



>ref|XP_011039373.1| PREDICTED: aquaporin NIP1-2-like [Populus euphratica]
 ref|XP_011039374.1| PREDICTED: aquaporin NIP1-2-like [Populus euphratica]
Length=278

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 144/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F+++++AE +GTY L+F  C  ++ N+    V V L   +    L V+V+V+S+G 
Sbjct  40   FSVPFMQKLVAEIVGTYFLIFAGCSSVAVNLNFEKV-VTLPGISIVWGLAVMVLVYSLGH  98

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPL  412
            ISGAH NP+VTLAFA+   FPW +VP YI  QV GS  A  + RLI+  + +H   T P 
Sbjct  99   ISGAHFNPAVTLAFATCKRFPWKQVPAYISCQVIGSTLAAGTIRLIFQGKQDHFTGTMPA  158

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNP
Sbjct  159  GSDLQSFVVEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNP  218

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPA+ S  +   LWIY V+P  GA AG ++Y L+R   +T KP
Sbjct  219  ARSLGPAMVSHEYRG-LWIYVVSPILGAQAGAWVYNLIR---YTDKP  261



>ref|XP_010058835.1| PREDICTED: aquaporin NIP1-1-like [Eucalyptus grandis]
 gb|KCW73717.1| hypothetical protein EUGRSUZ_E02327 [Eucalyptus grandis]
Length=267

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 142/223 (64%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            FI++++AE  GTY L+F  CG ++ N+    V V L   +    L V+V+V+S+G ISGA
Sbjct  37   FIQKLIAEVFGTYFLIFAGCGSVAVNLDNEKV-VTLPGISMVWGLAVMVLVYSVGHISGA  95

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VT+AFA+   FPW +V  YI AQV GS  A  + RL++  +  H + T+P     
Sbjct  96   HFNPAVTIAFATCRRFPWNQVLPYITAQVIGSTLACGTLRLLFTGKLNHFLGTQPAGSDV  155

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF  EF+ TF ++F+ S + +D +  G+ AG  VG  + L VL +GP++G SMNPARSL
Sbjct  156  QAFVFEFIITFYLMFIVSGVGTDNRAIGEFAGLAVGATVLLNVLFAGPITGASMNPARSL  215

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  + + LWIY VAP  GA++G ++Y L+R   +T KP
Sbjct  216  GPAIVSHHY-AKLWIYIVAPIVGAISGAWVYNLMR---FTDKP  254



>ref|XP_010461016.1| PREDICTED: aquaporin NIP3-1-like [Camelina sativa]
Length=323

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 143/227 (63%), Gaps = 9/227 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++ E +GT+ ++F  C  I   +  G  V L   A    LTV+V+++SIG
Sbjct  35   PLVSVSFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLTVMVMIYSIG  94

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-------  433
             +SGAH NP+V++AFAS   FP+ +VP YI AQV GS  A  + RL++ +          
Sbjct  95   HVSGAHFNPAVSIAFASSKRFPFNQVPGYIAAQVLGSTLAAGTLRLVFNLNDNVCSLKGD  154

Query  432  -HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
             ++ T P +    +F +EF+ATF ++F+ S++++D + TG  AG  +G  + L +L SGP
Sbjct  155  VYVGTYPSNSNTTSFIMEFIATFNLMFVISAVATDKRATGSFAGIAIGATVVLDILFSGP  214

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            +SG SMNPARSLGPA+  W   +DLW+Y V+P  GA++G + Y +LR
Sbjct  215  ISGASMNPARSLGPALI-WGCYNDLWLYIVSPIIGALSGAWTYDMLR  260



>ref|XP_009389176.1| PREDICTED: probable aquaporin NIP5-1 [Musa acuminata subsp. malaccensis]
Length=296

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 141/216 (65%), Gaps = 3/216 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
              R++ AE +GT+IL+F      I N +  G +  L+  AA A L V++V+ S G ISGA
Sbjct  68   LTRKLGAEFVGTFILIFGATAAPIVNQKYNGAET-LIGNAACAGLAVMIVILSTGHISGA  126

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPS+T+AFA L  FPW  VP YI+AQV  S+ A+ + + ++       +T P      
Sbjct  127  HLNPSLTIAFAMLRHFPWAHVPAYILAQVSASICASFALKAVFHPFLSGGVTVPSVSSPQ  186

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF++EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LG
Sbjct  187  AFFIEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLG  246

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            PA+A+ +++  +WIY VAPT GAV G  +Y  ++L+
Sbjct  247  PAVAAGNYE-RIWIYLVAPTAGAVTGAAVYTAVKLK  281



>ref|XP_009360260.1| PREDICTED: probable aquaporin NIP5-1 [Pyrus x bretschneideri]
Length=298

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 144/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  62   FPTPTVSLTRKLGAEFVGTFILMFAASAGPIVNQKYNGAE-SLIGNAACAGLGVMIVILS  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + I+       +T 
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGIFHPYMSGGVTV  180

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSM
Sbjct  181  PTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAGLAVGATVMLNILIAGPSSGGSM  240

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y  ++L+
Sbjct  241  NPVRTLGPAVAAGNY-TKLWIYLVAPTLGALAGAATYTAVKLR  282



>ref|XP_010058378.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=228

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 142/219 (65%), Gaps = 3/219 (1%)
 Frame = -3

Query  744  EMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++ AE +GT+ LV C + G I N +  G +  LL  AA A L V+++VFSIG ISGAH+N
Sbjct  2    QVGAEFVGTFFLVLCAVGGPIVNQKYNGAET-LLGNAACAGLAVMIIVFSIGHISGAHLN  60

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            PSVT+A A +  FPW +VP YI AQV GS+ A+   + ++       +T P      AF 
Sbjct  61   PSVTVALAVIWHFPWIQVPGYIAAQVAGSMCASYVLKGVFHPFANGGVTVPSVDIGQAFA  120

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            +EFLATFI+ F+  ++ +D +  G LAG  +G  + LGVL++G  +GGS+NP R+LGPA+
Sbjct  121  LEFLATFILAFVIVAVVTDTRAVGDLAGIAIGATVLLGVLVTGMPTGGSLNPVRTLGPAV  180

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            A+ ++   LW+Y VAP  GA+AG   Y+ ++L+G+  +P
Sbjct  181  AAGNYKG-LWMYMVAPPLGAIAGAVTYKAVKLRGYEAEP  218



>ref|XP_008437497.1| PREDICTED: probable aquaporin NIP5-1 [Cucumis melo]
Length=298

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  GV+  L+  AA A L V++V+ S
Sbjct  63   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNGVET-LIGNAACAGLAVMIVILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  182  PSVSTGQAFALEFIITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LW+Y VAPT GA+ G   Y  ++L+
Sbjct  242  NPVRTLGPAVAAGNYRA-LWVYLVAPTLGAIIGAGTYTAVKLR  283



>ref|XP_010554965.1| PREDICTED: aquaporin NIP2-1-like [Tarenaya hassleriana]
Length=266

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 147/237 (62%), Gaps = 6/237 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F R+++AE + TY+LVF  CG  +  +    +V  L  +    L V V+++++G +SGAH
Sbjct  31   FHRKVIAEIIATYMLVFVTCGSAAISESDEHKVSKLGASVAGGLVVTVMIYAVGHVSGAH  90

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA-  397
            +NP+VTLAFA++  FPW +VP Y  AQ+ GS+ A  + R++     +H+ T    G +  
Sbjct  91   MNPAVTLAFAAVRHFPWKQVPVYAAAQLAGSISAAATLRVLLH-PIKHVGTTTPSGSDVQ  149

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            A  +E + TF ++F+ S++++D +  G+LAG  VG  + +  +++GPVSGGSMNPAR++G
Sbjct  150  ALIMEIVVTFSMMFITSAVATDTRAVGELAGIAVGSAVCITSILAGPVSGGSMNPARTIG  209

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNNYNN  46
            PAIAS  +   LW+Y V P  G ++G + Y L+R+   T KP  A     L ++ +N
Sbjct  210  PAIASTCYKG-LWVYIVGPVVGTLSGAYCYSLIRV---TDKPVPAIECMNLKHDCSN  262



>ref|XP_004145889.1| PREDICTED: probable aquaporin NIP5-1-like [Cucumis sativus]
 ref|XP_004166374.1| PREDICTED: probable aquaporin NIP5-1-like [Cucumis sativus]
 gb|KGN49946.1| hypothetical protein Csa_5G146190 [Cucumis sativus]
Length=298

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  GV+  L+  AA A L V++V+ S
Sbjct  63   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYNGVET-LIGNAACAGLAVMIVILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  182  PSVSIGQAFALEFIITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LW+Y VAPT GA+ G   Y  ++L+
Sbjct  242  NPVRTLGPAVAAGNYKA-LWVYLVAPTLGAIIGAGTYTAVKLR  283



>ref|XP_004960601.1| PREDICTED: aquaporin NIP1-3-like [Setaria italica]
Length=281

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 142/228 (62%), Gaps = 5/228 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+F+  F+++++AE  GTY L+F  C  ++     G  V          L V+V+V+S+G
Sbjct  41   PMFSVPFVQKIIAEIFGTYFLIFAGCAAVAVNLRTGGTVTFPGICIVWGLAVMVMVYSVG  100

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRP  415
             ISGAH+NP+V++AFA+ G FPW +VP Y  AQV GS  A+++ RL++G   EH   T P
Sbjct  101  HISGAHLNPAVSVAFATCGRFPWRQVPAYAAAQVMGSTAASLTLRLLFGNAREHFFGTVP  160

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  +  +E + +F ++F+ S +++D +  G+LAG  +G  + L VL +GP+SG SMN
Sbjct  161  AGSDVQSLVIELIISFNLMFVVSGVATDNRAIGELAGLAIGATVLLNVLFAGPISGASMN  220

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAR+LGPAI +  + + +W+YF  P  G VAG + Y L+R   +T KP
Sbjct  221  PARTLGPAIVAGRY-AGIWVYFAGPILGTVAGAWAYNLIR---FTDKP  264



>ref|XP_007216752.1| hypothetical protein PRUPE_ppa024808mg, partial [Prunus persica]
 gb|EMJ17951.1| hypothetical protein PRUPE_ppa024808mg, partial [Prunus persica]
Length=222

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 141/222 (64%), Gaps = 9/222 (4%)
 Frame = -3

Query  735  AEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPSV  559
            AE +GT+ILVF    G I N +  GV+  LL  AA + L V+VV+ S G ISGAH+NPSV
Sbjct  3    AEFVGTFILVFSAAAGPIVNEKYHGVET-LLGNAACSGLAVMVVILSTGHISGAHLNPSV  61

Query  558  TLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWVEF  379
            TLAFA+   FPW +VP YI+ QV  S+ A+ + + ++       +T P      AF +EF
Sbjct  62   TLAFATFRHFPWSQVPLYIIVQVSASISASFALKGVFHPFMSGGVTVPSVTHGQAFSLEF  121

Query  378  LATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIASW  199
            + TFI++F  +++++D +  G++AG  +G  + L +L++GP +GGSMNP R+LGPAIA+ 
Sbjct  122  IVTFILMFTITAVATDTRAVGEMAGVAIGATVLLDILVAGPTTGGSMNPIRTLGPAIAAG  181

Query  198  SFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPN  73
            ++   LWIY VAPT GA+AG   Y  ++L      P +  PN
Sbjct  182  NYKG-LWIYLVAPTFGALAGAAAYTTVKL------PDNKPPN  216



>ref|XP_008356814.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=298

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 144/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  62   FPTPTVSLTRKLGAEFVGTFILMFAASAGPIVNQKYNGAE-SLIGNAACAGLGVMIVILS  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + I+       +T 
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGIFHPYISGGVTV  180

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSM
Sbjct  181  PTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAGLAVGATVMLNILIAGPSSGGSM  240

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y  ++L+
Sbjct  241  NPVRTLGPAVAAGNY-TKLWIYLVAPTLGALAGAATYTAVKLR  282



>ref|XP_006431151.1| hypothetical protein CICLE_v10012382mg [Citrus clementina]
 gb|ESR44391.1| hypothetical protein CICLE_v10012382mg [Citrus clementina]
Length=287

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 144/225 (64%), Gaps = 6/225 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+R+++AE + TY+LVF  CG  +       +V  L  +    L V V+++++G ISGAH
Sbjct  40   FLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAH  99

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN-A  397
            +NP+VTLAFA++  FPW +VP Y  AQ+ G+V A+++ R++     +H+ T    G +  
Sbjct  100  MNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLH-PIKHIGTTSPSGSDLQ  158

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            A  +E + TF ++F+ S++++D +  G+LAG  VG  + +  +++GPVSGGSMNPAR++G
Sbjct  159  ALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVG  218

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA  82
            PAIAS SF   +W+Y V P TG   G + Y ++R    T KPA A
Sbjct  219  PAIAS-SFYKGIWVYLVGPVTGTFMGAWSYNMIR---ETDKPAHA  259



>ref|XP_006415281.1| hypothetical protein EUTSA_v10008205mg [Eutrema salsugineum]
 gb|ESQ33634.1| hypothetical protein EUTSA_v10008205mg [Eutrema salsugineum]
Length=323

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 140/227 (62%), Gaps = 9/227 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++ E +GT+ L+F  C  I   +  G  V L   A    LTV V+++SIG
Sbjct  35   PLVSVSFVQKLIGEFVGTFTLIFAGCSAIVVNETYGKPVTLPGIALVWGLTVTVMIYSIG  94

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-------  433
             +SGAH NP+V++AFAS   FP+ +VP YI AQV GS  A  + RL++ +          
Sbjct  95   HVSGAHFNPAVSIAFASSKKFPFKQVPAYIAAQVLGSTLAAAALRLVFHLNDNVCSLKGD  154

Query  432  -HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
             ++ T P +    +F +EF+ TF ++F+ +++++D + TG  AG  +G  + L +L+SGP
Sbjct  155  VYVGTYPSNSNTTSFVMEFITTFNLMFVIAAVATDKRATGSFAGVAIGATVVLDILMSGP  214

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            +SG SMNPARSLGPA   W    DLW+Y V+P  GA++G + Y +LR
Sbjct  215  ISGASMNPARSLGPAFI-WGCYKDLWLYIVSPVLGALSGAWTYDMLR  260



>ref|XP_010251728.1| PREDICTED: probable aquaporin NIP5-1 [Nelumbo nucifera]
Length=300

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 148/229 (65%), Gaps = 3/229 (1%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSI  595
            P  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V+VV+ S 
Sbjct  66   PTPDVSLTRKLGAEFVGTFILMFAATAGPIVNQKYNGAET-LIGNAACAGLGVMVVILST  124

Query  594  GPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRP  415
            G +SGAH+NPS+T+AFA    FPW +VP YI+AQV  S+ A+ + + ++       +T P
Sbjct  125  GHLSGAHLNPSLTIAFAVFRHFPWVQVPAYIVAQVSASICASFALKGVFHPYLSGGVTVP  184

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSMN
Sbjct  185  SVSHGQAFALEFIITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPSSGGSMN  244

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPA  88
            P R+LGPA+A+ ++ + LW+Y VAPT GAVAG  +Y L++L+    +P+
Sbjct  245  PVRTLGPAVAAGNYRA-LWVYLVAPTLGAVAGAGVYTLVKLREDEVEPS  292



>ref|XP_010058381.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=228

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 142/219 (65%), Gaps = 3/219 (1%)
 Frame = -3

Query  744  EMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++ AE +GT+ LV C + G I N +  G +  LL  AA A L V+++VFSIG ISGAH+N
Sbjct  2    QVGAEFVGTFFLVLCAVGGPIVNQKYNGAET-LLGNAACAGLAVMIIVFSIGHISGAHLN  60

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFW  388
            PSVT+A A +  FPW +VP YI AQV GS+ A+   + ++       +T P      AF 
Sbjct  61   PSVTVALAVIWHFPWIQVPGYIAAQVAGSMCASYVLKGVFHPFANGGVTVPSVDIGQAFA  120

Query  387  VEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAI  208
            +EFLATFI+ F+  ++ +D +  G LAG  +G  + LGVL++G  +GGS+NP R+LGPA+
Sbjct  121  LEFLATFILAFVIVAVVTDTRAVGDLAGIAIGATVLLGVLVTGMPTGGSLNPVRTLGPAV  180

Query  207  ASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            A+ ++   LW+Y VAP  GA+AG   Y+ ++L+G+  +P
Sbjct  181  AAGNYKG-LWMYMVAPPLGAIAGAVTYKAVKLRGYEVEP  218



>ref|XP_006482598.1| PREDICTED: aquaporin NIP2-1-like [Citrus sinensis]
Length=287

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 150/247 (61%), Gaps = 19/247 (8%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+R+++AE + TY+LVF  CG  +       +V  L  +    L V V+++++G ISGAH
Sbjct  40   FLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAH  99

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN-A  397
            +NP+VTLAFA++  FPW +VP Y  AQ+ G+V A+++ R++     +H+ T    G +  
Sbjct  100  MNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLH-PIKHIGTTSPSGSDLQ  158

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            A  +E + TF ++F+ S++++D +  G+LAG  VG  + +  +++GPVSGGSMNPAR++G
Sbjct  159  ALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVG  218

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA-SP------------  76
            PAIAS SF   +W+Y V P TG   G + Y ++R    T KPA A SP            
Sbjct  219  PAIAS-SFYKGIWVYLVGPVTGTFMGAWSYNMIR---ETDKPAHAISPGSLSFKLRRLKS  274

Query  75   NTPLHNN  55
            N   HNN
Sbjct  275  NEQAHNN  281



>ref|XP_006284229.1| hypothetical protein CARUB_v10005388mg [Capsella rubella]
 gb|EOA17127.1| hypothetical protein CARUB_v10005388mg [Capsella rubella]
Length=293

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 149/234 (64%), Gaps = 14/234 (6%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L+  A    LTV+V+V+S+G I
Sbjct  45   FSVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLVGIAIVWGLTVMVLVYSLGHI  104

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H + 
Sbjct  105  SGAHFNPAVTVAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVF  164

Query  423  --TRPLHGCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPV  253
              T P  G N  +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPV
Sbjct  165  VGTLP-SGTNWQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPV  223

Query  252  SGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SG SMNP RSLGPA+    +   +WIY V+P  GAV+G ++Y  +R   +T KP
Sbjct  224  SGASMNPGRSLGPAMVYGCYRG-IWIYIVSPILGAVSGAWVYNTVR---YTDKP  273



>ref|XP_002317387.2| hypothetical protein POPTR_0011s06770g [Populus trichocarpa]
 gb|EEE97999.2| hypothetical protein POPTR_0011s06770g [Populus trichocarpa]
Length=278

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 144/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F+++++AE +GTY L+F  C  ++ N+    V V L   +    L V+V+V+S+G 
Sbjct  40   FSVPFMQKLVAEIVGTYFLIFAGCSSVAVNLNFEKV-VTLPGISIVWGLAVMVLVYSLGH  98

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPL  412
            ISGAH NP+VTLAFA+   FPW +VP YI  QV GS  A  + RLI+  + +H   T P 
Sbjct  99   ISGAHFNPAVTLAFATCKRFPWKQVPAYISCQVIGSTLAAGTIRLIFQGKQDHFTGTMPA  158

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNP
Sbjct  159  GSDLQSFVVEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVMFAGPISGASMNP  218

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPA+ S  +   +WIY V+P  GA AG ++Y L+R   +T KP
Sbjct  219  ARSLGPAMVSHEYRG-IWIYVVSPILGAQAGAWVYNLIR---YTDKP  261



>ref|XP_002454982.1| hypothetical protein SORBIDRAFT_03g002490 [Sorghum bicolor]
 gb|EES00102.1| hypothetical protein SORBIDRAFT_03g002490 [Sorghum bicolor]
Length=271

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 145/225 (64%), Gaps = 9/225 (4%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE LGTY ++F  CG ++ N+   G  V      A   L V+V+V+S+G ISGA
Sbjct  34   FMQKIIAEVLGTYFMIFAGCGSVVVNLSTNGT-VTFPGICAVWGLVVMVLVYSVGHISGA  92

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYG--VEYEHMM-TRPLHG  406
            H NP+VT+AFA+ G FPW +VP Y +AQV GS  A+++ R+++G    +EH   T P   
Sbjct  93   HFNPAVTVAFATCGRFPWKQVPSYAVAQVLGSTLASLTLRVVFGGATAHEHFFGTAPSGT  152

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               A  +EF+ +F ++F+ S +++D +  G+LAG  VG  + L VL++GP++G SMNPAR
Sbjct  153  VAQAVVLEFVISFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVLVAGPITGASMNPAR  212

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +LGPAI +  + S +W+Y V P  G V G + Y L+R   +T KP
Sbjct  213  TLGPAIVAGRYRS-IWVYMVGPVCGTVTGAWAYNLVR---FTDKP  253



>ref|XP_009373676.1| PREDICTED: probable aquaporin NIP5-1 isoform X1 [Pyrus x bretschneideri]
Length=298

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  62   FPTPTVSLSRKVGAEFVGTFILMFAASAGPIVNQKYNGAE-SLIGNAACAGLGVMIVILS  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV GS+ A+ + + ++       +T 
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWVHVPAYIAAQVSGSICASFTLKGVFHPYMSGGVTL  180

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG C+ L +L++GP SGGSM
Sbjct  181  PTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAGLAVGACVMLNILMAGPSSGGSM  240

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LWIY VAPT GA+AG   Y  ++L+
Sbjct  241  NPVRTLGPAVAAGNY-TKLWIYLVAPTLGALAGAGTYTAVKLR  282



>ref|XP_004163347.1| PREDICTED: aquaporin NIP1-2-like [Cucumis sativus]
 gb|KGN49336.1| hypothetical protein Csa_6G520340 [Cucumis sativus]
Length=276

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 138/223 (62%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            FI++++AE +GTY L+F     ++ N+    V +     A    L V+V+V+S+G ISGA
Sbjct  39   FIQKLIAEVVGTYFLIFAGGASVVVNLSKDKV-ISFPGIAIVWGLVVMVMVYSVGHISGA  97

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VT+AFA+   FPW +VP Y+++QV GS  A  + RLI+    +H   T P     
Sbjct  98   HFNPAVTIAFATTKRFPWKQVPAYVISQVLGSTLAAGTLRLIFNGHQDHFSGTLPSDSYL  157

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
              F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPARSL
Sbjct  158  QTFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPITGASMNPARSL  217

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  F   LWIY VAP  GA+ G  +Y  +R   +T KP
Sbjct  218  GPAIVSRQFKG-LWIYIVAPIFGAITGALVYNTIR---FTDKP  256



>ref|XP_010274649.1| PREDICTED: probable aquaporin NIP-type [Nelumbo nucifera]
Length=275

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 143/222 (64%), Gaps = 6/222 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE +GTY ++F  CG ++  ++ G  V       T  L V+V+V+S+G ISGAH
Sbjct  42   FVQKLIAEVIGTYFVIFSGCGAVAVNKIYG-SVSFPGICITWGLVVMVMVYSVGHISGAH  100

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVE-YEHMMTRPLHGCNA  397
             NP+VT+ FA    FPW +VP YI+AQV GS  A+ + RL++ V+  ++  T P+     
Sbjct  101  FNPAVTITFAIFRRFPWKQVPLYIVAQVFGSTLASGTLRLLFTVKAVDYFGTVPVGSNFQ  160

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +  VE + TF+++F+ S +S+D +  G+L G  VG+ I L VL++GPVSG SMNPARS+G
Sbjct  161  SLVVEIIITFLLMFVISGVSTDDRAIGELGGVAVGMTILLNVLVAGPVSGASMNPARSIG  220

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+   +    LW+Y + P  GA+AG F Y LLR   +T KP
Sbjct  221  PALV-MNIYGGLWVYILGPIVGAIAGAFAYNLLR---FTDKP  258



>ref|XP_008348330.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=266

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 148/239 (62%), Gaps = 4/239 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGI-ISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
             +R++ AE +G++IL+F      I N +  G +  LL  AA A L V+ V+ S G ISGA
Sbjct  17   LLRKLGAEFVGSFILIFSAAAAPIVNQKYQGSET-LLGNAACAGLAVMAVILSTGHISGA  75

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPSVT+AFA+   FPW +VP YI+AQV  S+ A+ + + ++       +T P      
Sbjct  76   HLNPSVTIAFATFRHFPWTQVPLYIIAQVSASISASFALKGVFHPFMSGGVTVPSVSHCQ  135

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EF+ TFI++F  +S+++D +  G+LAG  +G  + L +L++GP +GGSMNP R+LG
Sbjct  136  AFALEFIVTFILMFTVTSVATDTRAVGELAGVAIGATVLLNILVAGPTTGGSMNPIRTLG  195

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNNYNNPS  40
            PA+A+ ++   LWIY VAPT GA+AG   Y  ++L     +   A   TPL   Y++ S
Sbjct  196  PAVAAGNYK-GLWIYLVAPTLGALAGAATYTAVKLPHNQIRD-KADGGTPLPQFYSDGS  252



>ref|XP_010421957.1| PREDICTED: probable aquaporin NIP5-1 [Camelina sativa]
Length=304

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 144/229 (63%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +G SM
Sbjct  188  PSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGASM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LWIY VAPT G +AG  +Y  ++L      P
Sbjct  248  NPVRTLGPAVASGNYRS-LWIYLVAPTLGGIAGAAVYTGVKLNDSETDP  295



>ref|XP_008380091.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=266

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 148/239 (62%), Gaps = 4/239 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGI-ISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
             +R++ AE +G++IL+F      I N +  G +  LL  AA A L V+ V+ S G ISGA
Sbjct  17   LLRKLGAEFVGSFILIFSAAAAPIVNQKYQGSET-LLGNAACAGLAVMAVILSTGHISGA  75

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPSVT+AFA+   FPW +VP YI+AQV  S+ A+ + + ++       +T P      
Sbjct  76   HLNPSVTIAFATFRHFPWTQVPLYIIAQVSASISASFALKGVFHPFMSGGVTVPSVSHCQ  135

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EF+ TFI++F  +S+++D +  G+LAG  +G  + L +L++GP +GGSMNP R+LG
Sbjct  136  AFALEFIVTFILMFTVTSVATDTRAVGELAGVAIGATVLLNILVAGPTTGGSMNPIRTLG  195

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNNYNNPS  40
            PA+A+ ++   LWIY VAPT GA+AG   Y  ++L     +   A   TPL   Y++ S
Sbjct  196  PAVAAGNYK-GLWIYLVAPTLGALAGAATYTAVKLPHNQIRD-KADGGTPLPQFYSDGS  252



>ref|XP_008225242.1| PREDICTED: aquaporin NIP1-1 [Prunus mume]
Length=281

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 137/222 (62%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE LGTY +VF  CG +         V     +    L V+V+V+S+G ISGAH
Sbjct  47   FMQKVIAEVLGTYFVVFAGCGAVVVNLSTDKTVSAPGISIVWGLVVMVMVYSVGHISGAH  106

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA    FPW +VP YI AQV GS  A+ + RLI+     H   T P      
Sbjct  107  FNPAVTIAFAITKRFPWKQVPAYIAAQVLGSTLASGTLRLIFQGHQNHFAGTLPTGNPWQ  166

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARS+G
Sbjct  167  SFAIEFVITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPARSIG  226

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  + + LW+Y  APT GAV G  +Y ++R   +T KP
Sbjct  227  PAIVSTQY-THLWVYIFAPTLGAVCGALVYNVIR---FTDKP  264



>ref|XP_009360304.1| PREDICTED: probable aquaporin NIP5-1 [Pyrus x bretschneideri]
Length=298

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 143/223 (64%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  62   FPTPTVSLTRKLGAEFVGTFILMFAASAGPIVNQKYNGAE-SLIGNAACAGLGVMIVILS  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + I+       +T 
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGIFHPYMSGGVTV  180

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSM
Sbjct  181  PTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAGLAVGATVMLNILIAGPSSGGSM  240

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A  ++ + LWIY VAPT GA+AG   Y  ++L+
Sbjct  241  NPVRTLGPAVALGNY-TKLWIYLVAPTRGALAGAATYTAVKLR  282



>ref|XP_006303503.1| hypothetical protein CARUB_v10010843mg [Capsella rubella]
 gb|EOA36401.1| hypothetical protein CARUB_v10010843mg [Capsella rubella]
Length=325

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 140/227 (62%), Gaps = 9/227 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++ E +GT+ ++F  C  I   +  G  V L   A    LTV ++++SIG
Sbjct  35   PLVSVSFVQKLIGEFVGTFSMIFAGCSAIVVNETYGKPVTLPGIALVWGLTVTIMIYSIG  94

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-------  433
             +SGAH NP+V++AFAS   FP+ +VP YI AQV GS  A  + RL++ +          
Sbjct  95   HVSGAHFNPAVSIAFASSKKFPFNQVPGYIAAQVLGSTLAAAALRLVFHLNDNVCSLKGD  154

Query  432  -HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
             ++ T P +    +F +EF+ TF ++F+ S++++D + TG  AG  +G  + L +L SGP
Sbjct  155  VYVGTYPSNSTTTSFVMEFITTFNLMFVISAVATDKRATGSFAGIAIGATVVLDILFSGP  214

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            +SG SMNPARSLGPA+  W    DLW+Y V+P  GA++G + Y LLR
Sbjct  215  ISGASMNPARSLGPALI-WGCYKDLWLYIVSPVIGALSGAWTYDLLR  260



>ref|NP_001266068.1| aquaporin NIP2-1-like [Cicer arietinum]
 emb|CAG34223.1| nod26-like major intrinsic protein [Cicer arietinum]
Length=273

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 139/213 (65%), Gaps = 1/213 (0%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F R+++AE +GTY+LVF   G  +   +   +V  L  +      V V++++IG ISGAH
Sbjct  30   FPRKVLAEVIGTYLLVFVGSGSAAMNAIDENKVSKLGASMAGGFIVTVMIYAIGHISGAH  89

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+V+LAFA++  FPW +VPFYI AQ+ G++ A+ + +++     +   T P      A
Sbjct  90   MNPAVSLAFATVSHFPWKQVPFYIAAQLTGAISASYTLKVLLEPSKQLGATSPSGSNIQA  149

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E + TF ++ +++++S+DP+  G+L+G  VG  + +  +++GP+SGGSMNPAR+LGP
Sbjct  150  LIIEIVTTFTMVLISTAVSTDPKAIGELSGVAVGSSVCIASIVAGPISGGSMNPARTLGP  209

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            AIA+ S+   +W+Y V P TGA+ G + Y +++
Sbjct  210  AIATSSYKG-IWVYMVGPITGALLGTWSYVVIQ  241



>ref|XP_007025281.1| NOD26-like intrinsic protein 1,2 isoform 2 [Theobroma cacao]
 gb|EOY27903.1| NOD26-like intrinsic protein 1,2 isoform 2 [Theobroma cacao]
Length=277

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 142/226 (63%), Gaps = 5/226 (2%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  CG +         V L   +    L V+V+V+S+G I
Sbjct  36   FSVPFMQKLMAEVLGTYFLIFAGCGSVVVNVNNEKVVSLPGISMVWGLAVMVLVYSVGHI  95

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHG  406
            SGAH NP+VT+AFA+   FP  +VP YI AQV GS  A  + RL++   ++        G
Sbjct  96   SGAHFNPAVTIAFATCKRFPLKQVPAYISAQVLGSTLAAGTLRLLFNGTHDVFFGTSPQG  155

Query  405  CN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPA  229
             +  AF +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPA
Sbjct  156  SDLQAFVMEFIITFYLMFIISGVATDNRAIGELAGLAVGATVLLNVMFAGPITGASMNPA  215

Query  228  RSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            RSLGPAI S ++   +WIY  +PT GAV+G ++Y ++R   +T KP
Sbjct  216  RSLGPAIVSNNYKG-IWIYLTSPTLGAVSGAWVYNMVR---YTDKP  257



>ref|XP_008360732.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
 ref|XP_008360733.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=298

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 148/226 (65%), Gaps = 9/226 (4%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++V+ S
Sbjct  62   FPTPTVSLSRKVGAEFVGTFILMFAASAGPIVNQKYNGAE-SLIGNAACAGLGVMIVILS  120

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM---  427
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV GS+ A+ +   + GV + +M   
Sbjct  121  TGHISGAHLNPSLTIAFAALRHFPWLHVPAYIAAQVLGSICASFT---LKGVLHPYMSGG  177

Query  426  MTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSG  247
            +T P      AF +EF+ TF +LF+ +++++D +  G+LAG  VG C+ L +L++GP SG
Sbjct  178  VTVPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAGLAVGACVMLNILMAGPSSG  237

Query  246  GSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            GSMNP R+LGPAIA+ ++ + LWIY VAPT GAVAG   Y  ++L+
Sbjct  238  GSMNPVRTLGPAIAAGNY-TKLWIYLVAPTLGAVAGAGTYTAVKLR  282



>ref|XP_008439707.1| PREDICTED: aquaporin NIP1-1 [Cucumis melo]
 gb|ADN34021.1| aquaporin [Cucumis melo subsp. melo]
Length=276

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 138/223 (62%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCI-CGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            FI++++AE +GTY L+F     ++ N+    V +     +    L V+V+V+S+G ISGA
Sbjct  39   FIQKLIAEIVGTYFLIFAGGASVVVNLSKDKV-ITFPGISIVWGLVVMVMVYSVGHISGA  97

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VT+AFA+   FPW +VP Y+M+QV GS  A  + RLI+    +H   T P     
Sbjct  98   HFNPAVTIAFATTKRFPWKQVPAYVMSQVLGSTLAAGTLRLIFNGHEDHFSGTLPSDSYL  157

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
              F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPARSL
Sbjct  158  QTFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMFAGPITGASMNPARSL  217

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  F   LWIY VAP  GA+ G  +Y  +R   +T KP
Sbjct  218  GPAIVSRQFKG-LWIYIVAPIFGAITGALVYNTIR---FTDKP  256



>ref|XP_006288313.1| hypothetical protein CARUB_v10001558mg [Capsella rubella]
 gb|EOA21211.1| hypothetical protein CARUB_v10001558mg [Capsella rubella]
Length=304

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 145/229 (63%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  69   FPSPDVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  127

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T 
Sbjct  128  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  187

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +G SM
Sbjct  188  PSVSIGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGASVMLNILVAGPSTGASM  247

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  248  NPVRTLGPAVASGNYRS-LWLYLVAPTLGAISGAAVYTGVKLNDTETDP  295



>ref|XP_006449563.1| hypothetical protein CICLE_v10016171mg [Citrus clementina]
 gb|ESR62803.1| hypothetical protein CICLE_v10016171mg [Citrus clementina]
Length=283

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 143/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F++++MAE LGTY ++F  C  ++ N+    + V L   +    L V+V+V+S+G 
Sbjct  45   FSVPFMQKLMAEILGTYFMIFAGCAAVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGH  103

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLH  409
            ISGAH NPSVT+A A+   FPW +VP YI+ QV GS  A  + RL++  + +        
Sbjct  104  ISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFAGTLPA  163

Query  408  GCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
            G N  AF +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNP
Sbjct  164  GSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMFAGPITGASMNP  223

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPAI S  +   LWIY VAP  GA AG ++Y ++R   +T KP
Sbjct  224  ARSLGPAIVSSQYKG-LWIYIVAPPLGATAGAWVYNMVR---YTDKP  266



>ref|XP_002324057.1| hypothetical protein POPTR_0017s11960g [Populus trichocarpa]
 gb|EEF04190.1| hypothetical protein POPTR_0017s11960g [Populus trichocarpa]
Length=278

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 140/227 (62%), Gaps = 4/227 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+R+++AE + TY+LVF  CG  +       +V  L  +    L V V+++++G ISGAH
Sbjct  31   FLRKVVAEVIATYLLVFVTCGAAAISASDEHKVSKLGASVAGGLIVTVMIYAVGHISGAH  90

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+VT AFA++  FPW +VPFY  AQ+ G++ A+ + +++         T P      A
Sbjct  91   MNPAVTTAFAAVLNFPWKQVPFYAAAQLTGAISASFTLKVLLHPIRNVGTTSPSGTAVQA  150

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E + TF ++F+ S++++D +  G+LAG  VG  + +  +++GPVSGGSMNPAR+LGP
Sbjct  151  LIMEIVVTFSMMFITSAVATDTKAVGELAGIAVGSAVCITSILAGPVSGGSMNPARTLGP  210

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPN  73
            AIAS  F   +W+Y + P TG + G + Y L+R+   T KP  A P 
Sbjct  211  AIASRYFKG-VWVYLLGPVTGTLLGAWSYNLIRV---TDKPVQAIPR  253



>ref|XP_009132304.1| PREDICTED: aquaporin NIP1-2-like [Brassica rapa]
Length=297

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 144/229 (63%), Gaps = 12/229 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G ISGAH
Sbjct  53   FLQKLMAEILGTYFLIFAGCASVAVNAQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAH  112

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM---TR  418
             NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H +   T 
Sbjct  113  FNPAVTIAFASSGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTL  172

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVSG SM
Sbjct  173  PAGSDLQSFVIEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASM  232

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+  ++    +WIY  +P  GAVAG ++Y  +R   +T KP
Sbjct  233  NPGRSLGPAMV-YNCYKGIWIYIASPILGAVAGAWVYNTVR---YTDKP  277



>ref|XP_006467589.1| PREDICTED: aquaporin NIP1-2-like [Citrus sinensis]
Length=284

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 143/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F++++MAE LGTY ++F  C  ++ N+    + V L   +    L V+V+V+S+G 
Sbjct  46   FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGH  104

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLH  409
            ISGAH NPSVT+A A+   FPW +VP YI+ QV GS  A  + RL++  + +        
Sbjct  105  ISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFAGTLPA  164

Query  408  GCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
            G N  AF +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNP
Sbjct  165  GSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMFAGPITGASMNP  224

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPAI S  +   LWIY VAP  GA AG ++Y ++R   +T KP
Sbjct  225  ARSLGPAIVSSQYKG-LWIYIVAPPLGATAGAWVYNMVR---YTDKP  267



>gb|KHG22884.1| putative aquaporin NIP5-1 -like protein [Gossypium arboreum]
Length=298

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 143/223 (64%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  LL  A  A L V++++ S
Sbjct  63   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYSGAET-LLGNATCAGLAVMIIILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+   FPW +VP YI AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAACRHFPWTQVPAYIAAQVSASICASFALKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSM
Sbjct  182  PSVSHGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LWIY +APT GAV G   Y L++L+
Sbjct  242  NPVRTLGPAVAAGNYRA-LWIYLIAPTLGAVIGSATYTLVKLR  283



>ref|XP_003568755.1| PREDICTED: aquaporin NIP1-3-like [Brachypodium distachyon]
Length=282

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 141/227 (62%), Gaps = 5/227 (2%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++AE  GTY L+F  C  ++  Q     V       T  L V+V+V+S+G
Sbjct  44   PMLSVQFVQKILAEIFGTYFLIFAGCAAVAVNQRTAGTVTFPGICITWGLAVMVMVYSVG  103

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPL  412
             ISGAH NP+VT AFA+ G FPW +VP Y  AQ+ GS  A ++ RL++G E+  + T P 
Sbjct  104  HISGAHFNPAVTFAFATCGRFPWKQVPAYAAAQLIGSTAAGLTLRLLFGREH-FVGTVPA  162

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 +  +EF+ TF ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMNP
Sbjct  163  GSDVQSLVLEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVLFAGPISGASMNP  222

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            AR+LGPA+ +  +   +W+Y V P  GAVAG + Y L+R   +T KP
Sbjct  223  ARTLGPAMVAGRYKG-IWVYIVGPVGGAVAGAWAYNLIR---FTNKP  265



>ref|XP_009136970.1| PREDICTED: aquaporin NIP1-2 [Brassica rapa]
Length=298

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 146/233 (63%), Gaps = 12/233 (5%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G I
Sbjct  50   FSVPFLQKLMAEILGTYFLIFAGCASVAVNAQHDKAVTLPGIAIVWGLTVMVLVYSLGHI  109

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H + 
Sbjct  110  SGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVF  169

Query  423  --TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVS
Sbjct  170  VGTLPSGSDLQSFVIEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVS  229

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNP RSLGPA+  ++    +WIY  +P  GAVAG ++Y  +R   +T KP
Sbjct  230  GASMNPGRSLGPAMV-YNCYKGIWIYIASPILGAVAGAWVYNTVR---YTDKP  278



>ref|XP_006361154.1| PREDICTED: multicystatin-like [Solanum tuberosum]
Length=557

 Score =   145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 143/222 (64%), Gaps = 4/222 (2%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F K+   +++AE +GTY+L+F  C  II N+    V V L   A+   L V+V+++S+G 
Sbjct  272  FKKVVEFKLVAEFVGTYMLIFAGCAAIILNINKNNV-VTLPGIASVWGLVVMVLIYSVGH  330

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPL  412
            +SGAH NP+VT+AFA+   FPW +VP YI+ QV GS+ A+ S RLI+ G E + + T P 
Sbjct  331  VSGAHFNPAVTIAFATSKMFPWIQVPAYILVQVVGSILASGSLRLIFNGKEDQFVGTVPA  390

Query  411  HGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 A  +EF+ATF ++F+ + +++D +    L+G  +G  + L +L SGP++G SMNP
Sbjct  391  GTNLQALILEFIATFYLMFVIAGVATDDRAMKHLSGVAIGATVSLDILFSGPLTGASMNP  450

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQG  106
            ARSLGPAI +  +   LWIY + PT GA+ G + Y L+RL+ 
Sbjct  451  ARSLGPAIVTGHYKG-LWIYIIGPTLGAIFGAWTYNLMRLKN  491



>ref|NP_001274279.1| nodulin-26-like [Solanum lycopersicum]
 dbj|BAO18644.1| nodulin26-like intrinsic protein 3;1 [Solanum lycopersicum]
Length=345

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE +GTY+L+F  C  I+ N+    V V L   A+   L V+V+++S+G +SGA
Sbjct  44   FVQKLIAEFVGTYMLIFAGCAAIVLNINKNNV-VTLPGIASVWGLVVMVLIYSVGHVSGA  102

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+AFA+   FPW +VP YI+ QV GS  A+ S RLI+ G E + + T P     
Sbjct  103  HFNPAVTIAFATSKMFPWIQVPAYILVQVVGSTLASGSLRLIFNGKEDQFVGTVPAGTDL  162

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             A  +EF+ATF ++F+ + +++D +    L+G  +G  + L +L SGP++G SMNPARSL
Sbjct  163  QALILEFIATFYLMFVIAGVATDDRAMKHLSGVAIGATVSLDILFSGPLTGASMNPARSL  222

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL  112
            GPAI +  +   LWIY + PT GA+ G + Y L+RL
Sbjct  223  GPAIVTGHYKG-LWIYIIGPTLGAIFGAWTYNLMRL  257



>emb|CDX78905.1| BnaA01g09720D [Brassica napus]
Length=297

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 144/229 (63%), Gaps = 12/229 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G ISGAH
Sbjct  53   FLQKLMAEILGTYFLIFAGCASVAVNAQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAH  112

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM---TR  418
             NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H +   T 
Sbjct  113  FNPAVTIAFASSGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTL  172

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVSG SM
Sbjct  173  PAGSDLQSFVIEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASM  232

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+  ++    +WIY  +P  GAVAG ++Y  +R   +T KP
Sbjct  233  NPGRSLGPAMV-YNCYKGIWIYIASPILGAVAGAWVYNTVR---YTDKP  277



>emb|CDX98596.1| BnaA03g43810D [Brassica napus]
Length=298

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 146/233 (63%), Gaps = 12/233 (5%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G I
Sbjct  50   FSVPFLQKLMAEILGTYFLIFAGCASVAVNAQHDKAVTLPGIAIVWGLTVMVLVYSLGHI  109

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++ +     H + 
Sbjct  110  SGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVF  169

Query  423  --TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVS
Sbjct  170  VGTLPSGSDLQSFVIEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVS  229

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNP RSLGPA+  ++    +WIY  +P  GAVAG ++Y  +R   +T KP
Sbjct  230  GASMNPGRSLGPAMV-YNCYKGIWIYIASPILGAVAGAWVYNTVR---YTDKP  278



>gb|KDO77955.1| hypothetical protein CISIN_1g023184mg [Citrus sinensis]
Length=284

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 143/227 (63%), Gaps = 7/227 (3%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGP  589
            F+  F++++MAE LGTY ++F  C  ++ N+    + V L   +    L V+V+V+S+G 
Sbjct  46   FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGH  104

Query  588  ISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLH  409
            ISGAH NPSVT+A A+   FPW +VP YI+ QV GS  A  + RL++  + +        
Sbjct  105  ISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFAGTLPA  164

Query  408  GCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
            G N  AF +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNP
Sbjct  165  GSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMFAGPITGASMNP  224

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ARSLGPAI S  +   LWIY VAP  GA AG ++Y ++R   +T KP
Sbjct  225  ARSLGPAIVSSQYKG-LWIYIVAPPLGATAGAWVYNMVR---YTDKP  267



>ref|XP_010455435.1| PREDICTED: probable aquaporin NIP5-1 isoform X1 [Camelina sativa]
Length=307

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = -3

Query  735  AEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINPSV  559
            AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S G ISGAH+NPS+
Sbjct  85   AEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILSTGHISGAHLNPSL  143

Query  558  TLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWVEF  379
            T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T P      AF +EF
Sbjct  144  TIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTVPSVSLGQAFALEF  203

Query  378  LATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIASW  199
            + TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +GGSMNP R+LGPA+AS 
Sbjct  204  IITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASG  263

Query  198  SFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            ++ S LWIY VAPT GA+AG  +Y  ++L      P
Sbjct  264  NYRS-LWIYLVAPTLGAIAGAAVYTGVKLNDSETDP  298



>emb|CDY05100.1| BnaC03g28980D [Brassica napus]
Length=301

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 144/229 (63%), Gaps = 3/229 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP       R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  66   FPTPGVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILS  124

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+L  FPW  VP YI AQV  SV A+ + + ++       +T 
Sbjct  125  TGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASVCASFALKAVFHPFMSGGVTV  184

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      AF +EF+ +FI+LF+ +++++D +  G+LAG  VG  + L +L++GP +G SM
Sbjct  185  PSVSVGQAFALEFIISFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGASM  244

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP R+LGPA+AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  245  NPVRTLGPALASGNYRS-LWVYLVAPTLGAISGAAVYTGVKLNDSATDP  292



>ref|XP_011038068.1| PREDICTED: probable aquaporin NIP5-1 [Populus euphratica]
Length=299

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 141/228 (62%), Gaps = 1/228 (0%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSI  595
            FP  +    R++ AE +GT+IL+F         Q       L+  AA A L V++++ S 
Sbjct  64   FPAPDVSLTRKLGAEFVGTFILIFAATAAPIVNQKYNSAETLIGNAACAGLAVMIIILST  123

Query  594  GPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRP  415
            G ISGAH+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T P
Sbjct  124  GHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTVP  183

Query  414  LHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMN  235
                  AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMN
Sbjct  184  SVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMN  243

Query  234  PARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            P R+LGPA+A+ ++  ++WIY VAPT GA+AG   Y  ++L+     P
Sbjct  244  PVRTLGPAVAAGTYK-EIWIYLVAPTLGALAGAATYTAVKLREGEADP  290



>emb|CDY01565.1| BnaC07g35550D [Brassica napus]
Length=298

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 146/233 (63%), Gaps = 12/233 (5%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  F++++MAE LGTY L+F  C  ++        V L   A    LTV+V+V+S+G I
Sbjct  50   FSVPFLQKLMAEILGTYFLIFAGCASVAVNAQHDKAVTLPGIAIVWGLTVMVLVYSLGHI  109

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY-----EHMM-  424
            SGAH NP+VT+AFAS G FP  +VP Y+++QV GS  A  + RL++G++      +H + 
Sbjct  110  SGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQNVCSGKHDVF  169

Query  423  --TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVS  250
              T P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVS
Sbjct  170  VGTLPSGSDLQSFVIEFIITFYLMFIISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVS  229

Query  249  GGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            G SMNP RSLGPA+  ++    +WIY  +P  GAVAG ++Y  +R   +T KP
Sbjct  230  GASMNPGRSLGPAMV-YNCYKGIWIYIASPILGAVAGAWVYNTVR---YTDKP  278



>ref|XP_007211782.1| hypothetical protein PRUPE_ppa009698mg [Prunus persica]
 gb|EMJ12981.1| hypothetical protein PRUPE_ppa009698mg [Prunus persica]
Length=281

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 132/216 (61%), Gaps = 2/216 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE LGTY +VF  CG +         V     +    L V+V+V+S+G ISGAH
Sbjct  47   FMQKVIAEVLGTYFVVFAGCGAVVVNLSTDKTVSFPGISIVWGLVVMVMVYSVGHISGAH  106

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA    FPW +VP YI AQV GS  A+ + RLI+     H   T P      
Sbjct  107  FNPAVTIAFAITKRFPWKQVPAYIAAQVLGSTLASGTLRLIFQGHQNHFAGTIPTGNPWQ  166

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARS+G
Sbjct  167  SFAIEFVITFYLMFVISGVATDNRAIGELAGLAVGATVLLNVMFAGPISGASMNPARSVG  226

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            PAI S  +   LW+Y  APT GAV G  +Y ++R  
Sbjct  227  PAIVSTQYK-HLWVYIFAPTLGAVCGALVYNVIRFS  261



>gb|KHG20522.1| Aquaporin NIP1-2 -like protein [Gossypium arboreum]
Length=280

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 141/226 (62%), Gaps = 5/226 (2%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  FI+++MAE LGTY L+F  C  +         V L   +    L V+V+V+S+G I
Sbjct  41   FSVPFIQKLMAEVLGTYFLIFAGCAAVVVNVNNEKVVSLPGISIVWGLAVMVLVYSLGHI  100

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHG  406
            SGAH NP+VT+AFA+   FP  +VP Y++AQV GS  A  + RL++   ++        G
Sbjct  101  SGAHFNPAVTIAFATCKRFPLKQVPAYVLAQVIGSTLAAGTLRLLFSGPHDVFAGTSPQG  160

Query  405  CN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPA  229
             +  AF +EF+ TF ++F+ S +++D +  G+LAG  +G  + + V+ +GP++G SMNPA
Sbjct  161  SDLQAFGIEFIITFYLMFIISGVATDNRAIGELAGLAIGATVLINVMFAGPITGASMNPA  220

Query  228  RSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            RSLGPAI S  +   +WIY  +PT GAV+G ++Y ++R   +T KP
Sbjct  221  RSLGPAIVSNHYKG-IWIYLTSPTLGAVSGAWVYNMVR---YTDKP  262



>ref|NP_174472.2| aquaporin NIP3-1 [Arabidopsis thaliana]
 sp|Q9C6T0.2|NIP31_ARATH RecName: Full=Aquaporin NIP3-1; AltName: Full=NOD26-like intrinsic 
protein 3-1; Short=AtNIP3;1; Contains: RecName: Full=Aquaporin 
NIP3-1, N-terminally processed [Arabidopsis thaliana]
 gb|AEE31413.1| aquaporin NIP3-1 [Arabidopsis thaliana]
Length=323

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 141/227 (62%), Gaps = 9/227 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIG  592
            P+ +  F+++++ E +GT+ ++F  C  I   +  G  V L   A    L V V+++SIG
Sbjct  35   PLVSVSFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLVVTVMIYSIG  94

Query  591  PISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-------  433
             +SGAH NP+V++AFAS   FP+ +VP YI AQ+ GS  A    RL++ ++ +       
Sbjct  95   HVSGAHFNPAVSIAFASSKKFPFNQVPGYIAAQLLGSTLAAAVLRLVFHLDDDVCSLKGD  154

Query  432  -HMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
             ++ T P +    +F +EF+ATF ++F+ S++++D + TG  AG  +G  I L +L SGP
Sbjct  155  VYVGTYPSNSNTTSFVMEFIATFNLMFVISAVATDKRATGSFAGIAIGATIVLDILFSGP  214

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            +SG SMNPARSLGPA+  W    DLW+Y V+P  GA++G + Y LLR
Sbjct  215  ISGASMNPARSLGPALI-WGCYKDLWLYIVSPVIGALSGAWTYGLLR  260



>ref|XP_006643882.1| PREDICTED: aquaporin NIP1-2-like [Oryza brachyantha]
Length=237

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 141/222 (64%), Gaps = 6/222 (3%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +++++AE LGTY ++F  CG ++     G  V      A   L V+V+V+S+G ISGAH 
Sbjct  1    MQKILAEILGTYFMIFAGCGAVAVNLSTGGTVTFPGICAVWGLVVMVLVYSVGHISGAHF  60

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMM-TRPLHGCNA  397
            NP+VT+AFA+ G FPW +VP Y++AQV GS  A+++ R+++ G   EH   T P      
Sbjct  61   NPAVTVAFATCGRFPWKQVPSYVVAQVLGSTMASLTLRVVFGGGAREHFFGTAPAGSSAQ  120

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            A  +EF+ +F ++F+ S +++D +  G+LAG  VG  + + VL +GPV+G SMNPARSLG
Sbjct  121  AAALEFVISFFLMFVVSGVATDNRAIGELAGLAVGATVAVNVLFAGPVTGASMNPARSLG  180

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+ +  +   +W+Y  AP  GAV G + Y L+R   +T KP
Sbjct  181  PAMVAGRYG-GVWVYVAAPVGGAVCGAWAYNLIR---FTDKP  218



>ref|XP_009140163.1| PREDICTED: putative aquaporin NIP4-1 [Brassica rapa]
Length=276

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 138/220 (63%), Gaps = 5/220 (2%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++++AE +GTY ++F  CG++    L G  V       T  L V+V+++S G ISGAH N
Sbjct  43   QKLIAEMIGTYFVIFSGCGVVVVNVLYGGTVTFPGVCVTWGLIVMVMIYSTGHISGAHFN  102

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-HMMTRPLHGCNAAF  391
            P+VTL FA    FPW +VP Y+ AQ+ GS+ A+++ RL++ V  E +  T P      A 
Sbjct  103  PAVTLTFAIFRRFPWYQVPLYVGAQLAGSLLASLTIRLMFKVTPEAYFGTTPTDSAARAL  162

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              E + +F+++F+ S +S+D +  G+LAG  VG+ I L V ++GP+SG SMNPARSLGPA
Sbjct  163  VAEIIISFLLMFVISGVSTDSRAIGELAGIAVGMTIMLNVFVAGPISGASMNPARSLGPA  222

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            I    +  D+W+Y V P +G +AG F+Y  +R   +T KP
Sbjct  223  IVMGVYK-DIWVYIVGPISGVMAGGFVYNFIR---FTDKP  258



>ref|XP_007147986.1| hypothetical protein PHAVU_006G171000g [Phaseolus vulgaris]
 gb|ESW19980.1| hypothetical protein PHAVU_006G171000g [Phaseolus vulgaris]
Length=273

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGV--QVGLLEYAATASLTVIVVVFSIGPIS  583
             +++++AE +GTY L+F  C  ++ N+    V  Q G+   +    LTV+V+V+S+G IS
Sbjct  39   LLQKLIAEVVGTYFLIFAGCASVVVNLDKDKVITQPGI---SIVWGLTVMVLVYSVGHIS  95

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT+A AS   FP  +VP Y++AQV GS  A+ + RLI+  + +H   T P   
Sbjct  96   GAHFNPAVTIAHASTKRFPLKQVPAYVIAQVVGSTLASGTLRLIFNGKNDHFAGTLPAGS  155

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPAR
Sbjct  156  DLQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMFAGPITGASMNPAR  215

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI    +   +WIY V+PT GAVAG + Y  +R   +T KP
Sbjct  216  SLGPAIVHNEYRG-IWIYLVSPTLGAVAGAWAYNFIR---YTNKP  256



>ref|XP_010486098.1| PREDICTED: probable aquaporin NIP7-1 isoform X2 [Camelina sativa]
Length=237

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            +R ++AE +GT+IL+F +CG+IS+ QL G  VGLLEYAATA L+V+VVV+SIG ISGAH+
Sbjct  46   LRIVIAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAATAGLSVVVVVYSIGHISGAHL  105

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA  G FPW +VP YI AQ  G+  AT+    +YGV  + M T+P     +AF
Sbjct  106  NPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADLMATKPALSWVSAF  165

Query  390  WVEFLAT  370
            +VE +AT
Sbjct  166  FVELIAT  172



>ref|XP_011035752.1| PREDICTED: aquaporin NIP2-1-like [Populus euphratica]
 ref|XP_011035753.1| PREDICTED: aquaporin NIP2-1-like [Populus euphratica]
Length=279

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 140/230 (61%), Gaps = 4/230 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+R+++AE + TY+LVF  CG  +       +V  L  +    L V V+++++G ISGAH
Sbjct  31   FLRKVVAEVIATYLLVFVTCGAAAISASDEHKVSKLGASVAGGLIVTVMIYAVGHISGAH  90

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+VT AFA++  FPW +VPFY  AQ+ G++ A+ + +++         + P      A
Sbjct  91   MNPAVTTAFAAVLNFPWKQVPFYAAAQLTGAISASFTLKVLLNPIKNVGTSSPSGTAVQA  150

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E + TF ++F+ S++++D +  G LAG  VG  + +  +++GPVSGGSMNPAR+LGP
Sbjct  151  LTMEIVVTFSMMFITSAVATDTKAVGDLAGIAVGSAVCITSILAGPVSGGSMNPARTLGP  210

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPL  64
            A+AS  F   +W+Y + P TG + G + Y ++R+   T KP  A P   L
Sbjct  211  AVASRYFKG-IWVYLLGPVTGTLLGAWSYNMIRV---TDKPVQAIPRRSL  256



>gb|KCW73998.1| hypothetical protein EUGRSUZ_E02616 [Eucalyptus grandis]
Length=267

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 141/223 (63%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE  GTY L+F  CG ++ N+    V V L   +    L V V+V+S+G ISGA
Sbjct  37   FVQKLIAEVFGTYFLIFAGCGSVVVNLNNEKV-VTLPGISMVWGLAVTVLVYSVGHISGA  95

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+AFA+   FPW +V  YI AQV GS  A  + RL++ G   + + T+P     
Sbjct  96   HFNPAVTIAFATCRRFPWNQVLPYITAQVIGSTLACGTLRLLFTGKLNQFVGTQPAGSDV  155

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF  EF+ TF ++F+ S + +D +  G+ AG  VG  + L VL +GP++G SMNPARSL
Sbjct  156  QAFVFEFIITFYLMFIVSGVGTDNRAIGEFAGLAVGATVLLNVLFAGPITGASMNPARSL  215

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  ++  LWIY VAP  GA++G ++Y L+R   +T KP
Sbjct  216  GPAIVSHHYE-KLWIYIVAPIVGAISGAWVYNLIR---FTDKP  254



>ref|XP_003534451.1| PREDICTED: aquaporin NIP2-1-like [Glycine max]
Length=293

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 136/213 (64%), Gaps = 1/213 (0%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F R+++AE +GT++LVF   G     ++    V  L  +    L V V+++SIG ISGAH
Sbjct  47   FPRKVLAEIIGTFLLVFVGSGSAGLSKIDERMVSKLGASLAGGLIVTVMIYSIGHISGAH  106

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+V+LAF ++   PWP++PFYI AQ+ G++ A+ + R +     E   T P      A
Sbjct  107  MNPAVSLAFTAVRHLPWPQLPFYIAAQLTGAISASYTLRELLRPSNEIGGTSPAGSHIQA  166

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E + T+ ++F++ ++++D   TG+L+G  VG  + +  +++GP+SGGSMNPAR+LGP
Sbjct  167  LIMEMVTTYTMVFISMAVATDSNATGQLSGVAVGSSVCIASIVAGPISGGSMNPARTLGP  226

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            AIA+ S+   LW+YFV P TGAV   + Y ++R
Sbjct  227  AIAT-SYYKGLWVYFVGPITGAVLAAWSYNVIR  258



>ref|XP_004485943.1| PREDICTED: aquaporin NIP1-2-like [Cicer arietinum]
Length=273

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 149/238 (63%), Gaps = 14/238 (6%)
 Frame = -3

Query  786  ICSFFPIFNKI-FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATA---SL  622
            IC    I  ++  +++++AE +GTY+L+F  CG ++ N+     +  ++ +   +    L
Sbjct  24   ICDNSSIEERVPLLKKLVAEVVGTYLLIFAGCGAVVVNLD----KDKVITHPGISIVWGL  79

Query  621  TVIVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGV  442
            TV+V+V+SIG ISGAH NP+VT+A AS   FP  +VP Y++AQV GS  A+ + RLI+  
Sbjct  80   TVMVLVYSIGHISGAHFNPAVTIAHASTKRFPLKQVPAYVIAQVLGSTLASGTLRLIFNG  139

Query  441  EYEHMMTRPLHGCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlI  265
            +  H       G N   F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ 
Sbjct  140  KENHFSGTLPAGSNLQCFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMF  199

Query  264  SGPVSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +GP++G SMNPARSLGPAI    +   +WIY V+ T GA+AG ++Y ++R   +T KP
Sbjct  200  AGPITGASMNPARSLGPAIVHNEYRG-IWIYIVSTTLGAMAGTWVYNIIR---YTNKP  253



>ref|XP_008383590.1| PREDICTED: aquaporin NIP1-1-like [Malus domestica]
Length=271

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 136/222 (61%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++ AE LGTY ++F  CG +    +   +V     +    L V+V+++S+G ISGAH
Sbjct  37   FMQKVFAEVLGTYFVIFAGCGSVVVNLVSDNKVTFPGISIIWGLVVMVMIYSVGHISGAH  96

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA    FP  +VP Y+ AQ+ GS  A  + RLI+     H   T P      
Sbjct  97   FNPAVTIAFAVTKRFPLKQVPAYVGAQILGSTLAAGTLRLIFNGPQNHFAGTMPSGTPFQ  156

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARS+G
Sbjct  157  SFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMCTGPISGASMNPARSIG  216

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  F  DLW+Y   PT GAV+G  +Y L+R   +T KP
Sbjct  217  PAIVSGHFK-DLWVYIFGPTLGAVSGALVYNLIR---FTDKP  254



>ref|XP_003593792.1| Aquaporin NIP1-2 [Medicago truncatula]
 gb|AES64043.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=276

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 147/233 (63%), Gaps = 8/233 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
             +++++AE +GTY+++F  C  +I N+    V V L   A     TV+V+++S+G ISGA
Sbjct  37   LLKKLVAEVVGTYMMIFAGCAAVIVNLNNDHV-VTLPGIAFAWGFTVMVLIYSVGHISGA  95

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCN-  400
            H NP+VT+AFAS   FP+ +VP Y++AQV GS  A+ S RLI+  E +H +     G N 
Sbjct  96   HFNPAVTIAFASTRRFPFKQVPTYMIAQVLGSTLASGSLRLIFNGEDDHFIGTLPAGSNL  155

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF +EF+ TF ++F+ +++++D +  G+LAG  +G  I + +L +GP++G SMNPARSL
Sbjct  156  QAFVIEFICTFFLMFVITAVATDNRAIGELAGLAIGSTIIIDILFAGPMTGASMNPARSL  215

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPA-DASPNTPL  64
            GPA    ++ + LWIY +AP  GA+ G + Y  +R    T KP  D  P   L
Sbjct  216  GPAFLYDNY-TGLWIYLIAPILGALVGTWTYNFIR---HTNKPTCDELPKIEL  264



>gb|KHG08004.1| Aquaporin NIP2-1 [Gossypium arboreum]
Length=268

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 150/239 (63%), Gaps = 7/239 (3%)
 Frame = -3

Query  780  SFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVF  601
            SF   +   F R++ AE + TY+LVF  CG  +   +   ++  L  +    L V V+++
Sbjct  20   SFQQHYPPDFPRKVFAETIATYLLVFVTCGSAAISSVDEHKISRLGASVAGGLIVTVMIY  79

Query  600  SIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMT  421
            ++G +SGAH+NP+VTLAFA++  FPW +VPFY  AQ+ G++ A+ + R++     +H+ T
Sbjct  80   AVGHVSGAHMNPAVTLAFAAVRHFPWKQVPFYGAAQLTGAISASFTLRVLLH-PIKHVGT  138

Query  420  RPLHGCN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGG  244
                G +  A  +E + TF ++F+ S++++D +  G+LAG  VG  + +  +++GP+SGG
Sbjct  139  TSPSGSDLQALIMEIVVTFSMMFITSAVATDTKAIGELAGIAVGSAVCITSILAGPISGG  198

Query  243  SMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADA-SPNT  70
            SMNPARS+GPAIAS  +   +W+Y V P TG + G + Y L+R++    KP  A SP++
Sbjct  199  SMNPARSIGPAIASGEYKG-IWVYVVGPVTGTLMGAWSYNLIRMRD---KPHHAISPHS  253



>gb|KCW73713.1| hypothetical protein EUGRSUZ_E02324 [Eucalyptus grandis]
Length=256

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 142/222 (64%), Gaps = 7/222 (3%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            +++++AE  GTY L+F  CG ++ N+    V V L   +    L V+V+V+S+G ISGAH
Sbjct  38   VQKLIAEVFGTYFLIFAGCGSVAVNLDNEKV-VTLPGISMVWGLAVMVLVYSVGHISGAH  96

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FPW +V  YI AQV GS  A  + RL++  +  H + T+P      
Sbjct  97   FNPAVTIAFATCRRFPWNEVLPYITAQVIGSTLACGTLRLLFTGKLNHFVGTQPAGSDVQ  156

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF  EF+ TF ++F+ S + +D +  G+ AG VVG  + L VL +GP++G SMNPARSLG
Sbjct  157  AFVFEFIITFYLMFIVSGVGTDNRARGEFAGIVVGATVLLNVLFAGPITGASMNPARSLG  216

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  + + LWIY VAP  GA++G ++Y L+R   +T KP
Sbjct  217  PAIVSHHY-AKLWIYIVAPIVGAISGAWVYNLIR---FTDKP  254



>ref|XP_010056835.1| PREDICTED: aquaporin NIP1-1-like [Eucalyptus grandis]
 gb|KCW73714.1| hypothetical protein EUGRSUZ_E02325 [Eucalyptus grandis]
Length=267

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 141/222 (64%), Gaps = 7/222 (3%)
 Frame = -3

Query  750  IREMMAEALGTYILVFCICGIIS-NMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            +++++AE  GTY L+F  CG ++ N+    V V L   +    L V+V+V+S+G ISGAH
Sbjct  38   VQKLIAEVFGTYFLIFAGCGSVAVNLDSEKV-VTLPGISMVWGLAVMVLVYSVGHISGAH  96

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FPW +V  YI AQV GS  A  + RL++  +  H + T+P      
Sbjct  97   FNPAVTIAFATCRRFPWNQVLPYISAQVIGSTLACGTLRLLFTGKLNHFLGTQPAGSDVQ  156

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF  EF+ TF ++F+ S + +D +  G+ AG  VG  + L VL +GP++G SMNPARSLG
Sbjct  157  AFVFEFIITFYLMFIVSGVGTDNRAIGEFAGLAVGATVLLNVLFAGPITGASMNPARSLG  216

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  + + LWIY VAP  GA++G ++Y L+R   +T KP
Sbjct  217  PAIVSHHY-AKLWIYIVAPIIGAISGAWVYNLMR---FTDKP  254



>ref|XP_006414041.1| hypothetical protein EUTSA_v10025855mg [Eutrema salsugineum]
 gb|ESQ55494.1| hypothetical protein EUTSA_v10025855mg [Eutrema salsugineum]
Length=297

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 145/229 (63%), Gaps = 12/229 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++MAE LGTY L+F  C  ++        V L   AA   LTV+V+V+S+G ISGAH
Sbjct  53   FLQKLMAEILGTYFLIFAGCASVAVNTQHDKVVTLPGIAAVWGLTVMVLVYSLGHISGAH  112

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-----HMM---TR  418
             NP+VT+AFAS   FP  +VP Y+++Q+ GS  A  + RL++G++ +     H +   T 
Sbjct  113  FNPAVTIAFASCRRFPLKQVPAYVISQLIGSTLAAATLRLLFGLDNDVCSGKHDVFVGTL  172

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P      +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+I+GPVSG SM
Sbjct  173  PSGSDLQSFVIEFIITFYLMFIISGVATDNRAIGELAGIAVGSTVLLNVIIAGPVSGASM  232

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            NP RSLGPA+  ++    +WIY V+P  GA+AG ++Y  +R   +T KP
Sbjct  233  NPGRSLGPAMV-YNCYKGIWIYIVSPILGAIAGAWVYNTVR---YTDKP  277



>ref|XP_008794153.1| PREDICTED: aquaporin NIP1-1-like [Phoenix dactylifera]
Length=291

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 141/222 (64%), Gaps = 6/222 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F+++++AE  GTY L+F  CG ++ + L    V     +    L V+V+V+SIG ISGAH
Sbjct  55   FLQKIIAEVFGTYFLIFAGCGSVT-VNLSKGTVTFPGISIVWGLVVMVMVYSIGHISGAH  113

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA+   FPW +VP YI AQV GS  A+ + RL++G + E    T P      
Sbjct  114  FNPAVTIAFATCRRFPWNQVPAYIFAQVLGSTLASGTLRLLFGGKRELFAGTIPAGSDVQ  173

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +  +EF+ +F ++F+ S +++D +  G+LAG  VG  + L VL +GP+SG SMNPARSLG
Sbjct  174  SLVLEFIISFYLMFVISGVATDKRAIGELAGLAVGATVLLNVLFAGPISGASMNPARSLG  233

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI +  ++S +W+Y V P  GAV G + Y L+R   +T KP
Sbjct  234  PAIVANRYES-IWVYIVGPICGAVTGAWAYNLIR---FTNKP  271



>ref|XP_009762968.1| PREDICTED: probable aquaporin NIP-type isoform X2 [Nicotiana 
sylvestris]
Length=270

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 145/223 (65%), Gaps = 6/223 (3%)
 Frame = -3

Query  756  IFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            + +++++AEA+GTY ++F  CG ++  ++ G  V       T  L V+V+V+++G ISGA
Sbjct  40   VILQKLIAEAIGTYFVIFAGCGSVAVNKIYG-SVTFPGICVTWGLIVMVMVYTVGHISGA  98

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-HMMTRPLHGCN  400
            H NP+VT+ F+ LG FPW +VP YI+AQ+ GS+ A+ +  L++ V  + +  T P+    
Sbjct  99   HFNPAVTITFSILGHFPWKQVPLYIIAQLMGSILASGTLALLFDVTPQAYFGTVPVGSNG  158

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             +  +E + +F+++F+ S +++D +  G++AG  VG+ I L V ++GP+SG SMNPARS+
Sbjct  159  QSLAIEIIISFLLMFVISGVATDDRAIGQVAGIAVGMTITLNVFVAGPISGASMNPARSI  218

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI    + + LW+Y V P  G +AG F+Y L+R    T KP
Sbjct  219  GPAIVKHVY-TGLWVYIVGPIIGTLAGAFVYNLIR---STDKP  257



>gb|KFK31988.1| hypothetical protein AALP_AA6G185600 [Arabis alpina]
Length=302

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 142/220 (65%), Gaps = 3/220 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            R++ AE +GT+IL+F    G I + +  G +  L+  AA A L V++++ S G ISGAH+
Sbjct  76   RKLGAEFVGTFILIFTATAGPIVDQKYNGAET-LIGNAACAGLAVMIIILSTGHISGAHL  134

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA+L  FPW  VP YI AQV  S+ A+ + + ++       +T P      AF
Sbjct  135  NPSLTIAFAALRHFPWAHVPAYIAAQVSASLCASFALKGVFHPFMSGGVTVPSVNVGQAF  194

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
             +EF+ TFI+LF+ +++++D +  G+LAG  VG  + L +L++GP +G SMNP R+LGPA
Sbjct  195  ALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPATGASMNPVRTLGPA  254

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +AS ++ S +W+Y VAPT GA+AG  +Y  ++L      P
Sbjct  255  VASGNYRS-IWVYLVAPTLGAIAGAAVYTGVKLNDSETDP  293



>gb|KHN13616.1| Aquaporin NIP2-1 [Glycine soja]
Length=295

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 136/213 (64%), Gaps = 1/213 (0%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F R++ AE +GT++LVF   G     ++    V  L  +    L V V+++SIG ISGAH
Sbjct  49   FPRKVFAEVIGTFLLVFVGSGSAGLSKIDESMVSKLGASLAGGLIVTVMIYSIGHISGAH  108

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+V+LAF ++   PWP++PFY+ AQ+ G++ A+ + R +     E   T P      A
Sbjct  109  MNPAVSLAFTAVRHLPWPQLPFYVAAQLTGAISASYTLRELLRPSDEIGGTSPAGSHIQA  168

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E ++T+ ++F++ ++++D   TG+L+G  VG  + +  +++GP+SGGSMNPAR+LGP
Sbjct  169  LTMEMVSTYTMVFISMAVATDSNATGQLSGVAVGSSVCIASIVAGPISGGSMNPARTLGP  228

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            AIA+ S+   LW+YFV P TGAV   + Y ++R
Sbjct  229  AIAT-SYYKGLWVYFVGPITGAVLAAWSYNVIR  260



>ref|XP_007147984.1| hypothetical protein PHAVU_006G170900g [Phaseolus vulgaris]
 gb|ESW19978.1| hypothetical protein PHAVU_006G170900g [Phaseolus vulgaris]
Length=258

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 146/233 (63%), Gaps = 11/233 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNM--QLMGVQVGLLEYAATASLTVIVVVFSIGPIS  583
             +++++AEA+GTY LVF  C  I+ N+    +  Q G+   +    L V V+V+S+G IS
Sbjct  23   LLQKLVAEAVGTYFLVFAGCSSIVVNLGNDKVVTQPGI---SIVWGLAVTVLVYSVGHIS  79

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT+A AS+  FP  +VP YI+AQV G++ A+ + RL++  + +H   T P   
Sbjct  80   GAHFNPAVTIAHASIKRFPLKEVPAYIVAQVVGAILASGTLRLVFRGKGDHFAGTVPAGS  139

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               AF VEFL TF ++F+ S +++D +  G+LAG  VG  + L V+I+GP++G SMNPAR
Sbjct  140  DMQAFVVEFLITFFLMFVISGVATDDRAIGELAGVAVGSTVLLNVMIAGPITGASMNPAR  199

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTP  67
            SLGPAI    +   +WIY V+P  GA+A  +LY  +    +T KPA     TP
Sbjct  200  SLGPAILHHEYRG-IWIYMVSPIVGALAATWLYNFIS---YTNKPAREITRTP  248



>emb|CDX67591.1| BnaA07g16310D [Brassica napus]
Length=301

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 142/222 (64%), Gaps = 3/222 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
              R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S G ISGA
Sbjct  73   LTRKLGAEFVGTFILIFTATAGPIVNQKYDGAET-LIGNAACAGLAVMIIILSTGHISGA  131

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPS+T+AFA+L  FPW +VP YI AQV  S+ A+ + + ++       +T P      
Sbjct  132  HLNPSMTIAFAALRHFPWAQVPAYIAAQVSASICASFALKAVFHPFMSGGVTVPSVSVGQ  191

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EF+ +FI+LF+ +++++D +  G+LAG  VG  + L  L++GP SG SMNP R+LG
Sbjct  192  AFALEFIISFILLFVITAVATDTRAVGELAGIAVGATVMLNNLVAGPSSGASMNPVRTLG  251

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+AS ++ S LW+Y VAPT GA++G  +Y  ++L      P
Sbjct  252  PALASGNYRS-LWVYMVAPTLGAISGAAVYTGVKLNDNVSDP  292



>ref|XP_007039259.1| NOD26-like intrinsic protein 5,1 [Theobroma cacao]
 gb|EOY23760.1| NOD26-like intrinsic protein 5,1 [Theobroma cacao]
Length=298

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 142/223 (64%), Gaps = 3/223 (1%)
 Frame = -3

Query  774  FPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            FP  +    R++ AE +GT+IL+F    G I N +  G +  L+  AA A L V++++ S
Sbjct  63   FPAPDVSLTRKLGAEFVGTFILIFAATAGPIVNQKYSGAET-LIGNAACAGLAVMIIILS  121

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTR  418
             G ISGAH+NPS+T+AFA+   FPW  VP Y+ AQV  S+ A+ + + ++       +T 
Sbjct  122  TGHISGAHLNPSLTIAFAACRHFPWAHVPAYVAAQVSASICASFALKGVFHPFMSGGVTV  181

Query  417  PLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSM  238
            P  G   AF +EFL TF +LF+ +++++D +  G+LAG  VG  + L +L++G  SGGSM
Sbjct  182  PSVGYGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGSSSGGSM  241

Query  237  NPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            NP R+LGPA+A+ ++ + LWIY +APT GA+ G   Y L++L 
Sbjct  242  NPVRTLGPAVAAGNYKA-LWIYLIAPTLGALVGSGTYTLVKLH  283



>ref|NP_001240190.1| uncharacterized protein LOC100788071 [Glycine max]
 gb|ACU23509.1| unknown [Glycine max]
Length=295

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 136/213 (64%), Gaps = 1/213 (0%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F R++ AE +GT++LVF   G     ++    V  L  +    L V V+++SIG ISGAH
Sbjct  49   FPRKVFAEVIGTFLLVFVGSGSAGLSKIDESMVSKLGASLAGGLIVTVMIYSIGHISGAH  108

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAA  394
            +NP+V+LAF ++   PWP++PFY+ AQ+ G++ A+ + R +     E   T P      A
Sbjct  109  MNPAVSLAFTAVRHLPWPQLPFYVAAQLTGAISASYTLRELLRPSDEIGGTSPAGSHIQA  168

Query  393  FWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGP  214
              +E ++T+ ++F++ ++++D   TG+L+G  VG  + +  +++GP+SGGSMNPAR+LGP
Sbjct  169  LIMEMVSTYTMVFISMAVATDSNATGQLSGVAVGSSVCIASIVAGPISGGSMNPARTLGP  228

Query  213  AIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLR  115
            AIA+ S+   LW+YFV P TGAV   + Y ++R
Sbjct  229  AIAT-SYYKGLWVYFVGPITGAVLAAWSYNVIR  260



>ref|NP_001242005.1| uncharacterized protein LOC100812577 [Glycine max]
 gb|ACU23597.1| unknown [Glycine max]
Length=273

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGV--QVGLLEYAATASLTVIVVVFSIGPIS  583
             +++++AE +GTY L+F  C  ++ N+    V  Q G+   +    LTV+V+V+SIG IS
Sbjct  39   LLQKLVAEVVGTYFLIFAGCASVVVNLDKDKVVTQPGI---SIVWGLTVMVLVYSIGHIS  95

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT+A A+   FP  +VP Y++AQV G+  A+ + RLI+  + +H   T P   
Sbjct  96   GAHFNPAVTIAHATTKRFPLKQVPAYVIAQVVGATLASGTLRLIFNGKNDHFAGTLPSGS  155

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPAR
Sbjct  156  DLQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMFAGPITGASMNPAR  215

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI    +   +WIY V+PT GAVAG + Y  +R   +T KP
Sbjct  216  SLGPAIVHHEYRG-IWIYLVSPTLGAVAGTWAYNFIR---YTNKP  256



>ref|XP_004231994.1| PREDICTED: probable aquaporin NIP-type [Solanum lycopersicum]
Length=267

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 139/222 (63%), Gaps = 5/222 (2%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++++AE +GTY ++F  CG +   +L G  +     + T  L V+V+V+++G ISGAH N
Sbjct  39   QKLIAEVIGTYFVIFAGCGSVVVNKLYGGTITFPGISVTWGLIVMVMVYTVGHISGAHFN  98

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-HMMTRPLHGCNAAF  391
            P+VT+ F+  G FPW +VPFYI+AQ+ GS+ A+ +  L++ V  E +  T P+     + 
Sbjct  99   PAVTITFSVFGRFPWKEVPFYIVAQLMGSILASGTLSLMFDVTPEAYFGTVPVGSNVQSL  158

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              E + +F+++F+ S + +D +  G +AG  VG+ I L V + GP+SG SMNPARS+GPA
Sbjct  159  AAEIVISFLLMFVISGVGTDERAIGHIAGIAVGMTITLNVFVVGPISGASMNPARSIGPA  218

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD  85
            I   ++   LW+Y V P  G +AG F+Y L+R    T KP +
Sbjct  219  IVRHTYKG-LWVYIVGPIVGTLAGAFMYNLIRA---TDKPLN  256



>ref|XP_009352714.1| PREDICTED: aquaporin NIP1-1-like [Pyrus x bretschneideri]
Length=271

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 135/222 (61%), Gaps = 5/222 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAH  574
            F++++ AE LGTY ++F  CG +    +    V     +    L V+V+++S+G ISGAH
Sbjct  37   FMQKVFAEVLGTYFVIFAGCGSVVVNLVSDNTVTFPGISIIWGLVVMVMIYSVGHISGAH  96

Query  573  INPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCNA  397
             NP+VT+AFA    FP  +VP Y+ AQ+ GS  A  + RLI+     H   T P      
Sbjct  97   FNPAVTIAFAVTKRFPLKQVPSYVGAQILGSTLAAGTLRLIFNGPQNHFAGTTPSGTPFQ  156

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            +F +EF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP+SG SMNPARS+G
Sbjct  157  SFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLLNVMCTGPISGASMNPARSIG  216

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PAI S  F  DLW+Y   PT GAV+G  +Y L+R   +T KP
Sbjct  217  PAIVSGHFK-DLWVYIFGPTLGAVSGALVYNLIR---FTDKP  254



>dbj|BAO18645.1| nodulin26-like intrinsic protein 4;1 [Solanum lycopersicum]
Length=267

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 139/222 (63%), Gaps = 5/222 (2%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++++AE +GTY ++F  CG +   +L G  +     + T  L V+V+V+++G ISGAH N
Sbjct  39   QKLIAEVIGTYFVIFAGCGSVVVNKLYGGTITFPGISVTWGLIVMVMVYTVGHISGAHFN  98

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYE-HMMTRPLHGCNAAF  391
            P+VT+ F+  G FPW +VPFYI+AQ+ GS+ A+ +  L++ V  E +  T P+     + 
Sbjct  99   PAVTITFSVFGRFPWKEVPFYIVAQLMGSILASGTLSLMFDVTPEAYFGTVPVGSDVQSL  158

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              E + +F+++F+ S + +D +  G +AG  VG+ I L V + GP+SG SMNPARS+GPA
Sbjct  159  AAEIVISFLLMFVISGVGTDERAIGHIAGIAVGMTITLNVFVVGPISGASMNPARSIGPA  218

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPAD  85
            I   ++   LW+Y V P  G +AG F+Y L+R    T KP +
Sbjct  219  IVRHTYKG-LWVYIVGPIVGTLAGAFMYNLIRA---TDKPLN  256



>gb|AFK48191.1| unknown [Lotus japonicus]
Length=247

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 143/217 (66%), Gaps = 4/217 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
             + +++AE +GTY +VF  CG ++ N+    V + L   A    LTV+V+++S+G ISGA
Sbjct  32   LLHKVVAEVIGTYFMVFAGCGAVVVNLNNDKV-LTLPGIAIVWGLTVMVLIYSVGHISGA  90

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHGCN  400
            H NP+VTLA AS   FP  +VP YI+AQ+ GS  A+ + RL++  + +H + T P     
Sbjct  91   HFNPAVTLAHASTRRFPLKQVPAYIVAQLIGSTLASGALRLMFNGKDDHFVGTLPAGSDL  150

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF +EF+ TF ++F+ S++++D +  G+LAG  VG  I + VL +GP++G S+NPARSL
Sbjct  151  QAFLIEFIITFQLMFVISAVATDNRAIGELAGIAVGSTIMINVLFAGPITGASLNPARSL  210

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            GPAI   ++ + LWIY V+P  GA+AG ++Y  +R +
Sbjct  211  GPAIVHNNYTA-LWIYLVSPVMGAMAGTWVYDFIRCK  246



>ref|XP_001759426.1| predicted protein [Physcomitrella patens]
 gb|EDQ75728.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 139/225 (62%), Gaps = 4/225 (2%)
 Frame = -3

Query  744  EMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHINP  565
            +++AE + T+ILVF  CG +    +   +V  +  +    L + ++++++G ISGAH+NP
Sbjct  7    QLVAEVISTFILVFTGCGAVMVNAISNGKVTPVGISLVFGLVITIMIYAVGHISGAHMNP  66

Query  564  SVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAFWV  385
            +VTLAFA    FPW +VP YI+AQ GGSVFA+   R I         T P      +F +
Sbjct  67   AVTLAFAIAKHFPWTQVPMYIVAQCGGSVFASFLLRWILHPAASEGATIPAGSDIQSFLL  126

Query  384  EFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPAIA  205
            E + TFI++F+ +++++D +  G+LAG  VG C+ L  L++GP+SG SMNPARSLGPA+A
Sbjct  127  EIVITFILMFVVAAVATDTRARGELAGIAVGSCVALNALMAGPISGASMNPARSLGPAVA  186

Query  204  SWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL---QGWTCKPADAS  79
            S ++ S +W+Y   P  GA+ G+  Y  +RL   +    KPA  S
Sbjct  187  SGNYRS-IWVYIAGPIIGALVGILAYNCIRLPDTEAQCDKPAKNS  230



>gb|EYU40831.1| hypothetical protein MIMGU_mgv1a025179mg [Erythranthe guttata]
Length=279

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 146/241 (61%), Gaps = 3/241 (1%)
 Frame = -3

Query  756  IFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            +  ++++AEA+GTY L+F  CG ++  ++ G  +          LTV+V+V+S+G ISGA
Sbjct  39   VITQKVIAEAIGTYFLIFIGCGSVAVDKIYG-SITFPGICIAWGLTVMVMVYSVGHISGA  97

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGV-EYEHMMTRPLHGCN  400
            H NP+VT+ FA    FP+ +VP YI+AQ+ GS+ A+ +  L+  V + ++  T P+    
Sbjct  98   HFNPAVTITFAIFRQFPYKQVPLYIVAQLLGSILASGTLYLVLDVGKDDYFGTLPIGSNV  157

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             +  +EF+ +F+++F+ S +++D +  G+LAG  +G+ I + VL++GPVSGGSMNPARS+
Sbjct  158  QSLVIEFITSFLLMFVISGVATDNRSIGELAGIAIGMTILVDVLVAGPVSGGSMNPARSI  217

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADASPNTPLHNNYNNPS  40
            GPAI    +   LW+Y V P  G + G F Y L+R      +       + L  N N  S
Sbjct  218  GPAIIMHEYKG-LWVYVVGPIVGTIMGGFTYNLIRFTDKPLRDVTTKTASFLAGNTNTAS  276

Query  39   N  37
            +
Sbjct  277  S  277



>ref|XP_009381416.1| PREDICTED: aquaporin NIP2-1-like [Musa acuminata subsp. malaccensis]
Length=293

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 140/228 (61%), Gaps = 4/228 (2%)
 Frame = -3

Query  795  KKWICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTV  616
            +K +   FP F     R+++AE + T++LVF  CG  +  +     V  L  +    L V
Sbjct  33   QKSLKEVFPPF---LARKVVAETIATFLLVFATCGSAALSKSNPGLVSQLGASVAGGLIV  89

Query  615  IVVVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEY  436
             V+++++G ISGAH+NP+VTLAFA    FPW +VPFY+ AQ+ G++ A+   R +     
Sbjct  90   TVMIYAVGHISGAHMNPAVTLAFAVARHFPWIQVPFYMAAQISGAMIASFVLRELLHPIT  149

Query  435  EHMMTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            +   T P      A  +E + TF ++F+ S++++D +  G+LAG  VG  + +  +++GP
Sbjct  150  DLGTTAPSDTAVKALVMEIVVTFCMMFVTSAVATDTKAVGELAGLAVGSSVCITSILAGP  209

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL  112
            +SGGSMNPAR+LGPA+AS ++DS LW+YF+ P  G ++G   Y  +R+
Sbjct  210  ISGGSMNPARTLGPAVASSNYDS-LWVYFLGPVLGTLSGACSYSFIRM  256



>ref|XP_010058935.1| PREDICTED: nodulin-26-like [Eucalyptus grandis]
Length=330

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 141/223 (63%), Gaps = 7/223 (3%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE  GTY L+F  CG ++ N+    V V L   +    L V V+V+S+G ISGA
Sbjct  100  FVQKLIAEVFGTYFLIFAGCGSVVVNLNNEKV-VTLPGISMVWGLAVTVLVYSVGHISGA  158

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+AFA+   FPW +V  YI AQV GS  A  + RL++ G   + + T+P     
Sbjct  159  HFNPAVTIAFATCRRFPWNQVLPYITAQVIGSTLACGTLRLLFTGKLNQFVGTQPAGSDV  218

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF  EF+ TF ++F+ S + +D +  G+ AG  VG  + L VL +GP++G SMNPARSL
Sbjct  219  QAFVFEFIITFYLMFIVSGVGTDNRAIGEFAGLAVGATVLLNVLFAGPITGASMNPARSL  278

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            GPAI S  ++  LWIY VAP  GA++G ++Y L+R   +T KP
Sbjct  279  GPAIVSHHYE-KLWIYIVAPIVGAISGAWVYNLIR---FTDKP  317



>ref|XP_007150811.1| hypothetical protein PHAVU_005G182400g [Phaseolus vulgaris]
 gb|ESW22805.1| hypothetical protein PHAVU_005G182400g [Phaseolus vulgaris]
Length=303

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 141/225 (63%), Gaps = 3/225 (1%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVV  607
            CS  P       R++ AE +GT+IL+F      I N +  G +  L+  AAT  L V++V
Sbjct  64   CSLPPPPPVPLARKVGAEFIGTFILMFAATAAAIVNQKTNGSET-LIGCAATTGLAVMIV  122

Query  606  VFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHM  427
            + + G ISGAH+NP+VTL+FA+L  FPW  VP YI AQV  S+ A  + + +Y       
Sbjct  123  ILATGHISGAHLNPAVTLSFAALKHFPWKHVPMYIGAQVLASICAAFALKGVYHPFMSGG  182

Query  426  MTRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSG  247
            +T P  G   AF +EF+  F ++F+ +++++D +  G+LAG  VG  + L +LI+GPVSG
Sbjct  183  VTVPSGGYAQAFALEFIIAFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPVSG  242

Query  246  GSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL  112
            GSMNP R+LGPAIA+ ++ + +W+Y VAP  GA+AG   Y  ++L
Sbjct  243  GSMNPVRTLGPAIAANNYKA-IWVYLVAPVLGALAGAGTYTAVKL  286



>gb|KHN47385.1| Aquaporin NIP1-2 [Glycine soja]
Length=273

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 94/225 (42%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGV--QVGLLEYAATASLTVIVVVFSIGPIS  583
             +++++AE +GTY L+F  C  ++ N+    V  Q G+   +    LTV+V+V+S+G IS
Sbjct  39   LLQKLVAEVVGTYFLIFAGCASVVVNLDKDKVVTQPGI---SIVWGLTVMVLVYSVGHIS  95

Query  582  GAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-TRPLHG  406
            GAH NP+VT+A A+   FP  +VP Y++AQV G+  A+ + RLI+  + +H   T P   
Sbjct  96   GAHFNPAVTIAHATTKRFPLKQVPAYVIAQVVGATLASGTLRLIFNGKNDHFAGTLPSGS  155

Query  405  CNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPAR  226
               +F VEF+ TF ++F+ S +++D +  G+LAG  VG  + L V+ +GP++G SMNPAR
Sbjct  156  DLQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVMFAGPITGASMNPAR  215

Query  225  SLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            SLGPAI    +   +WIY V+PT GAVAG + Y  +R   +T KP
Sbjct  216  SLGPAIVHHEYRG-IWIYLVSPTLGAVAGTWAYNFIR---YTNKP  256



>emb|CDY01700.1| BnaC04g30520D [Brassica napus]
Length=283

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -3

Query  747  REMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHIN  568
            ++++AE +GTY L+F  CG++    L G  V       T  L V+V+++S G ISGAH N
Sbjct  43   QKLIAEMIGTYFLIFAGCGVVVVNVLYGGTVTFPGICVTWGLIVMVMIYSTGHISGAHFN  102

Query  567  PSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVE-YEHMMTRPLHGCNAAF  391
            P+VTL FA    FPW +VP YI AQ+ GS+  +++ +L++ V    +  T P      A 
Sbjct  103  PAVTLTFAVFRRFPWYQVPLYIGAQLTGSLLGSLTLKLMFHVTPAAYFGTTPSDSAAQAL  162

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
              E + +F+++F+ S +++D +  G+LAG  VG+ I L V ++GPVSG SMNPARSLGPA
Sbjct  163  AAEIIISFLLMFVISGVATDNRAVGELAGIAVGMTIILNVFVAGPVSGASMNPARSLGPA  222

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            I    +D  LWIY V P  G +AG F+Y L+R   +T KP
Sbjct  223  IVMGVYDG-LWIYIVGPLVGIMAGGFVYNLIR---FTDKP  258



>tpg|DAA33874.1| TPA_inf: aquaporin NIP1;1 [Gossypium hirsutum]
Length=280

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 141/226 (62%), Gaps = 5/226 (2%)
 Frame = -3

Query  765  FNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            F+  FI+++MAE LGTY L+F  C  +         V L   +    L V+V+V+S+G I
Sbjct  41   FSVPFIQKLMAEVLGTYFLIFAGCAAVVVNVNNEKVVSLPGISMVWGLAVMVLVYSLGHI  100

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHG  406
            SGAH NP+VT+AFA+   FP  +VP Y++AQV GS  A  + RL++   ++        G
Sbjct  101  SGAHFNPAVTIAFATCKRFPLKQVPAYVLAQVIGSTLAAGTLRLLFSGPHDVFAGTSPQG  160

Query  405  CN-AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPA  229
             +  AF +EF+ TF ++F+ S +++D +  G+LAG  +G  + + V+ +GP++G SMNPA
Sbjct  161  SDLQAFGIEFIITFYLMFIISGVATDNRAIGELAGLAIGATVLINVMFAGPITGASMNPA  220

Query  228  RSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            RSLGPAI S  +   +WIY ++PT  AV+G ++Y ++R   +T KP
Sbjct  221  RSLGPAIVSNHYKG-IWIYLMSPTLEAVSGAWVYNMVR---YTDKP  262



>ref|XP_010110421.1| putative aquaporin NIP5-1 [Morus notabilis]
 gb|EXC26253.1| putative aquaporin NIP5-1 [Morus notabilis]
Length=299

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 140/214 (65%), Gaps = 3/214 (1%)
 Frame = -3

Query  747  REMMAEALGTYILVFC-ICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGAHI  571
            R++ AE +GT+IL+F    G I N +    +  L+  AA A L V+VV+ S G ISGAH+
Sbjct  74   RKIGAEFIGTFILIFAATAGPIVNEKYDHAET-LIGNAACAGLAVMVVILSTGHISGAHL  132

Query  570  NPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNAAF  391
            NPS+T+AFA+L  FPW +VP YI AQV GS+ A+ + +  +       +T P      AF
Sbjct  133  NPSLTIAFAALRHFPWVQVPAYIAAQVAGSICASFALKGAFHPFLSGGVTVPSVDTAQAF  192

Query  390  WVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLGPA  211
             +EF+ TF +LF+ +++++D +  G+LAG  VG  + L +LI+GP SGGSMNP R+LGPA
Sbjct  193  ALEFIITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPSSGGSMNPVRTLGPA  252

Query  210  IASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            IA+ ++ + LWIYFVAPT GA+ G   Y  ++L 
Sbjct  253  IAAGNY-TKLWIYFVAPTLGALVGATTYAAVKLS  285



>ref|XP_010088155.1| Aquaporin NIP2-1 [Morus notabilis]
 gb|EXB31967.1| Aquaporin NIP2-1 [Morus notabilis]
Length=299

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 140/235 (60%), Gaps = 5/235 (2%)
 Frame = -3

Query  789  WICSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIV  610
            W+  +   +   F+R++ AE +GT +LVF  CG  +       +V  L  +    L V V
Sbjct  39   WVLYYREQYQSGFLRKVFAEIIGTSLLVFVTCGAAAINASDERRVSQLGASVAGGLIVTV  98

Query  609  VVFSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSR-LIYGVEYE  433
            +++++G ISGAH+NP+VTLAFA++  FPW +VP Y  AQ  G++    + R ++Y +  +
Sbjct  99   MIYAVGHISGAHMNPAVTLAFATVRHFPWKQVPLYAAAQFTGAIMGAFTLREVLYPI--Q  156

Query  432  HMMTRPLHGCNA-AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGP  256
            H+ T    G +  A  +E + TFI++F+ S++++D +  G+LAG  VG  + +  + +GP
Sbjct  157  HLGTTTPSGTDVQALVMEIVVTFIMMFVTSAVATDTKAVGELAGIAVGSAVCITSIFAGP  216

Query  255  VSGGSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            +SGGSMNP R+LGPAIAS  +   LW+Y V P  G + G   YR++R+      P
Sbjct  217  ISGGSMNPVRTLGPAIASGCYKG-LWVYIVGPVIGTLLGSLSYRIIRVDDKAIHP  270



>emb|CDM82127.1| unnamed protein product [Triticum aestivum]
Length=268

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 135/225 (60%), Gaps = 2/225 (1%)
 Frame = -3

Query  783  CSFFPIFNKIFIREMMAEALGTYILVFCICGIISNMQLMGVQVGLLEYAATASLTVIVVV  604
            C    + +  F+++++AE LGTY ++   CG +   Q  G  V          L V+V+V
Sbjct  27   CDGSGLMSVQFMQKILAEILGTYFMILAGCGAVVVNQSTGGAVTFPGICVVWGLVVMVMV  86

Query  603  FSIGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM  424
            +S+G +SGAH NP+VT+AFA+   FPW +VP Y++AQV GS  A+++ RL +G  + H  
Sbjct  87   YSVGHVSGAHFNPAVTIAFATCRRFPWKQVPSYVLAQVLGSTLASLTLRLTFGGAHGHSF  146

Query  423  -TRPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSG  247
             T P      A  +EF+ +F ++F+ S + +D +  G+LAG  VG  + L VL +GP++G
Sbjct  147  GTMPSGSSTQAVALEFIISFYLMFVVSGVGTDDRAVGELAGLAVGATVVLNVLFAGPITG  206

Query  246  GSMNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRL  112
             SMN ARSLGPAI +  +   +W+Y V P  G VA  + Y L+RL
Sbjct  207  ASMNSARSLGPAIVACRY-GGVWVYVVGPVCGTVAAAWTYNLIRL  250



>ref|XP_010052152.1| PREDICTED: nodulin-26-like [Eucalyptus grandis]
Length=278

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 142/230 (62%), Gaps = 10/230 (4%)
 Frame = -3

Query  771  PIFNKIFIREMMAEALGTYILVFCICG--IISNMQLMGVQVGLLEYAATASLTVIVVVFS  598
            P F+  F+++ +AE LGTY L+F  CG   ++    +  Q G+   A    L V+V+V+S
Sbjct  28   PCFSLPFLQKCIAEMLGTYFLIFAGCGSVAVNKNDHVVTQPGI---AIVWGLVVMVLVYS  84

Query  597  IGPISGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMM-T  421
            +G ISGAH NP+VT+AFA    FP  +VP Y++AQ+ GS  A  + RL++   ++    T
Sbjct  85   VGHISGAHFNPAVTIAFAVTRRFPLKQVPAYVLAQLIGSTLAAGTLRLLFTGSHDQFTGT  144

Query  420  RPLHGCNAAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGS  241
            +P      +F +EF+ TF ++F+   +++D +  G+LAG  VG  I L V+ +GPV+G S
Sbjct  145  QPSGSDLQSFVIEFIITFYLMFVICGVATDTRAIGELAGLAVGSTILLNVMFTGPVTGAS  204

Query  240  MNPARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            MNPARSLGPAI S  +   +WIY +APT GA+ G  +Y  +R   +T KP
Sbjct  205  MNPARSLGPAIVSKQYKG-IWIYLLAPTMGAITGAAVYNTIR---FTNKP  250



>ref|XP_011004393.1| PREDICTED: probable aquaporin NIP5-1 [Populus euphratica]
Length=300

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 141/222 (64%), Gaps = 3/222 (1%)
 Frame = -3

Query  753  FIREMMAEALGTYILVF-CICGIISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
              R++ AE +GT+IL+F    G I N +    +  L+  AA A L V++++ S G ISGA
Sbjct  72   LTRKLGAEFVGTFILIFTATAGPIVNQKYDQAET-LIGNAACAGLAVMIIILSTGHISGA  130

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHGCNA  397
            H+NPS+T+ FA+L  FPW +VP YI AQV  S+ A+ + + ++       +T P      
Sbjct  131  HLNPSLTITFAALRHFPWVQVPAYIAAQVSASICASFALKGVFHPFMSGGVTVPSVSNGQ  190

Query  396  AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSLG  217
            AF +EF  TF +LF+ +++++D +  G+LAG  VG  + L +L++GP SGGSMNP R+LG
Sbjct  191  AFALEFFITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLG  250

Query  216  PAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKP  91
            PA+A+ ++  ++WIY VAPT GA+AG   Y L++L+     P
Sbjct  251  PAVAAGNYK-EIWIYLVAPTLGALAGAGTYTLVKLRDDEADP  291



>gb|EYU31219.1| hypothetical protein MIMGU_mgv1a018295mg [Erythranthe guttata]
Length=252

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 143/221 (65%), Gaps = 5/221 (2%)
 Frame = -3

Query  762  NKIFIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPI  586
            N    R++ AE +GT+IL+F   G  I N +  GV+  L+  A  A L V++V+ SIG I
Sbjct  21   NATLARKVGAEFVGTFILIFAAAGGPILNEKYNGVET-LIGNALCAGLAVMIVILSIGHI  79

Query  585  SGAHINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIYGVEYEHMMTRPLHG  406
            SGAH+NPSV++AFA+L  FPW +VP Y+ AQ+ G++ A+ + +  +       +T P   
Sbjct  80   SGAHLNPSVSIAFAALRHFPWVEVPAYLAAQICGAICASFALKGCFHPFLSGGVTVPSSS  139

Query  405  CNA--AFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNP  232
                 AF +EFL T+ +LF+  +L++D +  G+LAG  +G  + L +L++G  +G SMNP
Sbjct  140  VTTGQAFALEFLTTYFLLFVIIALATDTRAVGELAGIGIGAIVMLDILVAGSSTGASMNP  199

Query  231  ARSLGPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQ  109
            AR+LGPAIA+ ++ S +WIY VAPT GAVAG   Y LL+L+
Sbjct  200  ARTLGPAIAAGNYKS-IWIYIVAPTLGAVAGAATYTLLKLR  239



>gb|KEH36650.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=256

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 141/227 (62%), Gaps = 4/227 (2%)
 Frame = -3

Query  753  FIREMMAEALGTYILVFCICG-IISNMQLMGVQVGLLEYAATASLTVIVVVFSIGPISGA  577
            F+++++AE + T+ L+F  CG ++ N+    V V L   A    L V+V+V+SIG ISGA
Sbjct  22   FLQKLVAEVVRTFFLIFAGCGSVVVNLNNDKV-VTLPGIAIVWGLVVMVLVYSIGHISGA  80

Query  576  HINPSVTLAFASLGPFPWPKVPFYIMAQVGGSVFATVSSRLIY-GVEYEHMMTRPLHGCN  400
            H NP+VT+A  + G FP  +VP YI+AQV GS  A+ + +LI+ G E +   T P    +
Sbjct  81   HFNPAVTIAHTTTGRFPLKQVPAYIIAQVAGSTLASEALKLIFSGKENQFAGTLPAGLDH  140

Query  399  AAFWVEFLATfiilflasslsSDPQFTGKLAgfvvgvciglgvlISGPVSGGSMNPARSL  220
             AF VEF+ TF ++F+ S +++D +  G+LAG  VG  + L VL +GP++G SMNPARSL
Sbjct  141  QAFVVEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVMLNVLFAGPITGASMNPARSL  200

Query  219  GPAIASWSFDSDLWIYFVAPTTGAVAGVFLYRLLRLQGWTCKPADAS  79
            GPAI    +   +WIY V+P  GA+A  + Y  LR+   + +    S
Sbjct  201  GPAIVHHEYRG-IWIYMVSPILGALASTWTYTFLRITNKSVRELTKS  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2797048251622