BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30267_g1_i1 len=863 path=[1:0-862]

Length=863
                                                                      Score     E

emb|CDP16156.1|  unnamed protein product                                253   7e-77   
ref|XP_006340268.1|  PREDICTED: uncharacterized protein LOC102587334    249   3e-75   
ref|XP_011081835.1|  PREDICTED: uncharacterized protein LOC105164774    247   2e-74   
ref|XP_004245262.1|  PREDICTED: uncharacterized protein LOC101258883    244   1e-73   
ref|XP_007012055.1|  Sulfite exporter TauE/SafE family protein          244   4e-73   
ref|XP_002284175.1|  PREDICTED: uncharacterized protein LOC100267889    242   2e-72   Vitis vinifera
ref|XP_008799063.1|  PREDICTED: uncharacterized protein LOC103713782    241   2e-72   
gb|KDO79725.1|  hypothetical protein CISIN_1g011811mg                   238   4e-72   
ref|XP_008357417.1|  PREDICTED: uncharacterized protein LOC103421160    233   1e-71   
ref|XP_004291206.1|  PREDICTED: uncharacterized protein LOC101310663    238   3e-71   
gb|KDO79723.1|  hypothetical protein CISIN_1g011811mg                   237   4e-71   
ref|XP_006450629.1|  hypothetical protein CICLE_v10008167mg             238   8e-71   
ref|XP_010254104.1|  PREDICTED: uncharacterized protein LOC104595187    238   8e-71   
ref|XP_006476094.1|  PREDICTED: uncharacterized protein LOC102623437    237   2e-70   
ref|XP_008220035.1|  PREDICTED: uncharacterized protein LOC103320179    236   2e-70   
gb|EYU21882.1|  hypothetical protein MIMGU_mgv1a005504mg                236   3e-70   
gb|EYU21883.1|  hypothetical protein MIMGU_mgv1a005504mg                236   3e-70   
ref|XP_010049082.1|  PREDICTED: uncharacterized protein LOC104437756    236   3e-70   
ref|XP_008347634.1|  PREDICTED: uncharacterized protein LOC103410...    232   4e-70   
ref|XP_009367912.1|  PREDICTED: uncharacterized protein LOC103957476    236   4e-70   
ref|XP_010924740.1|  PREDICTED: uncharacterized protein LOC105047500    235   7e-70   
ref|XP_006833308.1|  hypothetical protein AMTR_s00109p00049700          234   1e-69   
gb|EEC84400.1|  hypothetical protein OsI_30977                          234   1e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_008393890.1|  PREDICTED: uncharacterized protein LOC103456039    234   2e-69   
gb|KDP37239.1|  hypothetical protein JCGZ_06295                         234   2e-69   
ref|XP_006660551.1|  PREDICTED: uncharacterized protein LOC102715329    233   2e-69   
ref|XP_010109461.1|  hypothetical protein L484_001800                   234   2e-69   
gb|EEE69518.1|  hypothetical protein OsJ_28979                          233   7e-69   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062933.1|  Os09g0344800                                       233   7e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009627765.1|  PREDICTED: uncharacterized protein LOC104118259    232   8e-69   
ref|XP_008347633.1|  PREDICTED: uncharacterized protein LOC103410...    232   8e-69   
ref|XP_010048102.1|  PREDICTED: uncharacterized protein LOC104436...    232   1e-68   
ref|XP_010048101.1|  PREDICTED: uncharacterized protein LOC104436...    231   1e-68   
ref|XP_002516035.1|  conserved hypothetical protein                     232   2e-68   Ricinus communis
ref|XP_009783706.1|  PREDICTED: uncharacterized protein LOC104232253    231   2e-68   
dbj|BAG89362.1|  unnamed protein product                                227   3e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009410875.1|  PREDICTED: uncharacterized protein LOC103992760    228   3e-68   
ref|XP_010313606.1|  PREDICTED: uncharacterized protein LOC101255958    231   3e-68   
ref|XP_002516571.1|  conserved hypothetical protein                     231   3e-68   Ricinus communis
ref|XP_003578003.1|  PREDICTED: uncharacterized protein LOC100827421    230   5e-68   
gb|KHN10230.1|  hypothetical protein glysoja_017834                     229   6e-68   
ref|XP_011019654.1|  PREDICTED: uncharacterized protein LOC105122312    230   7e-68   
ref|XP_006366207.1|  PREDICTED: uncharacterized protein LOC102587...    229   1e-67   
ref|XP_003523730.1|  PREDICTED: uncharacterized protein LOC100809318    229   1e-67   
ref|XP_006366208.1|  PREDICTED: uncharacterized protein LOC102587...    229   1e-67   
ref|XP_010249715.1|  PREDICTED: uncharacterized protein LOC104592187    229   2e-67   
ref|XP_002303288.2|  hypothetical protein POPTR_0003s05180g             229   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009388715.1|  PREDICTED: uncharacterized protein LOC103975470    229   2e-67   
gb|KDP34212.1|  hypothetical protein JCGZ_07783                         229   2e-67   
ref|XP_010249713.1|  PREDICTED: uncharacterized protein LOC104592186    229   2e-67   
gb|EAZ42610.1|  hypothetical protein OsJ_27176                          227   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003527825.1|  PREDICTED: uncharacterized protein LOC100810784    228   3e-67   
ref|XP_009623066.1|  PREDICTED: uncharacterized protein LOC104114346    228   4e-67   
ref|XP_010048100.1|  PREDICTED: uncharacterized protein LOC104436943    228   4e-67   
ref|XP_010667910.1|  PREDICTED: uncharacterized protein LOC104884...    224   5e-67   
dbj|BAK01650.1|  predicted protein                                      227   6e-67   
gb|EPS70854.1|  hypothetical protein M569_03904                         227   7e-67   
ref|NP_001061719.1|  Os08g0389700                                       227   8e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002284423.1|  PREDICTED: uncharacterized protein LOC100266912    227   8e-67   Vitis vinifera
ref|XP_009791161.1|  PREDICTED: uncharacterized protein LOC104238494    227   1e-66   
tpg|DAA61110.1|  TPA: hypothetical protein ZEAMMB73_890925              224   1e-66   
gb|EEC83519.1|  hypothetical protein OsI_29108                          226   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_006660104.1|  PREDICTED: uncharacterized protein LOC102707608    225   3e-66   
ref|XP_009409060.1|  PREDICTED: uncharacterized protein LOC103991...    225   5e-66   
ref|XP_009409059.1|  PREDICTED: uncharacterized protein LOC103991...    225   9e-66   
ref|XP_010667904.1|  PREDICTED: uncharacterized protein LOC104884...    224   1e-65   
ref|XP_008651296.1|  PREDICTED: uncharacterized protein LOC100279...    224   1e-65   
ref|XP_002309560.2|  hypothetical protein POPTR_0006s25880g             224   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_007222835.1|  hypothetical protein PRUPE_ppa005114mg             223   2e-65   
ref|XP_007137180.1|  hypothetical protein PHAVU_009G106400g             222   6e-65   
ref|XP_011026589.1|  PREDICTED: uncharacterized protein LOC105127137    222   7e-65   
ref|XP_002460084.1|  hypothetical protein SORBIDRAFT_02g022510          221   9e-65   Sorghum bicolor [broomcorn]
ref|XP_010062471.1|  PREDICTED: uncharacterized protein LOC104449877    221   1e-64   
ref|XP_002516570.1|  conserved hypothetical protein                     221   2e-64   Ricinus communis
ref|XP_010235080.1|  PREDICTED: uncharacterized protein LOC100846...    220   2e-64   
ref|XP_007216479.1|  hypothetical protein PRUPE_ppa024737mg             219   7e-64   
ref|XP_003636475.1|  hypothetical protein MTR_042s0018                  219   7e-64   
ref|XP_003574412.1|  PREDICTED: uncharacterized protein LOC100846...    219   7e-64   
ref|XP_010254877.1|  PREDICTED: uncharacterized protein LOC104595...    216   8e-64   
ref|XP_010429580.1|  PREDICTED: uncharacterized protein LOC104714041    219   1e-63   
ref|XP_010235081.1|  PREDICTED: uncharacterized protein LOC100846...    216   1e-63   
ref|XP_002878880.1|  hypothetical protein ARALYDRAFT_481426             218   2e-63   
ref|XP_008792340.1|  PREDICTED: uncharacterized protein LOC103708984    217   4e-63   
ref|XP_006405251.1|  hypothetical protein EUTSA_v10000151mg             217   4e-63   
ref|XP_008380922.1|  PREDICTED: uncharacterized protein LOC103443804    217   5e-63   
ref|XP_003574413.1|  PREDICTED: uncharacterized protein LOC100846...    216   5e-63   
ref|XP_006294138.1|  hypothetical protein CARUB_v10023132mg             217   6e-63   
ref|XP_008228544.1|  PREDICTED: uncharacterized protein LOC103327946    217   6e-63   
ref|XP_010417351.1|  PREDICTED: uncharacterized protein LOC104703106    217   7e-63   
ref|XP_002516037.1|  conserved hypothetical protein                     217   7e-63   Ricinus communis
ref|XP_011001598.1|  PREDICTED: uncharacterized protein LOC105108...    217   9e-63   
ref|XP_004136295.1|  PREDICTED: uncharacterized protein LOC101214783    216   9e-63   
ref|XP_010472595.1|  PREDICTED: uncharacterized protein LOC104752...    216   9e-63   
ref|XP_004168635.1|  PREDICTED: uncharacterized LOC101214783            216   9e-63   
ref|XP_010472594.1|  PREDICTED: uncharacterized protein LOC104752...    216   9e-63   
ref|XP_011001600.1|  PREDICTED: uncharacterized protein LOC105108...    216   9e-63   
ref|XP_004501773.1|  PREDICTED: uncharacterized protein LOC101498079    216   1e-62   
dbj|BAJ87419.1|  predicted protein                                      216   1e-62   
ref|XP_011011436.1|  PREDICTED: uncharacterized protein LOC105116...    214   1e-62   
ref|XP_007216108.1|  hypothetical protein PRUPE_ppa018715mg             215   1e-62   
gb|KDO56902.1|  hypothetical protein CISIN_1g0116821mg                  212   2e-62   
ref|XP_002299704.2|  hypothetical protein POPTR_0001s18300g             215   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010254876.1|  PREDICTED: uncharacterized protein LOC104595...    215   2e-62   
gb|KDO56900.1|  hypothetical protein CISIN_1g0116821mg                  212   3e-62   
gb|KDO56901.1|  hypothetical protein CISIN_1g0116821mg                  212   3e-62   
ref|XP_003611976.1|  Membrane protein-like protein                      215   3e-62   
gb|AAY63998.1|  unknown                                                 211   4e-62   Brassica napus [oilseed rape]
ref|XP_011011435.1|  PREDICTED: uncharacterized protein LOC105116...    215   4e-62   
gb|EMT12794.1|  hypothetical protein F775_19997                         214   4e-62   
ref|XP_003517231.1|  PREDICTED: uncharacterized protein LOC100801441    214   5e-62   
ref|XP_011011433.1|  PREDICTED: uncharacterized protein LOC105116...    215   5e-62   
ref|XP_010915823.1|  PREDICTED: uncharacterized protein LOC105040818    214   5e-62   
ref|XP_010526182.1|  PREDICTED: uncharacterized protein LOC104803...    214   5e-62   
gb|AEI72271.1|  hypothetical protein                                    211   6e-62   
ref|XP_010526181.1|  PREDICTED: uncharacterized protein LOC104803...    214   6e-62   
ref|XP_007046968.1|  DNA-directed RNA polymerase isoform 2              213   6e-62   
ref|NP_850068.1|  Sulfite exporter TauE/SafE family protein             214   9e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83221.1|  BnaA03g22850D                                          213   9e-62   
ref|XP_003636476.1|  hypothetical protein MTR_042s0018                  214   1e-61   
ref|XP_008342687.1|  PREDICTED: uncharacterized protein LOC103405461    212   1e-61   
ref|XP_010070053.1|  PREDICTED: uncharacterized protein LOC104456870    213   1e-61   
ref|XP_009403528.1|  PREDICTED: uncharacterized protein LOC103987...    213   1e-61   
ref|XP_009403527.1|  PREDICTED: uncharacterized protein LOC103987...    213   1e-61   
ref|XP_006426964.1|  hypothetical protein CICLE_v10025511mg             213   1e-61   
gb|EPS70855.1|  hypothetical protein M569_03905                         213   1e-61   
ref|XP_008338104.1|  PREDICTED: uncharacterized protein LOC103401...    213   1e-61   
ref|XP_008338105.1|  PREDICTED: uncharacterized protein LOC103401...    213   1e-61   
ref|XP_007046967.1|  Sulfite exporter TauE/SafE family protein, p...    213   1e-61   
ref|XP_009353619.1|  PREDICTED: uncharacterized protein LOC103944866    213   1e-61   
ref|XP_009371583.1|  PREDICTED: uncharacterized protein LOC103960...    213   2e-61   
ref|XP_009371582.1|  PREDICTED: uncharacterized protein LOC103960...    213   2e-61   
ref|XP_006465615.1|  PREDICTED: uncharacterized protein LOC102614...    213   2e-61   
ref|XP_009356691.1|  PREDICTED: uncharacterized protein LOC103947...    213   2e-61   
ref|XP_006465614.1|  PREDICTED: uncharacterized protein LOC102614...    213   2e-61   
ref|XP_007202022.1|  hypothetical protein PRUPE_ppa004997mg             213   2e-61   
ref|XP_002324817.1|  hypothetical protein POPTR_0018s00760g             213   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006383214.1|  hypothetical protein POPTR_0005s12570g             213   2e-61   
ref|XP_006426963.1|  hypothetical protein CICLE_v10025503mg             213   2e-61   
emb|CDY70121.1|  BnaC03g72820D                                          212   2e-61   
ref|XP_009356692.1|  PREDICTED: uncharacterized protein LOC103947...    213   3e-61   
ref|XP_002521607.1|  conserved hypothetical protein                     213   3e-61   Ricinus communis
ref|XP_009133962.1|  PREDICTED: uncharacterized protein LOC103858367    212   3e-61   
gb|KHG13748.1|  Flavonol synthase/flavanone 3-hydroxylase               207   4e-61   
ref|XP_006465610.1|  PREDICTED: uncharacterized protein LOC102613...    212   4e-61   
ref|XP_008363110.1|  PREDICTED: uncharacterized protein LOC103426...    212   4e-61   
ref|XP_008228542.1|  PREDICTED: uncharacterized protein LOC103327945    212   5e-61   
ref|XP_008363111.1|  PREDICTED: uncharacterized protein LOC103426...    211   6e-61   
gb|KHN41986.1|  hypothetical protein glysoja_003726                     203   6e-61   
gb|KHN42580.1|  hypothetical protein glysoja_042801                     211   7e-61   
ref|XP_010935066.1|  PREDICTED: uncharacterized protein LOC105055061    212   7e-61   
ref|XP_008241663.1|  PREDICTED: uncharacterized protein LOC103340075    211   8e-61   
ref|XP_008466240.1|  PREDICTED: uncharacterized protein LOC103503714    211   8e-61   
ref|XP_003537580.2|  PREDICTED: uncharacterized protein LOC100817312    203   1e-60   
emb|CDX77007.1|  BnaC04g38020D                                          210   1e-60   
emb|CDY35338.1|  BnaA04g15090D                                          210   2e-60   
ref|XP_009140696.1|  PREDICTED: uncharacterized protein LOC103864686    210   2e-60   
ref|XP_002310222.2|  hypothetical protein POPTR_0007s12700g             210   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_004956625.1|  PREDICTED: uncharacterized protein LOC101768056    210   2e-60   
ref|XP_011025767.1|  PREDICTED: uncharacterized protein LOC105126564    210   2e-60   
ref|XP_002516036.1|  conserved hypothetical protein                     209   3e-60   Ricinus communis
ref|XP_009346009.1|  PREDICTED: uncharacterized protein LOC103937781    209   6e-60   
ref|XP_010263696.1|  PREDICTED: uncharacterized protein LOC104601887    208   1e-59   
ref|XP_008228546.1|  PREDICTED: uncharacterized protein LOC103327...    208   1e-59   
ref|XP_002298219.2|  hypothetical protein POPTR_0001s18390g             207   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_004504238.1|  PREDICTED: uncharacterized protein LOC101507523    207   2e-59   
ref|XP_010999980.1|  PREDICTED: uncharacterized protein LOC105107666    207   2e-59   
ref|XP_007156932.1|  hypothetical protein PHAVU_002G029400g             206   4e-59   
ref|XP_006340601.1|  PREDICTED: uncharacterized protein LOC102601548    207   4e-59   
gb|KHN36120.1|  hypothetical protein glysoja_003243                     205   7e-59   
gb|AEI98632.1|  hypothetical protein 111018.19                          206   7e-59   
ref|XP_009788571.1|  PREDICTED: uncharacterized protein LOC104236361    206   7e-59   
gb|KDO79523.1|  hypothetical protein CISIN_1g011797mg                   202   1e-58   
ref|XP_008353719.1|  PREDICTED: uncharacterized protein LOC103417306    212   1e-58   
ref|XP_004959391.1|  PREDICTED: uncharacterized protein LOC101762929    205   1e-58   
ref|XP_004232395.1|  PREDICTED: uncharacterized protein LOC101255155    206   1e-58   
ref|XP_009631525.1|  PREDICTED: uncharacterized protein LOC104121277    206   1e-58   
ref|XP_004512031.1|  PREDICTED: uncharacterized protein LOC101496...    206   1e-58   
ref|XP_004512030.1|  PREDICTED: uncharacterized protein LOC101496...    206   1e-58   
ref|XP_004512029.1|  PREDICTED: uncharacterized protein LOC101496...    206   1e-58   
emb|CDP02034.1|  unnamed protein product                                206   1e-58   
ref|XP_004512028.1|  PREDICTED: uncharacterized protein LOC101496...    206   1e-58   
ref|XP_003527721.1|  PREDICTED: uncharacterized protein LOC100789748    206   1e-58   
ref|XP_006465613.1|  PREDICTED: uncharacterized protein LOC102613991    203   2e-58   
gb|AAL27555.1|AF420410_1  hypothetical protein                          198   2e-58   Musa acuminata [banana]
ref|XP_007024174.1|  Sulfite exporter TauE/SafE family protein, p...    205   2e-58   
ref|XP_004287906.1|  PREDICTED: uncharacterized protein LOC101304510    204   3e-58   
gb|KDP37236.1|  hypothetical protein JCGZ_06292                         202   3e-58   
ref|XP_003523605.1|  PREDICTED: uncharacterized protein LOC100816633    204   4e-58   
gb|ABR16333.1|  unknown                                                 205   4e-58   Picea sitchensis
ref|XP_007217721.1|  hypothetical protein PRUPE_ppa005105mg             204   6e-58   
ref|XP_009381051.1|  PREDICTED: uncharacterized protein LOC103969282    204   7e-58   
ref|XP_008783526.1|  PREDICTED: uncharacterized protein LOC103702749    204   1e-57   
gb|KDP38300.1|  hypothetical protein JCGZ_05186                         203   1e-57   
ref|XP_010680798.1|  PREDICTED: uncharacterized protein LOC104895...    203   1e-57   
ref|XP_010680799.1|  PREDICTED: uncharacterized protein LOC104895...    203   1e-57   
ref|XP_010649158.1|  PREDICTED: uncharacterized protein LOC100253061    203   1e-57   
gb|KDO79522.1|  hypothetical protein CISIN_1g011797mg                   202   3e-57   
gb|KDO79521.1|  hypothetical protein CISIN_1g011797mg                   202   3e-57   
ref|XP_006425693.1|  hypothetical protein CICLE_v10025446mg             202   3e-57   
ref|XP_007159526.1|  hypothetical protein PHAVU_002G244900g             201   4e-57   
ref|XP_006595132.1|  PREDICTED: uncharacterized protein LOC100789...    201   4e-57   
ref|XP_004509250.1|  PREDICTED: uncharacterized protein LOC101512581    201   5e-57   
ref|XP_003542098.1|  PREDICTED: uncharacterized protein LOC100789...    201   5e-57   
ref|XP_003546436.1|  PREDICTED: uncharacterized protein LOC100816528    201   6e-57   
ref|XP_006369186.1|  hypothetical protein POPTR_0001s18380g             199   1e-56   
ref|XP_009396550.1|  PREDICTED: uncharacterized protein LOC103981523    200   2e-56   
ref|XP_011026588.1|  PREDICTED: uncharacterized protein LOC105127135    200   2e-56   
gb|KHG02837.1|  ATP synthase subunit delta                              199   3e-56   
ref|XP_011009831.1|  PREDICTED: uncharacterized protein LOC105114838    199   3e-56   
ref|XP_008380919.1|  PREDICTED: uncharacterized protein LOC103443803    199   4e-56   
ref|XP_007156036.1|  hypothetical protein PHAVU_003G253000g             197   1e-55   
ref|XP_008670142.1|  PREDICTED: uncharacterized protein LOC103647377    195   1e-55   
ref|XP_006659358.1|  PREDICTED: uncharacterized protein LOC102716712    197   1e-55   
ref|XP_009353615.1|  PREDICTED: uncharacterized protein LOC103944864    197   2e-55   
ref|XP_010691331.1|  PREDICTED: uncharacterized protein LOC104904681    197   2e-55   
gb|EAZ06861.1|  hypothetical protein OsI_29096                          197   2e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001061712.1|  Os08g0387200                                       197   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KHN06458.1|  hypothetical protein glysoja_010802                     197   2e-55   
ref|XP_004302906.1|  PREDICTED: uncharacterized protein LOC101294092    197   3e-55   
ref|XP_004305285.1|  PREDICTED: uncharacterized protein LOC101291554    196   3e-55   
gb|ABC47842.1|  membrane protein-like protein                           196   3e-55   Glycine max [soybeans]
ref|XP_009592781.1|  PREDICTED: uncharacterized protein LOC104089...    196   4e-55   
gb|ACJ86264.1|  unknown                                                 196   4e-55   Medicago truncatula
gb|KHN32619.1|  hypothetical protein glysoja_022301                     196   4e-55   
ref|XP_003629897.1|  hypothetical protein MTR_8g088080                  196   4e-55   
ref|XP_003532779.1|  PREDICTED: uncharacterized protein LOC100801788    196   5e-55   
ref|XP_007150626.1|  hypothetical protein PHAVU_005G168100g             196   6e-55   
ref|XP_011014738.1|  PREDICTED: uncharacterized protein LOC105118467    193   6e-55   
gb|KHM98753.1|  hypothetical protein glysoja_030806                     196   6e-55   
ref|XP_006580197.1|  PREDICTED: uncharacterized protein LOC100818778    195   9e-55   
tpg|DAA39926.1|  TPA: hypothetical protein ZEAMMB73_327447              195   2e-54   
ref|XP_007159525.1|  hypothetical protein PHAVU_002G244800g             191   3e-54   
ref|XP_008228601.1|  PREDICTED: uncharacterized protein LOC103327990    192   3e-54   
ref|XP_006585192.1|  PREDICTED: uncharacterized protein LOC100801244    192   5e-54   
ref|XP_009800425.1|  PREDICTED: uncharacterized protein LOC104246...    193   6e-54   
ref|XP_006580862.1|  PREDICTED: uncharacterized protein LOC100818240    192   7e-54   
gb|AET03944.2|  sulfite exporter TauE/SafE family protein               192   9e-54   
ref|XP_003629468.1|  hypothetical protein MTR_8g077830                  192   1e-53   
ref|XP_007216194.1|  hypothetical protein PRUPE_ppa015991mg             191   1e-53   
ref|XP_002460083.1|  hypothetical protein SORBIDRAFT_02g022500          192   1e-53   Sorghum bicolor [broomcorn]
gb|AFK35007.1|  unknown                                                 192   2e-53   
gb|KHN48050.1|  hypothetical protein glysoja_015520                     191   3e-53   
ref|XP_009338073.1|  PREDICTED: uncharacterized protein LOC103930451    191   4e-53   
ref|XP_007159524.1|  hypothetical protein PHAVU_002G244800g             191   4e-53   
ref|XP_007159577.1|  hypothetical protein PHAVU_002G249100g             190   6e-53   
ref|XP_009338074.1|  PREDICTED: uncharacterized protein LOC103930452    190   6e-53   
gb|ACJ85296.1|  unknown                                                 190   6e-53   Medicago truncatula
ref|XP_006343068.1|  PREDICTED: uncharacterized protein LOC102587...    189   3e-52   
gb|AET04372.2|  sulfite exporter TauE/SafE family protein               188   4e-52   
ref|XP_004302905.1|  PREDICTED: uncharacterized protein LOC101293605    188   5e-52   
gb|EMS53169.1|  hypothetical protein TRIUR3_09961                       191   5e-52   
ref|XP_008342674.1|  PREDICTED: uncharacterized protein LOC103405448    187   5e-52   
ref|XP_009784625.1|  PREDICTED: uncharacterized protein LOC104233...    185   1e-51   
gb|AAC42255.1|  hypothetical protein                                    191   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394307.1|  PREDICTED: uncharacterized protein LOC103979817    186   3e-51   
ref|XP_007159523.1|  hypothetical protein PHAVU_002G244700g             184   4e-51   
ref|XP_009613204.1|  PREDICTED: uncharacterized protein LOC104106373    185   9e-51   
gb|AFK45505.1|  unknown                                                 180   1e-50   
ref|XP_006585193.1|  PREDICTED: uncharacterized protein LOC100802321    184   1e-50   
ref|XP_009784620.1|  PREDICTED: uncharacterized protein LOC104233...    184   1e-50   
ref|XP_006580198.1|  PREDICTED: uncharacterized protein LOC100819316    183   4e-50   
ref|XP_004235668.1|  PREDICTED: uncharacterized protein LOC101262796    182   7e-50   
gb|EYU21457.1|  hypothetical protein MIMGU_mgv1a005411mg                182   1e-49   
ref|XP_004504239.1|  PREDICTED: uncharacterized protein LOC101507...    181   1e-49   
ref|XP_011072363.1|  PREDICTED: uncharacterized protein LOC105157640    180   4e-49   
ref|XP_010113488.1|  hypothetical protein L484_026823                   180   4e-49   
ref|XP_009777903.1|  PREDICTED: uncharacterized protein LOC104227...    177   1e-48   
gb|EMT09652.1|  hypothetical protein F775_10698                         174   2e-48   
ref|XP_009777896.1|  PREDICTED: uncharacterized protein LOC104227...    178   4e-48   
ref|XP_004498484.1|  PREDICTED: uncharacterized protein LOC101508...    177   5e-48   
ref|XP_009611253.1|  PREDICTED: uncharacterized protein LOC104104...    177   6e-48   
gb|KEH35985.1|  sulfite exporter TauE/SafE family protein               175   2e-47   
ref|XP_004498483.1|  PREDICTED: uncharacterized protein LOC101508...    172   3e-46   
ref|XP_007012056.1|  Membrane protein-like, putative                    171   1e-45   
emb|CDO98032.1|  unnamed protein product                                169   4e-45   
ref|XP_010314287.1|  PREDICTED: uncharacterized protein LOC101268...    165   8e-44   
gb|KHG04871.1|  hypothetical protein F383_28778                         165   8e-44   
ref|XP_010314281.1|  PREDICTED: uncharacterized protein LOC101268...    165   1e-43   
ref|XP_009800426.1|  PREDICTED: uncharacterized protein LOC104246...    165   2e-43   
ref|XP_009592782.1|  PREDICTED: uncharacterized protein LOC104089...    164   3e-43   
ref|XP_006359451.1|  PREDICTED: uncharacterized protein LOC102590...    164   3e-43   
gb|KEH40300.1|  sulfite exporter TauE/SafE family protein               164   4e-43   
ref|XP_008228549.1|  PREDICTED: uncharacterized protein LOC103327...    163   5e-43   
gb|KHN48052.1|  hypothetical protein glysoja_015522                     162   1e-42   
ref|XP_008228548.1|  PREDICTED: uncharacterized protein LOC103327...    162   1e-42   
gb|KHN06459.1|  hypothetical protein glysoja_010803                     161   3e-42   
ref|XP_006833307.1|  hypothetical protein AMTR_s00109p00047950          159   2e-41   
ref|XP_003629896.1|  hypothetical protein MTR_8g088070                  158   4e-41   
ref|XP_007161545.1|  hypothetical protein PHAVU_001G078400g             145   1e-39   
ref|XP_006359480.1|  PREDICTED: uncharacterized protein LOC102600300    153   5e-39   
ref|XP_007161342.1|  hypothetical protein PHAVU_001G061000g             152   5e-39   
ref|XP_006596173.1|  PREDICTED: uncharacterized protein LOC100781...    151   1e-38   
gb|EMS49201.1|  hypothetical protein TRIUR3_18274                       144   6e-38   
ref|XP_003611978.1|  Membrane protein-like protein                      140   2e-37   
gb|AES94936.2|  membrane-like protein, putative                         139   2e-37   
ref|XP_003636267.1|  Membrane protein-like protein                      139   3e-37   
ref|XP_011018859.1|  PREDICTED: uncharacterized protein LOC105121770    148   3e-37   
ref|XP_011094444.1|  PREDICTED: uncharacterized protein LOC105174142    147   4e-37   
gb|EYU41559.1|  hypothetical protein MIMGU_mgv1a005977mg                147   4e-37   
ref|XP_006381336.1|  hypothetical protein POPTR_0006s11920g             147   5e-37   
ref|XP_011101500.1|  PREDICTED: uncharacterized protein LOC105179547    147   5e-37   
ref|XP_009611256.1|  PREDICTED: uncharacterized protein LOC104104...    144   9e-36   
ref|XP_010098073.1|  hypothetical protein L484_026205                   144   1e-35   
ref|XP_009777900.1|  PREDICTED: uncharacterized protein LOC104227...    143   1e-35   
ref|XP_010683928.1|  PREDICTED: uncharacterized protein LOC104898535    143   1e-35   
ref|XP_004504240.1|  PREDICTED: uncharacterized protein LOC101507...    142   2e-35   
ref|XP_002283988.1|  PREDICTED: uncharacterized protein LOC100240792    142   2e-35   
gb|EMS50771.1|  hypothetical protein TRIUR3_13143                       140   2e-35   
ref|XP_003553577.1|  PREDICTED: uncharacterized protein LOC100807336    142   5e-35   
ref|XP_006594178.1|  PREDICTED: uncharacterized protein LOC100804918    141   6e-35   
ref|XP_006651766.1|  PREDICTED: uncharacterized protein LOC102721538    140   7e-35   
gb|KEH24087.1|  sulfite exporter TauE/SafE family protein               139   9e-35   
gb|EMT22888.1|  hypothetical protein F775_28607                         140   9e-35   
ref|XP_004981916.1|  PREDICTED: uncharacterized protein LOC101758770    140   1e-34   
ref|XP_004494124.1|  PREDICTED: uncharacterized protein LOC101492516    140   1e-34   
ref|XP_004303051.1|  PREDICTED: uncharacterized protein LOC101313325    140   1e-34   
ref|XP_002528632.1|  conserved hypothetical protein                     140   2e-34   
ref|XP_010050180.1|  PREDICTED: uncharacterized protein LOC104438693    140   2e-34   
ref|XP_006838739.1|  hypothetical protein AMTR_s00002p00254220          140   2e-34   
gb|KEH24086.1|  sulfite exporter TauE/SafE family protein               139   2e-34   
ref|XP_003560372.1|  PREDICTED: uncharacterized protein LOC100844938    140   2e-34   
ref|XP_006341192.1|  PREDICTED: uncharacterized protein LOC102602443    140   2e-34   
dbj|BAK00649.1|  predicted protein                                      140   2e-34   
ref|XP_004246584.1|  PREDICTED: uncharacterized protein LOC101249675    139   3e-34   
gb|KEH24085.1|  sulfite exporter TauE/SafE family protein               139   3e-34   
gb|EYU38596.1|  hypothetical protein MIMGU_mgv1a005752mg                139   4e-34   
gb|EAY91726.1|  hypothetical protein OsI_13369                          139   5e-34   
ref|NP_001051136.1|  Os03g0726500                                       139   5e-34   
gb|KDP29233.1|  hypothetical protein JCGZ_16622                         139   6e-34   
ref|XP_009388390.1|  PREDICTED: uncharacterized protein LOC103975...    138   8e-34   
gb|EMT16950.1|  hypothetical protein F775_12779                         138   8e-34   
ref|XP_010278281.1|  PREDICTED: uncharacterized protein LOC104612536    138   1e-33   
ref|XP_008462667.1|  PREDICTED: uncharacterized protein LOC103500970    137   1e-33   
ref|XP_009388389.1|  PREDICTED: uncharacterized protein LOC103975...    138   1e-33   
ref|XP_010558974.1|  PREDICTED: uncharacterized protein LOC104827497    137   2e-33   
gb|EEE59848.1|  hypothetical protein OsJ_12424                          137   2e-33   
ref|XP_009803774.1|  PREDICTED: uncharacterized protein LOC104249090    137   2e-33   
ref|XP_010243123.1|  PREDICTED: uncharacterized protein LOC104587275    137   2e-33   
gb|KHG12656.1|  putative tripeptidyl-peptidase SED4                     137   2e-33   
ref|XP_009603782.1|  PREDICTED: uncharacterized protein LOC104098687    137   2e-33   
ref|XP_007027567.1|  Sulfite exporter TauE/SafE family protein is...    137   3e-33   
ref|XP_006588810.1|  PREDICTED: uncharacterized protein LOC100788770    137   3e-33   
ref|XP_010936218.1|  PREDICTED: uncharacterized protein LOC105055...    136   4e-33   
ref|XP_009615566.1|  PREDICTED: uncharacterized protein LOC104108278    135   6e-33   
ref|XP_004143372.1|  PREDICTED: uncharacterized protein LOC101206149    135   7e-33   
ref|XP_007145273.1|  hypothetical protein PHAVU_007G225100g             135   7e-33   
ref|NP_001168709.1|  uncharacterized protein LOC100382501               135   1e-32   
ref|XP_006410834.1|  hypothetical protein EUTSA_v10016620mg             133   2e-32   
ref|XP_008790425.1|  PREDICTED: uncharacterized protein LOC103707634    133   5e-32   
ref|XP_006410835.1|  hypothetical protein EUTSA_v10016620mg             133   6e-32   
ref|XP_009760234.1|  PREDICTED: uncharacterized protein LOC104212618    132   8e-32   
ref|XP_002463955.1|  hypothetical protein SORBIDRAFT_01g009520          132   9e-32   
ref|XP_010527869.1|  PREDICTED: uncharacterized protein LOC104805133    132   1e-31   
gb|ABK22903.1|  unknown                                                 124   1e-31   
ref|XP_009143571.1|  PREDICTED: uncharacterized protein LOC103867...    130   1e-31   
ref|XP_009143570.1|  PREDICTED: uncharacterized protein LOC103867...    130   3e-31   
gb|KHN48208.1|  hypothetical protein glysoja_007877                     130   4e-31   
gb|KHN04837.1|  hypothetical protein glysoja_047520                     130   5e-31   
ref|XP_006596174.1|  PREDICTED: uncharacterized protein LOC100781...    130   5e-31   
ref|XP_009340971.1|  PREDICTED: uncharacterized protein LOC103933044    130   5e-31   
ref|XP_009592783.1|  PREDICTED: uncharacterized protein LOC104089...    129   6e-31   
gb|KEH40299.1|  sulfite exporter TauE/SafE family protein               129   7e-31   
emb|CDP15335.1|  unnamed protein product                                129   8e-31   
ref|XP_008387475.1|  PREDICTED: uncharacterized protein LOC103449926    129   1e-30   
ref|XP_002881456.1|  hypothetical protein ARALYDRAFT_902780             129   1e-30   
gb|KHN45702.1|  hypothetical protein glysoja_036851                     129   1e-30   
gb|KHG01219.1|  hypothetical protein F383_22307                         129   2e-30   
ref|XP_007027568.1|  Sulfite exporter TauE/SafE family protein is...    129   2e-30   
ref|XP_004498087.1|  PREDICTED: uncharacterized protein LOC101512728    128   2e-30   
ref|XP_010505210.1|  PREDICTED: uncharacterized protein LOC104782082    128   3e-30   
ref|XP_010516887.1|  PREDICTED: uncharacterized protein LOC104792440    126   1e-29   
gb|KDO57298.1|  hypothetical protein CISIN_1g048232mg                   126   1e-29   
ref|XP_006481932.1|  PREDICTED: uncharacterized protein LOC102623178    126   2e-29   
ref|XP_006430350.1|  hypothetical protein CICLE_v10011694mg             125   2e-29   
ref|XP_010509452.1|  PREDICTED: uncharacterized protein LOC104785865    125   3e-29   
ref|NP_850267.1|  Sulfite exporter TauE/SafE family protein             124   5e-29   
ref|XP_007202039.1|  hypothetical protein PRUPE_ppa005330mg             124   8e-29   
emb|CDY33170.1|  BnaC04g08690D                                          124   9e-29   
ref|XP_008241334.1|  PREDICTED: uncharacterized protein LOC103339...    124   1e-28   
ref|XP_008241333.1|  PREDICTED: uncharacterized protein LOC103339...    124   1e-28   
emb|CDX75027.1|  BnaA05g07730D                                          123   1e-28   
gb|KHN06457.1|  hypothetical protein glysoja_010801                     122   2e-28   
ref|XP_006294156.1|  hypothetical protein CARUB_v10023149mg             120   1e-27   
gb|KDP37237.1|  hypothetical protein JCGZ_06293                         119   2e-27   
gb|EMS67477.1|  hypothetical protein TRIUR3_25438                       114   5e-27   
gb|KEH24089.1|  sulfite exporter TauE/SafE family protein               118   9e-27   
ref|XP_008795085.1|  PREDICTED: uncharacterized protein LOC103710932    117   1e-26   
gb|KHN02273.1|  60S ribosomal protein L24                               115   3e-25   
gb|KDO56904.1|  hypothetical protein CISIN_1g0454881mg                  103   6e-24   
gb|KEH35984.1|  sulfite exporter TauE/SafE family protein               108   1e-23   
ref|XP_006425694.1|  hypothetical protein CICLE_v10025446mg           76.3    6e-23   
gb|EMT30170.1|  hypothetical protein F775_26300                         103   5e-22   
ref|XP_002968975.1|  hypothetical protein SELMODRAFT_170159             103   5e-22   
gb|EPS64071.1|  hypothetical protein M569_10711                       98.6    6e-22   
ref|XP_007159528.1|  hypothetical protein PHAVU_002G2450000g            103   6e-22   
gb|ACY95275.1|  unknown                                               96.7    2e-21   
ref|XP_006450630.1|  hypothetical protein CICLE_v10010242mg           97.8    2e-20   
ref|XP_002460081.1|  hypothetical protein SORBIDRAFT_02g022480        97.1    1e-19   
gb|KDO79726.1|  hypothetical protein CISIN_1g039794mg                 95.1    1e-19   
gb|AES60654.2|  sulfite exporter TauE/SafE family protein             97.4    2e-19   
ref|XP_007159527.1|  hypothetical protein PHAVU_002G2450001g          89.0    6e-19   
ref|XP_009611257.1|  PREDICTED: uncharacterized protein LOC104104...  90.9    3e-17   
ref|XP_002974406.1|  hypothetical protein SELMODRAFT_414563           89.7    3e-17   
gb|EMS56955.1|  hypothetical protein TRIUR3_23950                     90.5    4e-17   
gb|KDP37238.1|  hypothetical protein JCGZ_06294                       87.8    6e-17   
ref|XP_002985707.1|  hypothetical protein SELMODRAFT_446339           88.6    9e-17   
ref|XP_006426967.1|  hypothetical protein CICLE_v10025511mg           87.0    1e-16   
ref|XP_002990023.1|  hypothetical protein SELMODRAFT_184956           86.7    3e-16   
ref|XP_007024175.1|  Sulfite exporter TauE/SafE family protein, p...  83.2    7e-16   
ref|XP_009777901.1|  PREDICTED: uncharacterized protein LOC104227...  84.3    5e-15   
ref|XP_003590403.1|  hypothetical protein MTR_1g061710                84.3    6e-15   
ref|XP_010104542.1|  hypothetical protein L484_025516                 77.4    6e-14   
ref|XP_007161546.1|  hypothetical protein PHAVU_001G078500g           76.6    1e-12   
ref|XP_007217409.1|  hypothetical protein PRUPE_ppa025656mg           75.1    1e-12   
ref|XP_007203332.1|  hypothetical protein PRUPE_ppa020174mg           72.0    5e-12   
ref|XP_006589072.1|  PREDICTED: uncharacterized protein LOC100806...  71.6    7e-12   
ref|XP_001774657.1|  predicted protein                                74.3    1e-11   
gb|KHN24669.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...  70.5    8e-11   
ref|XP_004514669.1|  PREDICTED: uncharacterized protein LOC101497...  65.5    4e-10   
gb|KEH24090.1|  sulfite exporter TauE/SafE family protein             69.3    6e-10   
ref|XP_002962601.1|  hypothetical protein SELMODRAFT_65204            67.0    3e-09   
ref|XP_002980486.1|  hypothetical protein SELMODRAFT_55219            67.0    3e-09   
gb|ACJ86237.1|  unknown                                               62.4    4e-08   
ref|XP_009611258.1|  PREDICTED: uncharacterized protein LOC104104...  63.2    6e-08   
ref|XP_001762486.1|  predicted protein                                61.6    2e-07   
ref|XP_004514668.1|  PREDICTED: uncharacterized protein LOC101497...  58.2    2e-07   
ref|XP_009777905.1|  PREDICTED: uncharacterized protein LOC104227...  60.5    5e-07   
ref|XP_007203428.1|  hypothetical protein PRUPE_ppa021619mg           58.9    1e-06   
emb|CCI45112.1|  unnamed protein product                              58.9    2e-06   
gb|KDO56903.1|  hypothetical protein CISIN_1g0454882mg                57.4    4e-06   
ref|XP_001784459.1|  predicted protein                                57.0    7e-06   
ref|XP_008793737.1|  PREDICTED: uncharacterized protein LOC103709964  56.2    1e-05   
ref|XP_002672720.1|  hypothetical protein NAEGRDRAFT_81115            55.8    2e-05   
ref|XP_009617473.1|  PREDICTED: uncharacterized protein LOC104109...  55.5    2e-05   
ref|XP_009772341.1|  PREDICTED: uncharacterized protein LOC104222...  55.1    3e-05   
ref|XP_010458554.1|  PREDICTED: uncharacterized protein LOC104739794  55.1    3e-05   
ref|XP_009772340.1|  PREDICTED: uncharacterized protein LOC104222...  54.7    4e-05   
ref|XP_009599010.1|  PREDICTED: uncharacterized protein LOC104094736  54.3    6e-05   
ref|XP_007025919.1|  Sulfite exporter TauE/SafE family protein, p...  53.9    7e-05   
ref|XP_010931407.1|  PREDICTED: uncharacterized protein LOC105052329  53.5    9e-05   
ref|XP_011086161.1|  PREDICTED: uncharacterized protein LOC105167962  53.1    1e-04   
ref|NP_001175555.1|  Os08g0389733                                     50.1    1e-04   
ref|XP_009617472.1|  PREDICTED: uncharacterized protein LOC104109...  53.1    1e-04   
ref|XP_010476082.1|  PREDICTED: uncharacterized protein LOC104755404  52.8    2e-04   
emb|CAN61520.1|  hypothetical protein VITISV_033969                   52.4    2e-04   
ref|XP_010316623.1|  PREDICTED: uncharacterized protein LOC101265...  52.8    2e-04   
ref|XP_008866040.1|  hypothetical protein, variant 2                  52.4    2e-04   
ref|XP_010923986.1|  PREDICTED: uncharacterized protein LOC105046...  52.0    3e-04   
ref|NP_172621.2|  Sulfite exporter TauE/SafE family protein           51.6    3e-04   
gb|KEH24088.1|  sulfite exporter TauE/SafE family protein             51.6    4e-04   
gb|AAF16643.1|AC011661_21  T23J18.20                                  51.6    4e-04   
ref|XP_004232753.1|  PREDICTED: uncharacterized protein LOC101265...  51.6    4e-04   
gb|ETL26984.1|  hypothetical protein L916_19423                       48.1    9e-04   
gb|ETM33474.1|  hypothetical protein L914_19303                       48.1    0.001   
ref|XP_006286061.1|  hypothetical protein CARUB_v10007594mg           50.4    0.001   
ref|XP_009760398.1|  PREDICTED: uncharacterized protein LOC104212746  50.4    0.001   
ref|XP_007217392.1|  hypothetical protein PRUPE_ppa025032mg           48.5    0.001   



>emb|CDP16156.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQIIKN+T TCSALYW+VNLLQIPVS  V+ +EA  L KGWRKI+SKG++ +N +
Sbjct  276  IAFLALQIIKNHTDTCSALYWVVNLLQIPVSFGVSSFEAFSLYKGWRKIASKGDTGTNFK  335

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG+LAGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFS+SMSVV
Sbjct  336  VHQLITYCFFGVLAGVVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSASMSVV  395

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAAFIGQH VR++I+LLGRASLIIFILAFTIFVSA++LG
Sbjct  396  EYYLLKRFPVPYALYFIAVATVAAFIGQHFVRRIIILLGRASLIIFILAFTIFVSAISLG  455

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGISNMI KI HHEYMGFENLC Y
Sbjct  456  GVGISNMIGKIEHHEYMGFENLCKY  480



>ref|XP_006340268.1| PREDICTED: uncharacterized protein LOC102587334 [Solanum tuberosum]
Length=477

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V++LALQI K YT+TCSA YW+VNLLQ+PVSV V+ YEAI L KGWR+I SKG+  ++ +
Sbjct  271  VAYLALQIGKIYTSTCSAWYWVVNLLQVPVSVGVSFYEAISLYKGWRRIQSKGDDGTDFR  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            VTQL+AYC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  331  VTQLIAYCSFGILAGMVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAF+GQHVVR+LI +LGRASLIIFILAFTIFVSA++LG
Sbjct  391  EYYLLKRFPVPYALYFVAVATIAAFVGQHVVRRLIFVLGRASLIIFILAFTIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI   EYMGFENLC Y +
Sbjct  451  GVGISNMIGKIQRDEYMGFENLCKYRI  477



>ref|XP_011081835.1| PREDICTED: uncharacterized protein LOC105164774 [Sesamum indicum]
Length=480

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQIIK YT TCS LYW+VNLLQ+PVS  V+ YEA+ L KGWRKI SKG+  +N +
Sbjct  274  IAFLALQIIKEYTTTCSTLYWVVNLLQVPVSFGVSGYEAVSLYKGWRKIGSKGDEGTNFK  333

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QLL Y FFG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  334  VHQLLTYGFFGVLAGMVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  393

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAFIGQHVVRKLI++LGRAS+IIFIL+FTIFVSA++LG
Sbjct  394  EYYLLKRFPVPYALYFVAVATIAAFIGQHVVRKLIIVLGRASIIIFILSFTIFVSAISLG  453

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGFENLC Y V
Sbjct  454  GVGISNMIGKIQRHEYMGFENLCKYAV  480



>ref|XP_004245262.1| PREDICTED: uncharacterized protein LOC101258883 [Solanum lycopersicum]
Length=476

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KNYT  C+ LYW+VNLLQIPV++ V+ YEA+ L KGWR+I SKGE  +N +
Sbjct  270  VAFLGLQIGKNYTDNCTPLYWVVNLLQIPVALGVSSYEAVSLYKGWRRIESKGEDGTNFR  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG++AG+VGGLLGLGGGFIMGP+FLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  330  VMQLIVYCFFGIVAGMVGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAA IGQHVVR++IM+LGRASLIIFILA TIFVSA++LG
Sbjct  390  EYYLLKRFPVPYALYFVAVATVAALIGQHVVRRMIMILGRASLIIFILASTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  450  GVGISNMIGKIQRHEYMGFENLCKYD  475



>ref|XP_007012055.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
 gb|EOY29674.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
Length=483

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KN+TATCS  YW++NLLQIPVS  V+LYEA+ L KGWR I+SKG+  +N +
Sbjct  277  VAFLVLQIAKNHTATCSVAYWVLNLLQIPVSFGVSLYEAVSLYKGWRVIASKGDEGTNWR  336

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  337  VHQLVTYCAFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  396

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF  VAT+AA IGQH+VRKLI++ GRASLIIFILAFTIFVSAV+LG
Sbjct  397  EYYLLKRFPVPYALYFTAVATIAALIGQHIVRKLIIVFGRASLIIFILAFTIFVSAVSLG  456

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC YE
Sbjct  457  GVGISNMIGKIERHEYMGFENLCMYE  482



>ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera]
 emb|CBI20891.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI KN TATCS  YW++N +QIPVSV V+LYEA+ L KG R I+SKG++ +N +
Sbjct  272  VAFLALQIAKNNTATCSMAYWVLNFMQIPVSVGVSLYEAVSLYKGRRIIASKGDAGTNFR  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCF G+LAG+VGGLLGLGGGFI+GPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  332  VHQLILYCFCGVLAGIVGGLLGLGGGFILGPLFLELGVPPQVSSATATFAMTFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y +LVAT+AAFIGQHVVR+LI +LGRASLIIFILAFTIF+SA++LG
Sbjct  392  EYYLLKRFPVPYAVYLVLVATIAAFIGQHVVRRLISILGRASLIIFILAFTIFISAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVG+SNMI KI  HEYMGFENLC YEV
Sbjct  452  GVGLSNMIGKIERHEYMGFENLCRYEV  478



>ref|XP_008799063.1| PREDICTED: uncharacterized protein LOC103713782 [Phoenix dactylifera]
Length=477

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQI+K YT+ CS  YWI+NLLQIPVSV VT YEA+ L +G R ISSKG+ E+N +
Sbjct  271  MAFLALQIMKEYTSNCSKSYWILNLLQIPVSVGVTSYEAVSLYRGKRVISSKGDEETNWR  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + QL  YC  G+LAGVVGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  331  ILQLFLYCATGVLAGVVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA YF+ V TVAAFIGQHVVRKLI +LGRASLIIFILAFTIFVSA++LG
Sbjct  391  EYYLLKRFPVPYAAYFVAVVTVAAFIGQHVVRKLINILGRASLIIFILAFTIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  451  GVGISNMIQKIQRHEYMGFENLCKYQ  476



>gb|KDO79725.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=365

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KN+TA+CS +YW+++LLQIPVS+ V+LYEAI L KG R I+SKG+   + +
Sbjct  159  VAFLGLQIAKNHTASCSIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFR  218

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL++YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  219  VFQLVSYCAFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  278

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAF+GQHVVRKLI+LLGRASLIIFILAF IFVSA++LG
Sbjct  279  EYYLLKRFPVPYALYFVAVATIAAFVGQHVVRKLIILLGRASLIIFILAFMIFVSAISLG  338

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI K + HEYMGFENLC Y+
Sbjct  339  GVGISNMIGKFHRHEYMGFENLCKYD  364



>ref|XP_008357417.1| PREDICTED: uncharacterized protein LOC103421160 [Malus domestica]
Length=265

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K  T TCS  YW+VNLLQIPVS+ V++YEA+ L +G R I+SKGE  ++ +
Sbjct  59   VAFLALQIAKQXTTTCSPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWK  118

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG++AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  119  VHQLVIYCLFGVIAGIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  178

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y   VATVAA +GQH+VR+LI+L GRASLIIFILAFTIFVSA++LG
Sbjct  179  EYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLG  238

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KIN +EYMGFENLC Y+V
Sbjct  239  GVGISNMIGKINRNEYMGFENLCKYDV  265



>ref|XP_004291206.1| PREDICTED: uncharacterized protein LOC101310663 [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K++T+TCS  YW+VNLLQIPVS+ V+ YEA+GL +G + ISSKGE  +N Q
Sbjct  267  VAFLALQIAKHHTSTCSVAYWVVNLLQIPVSLGVSTYEAVGLYQGRKVISSKGEEGTNWQ  326

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G++AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  327  VHQLILYCLMGVVAGIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  386

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA Y+  VAT+AA  GQHVVR+LI + GRASLIIFILAF IF+SA++LG
Sbjct  387  EYYLLKRFPVPYAAYYTAVATIAAITGQHVVRRLITIFGRASLIIFILAFMIFISAISLG  446

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG+SNMIWKINH+EYMGFENLC Y+
Sbjct  447  GVGVSNMIWKINHNEYMGFENLCKYD  472



>gb|KDO79723.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=425

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KN+TA+CS +YW+++LLQIPVS+ V+LYEAI L KG R I+SKG+   + +
Sbjct  219  VAFLGLQIAKNHTASCSIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFR  278

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL++YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  279  VFQLVSYCAFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  338

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAF+GQHVVRKLI+LLGRASLIIFILAF IFVSA++LG
Sbjct  339  EYYLLKRFPVPYALYFVAVATIAAFVGQHVVRKLIILLGRASLIIFILAFMIFVSAISLG  398

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI K + HEYMGFENLC Y+
Sbjct  399  GVGISNMIGKFHRHEYMGFENLCKYD  424



>ref|XP_006450629.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
 gb|ESR63869.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
Length=477

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KN+TA+CS +YW+++LLQIPVS+ V+LYEAI L KG R I+SKG+   + +
Sbjct  271  VAFLGLQIAKNHTASCSIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFR  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL++YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  331  VFQLVSYCAFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAFIGQHVVRKLI+LLGRASLIIFILAF IFVSA++LG
Sbjct  391  EYYLLKRFPVPYALYFVAVATIAAFIGQHVVRKLIILLGRASLIIFILAFMIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI K + HEYMGFENLC Y+
Sbjct  451  GVGISNMIGKFHRHEYMGFENLCKYD  476



>ref|XP_010254104.1| PREDICTED: uncharacterized protein LOC104595187 [Nelumbo nucifera]
Length=481

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI+KN+T TCS  YWI+NLLQIPVS  V+LYEA+ L  G R I+S G++ +N +
Sbjct  275  VAFLVLQIVKNHTTTCSISYWILNLLQIPVSCGVSLYEAVSLYNGRRVIASNGDAGTNWK  334

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAGVVGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  335  VHQLILYCCCGILAGVVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  394

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAFIGQHVVR+LI++LGRASLIIFIL+FTIFVSA++LG
Sbjct  395  EYYLLKRFPVPYALYFVAVATIAAFIGQHVVRRLIIVLGRASLIIFILSFTIFVSAISLG  454

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI+KI  HEYMGFENLC YE
Sbjct  455  GVGISNMIYKIEKHEYMGFENLCKYE  480



>ref|XP_006476094.1| PREDICTED: uncharacterized protein LOC102623437 [Citrus sinensis]
 gb|KDO79724.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=477

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KN+TA+CS +YW+++LLQIPVS+ V+LYEAI L KG R I+SKG+   + +
Sbjct  271  VAFLGLQIAKNHTASCSIVYWVLDLLQIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFR  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL++YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  331  VFQLVSYCAFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAF+GQHVVRKLI+LLGRASLIIFILAF IFVSA++LG
Sbjct  391  EYYLLKRFPVPYALYFVAVATIAAFVGQHVVRKLIILLGRASLIIFILAFMIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI K + HEYMGFENLC Y+
Sbjct  451  GVGISNMIGKFHRHEYMGFENLCKYD  476



>ref|XP_008220035.1| PREDICTED: uncharacterized protein LOC103320179 [Prunus mume]
Length=476

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI KN+T TCS +YW+VNLLQIP+S  V+LYEA+ L KG R I+SKGE  +  +
Sbjct  270  VAFLALQIAKNHTTTCSPVYWVVNLLQIPISFGVSLYEAVSLYKGRRVIASKGEQGTVWR  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGF+MGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  330  VHQLVVYCIFGVLAGIVGGLLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAF+GQH+VR+LI+L GRASLIIFILAFTIFVSA++LG
Sbjct  390  EYYLLKRFPVPYALYFVAVATIAAFVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI+ +EYMGFENLC Y+
Sbjct  450  GVGISNMIVKIHQNEYMGFENLCKYD  475



>gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=481

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            SFLALQI+K YT TCS  YW VNLLQIPVS+ V+ YEA+ L KGWRK+ SKG+  +N +V
Sbjct  276  SFLALQILKMYTTTCSVTYWTVNLLQIPVSMGVSGYEALSLYKGWRKLGSKGDEGTNFKV  335

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QLL Y FFG+LAG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVVE
Sbjct  336  HQLLVYGFFGILAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVE  395

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+YF+ VATVAAFIGQH VRKLI++LGRAS+IIFILA TIF+SA++LGG
Sbjct  396  YYLLKRFPVPYALYFVAVATVAAFIGQHFVRKLIIILGRASIIIFILASTIFISAISLGG  455

Query  320  VGISNMIWKINHHEYMGFENLCTYEV  243
            VGISNMI KI  +EYMGFENLC Y+V
Sbjct  456  VGISNMIGKIERNEYMGFENLCKYQV  481



>gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=477

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            SFLALQI+K YT TCS  YW VNLLQIPVS+ V+ YEA+ L KGWRK+ SKG+  +N +V
Sbjct  272  SFLALQILKMYTTTCSVTYWTVNLLQIPVSMGVSGYEALSLYKGWRKLGSKGDEGTNFKV  331

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QLL Y FFG+LAG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVVE
Sbjct  332  HQLLVYGFFGILAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVE  391

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+YF+ VATVAAFIGQH VRKLI++LGRAS+IIFILA TIF+SA++LGG
Sbjct  392  YYLLKRFPVPYALYFVAVATVAAFIGQHFVRKLIIILGRASIIIFILASTIFISAISLGG  451

Query  320  VGISNMIWKINHHEYMGFENLCTYEV  243
            VGISNMI KI  +EYMGFENLC Y+V
Sbjct  452  VGISNMIGKIERNEYMGFENLCKYQV  477



>ref|XP_010049082.1| PREDICTED: uncharacterized protein LOC104437756 [Eucalyptus grandis]
 gb|KCW81533.1| hypothetical protein EUGRSUZ_C02892 [Eucalyptus grandis]
Length=477

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI KN+TATCS  YW++NLLQ+P+S +V+LYEAI L KG R ISSKG+ E+  Q
Sbjct  271  VAFLGIQIAKNHTATCSVGYWVLNLLQVPISFSVSLYEAISLYKGRRVISSKGDHETTFQ  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  331  VHQLVFYCACGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF++VATVAA  GQH+VRKLI++ GRASLIIFILAFTIFVSA++LG
Sbjct  391  EYYLLNRFPVPYALYFVIVATVAALFGQHIVRKLIIVFGRASLIIFILAFTIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNM+ KI  HEYMGFENLC Y+
Sbjct  451  GVGISNMVGKIERHEYMGFENLCKYD  476



>ref|XP_008347634.1| PREDICTED: uncharacterized protein LOC103410743 isoform X2 [Malus 
domestica]
Length=360

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K  T TCS  YW+VNLLQIPVS+ V++YEA+ L +G R I+SKGE  ++ +
Sbjct  154  VAFLALQIAKQXTTTCSPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWK  213

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG++AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  214  VHQLVIYCLFGVIAGIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  273

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y   VATVAA +GQH+VR+LI+L GRASLIIFILAFTIFVSA++LG
Sbjct  274  EYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLG  333

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KIN +EYMGFENLC Y+V
Sbjct  334  GVGISNMIGKINRNEYMGFENLCKYDV  360



>ref|XP_009367912.1| PREDICTED: uncharacterized protein LOC103957476 [Pyrus x bretschneideri]
Length=475

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K  T TCS  YW+VNLLQIPVS+ V++YEA+ L +G R I+SKGE  ++ +
Sbjct  269  VAFLALQIAKQRTTTCSPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWK  328

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG++AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  329  VHQLVIYCLFGVIAGIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  388

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y   VATVAA +GQH+VR+LI+L GRASLIIFILAFTIFVSAV+LG
Sbjct  389  EYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAVSLG  448

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KIN HEYMGFENLC Y+V
Sbjct  449  GVGISNMIGKINQHEYMGFENLCKYDV  475



>ref|XP_010924740.1| PREDICTED: uncharacterized protein LOC105047500 [Elaeis guineensis]
Length=478

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQI KNYTA CS  +W++NLLQIPVS+AVTLYEAI L  G R I+SKG   +N +
Sbjct  272  IAFLILQITKNYTAICSIWFWVLNLLQIPVSMAVTLYEAISLYNGKRVIASKGHEGTNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL  YC   ++AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  332  VHQLFIYCSLAVIAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VA VAAF+GQHVVR+LI+L+GRASLIIFILAFTIFVSA++LG
Sbjct  392  EYYLLDRFPVPYALYFITVAAVAAFVGQHVVRRLIILMGRASLIIFILAFTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  452  GVGISNMIRKIKDHEYMGFENLCRYQ  477



>ref|XP_006833308.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
 gb|ERM98586.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
Length=477

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ++K  T TCS  YW++NLLQ+PV+V V+LYEA+ L KGWR I+SKG + +N +
Sbjct  271  VAFLVLQLMKTNTTTCSVEYWVLNLLQVPVAVGVSLYEAVSLYKGWRVIASKGNAGTNWK  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + QL+ YCF G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  331  IRQLVLYCFCGILAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF LVA+ AA +GQHVVRK+I+LLGRASLIIFILAFTIFVSA+TLG
Sbjct  391  EYYLLKRFPVPYAVYFALVASGAALVGQHVVRKIIILLGRASLIIFILAFTIFVSAITLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI + EYMGFENLC+Y+
Sbjct  451  GVGISNMIHKIQNREYMGFENLCSYD  476



>gb|EEC84400.1| hypothetical protein OsI_30977 [Oryza sativa Indica Group]
Length=465

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNYTATCS+ YWI+NLLQIPVSV VTLYEA+GL  G R +SSKG  ++ L+
Sbjct  259  MAFLVLQVTKNYTATCSSWYWILNLLQIPVSVGVTLYEALGLMSGKRVLSSKGNEQTTLK  318

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCFFG+ AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  319  FHQLCIYCFFGITAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  378

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF++VA +AA IGQHVVR+LI  LGRASLIIFILAF IFVSA++LG
Sbjct  379  EYYLLNRFPVPYALYFVIVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLG  438

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KIN HEYMGFENLC Y+
Sbjct  439  GVGISNMIHKINQHEYMGFENLCKYD  464



>ref|XP_008393890.1| PREDICTED: uncharacterized protein LOC103456039 [Malus domestica]
 ref|XP_008352023.1| PREDICTED: uncharacterized protein LOC103415470 [Malus domestica]
Length=489

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K  T TCS  YW+VNLLQIPVS+ V++YEA+ L +G R I+SKGE  ++ +
Sbjct  283  VAFLALQIAKQRTTTCSPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWK  342

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG++AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  343  VHQLVIYCLFGVIAGIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  402

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y   VATVAA +GQH+VR+LI+L GRASLIIFILAFTIFVSA++LG
Sbjct  403  EYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLG  462

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNM+ KIN HEYMGFENLC Y+V
Sbjct  463  GVGISNMVGKINRHEYMGFENLCKYDV  489



>gb|KDP37239.1| hypothetical protein JCGZ_06295 [Jatropha curcas]
Length=482

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT+TCSA YW++N+LQ PV++ V++Y+A+ L KG RKI SKGE+ +NL+V Q
Sbjct  279  LALQISKNYTSTCSAAYWVLNILQFPVALGVSVYQAVNLYKGRRKIKSKGEAGTNLKVHQ  338

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAGVVGGLLGLGGGFI+GPLFLELG+P  VSSATATFAM FS+SMSV+EYY
Sbjct  339  LVLYCCCGVLAGVVGGLLGLGGGFILGPLFLELGVPAQVSSATATFAMTFSASMSVIEYY  398

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF+ V+TVAAF+GQHVVR+LI +LGRAS+IIFILAFTIFVSA++LGGVG
Sbjct  399  LLKRFPVPYALYFVSVSTVAAFVGQHVVRRLISILGRASIIIFILAFTIFVSAISLGGVG  458

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+NM+ KI +H+YMGFENLCTYE
Sbjct  459  IANMVEKIENHQYMGFENLCTYE  481



>ref|XP_006660551.1| PREDICTED: uncharacterized protein LOC102715329 [Oryza brachyantha]
Length=470

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            +SFL LQ+ KNYTATCS+ YWI+NLLQIPVSV VTLYEA+GL  G R +SSKG  ++ L+
Sbjct  264  ISFLVLQVTKNYTATCSSWYWILNLLQIPVSVGVTLYEALGLMSGKRVLSSKGTEQTTLK  323

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCFFG+ AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  324  FHQLCIYCFFGITAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  383

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VA +AA IGQHVVR+LI  LGRASLIIFILAF IFVSA++LG
Sbjct  384  EYYLLNRFPVPYALYFVAVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLG  443

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC YE
Sbjct  444  GVGISNMIHKIQQHEYMGFENLCKYE  469



>ref|XP_010109461.1| hypothetical protein L484_001800 [Morus notabilis]
 gb|EXC22697.1| hypothetical protein L484_001800 [Morus notabilis]
Length=478

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            ++L LQI KNYT+TCS  YW++NL+QIPVSV VTLYEAI L KG R I+SKGE  +N +V
Sbjct  273  AYLGLQIAKNYTSTCSTAYWVLNLMQIPVSVGVTLYEAISLYKGRRIIASKGEDGTNFKV  332

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL  YC  G+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFSSSMSVVE
Sbjct  333  HQLALYCACGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVE  392

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+Y +LVAT+AA +GQH+VR+LI+L GRASLIIFILAFTIFVSA++LGG
Sbjct  393  YYLLKRFPVPYAVYLVLVATLAAVVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGG  452

Query  320  VGISNMIWKINHHEYMGFENLCTYEV  243
            VGIS+MI  I  H YMGFENLC Y+V
Sbjct  453  VGISDMIGMIERHAYMGFENLCKYKV  478



>gb|EEE69518.1| hypothetical protein OsJ_28979 [Oryza sativa Japonica Group]
Length=481

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNYTATCS+ YWI+NLLQIPVSV VT+YEA+GL  G R +SSKG  ++ L+
Sbjct  275  MAFLVLQVTKNYTATCSSWYWILNLLQIPVSVGVTMYEALGLMSGKRVLSSKGNEQTTLK  334

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCFFG+ AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  335  FHQLCIYCFFGITAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  394

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF++VA +AA IGQHVVR+LI  LGRASLIIFILAF IFVSA++LG
Sbjct  395  EYYLLNRFPVPYALYFVIVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLG  454

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI +IN HEYMGFENLC Y+
Sbjct  455  GVGISNMIHRINQHEYMGFENLCKYD  480



>ref|NP_001062933.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAD29095.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24847.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAG88213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNYTATCS+ YWI+NLLQIPVSV VT+YEA+GL  G R +SSKG  ++ L+
Sbjct  275  MAFLVLQVTKNYTATCSSWYWILNLLQIPVSVGVTMYEALGLMSGKRVLSSKGNEQTTLK  334

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCFFG+ AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  335  FHQLCIYCFFGITAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  394

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF++VA +AA IGQHVVR+LI  LGRASLIIFILAF IFVSA++LG
Sbjct  395  EYYLLNRFPVPYALYFVIVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLG  454

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI +IN HEYMGFENLC Y+
Sbjct  455  GVGISNMIHRINQHEYMGFENLCKYD  480



>ref|XP_009627765.1| PREDICTED: uncharacterized protein LOC104118259 [Nicotiana tomentosiformis]
Length=478

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQI K YTATCS  YW VNLLQIPVSV V+ +EAI L KGWRKI SKGE  +N +
Sbjct  272  IAFLALQIGKIYTATCSVWYWAVNLLQIPVSVGVSSFEAISLYKGWRKIQSKGEDGTNFR  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  332  VMQLIVYCFFGILAGLVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAAF+GQHVVR+LI++LGRASLIIFILAFTIFVSA++LG
Sbjct  392  EYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRLIVVLGRASLIIFILAFTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGFENLC YEV
Sbjct  452  GVGISNMIGKIQRHEYMGFENLCKYEV  478



>ref|XP_008347633.1| PREDICTED: uncharacterized protein LOC103410743 isoform X1 [Malus 
domestica]
Length=476

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K  T TCS  YW+VNLLQIPVS+ V++YEA+ L +G R I+SKGE  ++ +
Sbjct  270  VAFLALQIAKQXTTTCSPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG++AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  330  VHQLVIYCLFGVIAGIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y   VATVAA +GQH+VR+LI+L GRASLIIFILAFTIFVSA++LG
Sbjct  390  EYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KIN +EYMGFENLC Y+V
Sbjct  450  GVGISNMIGKINRNEYMGFENLCKYDV  476



>ref|XP_010048102.1| PREDICTED: uncharacterized protein LOC104436944 isoform X2 [Eucalyptus 
grandis]
Length=472

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V++L LQI  N TATCS  YW++N LQ+PVS+ V  YEAI L KGWR I+SKGE     Q
Sbjct  266  VAYLILQISMNQTATCSTAYWVLNFLQVPVSIGVFAYEAISLYKGWRVIASKGEKGKKWQ  325

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V +LLAYC  G+LAG++GGLLG+GGGF+MGPLFLELGIPP VSSATATF M +SSSMSVV
Sbjct  326  VRELLAYCGCGVLAGIIGGLLGIGGGFVMGPLFLELGIPPEVSSATATFGMTYSSSMSVV  385

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+LVATVAAF+GQH+VRKLI++ GRAS+IIFIL+FTIFVSA+ LG
Sbjct  386  EYYLLKRFPVPYALYFILVATVAAFVGQHIVRKLIIITGRASIIIFILSFTIFVSAILLG  445

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVG+SNMI KI  HEYMGF+NLC +
Sbjct  446  GVGLSNMIGKIERHEYMGFDNLCNF  470



>ref|XP_010048101.1| PREDICTED: uncharacterized protein LOC104436944 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80235.1| hypothetical protein EUGRSUZ_C01582 [Eucalyptus grandis]
Length=474

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V++L LQI  N TATCS  YW++N LQ+PVS+ V  YEAI L KGWR I+SKGE     Q
Sbjct  268  VAYLILQISMNQTATCSTAYWVLNFLQVPVSIGVFAYEAISLYKGWRVIASKGEKGKKWQ  327

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V +LLAYC  G+LAG++GGLLG+GGGF+MGPLFLELGIPP VSSATATF M +SSSMSVV
Sbjct  328  VRELLAYCGCGVLAGIIGGLLGIGGGFVMGPLFLELGIPPEVSSATATFGMTYSSSMSVV  387

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+LVATVAAF+GQH+VRKLI++ GRAS+IIFIL+FTIFVSA+ LG
Sbjct  388  EYYLLKRFPVPYALYFILVATVAAFVGQHIVRKLIIITGRASIIIFILSFTIFVSAILLG  447

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVG+SNMI KI  HEYMGF+NLC +
Sbjct  448  GVGLSNMIGKIERHEYMGFDNLCNF  472



>ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46455.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I KNYT TCS +YW+ NLLQIPV++ V+ Y+A+ L KG R+I+SKGE+ +N +V Q
Sbjct  280  LALEITKNYTTTCSVVYWVCNLLQIPVALGVSSYQAVSLYKGKRRIASKGEAGTNWRVHQ  339

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELG+PP VSSATATFAM FS+SMSV+EYY
Sbjct  340  LVLYCACGVLAGMVGGLLGLGGGFILGPLFLELGVPPQVSSATATFAMTFSASMSVIEYY  399

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF+ V+T+AAF+GQHVVR+LI +LGRASLIIFIL+FTIFVSA++LGGVG
Sbjct  400  LLKRFPVPYALYFVAVSTIAAFVGQHVVRRLISILGRASLIIFILSFTIFVSAISLGGVG  459

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+NMI KI +HEYMGF+N+C+YE
Sbjct  460  IANMIEKIENHEYMGFDNICSYE  482



>ref|XP_009783706.1| PREDICTED: uncharacterized protein LOC104232253 [Nicotiana sylvestris]
Length=478

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQI K YTATCS  YW VNLLQIPVSV V+ +EAI L KGWRKI SKGE  +N +
Sbjct  272  IAFLALQIGKIYTATCSVWYWGVNLLQIPVSVGVSSFEAISLYKGWRKIQSKGEDGTNFR  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  332  VMQLIVYCLFGILAGLVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAAF+GQHVVR+LI++LGRASLIIFILAFTIFVSA++LG
Sbjct  392  EYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRLIVVLGRASLIIFILAFTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGFENLC YEV
Sbjct  452  GVGISNMIGKIQRHEYMGFENLCKYEV  478



>dbj|BAG89362.1| unnamed protein product [Oryza sativa Japonica Group]
Length=349

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNY  TCS  YW++N LQIPVSV VT+YE +GL +G R ISSKG+ ++NL+
Sbjct  143  IAFLVLQVTKNYMPTCSTWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLK  202

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  203  FHQLLVYCFFGMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  262

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA++F +VA  AA IGQH+VRKLI  LGRASLIIFIL+F IF+SA++LG
Sbjct  263  EYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLG  322

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGF+N+C Y+V
Sbjct  323  GVGISNMIGKIARHEYMGFDNICNYDV  349



>ref|XP_009410875.1| PREDICTED: uncharacterized protein LOC103992760 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FL LQ+ KN+TATCS  YWI+N LQIPVSVAVTL+EAI L KG R I+S+G+  +N +
Sbjct  167  VLFLVLQVTKNHTATCSTWYWILNFLQIPVSVAVTLHEAISLYKGERVIASRGDEGTNWK  226

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V+QL  +C  G++AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSS+SVV
Sbjct  227  VSQLFVFCLSGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSLSVV  286

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VATVAAF+GQHVVR+L++L+GRASLIIFILA  IF+SA++LG
Sbjct  287  EYYLLNRFPVPYAVYFIFVATVAAFVGQHVVRRLVILIGRASLIIFILASMIFISAISLG  346

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI NMI KI  ++YMGFENLC Y+
Sbjct  347  GVGIVNMIKKIEDNDYMGFENLCRYQ  372



>ref|XP_010313606.1| PREDICTED: uncharacterized protein LOC101255958 [Solanum lycopersicum]
Length=477

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI K YT+TCS  YW+VNLLQ+PVSV ++ YEAI L KGWR+I SKG+  ++ +
Sbjct  271  VAFLALQIGKIYTSTCSVWYWVVNLLQVPVSVGISFYEAISLYKGWRRIQSKGDDGTDFR  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            VTQL+AYC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  331  VTQLIAYCSFGILAGMVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAAF+GQHVVR+LI++LGRASLIIFILAFTIFVSA++LG
Sbjct  391  EYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRLIIVLGRASLIIFILAFTIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI   EYMGFENLC Y +
Sbjct  451  GVGISNMIGKIQRDEYMGFENLCNYRI  477



>ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45912.1| conserved hypothetical protein [Ricinus communis]
Length=476

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL L I KN+   CS  YW+VNLLQIPVS+ V+ YEA+ L KG R I+SKG+  +N +
Sbjct  270  VAFLILHIAKNHLPACSIEYWVVNLLQIPVSLGVSGYEAVSLYKGRRIIASKGKEGTNFK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  330  VHQLVLYCSCGVLAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AA IGQH+VR++I++ GRASLIIFILAFTIFVSA++LG
Sbjct  390  EYYLLKRFPVPYALYFVSVATIAALIGQHIVRRMIIMFGRASLIIFILAFTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMIWKI H+EYMGFENLC YE
Sbjct  450  GVGISNMIWKIQHNEYMGFENLCKYE  475



>ref|XP_003578003.1| PREDICTED: uncharacterized protein LOC100827421 [Brachypodium 
distachyon]
Length=469

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            +SFLA+QI KNYT+TCS  YWI+N LQIPVSV VTLYEA+GL  G R +SSKG  ++ L+
Sbjct  263  LSFLAIQITKNYTSTCSTWYWILNFLQIPVSVGVTLYEALGLMNGKRVLSSKGGEQTTLK  322

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCFFG+ AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFS+SMSVV
Sbjct  323  FHQLCIYCFFGVTAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVV  382

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VA +AA IGQH VRKLI  LGRASLIIFILAF IFVSA++LG
Sbjct  383  EYYLLNRFPVPYAVYFVAVAFIAAIIGQHAVRKLISWLGRASLIIFILAFMIFVSAISLG  442

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG+SNMI KI  HEYMGFENLC Y+
Sbjct  443  GVGVSNMIQKIQRHEYMGFENLCKYD  468



>gb|KHN10230.1| hypothetical protein glysoja_017834 [Glycine soja]
Length=439

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            VSFLALQI K NYT TCS LYW++NLLQ+PVSV VT YEA  L  G R I+S GE   + 
Sbjct  232  VSFLALQIAKENYTTTCSTLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDF  291

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC FG+LAGVVGG+LGLGGGF+MGPLFLELG+PP VSSATATFAM FSSSMSV
Sbjct  292  TVLQLMIYCVFGVLAGVVGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSV  351

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            +EYYLLKRFPVPYA+YF+LVAT+AAF+GQH+VRKLI+L GRASLIIFILA TIFVSAV+L
Sbjct  352  IEYYLLKRFPVPYALYFILVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSL  411

Query  326  GGVGISNMIWKINHHEYMGFENLCTY  249
            GGVGI NM+ KI +HEYMGFE+LC Y
Sbjct  412  GGVGIVNMVHKIQNHEYMGFEDLCKY  437



>ref|XP_011019654.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
 ref|XP_011019655.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
Length=479

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI K  T+TCS  YW++NLLQIPVSV V++YEA+ L KG R I+SKG  ++N  
Sbjct  273  VAFLVLQITKEGTSTCSTAYWVLNLLQIPVSVGVSMYEAVSLYKGHRIIASKGTEDTNFT  332

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  333  VLQLVIYCLFGILAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  392

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT AAFIGQH+VR+LI++ GRASLIIFILA TIF+SA++LG
Sbjct  393  EYYLLKRFPVPYAVYFVAVATFAAFIGQHIVRRLIIMFGRASLIIFILASTIFISAISLG  452

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG++NMI KI+ HEYMGFENLC Y+
Sbjct  453  GVGVANMIGKIHRHEYMGFENLCKYD  478



>ref|XP_006366207.1| PREDICTED: uncharacterized protein LOC102587808 isoform X1 [Solanum 
tuberosum]
Length=476

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI KNYT  C+ LYW+VNLLQ+PV++ V+ YEA+ L KGWR+I SKGE  +N +
Sbjct  270  VAFLALQIGKNYTDNCTPLYWVVNLLQVPVALGVSSYEAVSLYKGWRRIESKGEDGTNFR  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG++AG+VGGLLGLGGGFIMGP+FLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  330  VMQLIVYCFFGIVAGMVGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAAF+GQHVVR++IM+LGRASLIIFILA TIFVSA++LG
Sbjct  390  EYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRMIMILGRASLIIFILASTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  450  GVGISNMIGKIQRHEYMGFENLCKYD  475



>ref|XP_003523730.1| PREDICTED: uncharacterized protein LOC100809318 [Glycine max]
Length=472

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            VSFLALQI K NYT TCS LYW++NLLQ+PVSV VT YEA  L  G R I+S GE   + 
Sbjct  265  VSFLALQIAKENYTTTCSTLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDF  324

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC FG+LAGVVGG+LGLGGGF+MGPLFLELG+PP VSSATATFAM FSSSMSV
Sbjct  325  TVLQLMIYCVFGVLAGVVGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSV  384

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            +EYYLLKRFPVPYA+YF+LVAT+AAF+GQH+VRKLI+L GRASLIIFILA TIFVSAV+L
Sbjct  385  IEYYLLKRFPVPYALYFILVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSL  444

Query  326  GGVGISNMIWKINHHEYMGFENLCTY  249
            GGVGI NM+ KI +HEYMGFE+LC Y
Sbjct  445  GGVGIVNMVHKIQNHEYMGFEDLCKY  470



>ref|XP_006366208.1| PREDICTED: uncharacterized protein LOC102587808 isoform X2 [Solanum 
tuberosum]
Length=474

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI KNYT  C+ LYW+VNLLQ+PV++ V+ YEA+ L KGWR+I SKGE  +N +
Sbjct  268  VAFLALQIGKNYTDNCTPLYWVVNLLQVPVALGVSSYEAVSLYKGWRRIESKGEDGTNFR  327

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG++AG+VGGLLGLGGGFIMGP+FLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  328  VMQLIVYCFFGIVAGMVGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVV  387

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAAF+GQHVVR++IM+LGRASLIIFILA TIFVSA++LG
Sbjct  388  EYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRMIMILGRASLIIFILASTIFVSAISLG  447

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  448  GVGISNMIGKIQRHEYMGFENLCKYD  473



>ref|XP_010249715.1| PREDICTED: uncharacterized protein LOC104592187 [Nelumbo nucifera]
Length=481

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = -1

Query  863  VSFLALQI-IKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            V+FL LQI IK+ T TCS  YW++NLLQIP++V V+ YEAI L +G R I+SKG++ +N 
Sbjct  274  VAFLVLQIVIKDSTTTCSVPYWVLNLLQIPIAVVVSGYEAISLYRGRRVIASKGDAGTNW  333

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
            +V QL+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSV
Sbjct  334  KVHQLILYCSCGVLAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSV  393

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFPVPYA+YF+ VATVAAFIGQHVVRKLI++LGRASLIIFIL+ TIFVSAV+L
Sbjct  394  VEYYLLKRFPVPYALYFVAVATVAAFIGQHVVRKLIIILGRASLIIFILSLTIFVSAVSL  453

Query  326  GGVGISNMIWKINHHEYMGFENLCTYE  246
            GGVGISNMI KI  HEYMGFENLC Y 
Sbjct  454  GGVGISNMIGKIQRHEYMGFENLCKYS  480



>ref|XP_002303288.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
 gb|EEE78267.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
Length=485

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            + LAL+I KNYT TCS  YW +NLLQIPV+V V+ YEA+ L KG RKI+SKGE+ +N + 
Sbjct  280  AILALEIGKNYTTTCSMAYWALNLLQIPVAVGVSSYEAVSLYKGTRKIASKGETGTNWRA  339

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGI P VSSATATFAM FS+SMSVVE
Sbjct  340  HQLVLYCACGVLAGIVGGLLGLGGGFILGPLFLELGISPQVSSATATFAMTFSASMSVVE  399

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+YF+ VATV+AF+GQ VVRKLI LLGRASLIIFILAFTIFVSA++LGG
Sbjct  400  YYLLKRFPVPYALYFVAVATVSAFVGQFVVRKLINLLGRASLIIFILAFTIFVSAISLGG  459

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGI NMI KI HH+YMGFEN+C+Y+
Sbjct  460  VGIVNMIEKIEHHDYMGFENICSYD  484



>ref|XP_009388715.1| PREDICTED: uncharacterized protein LOC103975470 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            VSFL LQ++K NYT+TCS  YWI+N LQIP+S+ V+ YEA+ L +G R ISSKG+  +N 
Sbjct  270  VSFLILQVLKQNYTSTCSTWYWILNFLQIPISLGVSGYEAVSLYRGKRVISSKGDEGTNF  329

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC  G+LAGVVGGLLGLGGGF++GP+FLELG+PP VSSATATFAM FSSSMSV
Sbjct  330  TVLQLVFYCSIGVLAGVVGGLLGLGGGFVLGPVFLELGVPPQVSSATATFAMTFSSSMSV  389

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+YF+ VA VAAF+GQ+VV++LI +LGRASLIIFILAFTIFVSAV+L
Sbjct  390  VEYYLLKRFPIPYALYFISVALVAAFVGQYVVKRLIDILGRASLIIFILAFTIFVSAVSL  449

Query  326  GGVGISNMIWKINHHEYMGFENLCTYEV  243
            GGVGISNM+ KI HH YMGFENLC YEV
Sbjct  450  GGVGISNMVQKIQHHGYMGFENLCKYEV  477



>gb|KDP34212.1| hypothetical protein JCGZ_07783 [Jatropha curcas]
Length=477

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V++L LQI+K++ ATCS  YW+VNLLQ+PVS  V+ YEA+ L KG RK+ SKG++ +NL+
Sbjct  271  VAYLILQIVKSHMATCSMEYWVVNLLQVPVSFGVSTYEAVSLYKGRRKLGSKGDAATNLK  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL+ YC  G+LAG+VGGLLGLGGGFIMGPLFLELGIPP V+SATAT  M FSSSMSVV
Sbjct  331  ALQLVLYCSCGVLAGIVGGLLGLGGGFIMGPLFLELGIPPEVTSATATLGMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VATVAA +GQH++ KLI + GRASLIIFILAFTIFVSA++LG
Sbjct  391  EYYLLNRFPVPYAVYFIAVATVAALVGQHIMSKLIAIFGRASLIIFILAFTIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI+ HEYMGFENLC YE
Sbjct  451  GVGISNMIGKIHRHEYMGFENLCKYE  476



>ref|XP_010249713.1| PREDICTED: uncharacterized protein LOC104592186 [Nelumbo nucifera]
Length=480

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI+KN+T TCS +YW++NLLQIPV+V V+LYE + L KGW+ I SKG+  +N +
Sbjct  274  VAFLILQIVKNHTTTCSTIYWVLNLLQIPVAVGVSLYEGVSLYKGWKVIGSKGDKGTNWR  333

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAGVVGGLLGLGGGFI+GPLFLE+G+PP VSSATATFAMMFSSSMSVV
Sbjct  334  VHQLILYCCCGILAGVVGGLLGLGGGFILGPLFLEMGVPPEVSSATATFAMMFSSSMSVV  393

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFP+PYA+YF  VATVAAF+GQ VVR+LI+LLGRASLIIFIL+ TIFVSA++LG
Sbjct  394  EYYLLKRFPIPYALYFTAVATVAAFVGQRVVRRLIILLGRASLIIFILSLTIFVSAISLG  453

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            G+GIS MI KI  HEYMG ENLC Y 
Sbjct  454  GIGISRMIHKIERHEYMGLENLCNYN  479



>gb|EAZ42610.1| hypothetical protein OsJ_27176 [Oryza sativa Japonica Group]
Length=442

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNY  TCS  YW++N LQIPVSV VT+YE +GL +G R ISSKG+ ++NL+
Sbjct  236  IAFLVLQVTKNYMPTCSTWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLK  295

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  296  FHQLLVYCFFGMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  355

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA++F +VA  AA IGQH+VRKLI  LGRASLIIFIL+F IF+SA++LG
Sbjct  356  EYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLG  415

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGF+N+C Y+V
Sbjct  416  GVGISNMIGKIARHEYMGFDNICNYDV  442



>ref|XP_003527825.1| PREDICTED: uncharacterized protein LOC100810784 [Glycine max]
 gb|KHN18202.1| hypothetical protein glysoja_025092 [Glycine soja]
Length=477

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            VSFLALQI K NYT TCS  YW++NLLQ+PVSV VT YEA  L  G R I+S GE   + 
Sbjct  270  VSFLALQIAKENYTTTCSTFYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDF  329

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC FG+LAGVVGG+LGLGGGF+MGPLFLELG+PP VSSATATFAM FSSSMSV
Sbjct  330  TVLQLIIYCVFGVLAGVVGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSV  389

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            +EYYLLKRFP+PYA+YF+LVAT+AAF+GQH+VRKLI+L GRASLIIFILA TIFVSAV+L
Sbjct  390  IEYYLLKRFPIPYALYFVLVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSL  449

Query  326  GGVGISNMIWKINHHEYMGFENLCTY  249
            GGVGI NM+ KI++HEYMGFE+LC Y
Sbjct  450  GGVGIVNMVHKIDNHEYMGFEDLCKY  475



>ref|XP_009623066.1| PREDICTED: uncharacterized protein LOC104114346 [Nicotiana tomentosiformis]
Length=483

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KNYT  C+ALYW+VNLLQIPVS+ V+ YEAI L KGWR+I SKG+  +N +
Sbjct  277  VAFLGLQIGKNYTDNCTALYWVVNLLQIPVSLGVSSYEAISLYKGWRRIESKGDQGTNFR  336

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG++AG+VGGLLGLGGGFIMGP+FLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  337  VLQLIVYCFFGVVAGMVGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVV  396

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA YF+ VATVAA +GQHVVR++I++LGRASLIIFILAFTIFVSA++LG
Sbjct  397  EYYLLKRFPVPYAAYFVAVATVAALVGQHVVRRMIVILGRASLIIFILAFTIFVSAISLG  456

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI HHEYMGFENLC Y+
Sbjct  457  GVGISNMIEKIQHHEYMGFENLCKYD  482



>ref|XP_010048100.1| PREDICTED: uncharacterized protein LOC104436943 [Eucalyptus grandis]
 gb|KCW80234.1| hypothetical protein EUGRSUZ_C01581 [Eucalyptus grandis]
Length=480

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            +FL LQI K  T TCS  YW++NLLQ+PVSV V+LYEA+ L KG R I+SKG+  + L+V
Sbjct  275  AFLVLQIAKTQTTTCSIGYWVLNLLQVPVSVGVSLYEAVSLYKGRRVIASKGDYGTGLKV  334

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
            +QL  YC  G+LAGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVE
Sbjct  335  SQLALYCACGVLAGVVGGLLGLGGGFIMGPLFLELGVPPEVSSATATFAMTFSSSMSVVE  394

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+YF++VAT AA +GQH+VR+LI++LGRASLIIFILAFTIFVSA++LGG
Sbjct  395  YYLLKRFPVPYALYFVMVATFAALVGQHIVRRLIIVLGRASLIIFILAFTIFVSAISLGG  454

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGISNMI K + HEYMGFENLC Y+
Sbjct  455  VGISNMIGKFHRHEYMGFENLCKYD  479



>ref|XP_010667910.1| PREDICTED: uncharacterized protein LOC104884897 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=347

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI+K  T++CS  YW++NLLQ+PV++ V+LYEA+GL KG R ISSKG+  +  +
Sbjct  141  VTFLVLQIVKEQTSSCSIAYWVLNLLQVPVAIGVSLYEAVGLYKGRRIISSKGDVSTTWE  200

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAG+VGGLLGLGGGFI+ PLFLELG+PP VSSATATFAM FS+SMSVV
Sbjct  201  VHQLVLYCCCGILAGIVGGLLGLGGGFILIPLFLELGVPPQVSSATATFAMAFSASMSVV  260

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFP+ YA+YFM VA VAAF+GQH+VRKLI+LLGRASLIIFILAF+IFVSAV+LG
Sbjct  261  EYYLLKRFPITYALYFMAVAIVAAFVGQHLVRKLIILLGRASLIIFILAFSIFVSAVSLG  320

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI   + H YMGFENLC Y 
Sbjct  321  GVGISNMIKMFHRHHYMGFENLCKYR  346



>dbj|BAK01650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLA+QI KNY  TCS  YW++N LQIPVSV VT+YEA+GL  G R +SSKG+ ++ L+
Sbjct  265  LAFLAIQITKNYAPTCSTWYWVLNFLQIPVSVGVTMYEALGLMNGKRVLSSKGDEQTTLK  324

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCFFG+ AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFS+SMSVV
Sbjct  325  FHQLCIYCFFGVTAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVV  384

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA YF+ VA VAA IGQHVVR+LI  LGRASLIIFILAF IFVSA++LG
Sbjct  385  EYYLLNRFPVPYAAYFVAVAFVAAIIGQHVVRRLISWLGRASLIIFILAFMIFVSAISLG  444

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  445  GVGISNMIHKIEQHEYMGFENLCKYD  470



>gb|EPS70854.1| hypothetical protein M569_03904, partial [Genlisea aurea]
Length=479

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            +FL LQIIK +T TCSAL+W+VNLLQIPV+V V+ YEA+GL  GW+K+ SKG+  +NL+ 
Sbjct  276  AFLVLQIIKTHTPTCSALFWVVNLLQIPVAVGVSGYEAVGLYMGWKKLGSKGDDGTNLKP  335

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QLL Y  FG+LAGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVVE
Sbjct  336  QQLLIYALFGILAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVE  395

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLL+RFPVPY +Y  +VAT+AAF+GQHVV +LI+++GRAS+IIFIL+FTIFVSA++LGG
Sbjct  396  YYLLRRFPVPYGVYLAVVATMAAFVGQHVVGRLIVVMGRASIIIFILSFTIFVSAISLGG  455

Query  320  VGISNMIWKINHHEYMGFENLCTY  249
            VGISNM+ KI  HEYMGF+NLC+Y
Sbjct  456  VGISNMVGKIAGHEYMGFDNLCSY  479



>ref|NP_001061719.1| Os08g0389700 [Oryza sativa Japonica Group]
 dbj|BAD05341.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD05726.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF23633.1| Os08g0389700 [Oryza sativa Japonica Group]
Length=465

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNY  TCS  YW++N LQIPVSV VT+YE +GL +G R ISSKG+ ++NL+
Sbjct  259  IAFLVLQVTKNYMPTCSTWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLK  318

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  319  FHQLLVYCFFGMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  378

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA++F +VA  AA IGQH+VRKLI  LGRASLIIFIL+F IF+SA++LG
Sbjct  379  EYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLG  438

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGF+N+C Y+V
Sbjct  439  GVGISNMIGKIARHEYMGFDNICNYDV  465



>ref|XP_002284423.1| PREDICTED: uncharacterized protein LOC100266912 [Vitis vinifera]
 emb|CBI36119.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L LQI KNYT+TCSA YW +NLLQ+PV+V V+ YEA+ L KG R I+SKGE  +N +V  
Sbjct  278  LGLQIGKNYTSTCSAGYWTLNLLQVPVAVGVSGYEAVCLYKGRRVIASKGEEGTNWKVHN  337

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  338  LIFYCGVGVLAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  397

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF+ VATVAAF+GQHVVRKLI +LGRASLIIFIL+FTIFVSA++LGGVG
Sbjct  398  LLKRFPVPYALYFVAVATVAAFLGQHVVRKLINILGRASLIIFILSFTIFVSAISLGGVG  457

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I +MI KI   +YMGFENLCTYE
Sbjct  458  IKDMIEKIEQKDYMGFENLCTYE  480



>ref|XP_009791161.1| PREDICTED: uncharacterized protein LOC104238494 [Nicotiana sylvestris]
Length=483

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI KNYT  C+ALYW+VNLLQIPVS+ V+ YEAI L KGWR+I SKGE  +N +
Sbjct  277  VAFLGLQIGKNYTDNCTALYWVVNLLQIPVSLGVSSYEAISLYKGWRRIDSKGEQGTNFR  336

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YCFFG++AG+VGGLLGLGGGFIMGP+FLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  337  VLQLIVYCFFGVVAGIVGGLLGLGGGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVV  396

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA YF+ VATVAA +GQHVVR++I++LGRASLIIFILAFTIFVSA++LG
Sbjct  397  EYYLLKRFPVPYAAYFVAVATVAALVGQHVVRRMIVILGRASLIIFILAFTIFVSAISLG  456

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFENLC Y+
Sbjct  457  GVGISNMIGKIERHEYMGFENLCKYD  482



>tpg|DAA61110.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=404

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ+ KNYTATCS  YW++NLLQ+PVSV VTLYE  GL  G R +SSKG  ++ ++
Sbjct  198  VAFLVLQVTKNYTATCSPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSGQTTMK  257

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              Q++ Y  FG+ AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  258  FHQVVVYGLFGIAAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  317

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF++VA VAA IGQHVVRKLI  LGRASLIIFILAF IFVSA++LG
Sbjct  318  EYYLLNRFPVPYAVYFIVVAFVAAIIGQHVVRKLINWLGRASLIIFILAFMIFVSAISLG  377

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG+SNM+ KI  HEYMGFE+LC Y+
Sbjct  378  GVGVSNMVHKIERHEYMGFEDLCKYD  403



>gb|EEC83519.1| hypothetical protein OsI_29108 [Oryza sativa Indica Group]
Length=466

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNY  TCS  YW++N LQIPVSV VT+YE +GL +G R ISSKG+ ++NL+
Sbjct  260  IAFLVLQVTKNYMPTCSTWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLK  319

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  320  FHQLLVYCFFGMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  379

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA++F  VA  AA IGQH+VRKLI  LGRASLIIFIL+F IF+SA++LG
Sbjct  380  EYYLLDRFPVPYALFFTTVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLG  439

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNMI KI  HEYMGF+N+C Y+V
Sbjct  440  GVGISNMIGKIARHEYMGFDNICNYDV  466



>ref|XP_006660104.1| PREDICTED: uncharacterized protein LOC102707608 [Oryza brachyantha]
Length=446

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ+ KNY  TCS  YW++N+LQIPVS+ VT+YE +GL +G R ISSKG  ++NL+
Sbjct  240  VAFLVLQVTKNYMPTCSTWYWVLNILQIPVSIGVTMYEGLGLMQGRRVISSKGTEQTNLK  299

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  300  FHQLLVYCFFGMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  359

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA++F + A  AA +GQHVVRKLI  LGRASLIIFIL+F IFVSA++LG
Sbjct  360  EYYLLNRFPVPYALFFTVTAFFAAIVGQHVVRKLINWLGRASLIIFILSFMIFVSAISLG  419

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISNM+ KI+ HEYMGF+N+C Y+V
Sbjct  420  GVGISNMVGKISRHEYMGFDNICNYDV  446



>ref|XP_009409060.1| PREDICTED: uncharacterized protein LOC103991359 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            +SFL LQ++K NYT+TCS  YWI+NLLQ+PVS+ V+ YEA+ L +G R ISSKG   +N 
Sbjct  267  ISFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKGGDGTNF  326

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC  G+LAGVVGGLLGLGGGFI+GP+FLELG+PP VSSATATFAM FSSSMSV
Sbjct  327  TVIQLVFYCLIGVLAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSV  386

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+YF+ VA VAAF+GQH+V++LI +LGRASLIIFILA TIF+SA++L
Sbjct  387  VEYYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIFISAISL  446

Query  326  GGVGISNMIWKINHHEYMGFENLCTYE  246
            GGVGISNM+ KI HHEYMGFENLC YE
Sbjct  447  GGVGISNMVQKIQHHEYMGFENLCKYE  473



>ref|XP_009409059.1| PREDICTED: uncharacterized protein LOC103991359 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            +SFL LQ++K NYT+TCS  YWI+NLLQ+PVS+ V+ YEA+ L +G R ISSKG   +N 
Sbjct  292  ISFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKGGDGTNF  351

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC  G+LAGVVGGLLGLGGGFI+GP+FLELG+PP VSSATATFAM FSSSMSV
Sbjct  352  TVIQLVFYCLIGVLAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSV  411

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+YF+ VA VAAF+GQH+V++LI +LGRASLIIFILA TIF+SA++L
Sbjct  412  VEYYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIFISAISL  471

Query  326  GGVGISNMIWKINHHEYMGFENLCTYE  246
            GGVGISNM+ KI HHEYMGFENLC YE
Sbjct  472  GGVGISNMVQKIQHHEYMGFENLCKYE  498



>ref|XP_010667904.1| PREDICTED: uncharacterized protein LOC104884897 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI+K  T++CS  YW++NLLQ+PV++ V+LYEA+GL KG R ISSKG+  +  +
Sbjct  272  VTFLVLQIVKEQTSSCSIAYWVLNLLQVPVAIGVSLYEAVGLYKGRRIISSKGDVSTTWE  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAG+VGGLLGLGGGFI+ PLFLELG+PP VSSATATFAM FS+SMSVV
Sbjct  332  VHQLVLYCCCGILAGIVGGLLGLGGGFILIPLFLELGVPPQVSSATATFAMAFSASMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFP+ YA+YFM VA VAAF+GQH+VRKLI+LLGRASLIIFILAF+IFVSAV+LG
Sbjct  392  EYYLLKRFPITYALYFMAVAIVAAFVGQHLVRKLIILLGRASLIIFILAFSIFVSAVSLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI   + H YMGFENLC Y 
Sbjct  452  GVGISNMIKMFHRHHYMGFENLCKYR  477



>ref|XP_008651296.1| PREDICTED: uncharacterized protein LOC100279247 isoform X1 [Zea 
mays]
 tpg|DAA61108.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=470

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ+ KNYTATCS  YW++NLLQ+PVSV VTLYE  GL  G R +SSKG  ++ ++
Sbjct  264  VAFLVLQVTKNYTATCSPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSGQTTMK  323

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              Q++ Y  FG+ AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  324  FHQVVVYGLFGIAAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  383

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF++VA VAA IGQHVVRKLI  LGRASLIIFILAF IFVSA++LG
Sbjct  384  EYYLLNRFPVPYAVYFIVVAFVAAIIGQHVVRKLINWLGRASLIIFILAFMIFVSAISLG  443

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG+SNM+ KI  HEYMGFE+LC Y+
Sbjct  444  GVGVSNMVHKIERHEYMGFEDLCKYD  469



>ref|XP_002309560.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
 gb|EEE93083.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
Length=479

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI K  T+TCS  YW++NLLQIPVSV V++YEA+ L KG R I+SKG   +N  
Sbjct  273  VAFLVLQITKEGTSTCSTTYWVLNLLQIPVSVGVSMYEAVSLYKGHRIIASKGTEGTNFT  332

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + QL+ YC FG+LAGVVGGLLGLGGGFIMGPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  333  ILQLVIYCLFGILAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVV  392

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPV YA+YF+ VAT AAFIGQH+VR+LI++ GRASLIIFILA TIF+SA++LG
Sbjct  393  EYYLLKRFPVSYAVYFVAVATFAAFIGQHIVRRLIIVFGRASLIIFILASTIFISAISLG  452

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG++NMI KI+ HEYMGFENLC Y+
Sbjct  453  GVGVANMIGKIHRHEYMGFENLCKYD  478



>ref|XP_007222835.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
 gb|EMJ24034.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
Length=476

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQI KN+T TCS +YW+VNLLQIP+SV V+LYEA+ L KG R I+SKGE  +  +
Sbjct  270  VAFLALQIAKNHTTTCSPVYWVVNLLQIPISVGVSLYEAVSLYKGRRVIASKGEQGTVWR  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGF+MGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  330  VHQLVIYCIFGVLAGIVGGLLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VATVAA +GQH+VR+LI+L GRASLIIFILAFTIFVSA++LG
Sbjct  390  EYYLLKRFPVPYALYFVAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI+ +EYMGFENLC Y+
Sbjct  450  GVGISNMIGKIHQNEYMGFENLCKYD  475



>ref|XP_007137180.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
 gb|ESW09174.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
Length=468

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKN-YTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            V+FLALQI+K  YT TCS LYW++NLLQ+PVSV VT YEA  L  G R I+S GE   + 
Sbjct  261  VAFLALQIVKETYTTTCSTLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEEGKDF  320

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL  YC FG+LAGVVGG+LGLGGGF+MGPLFLELG+PP VSSATATFAM FSSSMSV
Sbjct  321  TVLQLTIYCVFGILAGVVGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSV  380

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            +EYYLLKRFPVPYA+YF LVA +AAF+GQH+VRKLI++LGRASLIIFILA TIF SAV+L
Sbjct  381  IEYYLLKRFPVPYAVYFTLVAVIAAFVGQHIVRKLIIVLGRASLIIFILASTIFASAVSL  440

Query  326  GGVGISNMIWKINHHEYMGFENLCTY  249
            GGVGI NM+ KI +HEYMGF+NLC Y
Sbjct  441  GGVGIVNMVHKIQNHEYMGFDNLCKY  466



>ref|XP_011026589.1| PREDICTED: uncharacterized protein LOC105127137 [Populus euphratica]
Length=479

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQI K  T+TCS  YW++NL QIPVSV VTLYE + L  G R I+SKG+  +N +
Sbjct  273  VAFLVLQIAKESTSTCSIGYWVLNLSQIPVSVGVTLYEVVSLYTGRRVIASKGDDGTNFR  332

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G++AGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  333  VLQLMTYCALGVMAGVVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  392

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF++VA  AA IGQH+VR+LI++ GRASLIIFILAFTIFVSA+ LG
Sbjct  393  EYYLLKRFPVPYAVYFVVVAAFAALIGQHIVRRLIIVFGRASLIIFILAFTIFVSAILLG  452

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            G GISN+I KI+H EYMGFENLC ++
Sbjct  453  GFGISNIIGKIHHQEYMGFENLCKHD  478



>ref|XP_002460084.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
 gb|EER96605.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
Length=470

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ+ KNYTATCS  YW++NLLQ+PVSV VTLYE  GL  G R +SSKG  ++ ++
Sbjct  264  VAFLVLQVTKNYTATCSPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSEQTTMK  323

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              Q++ Y  FG+ AG+VGGLLGLGGGFIMGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  324  FHQVVVYGLFGIAAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  383

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF +VA  AA IGQH VRKLI  LGRASLIIFILAF IFVSA++LG
Sbjct  384  EYYLLNRFPVPYAVYFTIVAFAAALIGQHAVRKLINWLGRASLIIFILAFMIFVSALSLG  443

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNM+ KI  HEYMGFENLC Y+
Sbjct  444  GVGISNMVHKIARHEYMGFENLCKYD  469



>ref|XP_010062471.1| PREDICTED: uncharacterized protein LOC104449877 [Eucalyptus grandis]
 gb|KCW69612.1| hypothetical protein EUGRSUZ_F03030 [Eucalyptus grandis]
Length=480

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+ LAL+I KNYT TCSALYW++NLLQIPV+  V+ YEA  L  G R I+S+GE  +N +
Sbjct  274  VAILALEIGKNYTTTCSALYWVLNLLQIPVAFGVSGYEAYNLYTGRRVIASRGEVAANWK  333

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            ++QL+ YC FG+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  334  ISQLVMYCAFGIAAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  393

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AAF GQHVVR++I +LGRASLIIFILAFTIFVSA++LG
Sbjct  394  EYYLLKRFPVPYALYFVAVATIAAFTGQHVVRRIIAILGRASLIIFILAFTIFVSAISLG  453

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI NMI  I + EYMGFE+LC+ +
Sbjct  454  GVGIVNMIEDIENKEYMGFEDLCSAD  479



>ref|XP_002516570.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45911.1| conserved hypothetical protein [Ricinus communis]
Length=465

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V++LALQI KNYTATCS  YW++NLLQ+PVSV V LY A+GL +G R+I+SKG+   NL+
Sbjct  259  VAYLALQIAKNYTATCSTAYWVLNLLQVPVSVGVFLYAAVGLYRGRRRIASKGDEGMNLK  318

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLLA+C +G++AG+VGGLLGLGGGFIMGPLFLELGIPP V+SATATF M FSSSMSV 
Sbjct  319  AYQLLAFCAYGVMAGIVGGLLGLGGGFIMGPLFLELGIPPQVTSATATFGMAFSSSMSVA  378

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VAT+AAF GQH++ KLI + GRASLIIF+LAFTIFVSA+TLG
Sbjct  379  EYYLLSRFPVPYALYFIAVATIAAFAGQHIITKLIAITGRASLIIFVLAFTIFVSALTLG  438

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGISN+I KI   E M F+NLC Y
Sbjct  439  GVGISNIIGKIEKGESMEFQNLCNY  463



>ref|XP_010235080.1| PREDICTED: uncharacterized protein LOC100846223 isoform X2 [Brachypodium 
distachyon]
Length=451

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQ+ KNY ATCS  YW++NLLQIPVSV V +YEA+GL +G R ISSK   +++L+
Sbjct  245  VAFLALQVTKNYIATCSTWYWVLNLLQIPVSVGVAMYEAVGLLQGKRVISSKANDQTSLK  304

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QLL YCF GL+AGVV GLLG+GGG IMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  305  VHQLLLYCFLGLMAGVVAGLLGVGGGSIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  364

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EY+LL RFPVPYA++F ++A  AA +GQ VVRKLI LLGRASLI+FIL+  IFVSA +LG
Sbjct  365  EYFLLNRFPVPYALFFTVLAFFAAIVGQRVVRKLIGLLGRASLIVFILSMMIFVSAFSLG  424

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFEN+C Y+
Sbjct  425  GVGISNMIHKITRHEYMGFENICKYD  450



>ref|XP_007216479.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
 gb|EMJ17678.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
Length=489

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L LQI KNYT TCSA YW +NLLQ+PV+  VT+YEA+ L  G R I+SKGES ++ +V Q
Sbjct  286  LVLQISKNYTTTCSATYWALNLLQLPVAFGVTIYEAVNLYTGRRVIASKGESNTDWKVHQ  345

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ Y   G++AG+VGGLLGLGGGFI+GP+FLELGIPP VSSATATFAM FS+SMSV+EYY
Sbjct  346  LVLYSACGIIAGIVGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVIEYY  405

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL+RFPVPYA+Y   VAT++A +GQHVVRK++M+LGRAS+IIFILAFTIFVSA++LGGVG
Sbjct  406  LLRRFPVPYALYLAAVATLSAIVGQHVVRKVVMILGRASIIIFILAFTIFVSAISLGGVG  465

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++M+ KI H EYMGFEN+CTY+
Sbjct  466  IADMVEKIEHKEYMGFENICTYD  488



>ref|XP_003636475.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
 gb|KEH35983.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            +SFLALQI K NYT TCSA YWI+NLLQIP++V VT YEA  L  G R I+S G+     
Sbjct  263  ISFLALQIAKQNYTTTCSAAYWILNLLQIPIAVGVTAYEATALFTGRRVIASTGDQGKAF  322

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC FG+LAG+VGGLLGLGGGF+MGPLFLELG+PP VSSATATFAM FSSSMSV
Sbjct  323  TVGQLVIYCVFGVLAGIVGGLLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSV  382

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFPVPYA+Y  LVAT+AA +GQH+VR+LI+L GRASLIIFILA TIF+SA++L
Sbjct  383  VEYYLLKRFPVPYALYLSLVATIAALVGQHIVRRLIILFGRASLIIFILAGTIFISAISL  442

Query  326  GGVGISNMIWKINHHEYMGFENLCTY  249
            GGVGISNM+ KI +HEYMGFEN+C Y
Sbjct  443  GGVGISNMVHKIANHEYMGFENICKY  468



>ref|XP_003574412.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235079.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
Length=468

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQ+ KNY ATCS  YW++NLLQIPVSV V +YEA+GL +G R ISSK   +++L+
Sbjct  262  VAFLALQVTKNYIATCSTWYWVLNLLQIPVSVGVAMYEAVGLLQGKRVISSKANDQTSLK  321

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QLL YCF GL+AGVV GLLG+GGG IMGPLFLELG+PP VSSATATFAMMFSSSMSVV
Sbjct  322  VHQLLLYCFLGLMAGVVAGLLGVGGGSIMGPLFLELGVPPQVSSATATFAMMFSSSMSVV  381

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EY+LL RFPVPYA++F ++A  AA +GQ VVRKLI LLGRASLI+FIL+  IFVSA +LG
Sbjct  382  EYFLLNRFPVPYALFFTVLAFFAAIVGQRVVRKLIGLLGRASLIVFILSMMIFVSAFSLG  441

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNMI KI  HEYMGFEN+C Y+
Sbjct  442  GVGISNMIHKITRHEYMGFENICKYD  467



>ref|XP_010254877.1| PREDICTED: uncharacterized protein LOC104595716 isoform X2 [Nelumbo 
nucifera]
Length=345

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+ LA+QI+K Y  TCS  YW++NLLQ+P++V+V+LYEA+ L KG R I+SKG+  +NL+
Sbjct  142  VAILAVQIVKTYAKTCSFEYWLLNLLQVPIAVSVSLYEAVCLYKGKRVIASKGKEVTNLK  201

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V  L  YC  G++AGVVGGLLGLGGGFI+GPLFLELGIPP V+S+T+TF M+FSSSMSV+
Sbjct  202  VHLLFFYCLCGIVAGVVGGLLGLGGGFILGPLFLELGIPPQVASSTSTFVMVFSSSMSVI  261

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+L+ATVAAF GQHVVRKLI L GRASLIIFILA TIFVSA+ LG
Sbjct  262  QYYLLKRFPVPYAAYFVLIATVAAFTGQHVVRKLIRLFGRASLIIFILALTIFVSAIGLG  321

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+ H+EYMGFE+LC
Sbjct  322  GVGIADMVEKLEHNEYMGFESLC  344



>ref|XP_010429580.1| PREDICTED: uncharacterized protein LOC104714041 [Camelina sativa]
Length=475

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+SKG+ +SN  
Sbjct  269  VVFLALQISKQNLATCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFT  328

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  329  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  388

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VAT+AA +GQHVVR+LI  LGRASLIIFILA TIF+SA++LG
Sbjct  389  EYYLLKRFPVPYALYLVGVATIAALVGQHVVRRLISALGRASLIIFILASTIFISAISLG  448

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI NMI KI  HEYMGFENLC Y
Sbjct  449  GVGIVNMIGKIQRHEYMGFENLCKY  473



>ref|XP_010235081.1| PREDICTED: uncharacterized protein LOC100846525 isoform X2 [Brachypodium 
distachyon]
Length=373

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQI K+Y ATCS  YW++N+LQIPVSV VT+Y+A+GL +G R ISSK  ++++L+
Sbjct  167  IAFLVLQITKDYVATCSTWYWVLNILQIPVSVGVTMYQAVGLAQGKRVISSKANNQTSLK  226

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YC  GL AG +GGLLG+GGG IMGPLFLELG+PP VSSAT+TFAMMFS+SMSVV
Sbjct  227  AYQLFVYCSLGLTAGSMGGLLGVGGGIIMGPLFLELGVPPQVSSATSTFAMMFSASMSVV  286

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA +F +VA +AA +GQ VVRK+I  LGRASLIIF+L+F IF+SA++LG
Sbjct  287  EYYLLKRFPVPYAAFFTIVAFLAAIVGQGVVRKMISWLGRASLIIFVLSFMIFISALSLG  346

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG SNMI KI  HEY+GFEN+C Y+
Sbjct  347  GVGTSNMIHKITQHEYLGFENICKYD  372



>ref|XP_002878880.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55139.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   A CS  YW++NLLQIPV+V V+ YEA+ L +G R I+SKG+ +SN  
Sbjct  273  VVFLALQISKQNLANCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFT  332

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  333  VGQLVMYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  392

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VAT+AAF+GQHVVR+LI  LGRASLIIFILA  IF+SA++LG
Sbjct  393  EYYLLKRFPVPYALYLVGVATIAAFVGQHVVRRLIAALGRASLIIFILASMIFISAISLG  452

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI NMI KI  HEYMGFENLC Y
Sbjct  453  GVGIVNMIGKIQRHEYMGFENLCKY  477



>ref|XP_008792340.1| PREDICTED: uncharacterized protein LOC103708984 [Phoenix dactylifera]
Length=478

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            +SFL LQI KNYTA CS  +W++NLLQIPVS+AVTLYEAI L  G R I+S G   +N +
Sbjct  272  ISFLILQITKNYTAICSIWFWVLNLLQIPVSMAVTLYEAISLYNGKRVIASNGHEGTNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL  YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  332  VHQLFIYCSLGVLAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VA VAA++GQ+VVR+LI+L+GRASLIIFILAFTIF+SA++LG
Sbjct  392  EYYLLNRFPVPYALYFVTVAAVAAYVGQNVVRRLIILMGRASLIIFILAFTIFISAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISN+I KI HHEYMGFENLC Y+
Sbjct  452  GVGISNIIRKIKHHEYMGFENLCRYQ  477



>ref|XP_006405251.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
 gb|ESQ46704.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
Length=478

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+ +SN  
Sbjct  272  VVFLALQITKQNLATCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFT  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QLL YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  332  VGQLLLYCTFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VAT+AA +GQHV+R+LI +LGRASLIIFILA  IF+SA++LG
Sbjct  392  EYYLLKRFPVPYALYFVGVATIAALVGQHVIRRLITVLGRASLIIFILASMIFISAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI NMI K   HEYMGFENLC Y 
Sbjct  452  GVGIVNMIGKYQRHEYMGFENLCKYS  477



>ref|XP_008380922.1| PREDICTED: uncharacterized protein LOC103443804 [Malus domestica]
Length=474

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCSA YW++NLLQIPV++ V+ YEA+ L KG R I S  ES ++ +V Q
Sbjct  271  LALQIAKNYTTTCSAEYWVLNLLQIPVALGVSTYEAVNLYKGHRVIESMEESGTDWKVRQ  330

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L  YC  G+ AG+VGGLLGLGGGFI+GPLFLELG+PP VSSATATFAM FS+SMSVVEYY
Sbjct  331  LFLYCGGGITAGIVGGLLGLGGGFILGPLFLELGLPPQVSSATATFAMTFSASMSVVEYY  390

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF LVA+++A +GQHVVRK+I +LGRAS+I+FILA TIFVSA++LGGVG
Sbjct  391  LLKRFPVPYALYFALVASLSALVGQHVVRKVISVLGRASIIVFILASTIFVSAISLGGVG  450

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++M+ KI + EYMGFEN+CTY+
Sbjct  451  IASMVEKIENKEYMGFENICTYD  473



>ref|XP_003574413.1| PREDICTED: uncharacterized protein LOC100846525 isoform X1 [Brachypodium 
distachyon]
Length=461

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQI K+Y ATCS  YW++N+LQIPVSV VT+Y+A+GL +G R ISSK  ++++L+
Sbjct  255  IAFLVLQITKDYVATCSTWYWVLNILQIPVSVGVTMYQAVGLAQGKRVISSKANNQTSLK  314

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YC  GL AG +GGLLG+GGG IMGPLFLELG+PP VSSAT+TFAMMFS+SMSVV
Sbjct  315  AYQLFVYCSLGLTAGSMGGLLGVGGGIIMGPLFLELGVPPQVSSATSTFAMMFSASMSVV  374

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA +F +VA +AA +GQ VVRK+I  LGRASLIIF+L+F IF+SA++LG
Sbjct  375  EYYLLKRFPVPYAAFFTIVAFLAAIVGQGVVRKMISWLGRASLIIFVLSFMIFISALSLG  434

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG SNMI KI  HEY+GFEN+C Y+
Sbjct  435  GVGTSNMIHKITQHEYLGFENICKYD  460



>ref|XP_006294138.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
 gb|EOA27036.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
Length=472

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FLALQI K   ATCS  YW++NLLQIPV++ V+ YEA+ L +G R I+SKG+ +SN  V 
Sbjct  268  FLALQISKQNLATCSVAYWVINLLQIPVAIGVSGYEAVALYQGRRIIASKGQGDSNFTVG  327

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEY
Sbjct  328  QLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEY  387

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLLKRFPVPYA+Y + VAT+AA +GQHVVR+LI  LGRASLIIFILA  IF SA++LGGV
Sbjct  388  YLLKRFPVPYALYLVGVATIAALVGQHVVRRLIAALGRASLIIFILASMIFTSAISLGGV  447

Query  317  GISNMIWKINHHEYMGFENLCTY  249
            GI+NMI KI  HEYMGFENLC Y
Sbjct  448  GIANMIGKIQRHEYMGFENLCKY  470



>ref|XP_008228544.1| PREDICTED: uncharacterized protein LOC103327946 [Prunus mume]
Length=489

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCSA YW +NLLQIPV+ +VT YEA+ L  G R I+SKGES ++ +V Q
Sbjct  286  LALQISKNYTTTCSAAYWALNLLQIPVAFSVTTYEAVNLYLGHRVITSKGESHTDWKVHQ  345

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ Y   G++AG+VGGLLGLGGGFI+GP+FLELGIPP VSSATATFAM FS+SMSV+EYY
Sbjct  346  LVLYSACGIVAGIVGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVIEYY  405

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL RFPVPYA+Y   VAT++A +GQHVVRK++M+LGRAS+IIFILAFTIFVSA++LGGVG
Sbjct  406  LLHRFPVPYALYLAAVATLSAVVGQHVVRKVVMILGRASIIIFILAFTIFVSAISLGGVG  465

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++ + KI H EYMGFEN+CTY+
Sbjct  466  IADTVEKIEHKEYMGFENICTYD  488



>ref|XP_010417351.1| PREDICTED: uncharacterized protein LOC104703106 [Camelina sativa]
Length=481

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+SKG+ +SN  
Sbjct  275  VVFLALQISKQNLATCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFT  334

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  335  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  394

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VAT+AA +GQHVVR+LI  LGRASLIIFILA  IF+SA++LG
Sbjct  395  EYYLLKRFPVPYALYLVGVATIAALVGQHVVRRLISALGRASLIIFILASMIFISAISLG  454

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI NMI KI  HEYMGFENLC Y
Sbjct  455  GVGIVNMIGKIQRHEYMGFENLCKY  479



>ref|XP_002516037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46457.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW+++ LQIPV+V VT YEAI L KG RKI+S+GE  +N ++ Q
Sbjct  278  LALQIGKNYSTTCSVTYWVLSTLQIPVAVGVTGYEAISLYKGQRKIASRGEVSTNWKIHQ  337

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L++Y   G+LAGVVGG+LGLGGGFI+GPLFLE+GIPP VSSATATF M FS+SMSV+EYY
Sbjct  338  LVSYSAIGILAGVVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFIMAFSASMSVIEYY  397

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+Y   VA +AAF+GQHVVRKLI LLGRASLIIFILAFTIF SA++LGGVG
Sbjct  398  LLKRFPVPYALYLFAVAIIAAFVGQHVVRKLISLLGRASLIIFILAFTIFASAISLGGVG  457

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+  I KI   EYMGFE++C+YE
Sbjct  458  IARAIKKIERKEYMGFEDICSYE  480



>ref|XP_011001598.1| PREDICTED: uncharacterized protein LOC105108832 isoform X1 [Populus 
euphratica]
Length=489

 Score =   217 bits (552),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            + LAL+I KNYT TCS  YW +NLLQIPV+V V+ YEA+ L KG RKI+SKGE+ +N + 
Sbjct  284  AILALEIAKNYTTTCSMAYWALNLLQIPVAVGVSSYEAVSLYKGRRKIASKGETGTNWRA  343

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YC  G+LAG+VGGLLGLGGGFI+GPLFL+LGIPP VSSATATFAM FS+SMSVVE
Sbjct  344  HQLVLYCACGVLAGMVGGLLGLGGGFILGPLFLDLGIPPQVSSATATFAMTFSASMSVVE  403

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+YF+ VATVAAF+GQ VVRKLI LLGRASLIIFIL+FTIFVSA++LGG
Sbjct  404  YYLLKRFPVPYALYFVAVATVAAFVGQFVVRKLINLLGRASLIIFILSFTIFVSAISLGG  463

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGI NMI KI HHEYMGFEN+C+YE
Sbjct  464  VGIENMIEKIEHHEYMGFENICSYE  488



>ref|XP_004136295.1| PREDICTED: uncharacterized protein LOC101214783 [Cucumis sativus]
 gb|KGN60205.1| hypothetical protein Csa_3G889130 [Cucumis sativus]
Length=471

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            +FLA+QI K ++  CS  YW++N LQ+P++  V+ YEA+GL KG RKI+S G  +++ ++
Sbjct  266  AFLAIQITKKHSPNCSWEYWLLNFLQVPIAFGVSGYEAVGLYKGKRKIASLGNQKTDFRI  325

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YCF G++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSA+ATF M FSSSMSV++
Sbjct  326  YQLVLYCFMGIIAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSASATFGMTFSSSMSVIQ  385

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLL RFPVPYA+YF +VA VAAF+GQHV+RKLI+L+GRASLIIFIL+FTIFVSA++LGG
Sbjct  386  YYLLNRFPVPYALYFTIVAAVAAFVGQHVIRKLILLIGRASLIIFILSFTIFVSALSLGG  445

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGIS MI +I  HEYMGFENLC Y+
Sbjct  446  VGISKMIGQIQRHEYMGFENLCKYD  470



>ref|XP_010472595.1| PREDICTED: uncharacterized protein LOC104752213 isoform X2 [Camelina 
sativa]
Length=472

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+SKG+ +SN  
Sbjct  266  VVFLALQISKQNLATCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFT  325

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  326  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  385

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VAT+AA +GQHVVR+LI  LGRASLIIFILA  IF+SA++LG
Sbjct  386  EYYLLKRFPVPYALYLVGVATIAAIVGQHVVRRLISALGRASLIIFILASMIFISAISLG  445

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI NMI KI  HEYMGFENLC Y
Sbjct  446  GVGIVNMIGKIQRHEYMGFENLCKY  470



>ref|XP_004168635.1| PREDICTED: uncharacterized LOC101214783 [Cucumis sativus]
Length=471

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            +FLA+QI K ++  CS  YW++N LQ+P++  V+ YEA+GL KG RKI+S G  +++ ++
Sbjct  266  AFLAIQITKKHSPNCSWEYWLLNFLQVPIAFGVSGYEAVGLYKGKRKIASLGNQKTDFRI  325

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YCF G++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSA+ATF M FSSSMSV++
Sbjct  326  YQLVLYCFMGIIAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSASATFGMTFSSSMSVIQ  385

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLL RFPVPYA+YF +VA VAAF+GQHV+RKLI+L+GRASLIIFIL+FTIFVSA++LGG
Sbjct  386  YYLLNRFPVPYALYFTIVAAVAAFVGQHVIRKLILLIGRASLIIFILSFTIFVSALSLGG  445

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGIS MI +I  HEYMGFENLC Y+
Sbjct  446  VGISKMIGQIQRHEYMGFENLCKYD  470



>ref|XP_010472594.1| PREDICTED: uncharacterized protein LOC104752213 isoform X1 [Camelina 
sativa]
Length=475

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+SKG+ +SN  
Sbjct  269  VVFLALQISKQNLATCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFT  328

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  329  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  388

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VAT+AA +GQHVVR+LI  LGRASLIIFILA  IF+SA++LG
Sbjct  389  EYYLLKRFPVPYALYLVGVATIAAIVGQHVVRRLISALGRASLIIFILASMIFISAISLG  448

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI NMI KI  HEYMGFENLC Y
Sbjct  449  GVGIVNMIGKIQRHEYMGFENLCKY  473



>ref|XP_011001600.1| PREDICTED: uncharacterized protein LOC105108832 isoform X2 [Populus 
euphratica]
Length=485

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            + LAL+I KNYT TCS  YW +NLLQIPV+V V+ YEA+ L KG RKI+SKGE+ +N + 
Sbjct  280  AILALEIAKNYTTTCSMAYWALNLLQIPVAVGVSSYEAVSLYKGRRKIASKGETGTNWRA  339

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YC  G+LAG+VGGLLGLGGGFI+GPLFL+LGIPP VSSATATFAM FS+SMSVVE
Sbjct  340  HQLVLYCACGVLAGMVGGLLGLGGGFILGPLFLDLGIPPQVSSATATFAMTFSASMSVVE  399

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFPVPYA+YF+ VATVAAF+GQ VVRKLI LLGRASLIIFIL+FTIFVSA++LGG
Sbjct  400  YYLLKRFPVPYALYFVAVATVAAFVGQFVVRKLINLLGRASLIIFILSFTIFVSAISLGG  459

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGI NMI KI HHEYMGFEN+C+YE
Sbjct  460  VGIENMIEKIEHHEYMGFENICSYE  484



>ref|XP_004501773.1| PREDICTED: uncharacterized protein LOC101498079 [Cicer arietinum]
Length=484

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            VSFLALQI K NYT TCS  YW++NLLQIP+SV VT YEA  L  G R I+S G+     
Sbjct  277  VSFLALQITKQNYTTTCSTAYWVLNLLQIPISVGVTGYEATALFTGKRVIASTGDQGKEF  336

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC FG+LAG+VGGLLGLGGGF+MGPLFLELG+PP VSSATATFAM FSSSMSV
Sbjct  337  TVFQLVIYCVFGVLAGIVGGLLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSV  396

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+Y  LVAT+AA +GQH+VRKLI+L GRASLIIFILA TIF+SA++L
Sbjct  397  VEYYLLKRFPIPYALYLGLVATIAAVVGQHIVRKLIILFGRASLIIFILAGTIFISAISL  456

Query  326  GGVGISNMIWKINHHEYMGFENLCTY  249
            GGVGISNM+ KI  HEYMGFEN+C Y
Sbjct  457  GGVGISNMVHKIASHEYMGFENICKY  482



>dbj|BAJ87419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLALQ+ KNY ATCS  YW++NLLQIPVSV V +YEA+GL +G R ISSK   E++L+
Sbjct  268  VAFLALQLAKNYMATCSISYWVLNLLQIPVSVGVAMYEAVGLMQGRRVISSKRNEENSLR  327

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCF G+ AGVV GLLG+GGG IMGPLFLELG+PP V+SATATFAMMFS+SMSVV
Sbjct  328  AHQLLVYCFLGVTAGVVAGLLGVGGGSIMGPLFLELGVPPQVASATATFAMMFSASMSVV  387

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+Y  ++A +AA IGQ VVRKLI LLGRAS+IIFIL+F IF+SA++LG
Sbjct  388  EYYLLNRFPVPYALYLTILAFLAAIIGQRVVRKLIDLLGRASIIIFILSFMIFISALSLG  447

Query  323  GVGISNMIWKINHHEYMGFENLCTYEV  243
            GVGISN I KI   EYMGFEN+C Y V
Sbjct  448  GVGISNTIHKIARREYMGFENICKYGV  474



>ref|XP_011011436.1| PREDICTED: uncharacterized protein LOC105116005 isoform X3 [Populus 
euphratica]
Length=422

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N+LQIPV+  V+ YEA  L KG RKI+SKG++ +N ++ Q
Sbjct  222  LALQIGKNYSTTCSVAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQ  281

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YCF GLLAG+VGG+LGLGGGFI+GPLFLE+GIPP VSSATATF+MMFS+SMSVVEYY
Sbjct  282  LVLYCFIGLLAGIVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYY  341

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  VAT+AA +GQHV+RKLI +LGRASLIIF LAFTIFVSA+ LGGVG
Sbjct  342  LLKRFPVPYALYFFAVATLAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVG  401

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I+ M+ +I   EYMGFEN+C+
Sbjct  402  IARMVRRIERKEYMGFENICS  422



>ref|XP_007216108.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
 gb|EMJ17307.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
Length=439

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCSA YW++NLLQIPV+  V+ YEA+ L KG R I+SK ES ++ +V Q
Sbjct  239  LALQIAKNYTTTCSAEYWVLNLLQIPVAFGVSTYEAVNLYKGRRVIASKEESGTDWKVHQ  298

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVVEYY
Sbjct  299  LVLYCACGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYY  358

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF ++++++A +GQHVVRK+I +LGRAS+IIFILA TIFVSA++LGGVG
Sbjct  359  LLKRFPVPYAVYFAVMSSLSALVGQHVVRKVISVLGRASIIIFILASTIFVSAISLGGVG  418

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I++MI KI H EYMGFEN+C 
Sbjct  419  IADMIGKIEHKEYMGFENICN  439



>gb|KDO56902.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=348

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS LYW++NLLQIPV+  V+ YEA+ L KG RKI+SKG+  +  + +Q
Sbjct  147  LALQIAKNYTTTCSVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQ  206

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA FA+ FSSSMSVVEYY
Sbjct  207  LVFYCACGITAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYY  266

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  ++ +AAF+GQHV++KLI +LGRAS+IIF L+F IFVSA++LGGVG
Sbjct  267  LLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSALSLGGVG  326

Query  314  ISNMIWKINHHEYMGFENLC  255
            ++ MI +I H EYMGF+N+C
Sbjct  327  LAKMIKRIEHKEYMGFDNIC  346



>ref|XP_002299704.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
 gb|EEE84509.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
Length=475

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N+LQIPV+  V+ YEA  L KG RKI+SKG++ +N ++ Q
Sbjct  275  LALQIGKNYSTTCSMAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQ  334

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  GLLAGVVGG+LGLGGGFI+GPLFLE+GIPP VSSATATFAMMFS+SMSVVEYY
Sbjct  335  LVLYCIIGLLAGVVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMMFSASMSVVEYY  394

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  VATVAA +GQHV+RKLI +LGRASLIIF LAFTIFVSA+ LGGVG
Sbjct  395  LLKRFPVPYALYFFAVATVAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVG  454

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I+ M+ +I   EYMGFEN+C+
Sbjct  455  IARMVKRIERKEYMGFENICS  475



>ref|XP_010254876.1| PREDICTED: uncharacterized protein LOC104595716 isoform X1 [Nelumbo 
nucifera]
Length=471

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+ LA+QI+K Y  TCS  YW++NLLQ+P++V+V+LYEA+ L KG R I+SKG+  +NL+
Sbjct  268  VAILAVQIVKTYAKTCSFEYWLLNLLQVPIAVSVSLYEAVCLYKGKRVIASKGKEVTNLK  327

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V  L  YC  G++AGVVGGLLGLGGGFI+GPLFLELGIPP V+S+T+TF M+FSSSMSV+
Sbjct  328  VHLLFFYCLCGIVAGVVGGLLGLGGGFILGPLFLELGIPPQVASSTSTFVMVFSSSMSVI  387

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+L+ATVAAF GQHVVRKLI L GRASLIIFILA TIFVSA+ LG
Sbjct  388  QYYLLKRFPVPYAAYFVLIATVAAFTGQHVVRKLIRLFGRASLIIFILALTIFVSAIGLG  447

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+ H+EYMGFE+LC
Sbjct  448  GVGIADMVEKLEHNEYMGFESLC  470



>gb|KDO56900.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=355

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS LYW++NLLQIPV+  V+ YEA+ L KG RKI+SKG+  +  + +Q
Sbjct  154  LALQIAKNYTTTCSVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQ  213

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA FA+ FSSSMSVVEYY
Sbjct  214  LVFYCACGITAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYY  273

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  ++ +AAF+GQHV++KLI +LGRAS+IIF L+F IFVSA++LGGVG
Sbjct  274  LLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSALSLGGVG  333

Query  314  ISNMIWKINHHEYMGFENLC  255
            ++ MI +I H EYMGF+N+C
Sbjct  334  LAKMIKRIEHKEYMGFDNIC  353



>gb|KDO56901.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=353

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS LYW++NLLQIPV+  V+ YEA+ L KG RKI+SKG+  +  + +Q
Sbjct  152  LALQIAKNYTTTCSVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQ  211

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA FA+ FSSSMSVVEYY
Sbjct  212  LVFYCACGITAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYY  271

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  ++ +AAF+GQHV++KLI +LGRAS+IIF L+F IFVSA++LGGVG
Sbjct  272  LLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSALSLGGVG  331

Query  314  ISNMIWKINHHEYMGFENLC  255
            ++ MI +I H EYMGF+N+C
Sbjct  332  LAKMIKRIEHKEYMGFDNIC  351



>ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula]
 ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula]
 gb|AES94934.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS  YWI+N LQ+P++++VTL+EA+ + KG R I SKG+   N++
Sbjct  266  VAFLIVQIVKTYTKTCSIEYWILNFLQVPIAISVTLFEAVCIYKGTRVIKSKGKEVKNMK  325

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLE+GIPP V+SAT+TF+M+FSSSMSVV
Sbjct  326  IYQILLYCSIGVIAGMVGGLLGLGGGFILGPLFLEMGIPPQVASATSTFSMLFSSSMSVV  385

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY L RFPVPYA YF+LVAT+AAF GQHVVR++I +LGRAS+IIFILA TIF+SA++LG
Sbjct  386  QYYYLDRFPVPYASYFVLVATIAAFAGQHVVRRIIAILGRASIIIFILASTIFISAISLG  445

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI NMI K+ +HEYMGFENLCT
Sbjct  446  GVGIQNMIVKLENHEYMGFENLCT  469



>gb|AAY63998.1| unknown [Brassica napus]
Length=348

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FLALQI K    TCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+  SN  + 
Sbjct  144  FLALQIAKKNMPTCSVGYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIG  203

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ YC FG+LAGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEY
Sbjct  204  QLILYCSFGVLAGVVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEY  263

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLLKRFP+PYA+Y + VAT+AA +GQHVVR+LI +LGRASLIIFILA TIF+SA++LGGV
Sbjct  264  YLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGV  323

Query  317  GISNMIWKINHHEYMGFENLCTYE  246
            GI NM+ K+  HEYMGFENLC Y 
Sbjct  324  GIVNMMGKLQRHEYMGFENLCKYS  347



>ref|XP_011011435.1| PREDICTED: uncharacterized protein LOC105116005 isoform X2 [Populus 
euphratica]
Length=475

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N+LQIPV+  V+ YEA  L KG RKI+SKG++ +N ++ Q
Sbjct  275  LALQIGKNYSTTCSVAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQ  334

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YCF GLLAG+VGG+LGLGGGFI+GPLFLE+GIPP VSSATATF+MMFS+SMSVVEYY
Sbjct  335  LVLYCFIGLLAGIVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYY  394

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  VAT+AA +GQHV+RKLI +LGRASLIIF LAFTIFVSA+ LGGVG
Sbjct  395  LLKRFPVPYALYFFAVATLAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVG  454

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I+ M+ +I   EYMGFEN+C+
Sbjct  455  IARMVRRIERKEYMGFENICS  475



>gb|EMT12794.1| hypothetical protein F775_19997 [Aegilops tauschii]
Length=468

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ+ KNY ATCS  YW++NLLQIPVSV V +YEA+GL +G R ISSK   +++L+
Sbjct  262  VAFLVLQVAKNYMATCSIWYWVLNLLQIPVSVGVAMYEAVGLVQGRRVISSKRNEQNSLR  321

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YCF G+ AGVV GLLG+GGG IMGPLFLELG+PP V+SATATFAMMFSSSMSVV
Sbjct  322  AHQLFVYCFLGVTAGVVAGLLGVGGGSIMGPLFLELGVPPQVASATATFAMMFSSSMSVV  381

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+Y  ++A  AA +GQ VVRKLI LLGRAS+I+FIL+F IF+SA++LG
Sbjct  382  EYYLLNRFPVPYAVYLTILAFFAAIVGQRVVRKLIDLLGRASIIVFILSFMIFISALSLG  441

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISN I KI  HEYMGFEN+C YE
Sbjct  442  GVGISNTIHKIERHEYMGFENICKYE  467



>ref|XP_003517231.1| PREDICTED: uncharacterized protein LOC100801441 [Glycine max]
Length=470

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+F  +QI+K YT  CS  +W++N LQ+PV+V+VTL+EAIGL KG R I+SKG+  +N +
Sbjct  265  VAFFIVQIVKEYTKPCSIQFWLLNFLQVPVAVSVTLFEAIGLYKGTRVIASKGKEVTNWK  324

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  325  IHQICLYCSTGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  384

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF LVAT+AAF GQHVVRK+I++LGRAS+IIFILA TIF+SA++LG
Sbjct  385  QYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLG  444

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI N+I KI +HEYMGFE+LC
Sbjct  445  GVGIENIIEKIENHEYMGFEDLC  467



>ref|XP_011011433.1| PREDICTED: uncharacterized protein LOC105116005 isoform X1 [Populus 
euphratica]
Length=497

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N+LQIPV+  V+ YEA  L KG RKI+SKG++ +N ++ Q
Sbjct  297  LALQIGKNYSTTCSVAYWLLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQ  356

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YCF GLLAG+VGG+LGLGGGFI+GPLFLE+GIPP VSSATATF+MMFS+SMSVVEYY
Sbjct  357  LVLYCFIGLLAGIVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYY  416

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  VAT+AA +GQHV+RKLI +LGRASLIIF LAFTIFVSA+ LGGVG
Sbjct  417  LLKRFPVPYALYFFAVATLAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVG  476

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I+ M+ +I   EYMGFEN+C+
Sbjct  477  IARMVRRIERKEYMGFENICS  497



>ref|XP_010915823.1| PREDICTED: uncharacterized protein LOC105040818 [Elaeis guineensis]
Length=475

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQI+K YT+ CS  YWI+NLLQIPVSV VT YEA+ L +G R I+SKG+  +N +
Sbjct  271  MTFLALQIVKEYTSNCSKSYWILNLLQIPVSVGVTAYEAVSLYRGKRVIASKGDEGTNWR  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FSSSMSVV
Sbjct  331  VLQLVLYCATGILAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA YF+ VATVAAF+GQH VRKLI +LGRASLIIFILAFTIFVSA++LG
Sbjct  391  EYYLLKRFPVPYAAYFVAVATVAAFVGQHAVRKLINILGRASLIIFILAFTIFVSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGISNMI KI  HEYMGFENLC Y
Sbjct  451  GVGISNMIHKIQRHEYMGFENLCKY  475



>ref|XP_010526182.1| PREDICTED: uncharacterized protein LOC104803812 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -1

Query  845  QIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLA  666
            QI K +T TCSALYW++NLLQIPVSV V+ YEA+ L +G R I+SKGE+ +N  V QLL 
Sbjct  277  QIAKQHTTTCSALYWVINLLQIPVSVGVSAYEAVALYQGRRVIASKGETGTNFTVAQLLL  336

Query  665  YCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLK  486
            YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEYY+LK
Sbjct  337  YCTFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYILK  396

Query  485  RFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISN  306
            RFPVPYA+YF+ VATVAAF+GQHVVR+LI +LGRASLIIFILAF IF+SA++LGGVGISN
Sbjct  397  RFPVPYALYFVAVATVAAFVGQHVVRRLIAVLGRASLIIFILAFMIFISAISLGGVGISN  456

Query  305  MIWKINHHEYMGFENLCTYEV  243
            M+ KI  HEYMGFENLC Y++
Sbjct  457  MVGKIQRHEYMGFENLCMYDI  477



>gb|AEI72271.1| hypothetical protein [Citrus trifoliata]
Length=353

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYTATCS LYW++N LQIPV+  V+ YEA+ L KG R I+SKG+  +N +  Q
Sbjct  151  LALQIAKNYTATCSVLYWVLNFLQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQ  210

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AGVVGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  211  LVFYCACGITAGVVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  270

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  V+T+AAF+GQHVVRKLI +LGRAS+IIF L+ TIFVSA++L G+G
Sbjct  271  LLKRFPVPYALYFFAVSTIAAFVGQHVVRKLINILGRASIIIFTLSLTIFVSALSLSGIG  330

Query  314  ISNMIWKINHHEYMGFENLCTY  249
            ++ M+ +I+  EYMGF+++C+Y
Sbjct  331  LAKMVPRIDRKEYMGFDSICSY  352



>ref|XP_010526181.1| PREDICTED: uncharacterized protein LOC104803812 isoform X1 [Tarenaya 
hassleriana]
Length=478

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -1

Query  845  QIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLA  666
            QI K +T TCSALYW++NLLQIPVSV V+ YEA+ L +G R I+SKGE+ +N  V QLL 
Sbjct  278  QIAKQHTTTCSALYWVINLLQIPVSVGVSAYEAVALYQGRRVIASKGETGTNFTVAQLLL  337

Query  665  YCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLK  486
            YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEYY+LK
Sbjct  338  YCTFGVLAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYILK  397

Query  485  RFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISN  306
            RFPVPYA+YF+ VATVAAF+GQHVVR+LI +LGRASLIIFILAF IF+SA++LGGVGISN
Sbjct  398  RFPVPYALYFVAVATVAAFVGQHVVRRLIAVLGRASLIIFILAFMIFISAISLGGVGISN  457

Query  305  MIWKINHHEYMGFENLCTYEV  243
            M+ KI  HEYMGFENLC Y++
Sbjct  458  MVGKIQRHEYMGFENLCMYDI  478



>ref|XP_007046968.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
 gb|EOX91125.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
Length=443

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FL +QI+K Y  TCS +YWIVN LQIP++ +VTL+EAI L KG R I+SKG+  +N +
Sbjct  238  IGFLIVQIVKEYVPTCSVVYWIVNSLQIPIAASVTLFEAICLYKGTRVIASKGKEVTNWK  297

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  298  IYQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  357

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS+IIFILA TIF+SA++LG
Sbjct  358  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFISAISLG  417

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+ + EYMGFENLC
Sbjct  418  GVGIADMVEKLENEEYMGFENLC  440



>ref|NP_850068.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
 gb|AAM97053.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72117.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42374.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63445.1| At2g25737 [Arabidopsis thaliana]
 gb|AEC07746.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
Length=476

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FLALQI K   A CS  YW++NLLQIPV+V V+ YEA+ L +G R I+SKG+ +SN  V 
Sbjct  272  FLALQISKQNLANCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVG  331

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ YC FG++AG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEY
Sbjct  332  QLVMYCTFGIIAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEY  391

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLLKRFPVPYA+Y + VAT+AA++GQHVVR+LI  +GRASLIIFILA  IF+SA++LGGV
Sbjct  392  YLLKRFPVPYALYLVGVATIAAWVGQHVVRRLIAAIGRASLIIFILASMIFISAISLGGV  451

Query  317  GISNMIWKINHHEYMGFENLCTY  249
            GI NMI KI  HEYMGFENLC Y
Sbjct  452  GIVNMIGKIQRHEYMGFENLCKY  474



>emb|CDX83221.1| BnaA03g22850D [Brassica napus]
Length=462

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+ +SN  
Sbjct  256  VVFLALQIAKQNMATCSIAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFT  315

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSV+
Sbjct  316  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVI  375

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VATVAA +GQHVVRKLI ++GRASLIIFILA  IF+SA++LG
Sbjct  376  EYYLLKRFPVPYALYLVGVATVAALVGQHVVRKLIAVIGRASLIIFILASMIFISAISLG  435

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI NMI K   HEYMGFEN+C Y 
Sbjct  436  GVGIVNMIGKFQRHEYMGFENICKYS  461



>ref|XP_003636476.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
Length=480

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 175/216 (81%), Gaps = 11/216 (5%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            +SFLALQI K NYT TCSA YWI+NLLQIP++V VT YEA  L  G R I+S G+     
Sbjct  263  ISFLALQIAKQNYTTTCSAAYWILNLLQIPIAVGVTAYEATALFTGRRVIASTGDQGKAF  322

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPP----------HVssatatf  537
             V QL+ YC FG+LAG+VGGLLGLGGGF+MGPLFLELG+PP          HVSSATATF
Sbjct  323  TVGQLVIYCVFGVLAGIVGGLLGLGGGFVMGPLFLELGVPPQVSFKLQYINHVSSATATF  382

Query  536  ammfsssmSVVEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILA  357
            AM FSSSMSVVEYYLLKRFPVPYA+Y  LVAT+AA +GQH+VR+LI+L GRASLIIFILA
Sbjct  383  AMTFSSSMSVVEYYLLKRFPVPYALYLSLVATIAALVGQHIVRRLIILFGRASLIIFILA  442

Query  356  FTIFVSAVTLGGVGISNMIWKINHHEYMGFENLCTY  249
             TIF+SA++LGGVGISNM+ KI +HEYMGFEN+C Y
Sbjct  443  GTIFISAISLGGVGISNMVHKIANHEYMGFENICKY  478



>ref|XP_008342687.1| PREDICTED: uncharacterized protein LOC103405461 [Malus domestica]
Length=428

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L LQI KNYT TCSA YW  NLLQIPV+  VT++EA+ L KG R I+S+ ES +N  V Q
Sbjct  225  LVLQIAKNYTTTCSAAYWAYNLLQIPVAFGVTIFEAVKLYKGHRVIASRAESNTNWTVNQ  284

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+     G+ AG+VGGLLGLGGGFI+GP+FLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  285  LVLCSACGITAGIVGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVVEYY  344

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VAT +A +GQ+VVRK++ + GRAS+IIFILAFTIFVSA++LGGVG
Sbjct  345  LLKRFPIPYALYFTAVATFSALVGQYVVRKVVSIFGRASIIIFILAFTIFVSAISLGGVG  404

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++MI KI H EYMGFEN+CTY+
Sbjct  405  IADMIEKIKHKEYMGFENICTYD  427



>ref|XP_010070053.1| PREDICTED: uncharacterized protein LOC104456870 [Eucalyptus grandis]
 gb|KCW58607.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=481

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K YT TCS  YWI+N LQ+P++ +VTL+EAI L +G R I+SKG+  +N +
Sbjct  276  VAFLAVQIVKTYTKTCSVKYWILNSLQVPIACSVTLFEAIALYRGTRVIASKGKEITNWK  335

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  336  LHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVV  395

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY+LKRFPVP+A YF+LVATVAA +GQHVVRK+I +LGR S+IIFILA TIFVSA++LG
Sbjct  396  QYYILKRFPVPFASYFVLVATVAAIVGQHVVRKIIAILGRTSIIIFILALTIFVSAISLG  455

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNM+ K+ + EYMGFE+LC YE
Sbjct  456  GVGISNMVEKLENQEYMGFESLC-YE  480



>ref|XP_009403528.1| PREDICTED: uncharacterized protein LOC103987063 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            ++FL LQ++K NYT+TCS  YWI+NLLQ+PVS+ V+ YEA+ L KG R ISSKGE  ++ 
Sbjct  267  ITFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYKGKRIISSKGEEGTSF  326

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V  L+ YC  G+LAGVVGGLLGLGGGFI+GP+FLELG+PP VSSATATFAM FSSSMSV
Sbjct  327  TVLHLVFYCCIGILAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSV  386

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+YF+ VA VAA +GQH+V++LI +LGRASLIIFILAFTIFVSA++L
Sbjct  387  VEYYLLKRFPIPYALYFVAVALVAALVGQHIVKRLIEILGRASLIIFILAFTIFVSAISL  446

Query  326  GGVGISNMIWKINHHEYMGFENLCTYE  246
            GGVGISNM+ KI HHEYMGF+NLC YE
Sbjct  447  GGVGISNMVQKIQHHEYMGFDNLCKYE  473



>ref|XP_009403527.1| PREDICTED: uncharacterized protein LOC103987063 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            ++FL LQ++K NYT+TCS  YWI+NLLQ+PVS+ V+ YEA+ L KG R ISSKGE  ++ 
Sbjct  268  ITFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYKGKRIISSKGEEGTSF  327

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V  L+ YC  G+LAGVVGGLLGLGGGFI+GP+FLELG+PP VSSATATFAM FSSSMSV
Sbjct  328  TVLHLVFYCCIGILAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSV  387

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+YF+ VA VAA +GQH+V++LI +LGRASLIIFILAFTIFVSA++L
Sbjct  388  VEYYLLKRFPIPYALYFVAVALVAALVGQHIVKRLIEILGRASLIIFILAFTIFVSAISL  447

Query  326  GGVGISNMIWKINHHEYMGFENLCTYE  246
            GGVGISNM+ KI HHEYMGF+NLC YE
Sbjct  448  GGVGISNMVQKIQHHEYMGFDNLCKYE  474



>ref|XP_006426964.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426965.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426966.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40204.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40205.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40206.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
Length=477

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYTATCS LYW++N LQIPV+  V+ YEA+ L KG R I+SKG+  +N +  Q
Sbjct  275  LALQIAKNYTATCSVLYWVLNFLQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQ  334

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AGVVGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  335  LVFYCACGITAGVVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  394

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  V+TVAAF+GQHVVRKLI +LGRAS+IIF L+ TIFVSA++LGG+G
Sbjct  395  LLKRFPVPYALYFFGVSTVAAFVGQHVVRKLINILGRASIIIFTLSLTIFVSALSLGGIG  454

Query  314  ISNMIWKINHHEYMGFENLCTY  249
            ++ M+ +I+  EYMGF+++C+Y
Sbjct  455  LAKMVQRIDRKEYMGFDSICSY  476



>gb|EPS70855.1| hypothetical protein M569_03905 [Genlisea aurea]
Length=444

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESN-LQ  684
            SFLA+QIIKNYT TCSA++W VNLLQIPVSV V+ YEA+ L  GW++I SK + E+   +
Sbjct  240  SFLAVQIIKNYTPTCSAIFWFVNLLQIPVSVGVSGYEAVRLYLGWKRIGSKVDDETTTFK  299

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL+ YC FG++AGVVGGLLG+GGGFIMGPLFLELG+PP VSSATATF MMFS+SMSVV
Sbjct  300  PRQLVIYCSFGIVAGVVGGLLGIGGGFIMGPLFLELGVPPQVSSATATFIMMFSASMSVV  359

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EY+LL RFPVPYA+Y  +VAT+AA++GQHVVR++I ++GRAS+IIF+L+FTIFVSAV+LG
Sbjct  360  EYHLLNRFPVPYALYLFVVATIAAYVGQHVVRRIIAVMGRASIIIFVLSFTIFVSAVSLG  419

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            G GIS ++ KI  HEYMGF NLC Y
Sbjct  420  GFGISKIVAKIRWHEYMGFGNLCKY  444



>ref|XP_008338104.1| PREDICTED: uncharacterized protein LOC103401168 isoform X1 [Malus 
domestica]
Length=486

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  281  VAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWK  340

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  341  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  400

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  401  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  460

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI+NM+ K+ + EYMGFEN C 
Sbjct  461  GVGIANMVEKMENQEYMGFENFCN  484



>ref|XP_008338105.1| PREDICTED: uncharacterized protein LOC103401168 isoform X2 [Malus 
domestica]
Length=484

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  279  VAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWK  338

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  339  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  398

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  399  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  458

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI+NM+ K+ + EYMGFEN C 
Sbjct  459  GVGIANMVEKMENQEYMGFENFCN  482



>ref|XP_007046967.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX91124.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=476

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FL +QI+K Y  TCS +YWIVN LQIP++ +VTL+EAI L KG R I+SKG+  +N +
Sbjct  271  IGFLIVQIVKEYVPTCSVVYWIVNSLQIPIAASVTLFEAICLYKGTRVIASKGKEVTNWK  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  331  IYQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS+IIFILA TIF+SA++LG
Sbjct  391  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFISAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+ + EYMGFENLC
Sbjct  451  GVGIADMVEKLENEEYMGFENLC  473



>ref|XP_009353619.1| PREDICTED: uncharacterized protein LOC103944866 [Pyrus x bretschneideri]
Length=474

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCSA YW++NLLQIPV++ V+ YEA+ L KG R I+S  E  ++ +V +
Sbjct  271  LALQIAKNYTTTCSAEYWVLNLLQIPVALGVSTYEAVNLYKGHRVIASMEELGTDWKVHR  330

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L  YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  331  LFLYCGGGITAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  390

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF LVA+++A +GQHVVRK+I +LGRAS+I+FILA TIFVSA++LGGVG
Sbjct  391  LLKRFPVPYALYFALVASLSALVGQHVVRKVISVLGRASIIVFILASTIFVSAISLGGVG  450

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++M+ KI + EYMGFEN+CTY+
Sbjct  451  IASMVEKIENKEYMGFENICTYD  473



>ref|XP_009371583.1| PREDICTED: uncharacterized protein LOC103960817 isoform X2 [Pyrus 
x bretschneideri]
Length=484

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  279  VAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWK  338

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  339  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  398

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  399  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  458

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI+NM+ K+ + EYMGFEN C 
Sbjct  459  GVGIANMVEKMENQEYMGFENFCN  482



>ref|XP_009371582.1| PREDICTED: uncharacterized protein LOC103960817 isoform X1 [Pyrus 
x bretschneideri]
Length=486

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  281  VAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAICLCKGTRVIASKGKEITNWK  340

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  341  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  400

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  401  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  460

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI+NM+ K+ + EYMGFEN C 
Sbjct  461  GVGIANMVEKMENQEYMGFENFCN  484



>ref|XP_006465615.1| PREDICTED: uncharacterized protein LOC102614288 isoform X2 [Citrus 
sinensis]
Length=477

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS LYW++NLLQIPV+  V+ YEA+ L KG RKI+SKG+  +  + +Q
Sbjct  276  LALQIAKNYTTTCSVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQ  335

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA FA+ FSSSMSVVEYY
Sbjct  336  LVFYCACGITAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYY  395

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  ++ +AAF+GQHV++KLI +LGRAS+IIF L+F IFVSAV+LGGVG
Sbjct  396  LLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSAVSLGGVG  455

Query  314  ISNMIWKINHHEYMGFENLC  255
            ++ MI +I H EYMGF+N+C
Sbjct  456  LAKMIKRIEHKEYMGFDNIC  475



>ref|XP_009356691.1| PREDICTED: uncharacterized protein LOC103947501 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349998.1| PREDICTED: uncharacterized protein LOC103941518 isoform X1 [Pyrus 
x bretschneideri]
Length=477

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS  +WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  272  VAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  332  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  392  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  452  GVGIANMVEKMENQEYMGFENFC  474



>ref|XP_006465614.1| PREDICTED: uncharacterized protein LOC102614288 isoform X1 [Citrus 
sinensis]
Length=479

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS LYW++NLLQIPV+  V+ YEA+ L KG RKI+SKG+  +  + +Q
Sbjct  278  LALQIAKNYTTTCSVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQ  337

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA FA+ FSSSMSVVEYY
Sbjct  338  LVFYCACGITAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYY  397

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  ++ +AAF+GQHV++KLI +LGRAS+IIF L+F IFVSAV+LGGVG
Sbjct  398  LLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKILGRASIIIFTLSFIIFVSAVSLGGVG  457

Query  314  ISNMIWKINHHEYMGFENLC  255
            ++ MI +I H EYMGF+N+C
Sbjct  458  LAKMIKRIEHKEYMGFDNIC  477



>ref|XP_007202022.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
 gb|EMJ03221.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
Length=482

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++W++N LQ+P++V+VTL+EAI L KG R I+SKG+  +N +
Sbjct  277  VAFLIVQIVKTYTETCSTMFWVLNSLQVPIAVSVTLFEAICLCKGTRVIASKGKEITNWK  336

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  337  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  396

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  397  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  456

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  457  GVGIANMVEKMENQEYMGFENFC  479



>ref|XP_002324817.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
 gb|EEF03382.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
Length=474

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            VS+LA+QI KNYTA CS  +W++NLLQIP+S+ V LYEAIGL KG R+ISSKG+   + Q
Sbjct  267  VSYLAVQIAKNYTAPCSTTFWVLNLLQIPISIGVFLYEAIGLYKGRRRISSKGDEIMDWQ  326

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V +LL +   G++AG+VGGLLG+GGGF+MGPLFLE+GIPP VSS TATF M+FSSSMSVV
Sbjct  327  VHRLLMFSVCGVVAGIVGGLLGIGGGFVMGPLFLEMGIPPQVSSGTATFGMLFSSSMSVV  386

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VA +AAFIGQ+++ KLI + GRASLIIF+LAFTIF+SA+ LG
Sbjct  387  EYYLLDRFPVPYALYFIAVAVIAAFIGQNIITKLITISGRASLIIFVLAFTIFISAIALG  446

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI+  I  +  HEYMGFENLC Y
Sbjct  447  GVGITRTIGMVERHEYMGFENLCKY  471



>ref|XP_006383214.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
 gb|ERP61011.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
Length=477

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FL +QI++ Y  TCS  YWI+N LQ+P++ +VTL+EAI L KG R I+SKG+  +N ++ 
Sbjct  274  FLVVQIVQTYFPTCSVTYWILNSLQVPIAASVTLFEAICLCKGTRVIASKGKEITNWKLH  333

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVVEY
Sbjct  334  QILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVVEY  393

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLL RFPVPYA YF LVAT++AF+GQHVVRK+I  LGRASLIIFILA TIFVSAV+LGGV
Sbjct  394  YLLNRFPVPYAAYFALVATISAFVGQHVVRKIIAFLGRASLIIFILALTIFVSAVSLGGV  453

Query  317  GISNMIWKINHHEYMGFENLC  255
            GI+NM+ K+ + EYMGFENLC
Sbjct  454  GIANMVEKLENEEYMGFENLC  474



>ref|XP_006426963.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
 gb|ESR40203.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
Length=479

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS LYW++NLLQIPV+  V+ YEA+ L KG RKI+SKG+  +  + +Q
Sbjct  278  LALQIAKNYTTTCSVLYWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQ  337

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA FA+ FSSSMSVVEYY
Sbjct  338  LVFYCACGITAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYY  397

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  ++ +AAF+GQHVV+KLI +LGRAS+IIF L+F IFVSA++LGGVG
Sbjct  398  LLKRFPVPYALYFFALSIIAAFVGQHVVKKLIKILGRASIIIFTLSFIIFVSALSLGGVG  457

Query  314  ISNMIWKINHHEYMGFENLC  255
            ++ MI +I H EYMGF+N+C
Sbjct  458  LAKMIKRIEHKEYMGFDNIC  477



>emb|CDY70121.1| BnaC03g72820D [Brassica napus]
Length=463

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+ +SN  
Sbjct  257  VVFLALQIAKQNMATCSIAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFT  316

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSV+
Sbjct  317  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVI  376

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VATVAA +GQHVVR+LI ++GRASLIIFILA  IF+SA++LG
Sbjct  377  EYYLLKRFPVPYALYLVGVATVAALVGQHVVRRLIAVIGRASLIIFILASMIFISAISLG  436

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI NMI K   HEYMGFEN+C Y 
Sbjct  437  GVGIVNMIGKFQRHEYMGFENICKYS  462



>ref|XP_009356692.1| PREDICTED: uncharacterized protein LOC103947501 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349999.1| PREDICTED: uncharacterized protein LOC103941518 isoform X2 [Pyrus 
x bretschneideri]
Length=475

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS  +WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  270  VAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  330  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I +LGRAS++IFILA TIFVSA++LG
Sbjct  390  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  450  GVGIANMVEKMENQEYMGFENFC  472



>ref|XP_002521607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40878.1| conserved hypothetical protein [Ricinus communis]
Length=478

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLA+QI+K+Y  TCS  YWI+N LQ+P++ +VTL+EAI L KG R I+S+G+  +N +
Sbjct  275  VGFLAVQIVKSYVRTCSVAYWILNALQVPIAASVTLFEAICLRKGTRVIASRGKEITNWK  334

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  335  YHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  394

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA +F+LVATVAA +GQHVVRK+I +LGRAS+IIFILA TIFVSA++LG
Sbjct  395  QYYLLKRFPVPYATFFVLVATVAALVGQHVVRKIIAILGRASIIIFILALTIFVSAISLG  454

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI +M+ K+ + EYMGFENLC
Sbjct  455  GVGIVDMVEKLTNEEYMGFENLC  477



>ref|XP_009133962.1| PREDICTED: uncharacterized protein LOC103858367 [Brassica rapa]
Length=462

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V FLALQI K   ATCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+ +SN  
Sbjct  256  VVFLALQIAKQNMATCSIAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFT  315

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL+ YC FG+LAG+VGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSV+
Sbjct  316  VGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVI  375

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+Y + VATVAA +GQHVVR+LI ++GRASLIIFILA  IF+SA++LG
Sbjct  376  EYYLLKRFPVPYALYLVGVATVAALVGQHVVRRLIAVIGRASLIIFILASMIFISAISLG  435

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI NMI K   HEYMGFEN+C Y 
Sbjct  436  GVGIVNMIGKFQRHEYMGFENICKYS  461



>gb|KHG13748.1| Flavonol synthase/flavanone 3-hydroxylase [Gossypium arboreum]
Length=303

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  785  QIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLAYCffgllagvvggllglggg  606
            +IPVSVAV+ YEA+ L KG R I+SKGE  SN Q  QL++YCFFG+LAG+VGGLLGLGGG
Sbjct  123  KIPVSVAVSAYEAVSLYKGNRAIASKGEQGSNFQAHQLVSYCFFGVLAGIVGGLLGLGGG  182

Query  605  fimgplfLELGIPPHVssatatfammfsssmSVVEYYLLKRFPVPYAIYFMLVATVAAFI  426
            FIMGPLFLELGIPP VSSATATFAM FSSSMSVVEYYLLKRFPVPYA+YF  VAT AAF+
Sbjct  183  FIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTAVATFAAFV  242

Query  425  GQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISNMIWKINHHEYMGFENLCTYE  246
            GQHVVR+LI++ GRASLIIFILAFTIFVSAV+LGGVGISNMI KI+H+EYMGFENLC YE
Sbjct  243  GQHVVRRLIIVFGRASLIIFILAFTIFVSAVSLGGVGISNMIDKIHHNEYMGFENLCKYE  302



>ref|XP_006465610.1| PREDICTED: uncharacterized protein LOC102613305 isoform X1 [Citrus 
sinensis]
 ref|XP_006465611.1| PREDICTED: uncharacterized protein LOC102613305 isoform X2 [Citrus 
sinensis]
 ref|XP_006465612.1| PREDICTED: uncharacterized protein LOC102613305 isoform X3 [Citrus 
sinensis]
Length=477

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYTATCS LYW +N LQIPV+  V+ YEA+ L KG R I+SKG+  +N +  Q
Sbjct  275  LALQIAKNYTATCSVLYWALNFLQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQ  334

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AGVVGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  335  LVFYCACGITAGVVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  394

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  V+T+AAF+GQHVVRKLI +LGRAS+IIF L+ TIFVSA++LGG+G
Sbjct  395  LLKRFPVPYALYFFAVSTIAAFVGQHVVRKLINILGRASIIIFTLSLTIFVSALSLGGIG  454

Query  314  ISNMIWKINHHEYMGFENLCTY  249
            ++ M+ +I+  EYMGF+++C+Y
Sbjct  455  LAKMVQRIDRKEYMGFDSICSY  476



>ref|XP_008363110.1| PREDICTED: uncharacterized protein LOC103426807 isoform X1 [Malus 
domestica]
Length=477

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS  +WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  272  VAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  332  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF++VAT+AAF GQHVVRK+I +LGRAS+IIFILA TIFVSA++LG
Sbjct  392  QYYLLNRFPVPYAAYFVVVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  452  GVGIANMVEKMENREYMGFENFC  474



>ref|XP_008228542.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
 ref|XP_008228543.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
Length=479

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCSA YW++NLLQIPV+  V+ YEA+ L KG R I+SK ES ++ +V Q
Sbjct  279  LALQIAKNYTTTCSAEYWVLNLLQIPVAFGVSTYEAVNLYKGRRVIASKEESVTDWKVHQ  338

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  339  LVLYCACGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  398

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF ++++++A +GQHVVR++I +LGRAS+IIFILA TIFVSA++LGGVG
Sbjct  399  LLKRFPVPYAVYFAVMSSLSALVGQHVVRRVISVLGRASIIIFILASTIFVSAISLGGVG  458

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I+ MI KI   EYMGFEN+CT
Sbjct  459  IAAMIGKIERKEYMGFENICT  479



>ref|XP_008363111.1| PREDICTED: uncharacterized protein LOC103426807 isoform X2 [Malus 
domestica]
Length=475

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS  +WI+N LQ+P++++VTL+EAI L KG R I+SKG+  +N +
Sbjct  270  VAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKGKEITNWK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  330  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF++VAT+AAF GQHVVRK+I +LGRAS+IIFILA TIFVSA++LG
Sbjct  390  QYYLLNRFPVPYAAYFVVVATIAAFTGQHVVRKIIAVLGRASIIIFILALTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  450  GVGIANMVEKMENREYMGFENFC  472



>gb|KHN41986.1| hypothetical protein glysoja_003726 [Glycine soja]
Length=198

 Score =   203 bits (517),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  839  IKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLAYC  660
            ++ Y+  CS  +W++N LQ+P++V+VTL+EAIGL KG R I+SKG+  +N ++ Q+  YC
Sbjct  1    MQEYSKPCSIHFWLLNFLQVPIAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLYC  60

Query  659  ffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLKRF  480
              G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV+YYLL RF
Sbjct  61   STGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRF  120

Query  479  PVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISNMI  300
            PVPYA YF LVAT+AAF GQHVVRK+I++LGRAS+IIFILA TIF+SA++LGGVGI N+I
Sbjct  121  PVPYASYFALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENII  180

Query  299  WKINHHEYMGFENLC  255
             KI  HEYMGFE+LC
Sbjct  181  EKIESHEYMGFEDLC  195



>gb|KHN42580.1| hypothetical protein glysoja_042801 [Glycine soja]
Length=469

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            VSFL +QI  N T+ CS +YW++N+LQIP+SV V+ YEA  L KG R+ISS G+      
Sbjct  263  VSFLGIQIAMNQTSKCSTIYWVLNMLQIPISVGVSGYEAASLYKGRRQISSVGDQGKTFT  322

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QL  YC FG+LAG+VGGLLG+GGGF+MGPLFLELG+PP VSSATATFAM FSSSMSVV
Sbjct  323  SQQLTIYCIFGVLAGIVGGLLGIGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVV  382

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLLKRFPVPYA+YF+ VA ++A +GQH+VRKLI +LGRASLIIF+LAFTI VSAV+LG
Sbjct  383  EYYLLKRFPVPYALYFIAVAAISAIVGQHIVRKLIDVLGRASLIIFVLAFTILVSAVSLG  442

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGI  M+ KI +HEYMGF++LCTY+
Sbjct  443  GVGIVAMVKKIENHEYMGFDDLCTYD  468



>ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis]
Length=495

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K Y  TCS  YWI+N+LQ+P++++VTLYEAI L KG R I+S+G+ +   +
Sbjct  282  VAFLAVQIVKTYATTCSIEYWILNVLQVPIALSVTLYEAINLCKGTRTIASRGKQDMRWK  341

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + QLL YCF G+LAG+VGGLLGLGGGFI+GPLFLE+G+PP V+SAT+TFAM FSSSMSV+
Sbjct  342  MHQLLLYCFCGVLAGIVGGLLGLGGGFILGPLFLEMGVPPQVASATSTFAMTFSSSMSVI  401

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+ +ATVAAF GQH+VR+LI+LLGRASLIIFILA TIFVSA++LG
Sbjct  402  QYYLLDRFPVPYAAYFVFLATVAAFTGQHIVRRLIVLLGRASLIIFILALTIFVSAISLG  461

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+   E+MGFENLC
Sbjct  462  GVGIAHMVEKLERKEHMGFENLC  484



>ref|XP_008241663.1| PREDICTED: uncharacterized protein LOC103340075 [Prunus mume]
Length=482

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++W++N LQ+P++V+VTL+EAI L KG R I+SKG+  +N +
Sbjct  277  VAFLIVQIVKTYTETCSTMFWVLNSLQVPIAVSVTLFEAICLCKGTRVIASKGKEITNWK  336

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  337  LHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  396

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I ++GRAS++IFILA TIFVSA++LG
Sbjct  397  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVVGRASIVIFILALTIFVSAISLG  456

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  457  GVGIANMVEKMENQEYMGFENFC  479



>ref|XP_008466240.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
 ref|XP_008466242.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
Length=471

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  860  SFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            +FLA+QI K ++  CS  YW++N LQIP++  V+ YEA+ L KG RKI+S G  +++ ++
Sbjct  266  AFLAIQIAKKHSPNCSWEYWLLNFLQIPIAFGVSGYEAVSLYKGKRKIASLGNQKTDFRI  325

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YCF G++AGVVGGLLGLGGGFIMGPLFLELGIPP VSSA+ATF M FSSSMSV++
Sbjct  326  YQLVLYCFLGIIAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSASATFGMTFSSSMSVIQ  385

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLL RFPVPYA+YF +VA VAAF+GQHV+R+LI L+GRASLIIFIL+FTIFVSA++LGG
Sbjct  386  YYLLNRFPVPYALYFTIVAAVAAFVGQHVIRRLINLIGRASLIIFILSFTIFVSALSLGG  445

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGIS MI +I  HEYMGFENLC Y+
Sbjct  446  VGISKMIRQIQRHEYMGFENLCKYD  470



>ref|XP_003537580.2| PREDICTED: uncharacterized protein LOC100817312 [Glycine max]
Length=204

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 169/196 (86%), Gaps = 1/196 (1%)
 Frame = -1

Query  839  IKN-YTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLAY  663
            +KN Y+  CS  +W++N LQ+P++V+VTL+EAIGL KG R I+SKG+  +N ++ Q+  Y
Sbjct  6    VKNEYSKPCSIHFWLLNFLQVPIAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLY  65

Query  662  CffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLKR  483
            C  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV+YYLL R
Sbjct  66   CSTGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDR  125

Query  482  FPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISNM  303
            FPVPYA YF LVAT+AAF GQHVVRK+I++LGRAS+IIFILA TIF+SA++LGGVGI N+
Sbjct  126  FPVPYASYFALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENI  185

Query  302  IWKINHHEYMGFENLC  255
            I KI  HEYMGFE+LC
Sbjct  186  IEKIESHEYMGFEDLC  201



>emb|CDX77007.1| BnaC04g38020D [Brassica napus]
Length=470

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FLALQI K    TCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+  SN  + 
Sbjct  266  FLALQIAKKNMPTCSVGYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIG  325

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ YC FG+LAGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEY
Sbjct  326  QLILYCSFGVLAGVVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEY  385

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLLKRFP+PYA+Y + VAT+AA +GQHVVR+LI +LGRASLIIFILA TIF+SA++LGGV
Sbjct  386  YLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGV  445

Query  317  GISNMIWKINHHEYMGFENLCTYE  246
            GI NM+ K+  HEYMGFENLC Y 
Sbjct  446  GIVNMMGKLQRHEYMGFENLCKYS  469



>emb|CDY35338.1| BnaA04g15090D [Brassica napus]
Length=470

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FLALQI K    TCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+  SN  + 
Sbjct  266  FLALQIAKKNMPTCSVGYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIG  325

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ YC FG+LAGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEY
Sbjct  326  QLILYCSFGVLAGVVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEY  385

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLLKRFP+PYA+Y + VAT+AA +GQHVVR+LI +LGRASLIIFILA TIF+SA++LGGV
Sbjct  386  YLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGV  445

Query  317  GISNMIWKINHHEYMGFENLCTYE  246
            GI NM+ K+  HEYMGFENLC Y 
Sbjct  446  GIVNMMGKLQRHEYMGFENLCKYS  469



>ref|XP_009140696.1| PREDICTED: uncharacterized protein LOC103864686 [Brassica rapa]
Length=470

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FLALQI K    TCS  YW++NLLQIPV+V V+ YEA+ L +G R I+S G+  SN  + 
Sbjct  266  FLALQIAKKNMPTCSVGYWVINLLQIPVAVGVSGYEAVALYQGRRIIASNGQGGSNFTIG  325

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ YC FG+LAGVVGGLLGLGGGFIMGPLFLELG+PP VSSATATFAM FSSSMSVVEY
Sbjct  326  QLILYCSFGVLAGVVGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEY  385

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLLKRFP+PYA+Y + VAT+AA +GQHVVR+LI +LGRASLIIFILA TIF+SA++LGGV
Sbjct  386  YLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVLGRASLIIFILASTIFISAISLGGV  445

Query  317  GISNMIWKINHHEYMGFENLCTYE  246
            GI NM+ K+  HEYMGFENLC Y 
Sbjct  446  GIVNMMGKLQRHEYMGFENLCKYS  469



>ref|XP_002310222.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
 gb|EEE90672.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
Length=477

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI++    TCS +YWI+N LQ+P++ +VTL+EAI L KG R I+SKG+  +N +
Sbjct  272  VAFLVVQIVQTNVPTCSVMYWILNSLQVPIAASVTLFEAICLCKGTRVIASKGKEITNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  332  LHQVLLYCSCGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA YF+LVAT+AAF GQHV+R++I +LGRAS+IIFILA TIFVSA++LG
Sbjct  392  EYYLLNRFPVPYAAYFVLVATIAAFAGQHVIRRIIAILGRASIIIFILALTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFENLC
Sbjct  452  GVGIANMVEKLENDEYMGFENLC  474



>ref|XP_004956625.1| PREDICTED: uncharacterized protein LOC101768056 [Setaria italica]
Length=468

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL LQ+ KNYT+TCS  YW++NLLQ+PVSV VT+YE +GL  G R +SSKG  +S L+
Sbjct  262  VAFLVLQVTKNYTSTCSTWYWVLNLLQVPVSVGVTMYEGLGLMSGKRVLSSKGSEQSTLK  321

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  Y FFG+ AG+VGGLLGLGGGF+MGPLFLELGIPP VSSATATFAMMFSSSMSVV
Sbjct  322  LYQIFIYGFFGIAAGLVGGLLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVV  381

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA++F++VA  AA IGQH+VRKL+  LGRASLIIFILAF IFVSA++LG
Sbjct  382  EYYLLNRFPVPYAVFFVVVAFFAAIIGQHIVRKLVNWLGRASLIIFILAFMIFVSALSLG  441

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVGISNM+ KI HHEYMGFENLC YE
Sbjct  442  GVGISNMVNKIAHHEYMGFENLCKYE  467



>ref|XP_011025767.1| PREDICTED: uncharacterized protein LOC105126564 [Populus euphratica]
Length=477

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI++    TCS +YWI+NLLQ+P++ +VTL+EAI L KG R I+SKG+  +N +
Sbjct  272  VAFLLVQIVQTNVPTCSVMYWILNLLQVPIAASVTLFEAISLCKGTRVIASKGKEITNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            +  +L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  332  LHLVLLYCSCGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA YF+LVAT+AAF GQHV+R++I +LGRAS+IIFILA TIFVSA++LG
Sbjct  392  EYYLLNRFPVPYAAYFVLVATIAAFAGQHVIRRIIAILGRASIIIFILALTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFENLC
Sbjct  452  GVGIANMVEKLENDEYMGFENLC  474



>ref|XP_002516036.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46456.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TC+  YWI++  QIPV+ ++T+Y+A+ L KG RKI+S+GE+ESN +V +
Sbjct  264  LALQIAKNYTKTCTVPYWILDFAQIPVAASLTIYQAVRLYKGRRKIASRGEAESNWRVHK  323

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            LL YCF GLLAG++GGLLGLGGGFI+GPLFLE+GIPP VSSATATFAM FS+SMSVVEYY
Sbjct  324  LLLYCFSGLLAGIIGGLLGLGGGFILGPLFLEMGIPPQVSSATATFAMTFSASMSVVEYY  383

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+Y   V T+A F+GQ+VV+K+I +LGRAS+IIFIL+FTI VSA++LGGVG
Sbjct  384  LLKRFPVPYALYLFAVTTLAGFVGQYVVKKVIDMLGRASIIIFILSFTILVSAISLGGVG  443

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            +++MI KI   EYMGFE++C Y 
Sbjct  444  LADMIKKIERKEYMGFEDICLYS  466



>ref|XP_009346009.1| PREDICTED: uncharacterized protein LOC103937781 [Pyrus x bretschneideri]
Length=489

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT +CSA YW  NLLQIPV+  VT++EA+ L KG R I+S+ E  +N  V Q
Sbjct  286  LALQIAKNYTTSCSAAYWAYNLLQIPVAFGVTIFEAVKLYKGDRVIASRAELNTNWTVNQ  345

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+     G++AG+VGGLLGLGGGFI+GP+FLELGIPP VSSATATFAM FS+S+SVVEYY
Sbjct  346  LVLCSACGIIAGIVGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASLSVVEYY  405

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VAT +A +GQ+VVRK++  LGRAS+IIFILAFTIFVSA++LGGVG
Sbjct  406  LLKRFPIPYALYFTAVATFSALVGQYVVRKVVSFLGRASIIIFILAFTIFVSAISLGGVG  465

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I +MI KI H EYMGFEN+CTY+
Sbjct  466  IVDMIEKIKHKEYMGFENICTYD  488



>ref|XP_010263696.1| PREDICTED: uncharacterized protein LOC104601887 [Nelumbo nucifera]
Length=473

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K Y  TCS  YW++NL+Q+P++ +V+LYEAI L +G R I+SKG+  +N +
Sbjct  270  VAFLAVQIVKTYAKTCSLEYWLLNLIQVPIAASVSLYEAICLYRGKRVIASKGKELTNWK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V  L  YCF G++AG+VGGLLGLGGGFI+GPLFLEL +PP V+SAT+TF M+FSSSMSVV
Sbjct  330  VPLLFLYCFCGIVAGIVGGLLGLGGGFILGPLFLELEVPPQVASATSTFVMVFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+LVAT+AAF GQHVVRKLI LLGRAS+IIFILA TIFVSA++LG
Sbjct  390  QYYLLKRFPVPYASYFVLVATIAAFTGQHVVRKLITLLGRASIIIFILAMTIFVSALSLG  449

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+  + H+EYMGFE+LC
Sbjct  450  GVGIANMLEMLEHNEYMGFESLC  472



>ref|XP_008228546.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
 ref|XP_008228547.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
Length=478

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+  CS +YWI+NLLQIPV+V +T YEA+ L KG R I SKGE  +N +V +
Sbjct  275  LALQIAKNYSTKCSVVYWILNLLQIPVTVGITSYEAVKLYKGSRIIESKGEGGANWRVHK  334

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L++YC  G++AG++GGLLGLGGGFIMGP+FLE+GIPP VSSATATF M FSSSMSVVEYY
Sbjct  335  LVSYCVLGIVAGILGGLLGLGGGFIMGPVFLEMGIPPQVSSATATFIMTFSSSMSVVEYY  394

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VATV+A +GQ++V K+I  LGRASLIIFILA TIFVSA+TLGGVG
Sbjct  395  LLKRFPIPYALYFAAVATVSAIMGQYLVGKVIKALGRASLIIFILALTIFVSALTLGGVG  454

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+NM+ KI H E +GFE +CT +
Sbjct  455  IANMVKKIEHKESLGFEKMCTQK  477



>ref|XP_002298219.2| hypothetical protein POPTR_0001s18390g [Populus trichocarpa]
 gb|EEE83024.2| hypothetical protein POPTR_0001s18390g [Populus trichocarpa]
Length=438

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  845  QIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLA  666
            QI KNYT TCSA+YW++N+LQIPV+  VT YEA+ L KG RKI+S GE+ +N  V +L+ 
Sbjct  241  QIGKNYTTTCSAIYWLLNILQIPVAAGVTSYEAVSLYKGRRKITSMGEASNNWPVHELIL  300

Query  665  YCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLK  486
            YCF G++AG VGG+LGLGGGFI+GPLFLE+GIPP VSSATATFAMMFS+SMSVVE+YLLK
Sbjct  301  YCFIGVMAGTVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMMFSASMSVVEFYLLK  360

Query  485  RFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISN  306
            RFPVPYA+YF  VAT+AA +GQHVVRKLI +LGRASLIIFILA TIFVSA+ +GG G+++
Sbjct  361  RFPVPYALYFFTVATIAAVVGQHVVRKLISILGRASLIIFILASTIFVSAILVGGAGMAS  420

Query  305  MIWKINHHEYMGFENLCT  252
            MI K    EYMGFE++C+
Sbjct  421  MIEKFERKEYMGFESMCS  438



>ref|XP_004504238.1| PREDICTED: uncharacterized protein LOC101507523 [Cicer arietinum]
Length=468

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS  YWI+NLLQ+P++V V+ YEA+ L KG R I+SKG+ ++   V Q
Sbjct  263  LALQIGKNYTTTCSVAYWILNLLQVPITVGVSSYEAVLLYKGKRVIASKGDQQTQWSVQQ  322

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AG++GGLLGLGGGFI+GPLF+ LGIPP VSSAT+TFAM FS+SMSVVEYY
Sbjct  323  LILYCACGIVAGIIGGLLGLGGGFILGPLFIGLGIPPQVSSATSTFAMTFSASMSVVEYY  382

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+ YA+YF+ VATVAA IGQH+VRKLI +LGRAS+IIFILA T+FVS ++LGG G
Sbjct  383  LLKRFPISYALYFVAVATVAALIGQHLVRKLIAILGRASIIIFILALTVFVSGISLGGTG  442

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            I+N+I ++ + EYMGF NLC Y V
Sbjct  443  IANLIKRVENKEYMGFGNLCEYRV  466



>ref|XP_010999980.1| PREDICTED: uncharacterized protein LOC105107666 [Populus euphratica]
Length=477

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FL +QI++    TCS  YWI+N LQ+P++ +VTL+EAI L KG R I+SKG+  +N ++ 
Sbjct  274  FLVVQIVQTNVPTCSVTYWILNSLQVPIAASVTLFEAICLCKGTRVIASKGKEITNWKLH  333

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVVEY
Sbjct  334  QILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMAFSSSMSVVEY  393

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLL RFPVPYA YF LVAT++A +GQHVVRK+I  LGRASLIIFILA TIFVSAV+LGGV
Sbjct  394  YLLNRFPVPYAAYFALVATISALVGQHVVRKIIAFLGRASLIIFILALTIFVSAVSLGGV  453

Query  317  GISNMIWKINHHEYMGFENLC  255
            GI+NM+ K+ + EYMGFENLC
Sbjct  454  GIANMVEKLENEEYMGFENLC  474



>ref|XP_007156932.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
 gb|ESW28926.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
Length=470

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+F  +QI+K Y+  CS  +WI+N LQ+P++++VTL+EAI L KG R I+SKG+  ++ +
Sbjct  265  VAFFIVQIVKEYSKPCSIQFWILNFLQVPIAISVTLFEAISLYKGTRVIASKGKEITHWK  324

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  325  IHQICLYCSTGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  384

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF LVAT+AAF GQHVVRK+I++LGRAS+IIFILA TIF+SA++LG
Sbjct  385  QYYLLDRFPVPYASYFALVATLAAFTGQHVVRKIIVVLGRASIIIFILALTIFISALSLG  444

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI N+I KI  HEYMGFE+LC
Sbjct  445  GVGIENIIEKIEKHEYMGFEDLC  467



>ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum]
Length=476

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K YT TCS  YWI+NLLQ+PV+V+V+LYEAI L KG R I+SKG+  +N +
Sbjct  271  VAFLAIQIVKTYTVTCSIGYWILNLLQVPVAVSVSLYEAICLYKGTRVIASKGKEITNWK  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
               L  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M FSSSMSVV
Sbjct  331  PHLLFFYCCCGIVAGIVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+ +AT+AA +GQHV+R++I LLGRAS+IIFILA TIF SA++LG
Sbjct  391  QYYLLKRFPVPYATYFVSIATIAAVVGQHVIRRVIALLGRASIIIFILAMTIFTSAISLG  450

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NMI K+ + +YMGF+NLC
Sbjct  451  GVGIANMIEKLENQDYMGFDNLC  473



>gb|KHN36120.1| hypothetical protein glysoja_003243 [Glycine soja]
Length=441

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  836  KNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLAYCf  657
            + YT  CS  +W++N LQ+PV+V+VTL+EAIGL KG R I+SKG+  +N ++ Q+  YC 
Sbjct  245  EEYTKPCSIQFWLLNFLQVPVAVSVTLFEAIGLYKGTRVIASKGKEVTNWKIHQICLYCS  304

Query  656  fgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLKRFP  477
             G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV+YYLL RFP
Sbjct  305  TGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLDRFP  364

Query  476  VPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISNMIW  297
            VPYA YF LVAT+AAF GQHVVRK+I++LGRAS+IIFILA TIF+SA++LGGVGI N+I 
Sbjct  365  VPYASYFALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISAISLGGVGIENIIE  424

Query  296  KINHHEYMGFENLC  255
            KI +HEYMGFE+LC
Sbjct  425  KIENHEYMGFEDLC  438



>gb|AEI98632.1| hypothetical protein 111018.19 [Coffea canephora]
Length=465

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLA+QI+K YT TCSA YW +N LQ+P++ +V+LYEA  L KG R I+SKG+  +  +
Sbjct  260  IAFLAIQIMKTYTQTCSAKYWTLNFLQVPIAASVSLYEATCLYKGTRTIASKGKEITVWK  319

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
               +  YC  G++AGVVGGLLGLGGGF++GPLFLELG+PP V+SAT+TFAM FSSSMSVV
Sbjct  320  PNLIFLYCCLGIVAGVVGGLLGLGGGFVLGPLFLELGVPPQVASATSTFAMTFSSSMSVV  379

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVATVAA +GQHVVR++I +LGRASLIIFILA TIFVSA++LG
Sbjct  380  QYYLLNRFPVPYATYFVLVATVAALVGQHVVRRIIAILGRASLIIFILALTIFVSAISLG  439

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++MI K+ +HEYMGF+NLC
Sbjct  440  GVGIASMIEKLQNHEYMGFDNLC  462



>ref|XP_009788571.1| PREDICTED: uncharacterized protein LOC104236361 [Nicotiana sylvestris]
Length=479

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K YT TCS  YWI+N LQIPV+V+V+LYEA+ L KG R I+SKG+  ++ +
Sbjct  274  VAFLAIQIVKTYTVTCSIEYWILNFLQIPVAVSVSLYEAVCLYKGTRVIASKGKEITSWK  333

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
               L  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M FSSSMSVV
Sbjct  334  PHLLFFYCCCGIVAGIVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVV  393

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+ VAT+AA +GQHVVR++I LLGRAS+IIFILA TIFVSA++LG
Sbjct  394  QYYLLKRFPVPYAAYFVSVATIAALVGQHVVRRVIALLGRASIIIFILAMTIFVSAISLG  453

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NMI K+ + +YMGF+NLC
Sbjct  454  GVGIANMIEKLENKDYMGFDNLC  476



>gb|KDO79523.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
 gb|KDO79524.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=347

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FLA+Q+ K Y   CS  YWI+N LQ+P++V+V L+EAI L KG R I+SKG+  +N +
Sbjct  142  LGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWK  201

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  202  IHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVV  261

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F LVAT AAF GQHVVRK+I +LGRAS+I+FILA TIFVSA++LG
Sbjct  262  QYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLG  321

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            G GI NM+ K+ + EYMGFENLC
Sbjct  322  GFGIENMVKKLKNQEYMGFENLC  344



>ref|XP_008353719.1| PREDICTED: uncharacterized protein LOC103417306 [Malus domestica]
Length=1022

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  854   LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
             L LQI KNYT TCSA YW  NLLQIPV+  VT++EA+ L KG R I+S+ ES +N  V Q
Sbjct  819   LVLQIAKNYTTTCSAAYWAYNLLQIPVAFGVTIFEAVKLYKGHRVIASRAESNTNWTVNQ  878

Query  674   LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
             L+     G+ AG+VGGLLGLGGGFI+GP+FLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  879   LVLCSACGITAGIVGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVVEYY  938

Query  494   LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
             LLKRFP+PYA+YF  VAT +A +GQ+VVRK++ + GRAS+IIFILAFTIFVSA++LGGVG
Sbjct  939   LLKRFPIPYALYFTAVATFSALVGQYVVRKVVSIFGRASIIIFILAFTIFVSAISLGGVG  998

Query  314   ISNMIWKINHHEYMGFENLCTYEV  243
             I++MI KI H EYMGFEN+CTY+ 
Sbjct  999   IADMIEKIKHKEYMGFENICTYDA  1022



>ref|XP_004959391.1| PREDICTED: uncharacterized protein LOC101762929 [Setaria italica]
Length=459

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 170/205 (83%), Gaps = 2/205 (1%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKG--ESESN  690
            V+FL LQI KNY A+CSA YW++N LQIPV++ VT+YEA GL  G R ++SKG  + +S 
Sbjct  253  VAFLGLQITKNYVASCSAWYWVLNSLQIPVAIGVTMYEAHGLMTGKRVLASKGSQQQQST  312

Query  689  LQVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmS  510
            L+V QL  YC FG+LAG++GGLLG+GGGFIMGPLFLELGIPP VSSATATF MMFSSSMS
Sbjct  313  LRVRQLSVYCLFGILAGLIGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMS  372

Query  509  VVEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVT  330
            VVEYYLL RFPVPYA YF  VA VAA +GQH VRKLI  LGRASLIIFILA  IFVSA+T
Sbjct  373  VVEYYLLHRFPVPYAAYFTAVAFVAAIVGQHCVRKLIAWLGRASLIIFILASMIFVSALT  432

Query  329  LGGVGISNMIWKINHHEYMGFENLC  255
            LGGVGISN++ ++  H+YMGFE+LC
Sbjct  433  LGGVGISNIVHRMERHQYMGFESLC  457



>ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum]
Length=486

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+Q++K YT TCS  YWI+NLLQ+PV+V+V+LYEA+ L KG R I+SKG+  +N +
Sbjct  281  VAFLAIQVVKTYTVTCSIGYWILNLLQVPVAVSVSLYEAVCLYKGTRVIASKGKEITNWK  340

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
               L  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M FSSSMSVV
Sbjct  341  PHLLFFYCCCGIVAGIVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVV  400

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+ +AT+AA +GQHV+R++I LLGRAS+IIFILA TIF SA++LG
Sbjct  401  QYYLLKRFPVPYATYFVSIATIAAVVGQHVIRRVIALLGRASIIIFILAMTIFTSAISLG  460

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NMI K+ +++YMGF+NLC
Sbjct  461  GVGIANMIEKLKNNDYMGFDNLC  483



>ref|XP_009631525.1| PREDICTED: uncharacterized protein LOC104121277 [Nicotiana tomentosiformis]
Length=480

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K YT TCS  YWI+N LQ+PV+V+V+LYEA+ L KG R I+SKG+  ++ +
Sbjct  275  VAFLAIQIVKTYTVTCSIEYWILNFLQVPVAVSVSLYEAVCLYKGTRVIASKGKEITSWK  334

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
               L  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M FSSSMSVV
Sbjct  335  PHLLFFYCCCGIVAGIVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVV  394

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLLKRFPVPYA YF+ VAT+AA +GQHVVR++I LLGRAS+IIFILA TIFVSA++LG
Sbjct  395  QYYLLKRFPVPYAAYFVSVATIAALVGQHVVRRVIALLGRASIIIFILAMTIFVSAISLG  454

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NMI K+ + +YMGF+NLC
Sbjct  455  GVGIANMIEKLENKDYMGFDNLC  477



>ref|XP_004512031.1| PREDICTED: uncharacterized protein LOC101496928 isoform X4 [Cicer 
arietinum]
Length=522

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI K YT TCS  YW++N LQ+P++++V L+EA+ L KG R I SKG+  +N +
Sbjct  317  VAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWK  376

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  377  IHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVV  436

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F+LVAT+AAF+GQHVVRK+I +LGRAS+IIFILA TIF+SA++LG
Sbjct  437  QYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLG  496

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI NMI K+ + EYMGFEN C 
Sbjct  497  GVGIENMIVKMENQEYMGFENFCN  520



>ref|XP_004512030.1| PREDICTED: uncharacterized protein LOC101496928 isoform X3 [Cicer 
arietinum]
Length=523

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI K YT TCS  YW++N LQ+P++++V L+EA+ L KG R I SKG+  +N +
Sbjct  318  VAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWK  377

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  378  IHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVV  437

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F+LVAT+AAF+GQHVVRK+I +LGRAS+IIFILA TIF+SA++LG
Sbjct  438  QYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLG  497

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI NMI K+ + EYMGFEN C 
Sbjct  498  GVGIENMIVKMENQEYMGFENFCN  521



>ref|XP_004512029.1| PREDICTED: uncharacterized protein LOC101496928 isoform X2 [Cicer 
arietinum]
Length=523

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI K YT TCS  YW++N LQ+P++++V L+EA+ L KG R I SKG+  +N +
Sbjct  318  VAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWK  377

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  378  IHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVV  437

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F+LVAT+AAF+GQHVVRK+I +LGRAS+IIFILA TIF+SA++LG
Sbjct  438  QYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLG  497

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI NMI K+ + EYMGFEN C 
Sbjct  498  GVGIENMIVKMENQEYMGFENFCN  521



>emb|CDP02034.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLA+QI+K YT TCSA YW +N LQ+P++ +V+LYEA  L KG R I+SKG+  +  +
Sbjct  274  MAFLAIQIMKTYTQTCSAKYWTLNFLQVPIAASVSLYEATCLYKGTRTIASKGKEITVWK  333

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
               +  YC  G++AGVVGGLLGLGGGF++GPLFLELG+PP V+SAT+TFAM FSSSMSVV
Sbjct  334  PNLIFLYCCLGIVAGVVGGLLGLGGGFVLGPLFLELGVPPQVASATSTFAMTFSSSMSVV  393

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVATVAA +GQHVVR++I +LGRASLIIFILA TIFVSA++LG
Sbjct  394  QYYLLNRFPVPYATYFVLVATVAALVGQHVVRRIIAILGRASLIIFILALTIFVSAISLG  453

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++MI K+ +HEYMGF+NLC
Sbjct  454  GVGIASMIEKLQNHEYMGFDNLC  476



>ref|XP_004512028.1| PREDICTED: uncharacterized protein LOC101496928 isoform X1 [Cicer 
arietinum]
Length=524

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI K YT TCS  YW++N LQ+P++++V L+EA+ L KG R I SKG+  +N +
Sbjct  319  VAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEITNWK  378

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  379  IHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSSMSVV  438

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F+LVAT+AAF+GQHVVRK+I +LGRAS+IIFILA TIF+SA++LG
Sbjct  439  QYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISAISLG  498

Query  323  GVGISNMIWKINHHEYMGFENLCT  252
            GVGI NMI K+ + EYMGFEN C 
Sbjct  499  GVGIENMIVKMENQEYMGFENFCN  522



>ref|XP_003527721.1| PREDICTED: uncharacterized protein LOC100789748 [Glycine max]
 gb|ABC47859.1| membrane protein-like protein [Glycine max]
 gb|KHN22333.1| hypothetical protein glysoja_022089 [Glycine soja]
Length=491

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESN-L  687
            V+FL +QIIK YT TCS LYW++N LQ+P++++VTLYEAI L  G R ISSKG+  ++ +
Sbjct  271  VAFLIVQIIKTYTKTCSILYWVLNSLQVPIAISVTLYEAICLCNGTRVISSKGKENTDWM  330

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
            ++ ++  YC  G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSV
Sbjct  331  KLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSV  390

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            V+YYLL+RFPVPYA YF+LVAT+AA  GQHVVRK+I + GRAS+IIF+LAFTIF+SA++L
Sbjct  391  VQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISL  450

Query  326  GGVGISNMIWKINHHEYMGFENLC  255
            GGVGI NM+ K+ ++EYMGF N+C
Sbjct  451  GGVGIENMVEKMENNEYMGFANIC  474



>ref|XP_006465613.1| PREDICTED: uncharacterized protein LOC102613991 [Citrus sinensis]
Length=380

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY  TCS +YW++N LQIPV+ AV+ YEAI L KG RKI+SKG+  +  +  Q
Sbjct  178  LALQIAKNYEVTCSVVYWVLNFLQIPVAGAVSAYEAIALYKGRRKIASKGDGRTKWRAHQ  237

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AGVVGGLLGLGGGFI+ PLFLELGI P VSSATA F M F+SS+S+VEYY
Sbjct  238  LVLYCACGIMAGVVGGLLGLGGGFILSPLFLELGIHPQVSSATAIFVMTFASSISIVEYY  297

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLK FP+PYAIYF  VAT+AA +GQ+VVRKLI +  RAS+IIF L+FTIFVSA+TLGGVG
Sbjct  298  LLKGFPLPYAIYFFAVATIAAIVGQYVVRKLINIFARASIIIFTLSFTIFVSALTLGGVG  357

Query  314  ISNMIWKINHHEYMGFENLCTY  249
            ++ MI +I H EYMGF+++C+Y
Sbjct  358  LAKMIKRIEHKEYMGFDSICSY  379



>gb|AAL27555.1|AF420410_1 hypothetical protein [Musa acuminata AAA Group]
Length=238

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = -1

Query  857  FLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQV  681
            FL LQ++K NYT+TCS  YWI+NLLQ+PVS+ V+ YEA+ L +G R ISSKG   ++  V
Sbjct  1    FLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKGLEGTDFTV  60

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             QL+ YC  G+LAGVVGGLLGLGGGFI+GP+FLELG+PP VSSATATFAM FSSSMSVVE
Sbjct  61   IQLVFYCLIGVLAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVE  120

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLLKRFP+PYA+YF+ VA VAAF+GQH+V++LI +LGRASLIIFILA TIF+SA++LGG
Sbjct  121  YYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIFISAISLGG  180

Query  320  VGISNMIWKINHHEYMGFE  264
            VGISNM+ KI HHE  G  
Sbjct  181  VGISNMVQKIQHHESWGLR  199



>ref|XP_007024174.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY26796.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=486

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N LQIPV+V V+ YEA+ L KG R+I+SKG+  +N +V +
Sbjct  283  LALQIAKNYSTTCSVEYWVLNFLQIPVAVGVSSYEAVCLYKGRRRIASKGDVVANWRVHK  342

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC FGLLAG++GG+LGLGGGFI+GPLFLE+GIPP VSSAT+TFAM+FS+SMSVVEYY
Sbjct  343  LVIYCAFGLLAGILGGMLGLGGGFILGPLFLEMGIPPQVSSATSTFAMLFSASMSVVEYY  402

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+Y  LVAT+AAF+GQHVV K+I +LGRAS+IIFILA  IF SA++LGG+G
Sbjct  403  LLKRFPVPYALYLSLVATIAAFVGQHVVGKVIKILGRASIIIFILAGMIFGSAISLGGLG  462

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+ MI +I   EYMGF+++C+Y+
Sbjct  463  IAKMIKRIERKEYMGFDDICSYQ  485



>ref|XP_004287906.1| PREDICTED: uncharacterized protein LOC101304510 [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K YT TCS ++W++N +Q+P++ +VT++E+I L KG R I+SKG+  +N +
Sbjct  273  VAFLIVQIVKTYTETCSTMFWVLNSMQVPIAASVTVFESICLWKGTRVIASKGKEITNWK  332

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + QL  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  333  LHQLFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLFSSSMSVV  392

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AAF GQHVVRK+I ++GRAS++IFILA TI VSA++LG
Sbjct  393  QYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKVIAVVGRASIVIFILALTILVSAISLG  452

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI+NM+ K+ + EYMGFEN C
Sbjct  453  GVGIANMVEKMENQEYMGFENFC  475



>gb|KDP37236.1| hypothetical protein JCGZ_06292 [Jatropha curcas]
Length=411

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -1

Query  845  QIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLA  666
            QI KNYT TCS  YW +N+LQIPV+V +T YEA+GL KG RKI+S GE+ ++ +V QL+ 
Sbjct  211  QIGKNYTTTCSVTYWALNILQIPVAVGLTAYEAVGLYKGQRKIASMGEAITHWRVHQLVL  270

Query  665  YCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLK  486
            YC  G+LAGV+G +LGLGGGFI+GPLFL++GIPP VSSAT TF M FS+SMSV+EYYLLK
Sbjct  271  YCAVGMLAGVLGAMLGLGGGFILGPLFLQMGIPPQVSSATTTFVMTFSASMSVIEYYLLK  330

Query  485  RFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISN  306
            RFPVPYA+YF   A  AAF+GQHVVRKLI +LGRASLIIFILAFTIFVSA+ LGGVGI++
Sbjct  331  RFPVPYALYFFGAAIFAAFVGQHVVRKLISILGRASLIIFILAFTIFVSAILLGGVGIAH  390

Query  305  MIWKINHHEYMGFENLCTY  249
            MI +I   EYMGFEN+C+Y
Sbjct  391  MIKRIERSEYMGFENICSY  409



>ref|XP_003523605.1| PREDICTED: uncharacterized protein LOC100816633 [Glycine max]
 gb|KHN04486.1| hypothetical protein glysoja_019573 [Glycine soja]
Length=474

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESN-L  687
            V+FL +QIIK YT TCS LYW++N LQ+P++++VTLYEAI L  G R I+SKG+  ++ +
Sbjct  270  VAFLIVQIIKTYTKTCSILYWVLNSLQVPIAISVTLYEAICLCNGTRVIASKGKENTDWM  329

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
            ++ ++  YC  G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSV
Sbjct  330  KLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSV  389

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            V+YYLL+RFPVPYA YF+LVAT+AA  GQHVVRK+I + GRAS+IIF+LAFTIF+SA++L
Sbjct  390  VQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISL  449

Query  326  GGVGISNMIWKINHHEYMGFENLC  255
            GGVGI NM+ K+ ++EYMGF N+C
Sbjct  450  GGVGIENMVEKMENNEYMGFANIC  473



>gb|ABR16333.1| unknown [Picea sitchensis]
Length=505

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVT  678
            FL LQ++K  + TCS  YW++NLLQIPV+++V+LYEAIGL KG + ++SKGE+  N +++
Sbjct  301  FLVLQVVKAKSTTCSVEYWVLNLLQIPVAMSVSLYEAIGLYKGTKAVASKGEAGINWKIS  360

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            QL+ Y F G+LAGVVGGLLGLGGGFI+GPL LELG+PP VSSATATF M FSSSMSVVEY
Sbjct  361  QLVLYFFCGILAGVVGGLLGLGGGFILGPLLLELGVPPQVSSATATFVMTFSSSMSVVEY  420

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            Y LKRFPVPYA Y   V  +AAF+GQHV+R+L++LLGRASLIIFILAF IF+SA+TLGGV
Sbjct  421  YFLKRFPVPYAAYLFGVCVIAAFMGQHVIRRLVILLGRASLIIFILAFVIFLSAITLGGV  480

Query  317  GISNMIWKINHHEYMGFENLCTY  249
            GI  MI K  + +YMGFENLC+Y
Sbjct  481  GIVKMIHKFENGDYMGFENLCSY  503



>ref|XP_007217721.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
 gb|EMJ18920.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
Length=477

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY A CS +YWI+NLLQIPV+V +T YEA+ L KG R I SKGE  +N +V +
Sbjct  274  LALQIAKNYAAKCSVVYWILNLLQIPVTVGITSYEAVKLYKGSRIIESKGEGGANWRVHK  333

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L++YC FG++AG++GGLLGLGGGFIMGP+FLE+GIPP VSSATATF M FSSSMSVVEYY
Sbjct  334  LVSYCAFGIVAGLLGGLLGLGGGFIMGPVFLEMGIPPQVSSATATFIMTFSSSMSVVEYY  393

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VA V+A +GQ++V K+I  LGRASLIIFILA TIFVSA+TLGGVG
Sbjct  394  LLKRFPIPYALYFAAVAIVSAIMGQYLVGKVIKALGRASLIIFILALTIFVSALTLGGVG  453

Query  314  ISNMIWKINHHEYMGFENLC  255
            I+NM+ KI H EY+ FE++C
Sbjct  454  IANMVKKIEHKEYLWFESMC  473



>ref|XP_009381051.1| PREDICTED: uncharacterized protein LOC103969282 [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNL  687
            ++FL LQ++K NYT+TCS  YWI+N LQ+PVS+ V+ YEA+ L +G R ISSKGE  +N 
Sbjct  268  IAFLILQVLKQNYTSTCSPWYWILNFLQVPVSLGVSGYEAVSLYRGKRIISSKGEKGTNF  327

Query  686  QVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             V QL+ YC  G+LAG+VGGLLGLGGGFI+GP+FLELG+PP VSSATATFAM FSSSMSV
Sbjct  328  TVVQLVFYCLIGVLAGMVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSV  387

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            VEYYLLKRFP+PYA+Y + VA VAA +GQHVV++LI +LGRASLIIFILA TIFVSA++L
Sbjct  388  VEYYLLKRFPIPYALYLVAVALVAAIVGQHVVKRLIEILGRASLIIFILASTIFVSAISL  447

Query  326  GGVGISNMIWKINHHEYMGFENLCTYE  246
            GGVGISNM+ KI HHEYMGFENLC Y+
Sbjct  448  GGVGISNMVQKIQHHEYMGFENLCKYK  474



>ref|XP_008783526.1| PREDICTED: uncharacterized protein LOC103702749 [Phoenix dactylifera]
Length=506

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QIIK Y  TCS  YW++N LQ+P++++VTL EAI L KG R I+S+G+ +   +
Sbjct  293  VAFLAVQIIKTYATTCSIEYWVLNALQVPIALSVTLCEAINLCKGKRTIASRGKQDIRWK  352

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + QLL YC  G+LAG+VGGLLGLGGGFI+GPLFLE+G+PP V+SAT+TFAM FSSSMSV+
Sbjct  353  MHQLLFYCCCGVLAGIVGGLLGLGGGFILGPLFLEMGVPPQVASATSTFAMTFSSSMSVI  412

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+ +ATVAAF  QH+VR+LI+LLGRASLIIFILA TIFVSA++LG
Sbjct  413  QYYLLDRFPVPYAAYFVFLATVAAFTSQHIVRRLIVLLGRASLIIFILALTIFVSAISLG  472

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+   E+MGFENLC
Sbjct  473  GVGIAHMVEKLERKEHMGFENLC  495



>gb|KDP38300.1| hypothetical protein JCGZ_05186 [Jatropha curcas]
Length=469

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FLA+QI+K+Y  TCS  YWI+N LQIP++ +VT++EAI L KG R I+SKG+  +N +
Sbjct  266  LGFLAVQIVKSYAKTCSMTYWILNALQIPIAASVTIFEAICLRKGTRVIASKGKEITNWK  325

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  326  FHQIFLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  385

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY L RFPVPYA YF++VAT AA  GQHVVR++I +LGR S+IIFILA TIFVSA++LG
Sbjct  386  QYYFLNRFPVPYATYFVIVATFAALAGQHVVRRIIAVLGRTSIIIFILALTIFVSAISLG  445

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+ + EYMGFENLC
Sbjct  446  GVGIADMVEKLENEEYMGFENLC  468



>ref|XP_010680798.1| PREDICTED: uncharacterized protein LOC104895862 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=476

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FL +Q++K YT TCS  YW+++ LQ+P++V+V+L+E + L KG + I+SKG+  + L+
Sbjct  271  LGFLVIQLLKRYTVTCSVQYWLLDSLQVPIAVSVSLFEGVCLYKGTKVIASKGKEITVLK  330

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  331  VHQIFFYCLCGVVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMIFSSSMSVV  390

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY+LKRFPVPYA YF+LVAT+AA +GQHVVR+LI LLGRAS+IIFILA TI VSA+TLG
Sbjct  391  QYYILKRFPVPYAAYFVLVATLAAIVGQHVVRRLITLLGRASIIIFILASTILVSAITLG  450

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NMI K+ +HEYMGFEN C
Sbjct  451  GVGIVNMIQKLENHEYMGFENFC  473



>ref|XP_010680799.1| PREDICTED: uncharacterized protein LOC104895862 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FL +Q++K YT TCS  YW+++ LQ+P++V+V+L+E + L KG + I+SKG+  + L+
Sbjct  270  LGFLVIQLLKRYTVTCSVQYWLLDSLQVPIAVSVSLFEGVCLYKGTKVIASKGKEITVLK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  330  VHQIFFYCLCGVVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMIFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY+LKRFPVPYA YF+LVAT+AA +GQHVVR+LI LLGRAS+IIFILA TI VSA+TLG
Sbjct  390  QYYILKRFPVPYAAYFVLVATLAAIVGQHVVRRLITLLGRASIIIFILASTILVSAITLG  449

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NMI K+ +HEYMGFEN C
Sbjct  450  GVGIVNMIQKLENHEYMGFENFC  472



>ref|XP_010649158.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera]
 emb|CBI17534.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FLA+QI+K YT TCS  YW++N LQ+P++ +V++YEA+ L KG R I+SKG+  +N +
Sbjct  276  VAFLAVQIVKTYTVTCSIEYWVLNCLQVPIAASVSIYEAVCLYKGTRVIASKGKEVTNWK  335

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M FSSSMSVV
Sbjct  336  IHQIFLYCSCGIVAGLVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMAFSSSMSVV  395

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +Y+LL+RFPVPYA YF+LVAT+AA +GQHVVRK+I L+GRAS+IIFILA TIF+SA++LG
Sbjct  396  QYHLLRRFPVPYASYFVLVATIAALVGQHVVRKVIKLVGRASIIIFILALTIFISAISLG  455

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI  M+ K+ ++EYMGF++LC
Sbjct  456  GVGIMTMVEKLANNEYMGFDDLC  478



>gb|KDO79522.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=474

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FLA+Q+ K Y   CS  YWI+N LQ+P++V+V L+EAI L KG R I+SKG+  +N +
Sbjct  269  LGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWK  328

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  329  IHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVV  388

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F LVAT AAF GQHVVRK+I +LGRAS+I+FILA TIFVSA++LG
Sbjct  389  QYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLG  448

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            G GI NM+ K+ + EYMGFENLC
Sbjct  449  GFGIENMVKKLKNQEYMGFENLC  471



>gb|KDO79521.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=477

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FLA+Q+ K Y   CS  YWI+N LQ+P++V+V L+EAI L KG R I+SKG+  +N +
Sbjct  272  LGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  332  IHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F LVAT AAF GQHVVRK+I +LGRAS+I+FILA TIFVSA++LG
Sbjct  392  QYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            G GI NM+ K+ + EYMGFENLC
Sbjct  452  GFGIENMVKKLKNQEYMGFENLC  474



>ref|XP_006425693.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 ref|XP_006466780.1| PREDICTED: uncharacterized protein LOC102622706 [Citrus sinensis]
 gb|ESR38933.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=477

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FLA+Q+ K Y   CS  YWI+N LQ+P++V+V L+EAI L KG R I+SKG+  +N +
Sbjct  272  LGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASKGKEITNWK  331

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM FSSSMSVV
Sbjct  332  IHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMTFSSSMSVV  391

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA +F LVAT AAF GQHVVRK+I +LGRAS+I+FILA TIFVSA++LG
Sbjct  392  QYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTIFVSAISLG  451

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            G GI NM+ K+ + EYMGFENLC
Sbjct  452  GFGIENMVKKLKNQEYMGFENLC  474



>ref|XP_007159526.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
 gb|ESW31520.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
Length=464

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L L+I K +T TCS LYW++NLLQ+P++V ++ YEA+ L KG R I+SKG+ +++  V Q
Sbjct  259  LGLEIGKKHTTTCSRLYWLMNLLQVPLAVGMSSYEAVRLYKGKRIIASKGDQQTHFCVLQ  318

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG++ GLLGLGGGFI+GPLFL LGIPP V+SAT+T  M FS+SM+VVEYY
Sbjct  319  LVLFCACGTLAGMIAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYY  378

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYAIYF+ +AT AA +GQH+VRK I +LGRAS+IIFIL FT+ VSAV LGGVG
Sbjct  379  LLKRFPVPYAIYFVSIATAAALVGQHLVRKAIAILGRASVIIFILTFTLSVSAVLLGGVG  438

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            + +MI KI H EYMGF +LCTY+V
Sbjct  439  VVHMIQKIEHQEYMGFGDLCTYKV  462



>ref|XP_006595132.1| PREDICTED: uncharacterized protein LOC100789733 isoform X2 [Glycine 
max]
Length=480

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LA +I K++T TCS  YWI+NLLQ+PV++  T Y+A+ L  G R I+SKG+  +  +  Q
Sbjct  277  LASEIAKSHTTTCSVEYWILNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQ  336

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  337  LVLYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  396

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PY +YF+ V+T AAF+GQ +VRKL+ +LGRASLIIFIL+ TIFVSA++LGGVG
Sbjct  397  LLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRASLIIFILSGTIFVSAISLGGVG  456

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            ISNMI KI + EYMGFENLCTY 
Sbjct  457  ISNMIQKIANKEYMGFENLCTYS  479



>ref|XP_004509250.1| PREDICTED: uncharacterized protein LOC101512581 [Cicer arietinum]
Length=472

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI K Y+ TCS  YWI+N LQ+P++++VT++EAI L+KG R I+SKG+  +  +
Sbjct  267  VAFLIVQIFKTYSKTCSIEYWILNSLQVPIAISVTVFEAICLSKGSRVIASKGKEITGWK  326

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              Q+  YC  G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TF M+FSSSMSVV
Sbjct  327  FHQICLYCLCGIIAGMVSGLLGLGGGFILGPLFLELGIPPQVASATSTFVMVFSSSMSVV  386

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA Y +LVAT+AA  GQHVVRK++ + GRAS+IIFILAFTIFVSA++LG
Sbjct  387  QYYLLDRFPVPYASYLVLVATIAALTGQHVVRKMVAIFGRASIIIFILAFTIFVSAISLG  446

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NM+ K+ + +YMGF+NLC
Sbjct  447  GVGIENMVEKMENEDYMGFDNLC  469



>ref|XP_003542098.1| PREDICTED: uncharacterized protein LOC100789733 isoform X1 [Glycine 
max]
Length=487

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LA +I K++T TCS  YWI+NLLQ+PV++  T Y+A+ L  G R I+SKG+  +  +  Q
Sbjct  284  LASEIAKSHTTTCSVEYWILNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQ  343

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  344  LVLYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  403

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PY +YF+ V+T AAF+GQ +VRKL+ +LGRASLIIFIL+ TIFVSA++LGGVG
Sbjct  404  LLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRASLIIFILSGTIFVSAISLGGVG  463

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            ISNMI KI + EYMGFENLCTY 
Sbjct  464  ISNMIQKIANKEYMGFENLCTYS  486



>ref|XP_003546436.1| PREDICTED: uncharacterized protein LOC100816528 [Glycine max]
Length=476

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LA +I K++T TCS  YW++NLLQ+PV++  T Y+A+ L  G R I+SKG+  +  +  Q
Sbjct  273  LASEIAKSHTTTCSVEYWVLNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQ  332

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  333  LIMYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  392

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PY +YF+ V+T AAF+GQ +VRKL+ +LGRASLIIFIL+ TIFVSA++LGGVG
Sbjct  393  LLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRASLIIFILSSTIFVSAISLGGVG  452

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            ISNMI +I + EYMGFENLCTY 
Sbjct  453  ISNMIQRIANKEYMGFENLCTYS  475



>ref|XP_006369186.1| hypothetical protein POPTR_0001s18380g [Populus trichocarpa]
 gb|ERP65755.1| hypothetical protein POPTR_0001s18380g [Populus trichocarpa]
Length=436

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 163/201 (81%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N +QIPV+V VT Y A+ L KG RKI+SKGE+ +N  + +
Sbjct  236  LALQIGKNYSTTCSVEYWLLNTMQIPVAVGVTSYVAVSLYKGRRKIASKGEARNNWPLHR  295

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L  YC   L+AG VGG+LGLGGGFI+GPLFLE+GIPP VSSATA FAMMFS+S+SVVE+Y
Sbjct  296  LFFYCVTALMAGTVGGMLGLGGGFILGPLFLEMGIPPQVSSATAAFAMMFSASISVVEFY  355

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF +VAT++A +GQHV  KLI +LGRASLIIF LAF IF SA+ LGGVG
Sbjct  356  LLKRFPVPYALYFFVVATISAVVGQHVAGKLIRILGRASLIIFTLAFIIFASAILLGGVG  415

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I   I +I  +EYMGFEN+C+
Sbjct  416  IGRSIRQIERNEYMGFENICS  436



>ref|XP_009396550.1| PREDICTED: uncharacterized protein LOC103981523 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQ+ KNYTATCS  YW +NLLQIP++ + TLYEA+ L  G RKISS  E  +  +
Sbjct  268  MAFLVLQVTKNYTATCSTWYWFLNLLQIPIAGSATLYEAVSLYSGRRKISSGREEGTKWR  327

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V QL  YC  G++AGV GGLLGLGGGFI+GPLFLELG+PP VSSAT TFAM FSSS+SVV
Sbjct  328  VAQLFIYCSCGVVAGVAGGLLGLGGGFILGPLFLELGLPPQVSSATTTFAMAFSSSISVV  387

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFP+PYA+YF LV+ VAAF GQ VV + I+ +GR SL+IFILA  IF+SA++LG
Sbjct  388  EYYLLNRFPLPYAVYFSLVSAVAAFNGQVVVGRWIVAMGRVSLVIFILASMIFISALSLG  447

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            GVG+S+M+ +I  HEYMGFENLC Y+
Sbjct  448  GVGVSDMLKRIEKHEYMGFENLCGYQ  473



>ref|XP_011026588.1| PREDICTED: uncharacterized protein LOC105127135 [Populus euphratica]
Length=475

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            VS+LA+QI KNYTATCS  +W++NLLQIPVS+ V LYEAIGL KG R+ISSKG+   + Q
Sbjct  268  VSYLAVQIAKNYTATCSTTFWVLNLLQIPVSIGVFLYEAIGLYKGRRRISSKGDEIMDWQ  327

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            V +LL +   G++AG+VGGLLG+GGGFIMGPLFLE+GIPP V+S TATF M+FSSSMSVV
Sbjct  328  VHRLLMFSACGVVAGIVGGLLGIGGGFIMGPLFLEMGIPPQVTSGTATFGMLFSSSMSVV  387

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYYLL RFPVPYA+YF+ VA +AAFIGQ+++ KLI L GRASLIIF+LAFTIF+SA+ LG
Sbjct  388  EYYLLDRFPVPYALYFIAVAIIAAFIGQNIITKLITLSGRASLIIFVLAFTIFISAIALG  447

Query  323  GVGISNMIWKINHHEYMGFENLCTY  249
            GVGI+  I  +  HEYMGFENLC Y
Sbjct  448  GVGITRTIGMMERHEYMGFENLCKY  472



>gb|KHG02837.1| ATP synthase subunit delta [Gossypium arboreum]
Length=469

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            + FL +QIIK Y  TCS +YWIV  LQIP++ +VT++EAI L KG R I+SKG+  +N +
Sbjct  265  IGFLIVQIIKEYLPTCSVMYWIVTSLQIPIAASVTIFEAICLCKGTRVIASKGKEITNWK  324

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
            + Q+L YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP V+SAT+TF+M+FSSSMSVV
Sbjct  325  MHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMVFSSSMSVV  384

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YYLL RFPVPYA YF+LVAT+AA  GQHVVR++I ++GRAS+IIFILA TIF+SA++LG
Sbjct  385  QYYLLDRFPVPYAAYFVLVATMAAIAGQHVVRRIIAVIGRASIIIFILALTIFISAISLG  444

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI++M+ K+ + EYMGFENLC
Sbjct  445  GVGIADMVKKLANKEYMGFENLC  467



>ref|XP_011009831.1| PREDICTED: uncharacterized protein LOC105114838 [Populus euphratica]
Length=478

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  845  QIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQLLA  666
            QI KNYT TCSA+Y ++N+LQIPV+  VT YEA+ L KG RKI+S GE+ ++  V +L+ 
Sbjct  281  QIGKNYTTTCSAIYRLLNILQIPVAAGVTSYEAVNLYKGRRKITSMGEASNDWPVHKLIL  340

Query  665  YCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYYLLK  486
            YCF G++AG VGG+LGLGGGFI+GPLFLE+GIPP VSSATATFAMMFS+S+SVVEYYL+K
Sbjct  341  YCFIGVMAGTVGGMLGLGGGFILGPLFLEMGIPPQVSSATATFAMMFSASLSVVEYYLIK  400

Query  485  RFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVGISN  306
            RFPVPYA+YF  VAT+AA +GQHVVRKLI +LGRASLIIFILA TIFVSA+ +GG G+++
Sbjct  401  RFPVPYALYFFTVATIAAVVGQHVVRKLISILGRASLIIFILASTIFVSAILVGGSGMAS  460

Query  305  MIWKINHHEYMGFENLCT  252
            MI K    EYMGFE++C+
Sbjct  461  MIKKFERKEYMGFESICS  478



>ref|XP_008380919.1| PREDICTED: uncharacterized protein LOC103443803 [Malus domestica]
 ref|XP_008380921.1| PREDICTED: uncharacterized protein LOC103443803 [Malus domestica]
 ref|XP_008348510.1| PREDICTED: uncharacterized protein LOC103411659 [Malus domestica]
Length=480

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L LQI KNY A CSA YWI++ LQIPV+V VT YEA+ + KG R I+S+GE+ +  +V  
Sbjct  277  LGLQIGKNYVAKCSAAYWILDFLQIPVTVGVTSYEAVKVYKGQRVIASRGEAGAKWRVHN  336

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L++YCFFG++AG++GGLLGLGGGFIMGPLFLE+GIPP V+SAT+TF M+FSSSMSVVEYY
Sbjct  337  LVSYCFFGIIAGLIGGLLGLGGGFIMGPLFLEMGIPPQVASATSTFIMLFSSSMSVVEYY  396

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VA  +A IGQHVV K+I  +GRASLIIFILAFTIFVSA+TLGGVG
Sbjct  397  LLKRFPIPYALYFAAVAIGSAIIGQHVVGKVIKAIGRASLIIFILAFTIFVSALTLGGVG  456

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+N++ KI H E +GF+ +CT++
Sbjct  457  IANLVKKIEHKENLGFQRMCTHK  479



>ref|XP_007156036.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
 gb|ESW28030.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
Length=471

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QIIK Y+ TCS LYW++N LQ+P++V+VTLYEAI L  G R I+SK +  ++ +
Sbjct  265  VAFLIVQIIKTYSKTCSILYWVLNSLQVPIAVSVTLYEAICLCNGTRVIASKEKEITDWK  324

Query  683  -VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSV  507
             + ++  YC  G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSV
Sbjct  325  KLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSV  384

Query  506  VEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTL  327
            V+YYLL+RFPVPYA YF+L+AT+AA  GQHVVRK+I + GRAS+IIF+LAFTIF+SA++L
Sbjct  385  VQYYLLERFPVPYASYFILIATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISL  444

Query  326  GGVGISNMIWKINHHEYMGFENLC  255
            GGVGI NM+ KI ++EYMGF N+C
Sbjct  445  GGVGIENMVEKIENNEYMGFANIC  468



>ref|XP_008670142.1| PREDICTED: uncharacterized protein LOC103647377 [Zea mays]
Length=383

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISS-KGESE--  696
            ++FL LQ+ + NY A+CS  YW++N LQ+PV+V VT+YEA GL  G R +SS KG S+  
Sbjct  174  IAFLGLQLTRTNYAASCSVWYWVLNSLQVPVAVGVTVYEACGLRTGRRALSSNKGGSQQQ  233

Query  695  -SNLQVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfss  519
             S L++ QLL YC FG+LAG+VGGLLG+GGGFIMGPLFLELGIPP VSSATATF MMFSS
Sbjct  234  QSALRIRQLLVYCLFGVLAGLVGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSS  293

Query  518  smSVVEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVS  339
            SMSVVEYYLL RFPVPYA YF  VA VAA  GQH VRKLI  LGRASLIIFILA  IFVS
Sbjct  294  SMSVVEYYLLHRFPVPYAAYFTGVAFVAAITGQHCVRKLIAWLGRASLIIFILASMIFVS  353

Query  338  AVTLGGVGISNMIWKINHHEYMGFENLC  255
            A+TLGGVGISN++ ++  H+YMGFE+LC
Sbjct  354  ALTLGGVGISNIVHRVERHQYMGFESLC  381



>ref|XP_006659358.1| PREDICTED: uncharacterized protein LOC102716712 [Oryza brachyantha]
Length=468

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FL LQI KNY  TCS  YW++NLLQIPVSV VT+YE IGL +G R ISS G  ++NL+
Sbjct  262  ITFLVLQITKNYIPTCSTWYWLLNLLQIPVSVGVTMYEGIGLVQGRRVISSNGNEQTNLK  321

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG+ AG+V GLLG+GGG I+GP+FL+LG+PP V+SATATF+MMFSSSMS +
Sbjct  322  FHQLLMYCFFGITAGIVAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSSSMSAI  381

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYY L RFPVPYA+Y  +VA  +A +GQ VVRKLI  LGRAS+I+F L+  I +S   LG
Sbjct  382  EYYFLDRFPVPYALYLTVVAFFSAIVGQRVVRKLINWLGRASIIVFTLSTMIILSTFPLG  441

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            G+GISN I KI  HEYMGFEN+C Y+
Sbjct  442  GIGISNWIGKIERHEYMGFENICKYD  467



>ref|XP_009353615.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
 ref|XP_009353616.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
 ref|XP_009353617.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
 ref|XP_009353618.1| PREDICTED: uncharacterized protein LOC103944864 [Pyrus x bretschneideri]
Length=480

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L LQI KNY A CS  YWI++ LQIPV+V VT YEA+ + KG R ISS+GE+ +  +V  
Sbjct  277  LGLQIGKNYVAKCSVAYWILDFLQIPVTVGVTSYEAVKVYKGQRVISSRGEAGAKWRVHN  336

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+++CFFG++AG++GGLLGLGGGFIMGPLFLE+G+PP V+SAT+TF M+FSSSMSVVEY 
Sbjct  337  LVSFCFFGIIAGLIGGLLGLGGGFIMGPLFLEMGVPPQVASATSTFIMLFSSSMSVVEYD  396

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VA  +A IGQHVV K+I  +GRASLIIFILAFTIFVSA+TLGGVG
Sbjct  397  LLKRFPIPYALYFTAVAIGSAIIGQHVVGKVIKAIGRASLIIFILAFTIFVSALTLGGVG  456

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I+N++ KI H EY+GF+++CT++
Sbjct  457  IANLVKKIEHKEYLGFQSMCTHK  479



>ref|XP_010691331.1| PREDICTED: uncharacterized protein LOC104904681 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L L+I + YT TC+ L+W+ NL QIP+++  + YEA  L  G R I+S+G++  N +V Q
Sbjct  260  LGLEIAQKYTTTCTVLFWVTNLAQIPIALGASGYEAYMLYTGKRVIASRGDAAGNWKVYQ  319

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+   F G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAMMFSSSMSVVEYY
Sbjct  320  LVLCLFTGMSAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYY  379

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA YF+ VAT AA +GQ +VR+LI ++GRASLIIFILAFTIFVSA++LGGVG
Sbjct  380  LLKRFPVPYAAYFVAVATFAALVGQILVRRLIAIIGRASLIIFILAFTIFVSAISLGGVG  439

Query  314  ISNMIWKINHHEYMGFENLCTY  249
            ISNM++KI  HEYMGF++LC Y
Sbjct  440  ISNMVYKIQQHEYMGFDSLCAY  461



>gb|EAZ06861.1| hypothetical protein OsI_29096 [Oryza sativa Indica Group]
Length=469

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQ+ KNY  TCS  YW++NLLQIPVSV VT+YE +GL +G R ISS G  ++NL+
Sbjct  263  IAFLALQVTKNYMPTCSTWYWVLNLLQIPVSVGVTMYEGLGLMQGRRVISSNGNEQTNLK  322

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG+ AG+V GLLG+GGG I+GP+FL+LG+PP V+SATATF+MMFS+SMS V
Sbjct  323  FHQLLMYCFFGITAGIVAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSASMSAV  382

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYY L RFPVPYA+Y  +VA  +A +GQ +VRK+I  LGRAS+IIF L+  IF+S + LG
Sbjct  383  EYYFLDRFPVPYALYLTVVAFFSAIVGQRMVRKVINWLGRASIIIFTLSIMIFLSTIPLG  442

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            G+GI N I KI  HEYMGFE++C ++
Sbjct  443  GIGIVNWIGKIERHEYMGFEDICKFD  468



>ref|NP_001061712.1| Os08g0387200 [Oryza sativa Japonica Group]
 dbj|BAD05436.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23626.1| Os08g0387200 [Oryza sativa Japonica Group]
 gb|EAZ42600.1| hypothetical protein OsJ_27163 [Oryza sativa Japonica Group]
Length=469

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            ++FLALQ+ KNY  TCS  YW++NLLQIPVSV VT+YE +GL +G R ISS G  ++NL+
Sbjct  263  IAFLALQVTKNYMPTCSTWYWVLNLLQIPVSVGVTMYEGLGLMQGRRVISSNGNEQTNLK  322

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              QLL YCFFG+ AG+V GLLG+GGG I+GP+FL+LG+PP V+SATATF+MMFS+SMS V
Sbjct  323  FHQLLMYCFFGITAGIVAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSASMSAV  382

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            EYY L RFPVPYA+Y  +VA  +A +GQ +VRK+I  LGRAS+IIF L+  IF+S + LG
Sbjct  383  EYYFLDRFPVPYALYLTVVAFFSAIVGQRMVRKVINWLGRASIIIFTLSIMIFLSTIPLG  442

Query  323  GVGISNMIWKINHHEYMGFENLCTYE  246
            G+GI N I KI  HEYMGFE++C ++
Sbjct  443  GIGIVNWIGKIERHEYMGFEDICKFD  468



>gb|KHN06458.1| hypothetical protein glysoja_010802 [Glycine soja]
Length=469

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I K +T TCS L+W++NLLQ+P++V ++ YEA+ L KG R I+SKG+ +S+  V Q
Sbjct  266  LALEIGKKHTTTCSRLFWLLNLLQVPIAVGMSSYEAVRLYKGKRIIASKGDQQSHWCVFQ  325

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG++ GLLGLGGGFI+GPLFL LGIPP V+SAT+T  M FS+SM+VVEYY
Sbjct  326  LVLFCACGTLAGMIAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYY  385

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF+ +AT AA +GQH+VRK I +LGRAS+IIFIL+ T+ VSAV LGGVG
Sbjct  386  LLKRFPVPYALYFVAIATAAALVGQHLVRKAIAILGRASVIIFILSLTLSVSAVLLGGVG  445

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++MI KI + EYMGF +LCTY 
Sbjct  446  IAHMIQKIENKEYMGFGDLCTYR  468



>ref|XP_004302906.1| PREDICTED: uncharacterized protein LOC101294092 [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI K YT TCS  YW++NL+QIPV+   + YEA+ L  G R ISS+  S  + +V  
Sbjct  279  LALQIAKYYTTTCSVAYWVLNLMQIPVAFGASSYEAVRLYYGQRVISSQDVSSMDWKVHH  338

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  339  LVLYCGCGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  398

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  VA+ AA +GQHVVRK+I +LGRAS+IIFILA TIFVSA++LGGVG
Sbjct  399  LLKRFPVPYALYFTAVASFAALVGQHVVRKVINILGRASIIIFILAATIFVSAISLGGVG  458

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I++ I KI ++EYMGFEN+CT
Sbjct  459  IADTIQKIENNEYMGFENICT  479



>ref|XP_004305285.1| PREDICTED: uncharacterized protein LOC101291554 [Fragaria vesca 
subsp. vesca]
Length=462

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI K+Y   C A YW+  LLQIPV+V VT Y+A+ L KG   I+SKG+      + +
Sbjct  259  LALQIAKSYLTKCLATYWLAELLQIPVAVGVTSYQAMNLYKGRSVIASKGDENMKWSMYK  318

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+AYC  G+ AG++GGLLGLGG F++GP+FLE+GIPP VSSATATFAM FSSSMSVVEYY
Sbjct  319  LVAYCACGIAAGMLGGLLGLGGAFLLGPIFLEMGIPPQVSSATATFAMTFSSSMSVVEYY  378

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  V +V+AF GQHV  K++  LGRASLIIFILAFT+FVS++TLGG+G
Sbjct  379  LLKRFPIPYALYFAAVTSVSAFAGQHVAGKMVKKLGRASLIIFILAFTVFVSSLTLGGIG  438

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I NMI KI H E +GF+N+CTY+
Sbjct  439  IENMIRKIQHKESLGFQNICTYK  461



>gb|ABC47842.1| membrane protein-like protein [Glycine max]
Length=469

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = -1

Query  857  FLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESN-LQV  681
            FLAL ++  YT TCS LYW++N LQ+P++++VTLYEAI L  G R I+SKG+  ++ +++
Sbjct  268  FLALHVV-TYTKTCSILYWVLNSLQVPIAISVTLYEAICLCNGTRVIASKGKENTDWMKL  326

Query  680  TQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVE  501
             ++  YC  G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV+
Sbjct  327  HKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVVQ  386

Query  500  YYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGG  321
            YYLL+RFPVPYA YF+LVAT+AA  GQHVVRK+I + GRAS+IIF+LAFTIF+SA++LGG
Sbjct  387  YYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIFGRASIIIFVLAFTIFLSAISLGG  446

Query  320  VGISNMIWKINHHEYMGFENLC  255
            VGI NM+ K+ ++EYMGF N+C
Sbjct  447  VGIENMVEKMENNEYMGFANIC  468



>ref|XP_009592781.1| PREDICTED: uncharacterized protein LOC104089559 isoform X1 [Nicotiana 
tomentosiformis]
Length=473

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL I KNY  TCS  YWI+NLLQ+PV+V  + YEA+ L KG R I S GE     +V Q
Sbjct  271  LALHIFKNYAPTCSTTYWILNLLQLPVAVGASAYEAVCLYKGSRMIMSSGEIVITWKVHQ  330

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA F M+FSSSMSV++YY
Sbjct  331  LILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYY  390

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL+RFPVPYA+YF+ VA++AA +GQHVVR++I ++GRAS+IIFILAFTIFVSA++LGGVG
Sbjct  391  LLRRFPVPYALYFIAVASIAALVGQHVVRRIISIVGRASVIIFILAFTIFVSAISLGGVG  450

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++ I KI   ++MGF+N+C Y 
Sbjct  451  IADTIKKIEEGQHMGFDNICAYN  473



>gb|ACJ86264.1| unknown [Medicago truncatula]
Length=481

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS +YWI+NLLQ+P+++ V+ YEAI L KG R I+S G+   N  V Q
Sbjct  276  LALQIGKNYTTTCSLIYWILNLLQVPIAIGVSGYEAILLYKGKRVIASNGDQGINWSVKQ  335

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AG++GGLLGLGGGFI+GPLF+ LGIPP V+SAT+TFAM FS+SMSVVEYY
Sbjct  336  LILYCSCGIIAGIIGGLLGLGGGFILGPLFIGLGIPPQVASATSTFAMTFSASMSVVEYY  395

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF++VATVAA +GQH+VRKLI LLGRAS+IIFILA T+FVS ++LGG G
Sbjct  396  LLKRFPIPYALYFVVVATVAALVGQHLVRKLIALLGRASIIIFILALTVFVSGISLGGTG  455

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            I+N+I ++ + EYMGF NLC+Y V
Sbjct  456  IANLIKRLENKEYMGFGNLCSYAV  479



>gb|KHN32619.1| hypothetical protein glysoja_022301 [Glycine soja]
Length=490

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LA +I K++T TCS  YWI+NLLQ+PV++  T Y+A+ L  G R I+SKG+  +  +  Q
Sbjct  285  LASEIAKSHTTTCSVEYWILNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQ  344

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  345  LVLYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  404

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG--G  321
            LLKRFP+PY +YF+ V+T AAF+GQ +VRKL+ +LGRASLIIFIL+ TIFVSA++LG  G
Sbjct  405  LLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRASLIIFILSGTIFVSAISLGKCG  464

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGISNMI KI + EYMGFENLCTY 
Sbjct  465  VGISNMIQKIANKEYMGFENLCTYS  489



>ref|XP_003629897.1| hypothetical protein MTR_8g088080 [Medicago truncatula]
 gb|AET04373.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=479

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNYT TCS +YWI+NLLQ+P+++ V+ YEAI L KG R I+S G+   N  V Q
Sbjct  274  LALQIGKNYTTTCSLIYWILNLLQVPIAIGVSGYEAILLYKGKRVIASNGDQGINWSVKQ  333

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AG++GGLLGLGGGFI+GPLF+ LGIPP V+SAT+TFAM FS+SMSVVEYY
Sbjct  334  LILYCSCGIIAGIIGGLLGLGGGFILGPLFIGLGIPPQVASATSTFAMTFSASMSVVEYY  393

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF++VATVAA +GQH+VRKLI LLGRAS+IIFILA T+FVS ++LGG G
Sbjct  394  LLKRFPIPYALYFVVVATVAALVGQHLVRKLIALLGRASIIIFILALTVFVSGISLGGTG  453

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            I+N+I ++ + EYMGF NLC+Y V
Sbjct  454  IANLIKRLENKEYMGFGNLCSYAV  477



>ref|XP_003532779.1| PREDICTED: uncharacterized protein LOC100801788 [Glycine max]
 gb|KHN48051.1| hypothetical protein glysoja_015521 [Glycine soja]
Length=469

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I K +T TCS LYW+ NLLQ+P++V ++ YEA+ L KG R I+SKG+ +++  V Q
Sbjct  266  LALEIGKKHTTTCSRLYWLSNLLQVPIAVGMSSYEAVRLYKGKRIIASKGDKQTHWCVLQ  325

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG++ GLLGLGGGFI+GPLFL LGIPP V+SAT+T  M FS+SM+VVEYY
Sbjct  326  LVLFCACGTLAGMIAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYY  385

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF+ +AT AA +GQH+VRK I +LGRAS+IIFIL  T+ VSAV LGGVG
Sbjct  386  LLKRFPVPYALYFVAIATAAALVGQHLVRKAIAILGRASVIIFILTLTLSVSAVLLGGVG  445

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++MI KI + EYMGF +LCTY 
Sbjct  446  IAHMIQKIENKEYMGFGDLCTYR  468



>ref|XP_007150626.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
 gb|ESW22620.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
Length=480

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LA +I K++T TCS  YWI+NLLQ+PV++ VT ++A+ L KG   I+SKG+ ++  +  Q
Sbjct  277  LACEIGKSHTTTCSTDYWILNLLQVPVALGVTTFQAVRLYKGKAVIASKGDQQTQWRAHQ  336

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  337  LILYCACGICAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  396

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL RFP+PY +YF+ V+T AAF+GQ +V+KL+ LLGRASLIIFIL+ TIFVSA++LG VG
Sbjct  397  LLNRFPIPYTLYFVAVSTFAAFVGQVLVKKLVALLGRASLIIFILSGTIFVSALSLGSVG  456

Query  314  ISNMIWKINHHEYMGFENLCTY  249
            I++M+ K+ H EYMGFENLCTY
Sbjct  457  IASMVQKLAHKEYMGFENLCTY  478



>ref|XP_011014738.1| PREDICTED: uncharacterized protein LOC105118467 [Populus euphratica]
Length=364

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI KNY+ TCS  YW++N +QIPV+V VT Y A+ L KG RKI+SK E+ +N  + +
Sbjct  164  LALQIGKNYSTTCSVEYWLLNTMQIPVAVGVTSYVAVSLYKGRRKIASKEEARNNWPLHR  223

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L  YC   L+AG  GG+LGLGGGFI+GPLFLE+GIPP VSSATA FAMMFS+S+S VE+Y
Sbjct  224  LFFYCVTALMAGRGGGMLGLGGGFILGPLFLEMGIPPQVSSATAAFAMMFSASISAVEFY  283

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF  VAT++A +GQHV  KLI +LGRASLIIF LAF IF SA+ LGGVG
Sbjct  284  LLKRFPIPYALYFFAVATISAVVGQHVAGKLIRVLGRASLIIFTLAFIIFASAILLGGVG  343

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I   + +I  +EYMGFEN+C+
Sbjct  344  IGRSMKQIERNEYMGFENICS  364



>gb|KHM98753.1| hypothetical protein glysoja_030806 [Glycine soja]
Length=479

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LA +I K++T TCS  YW++NLLQ+PV++  T Y+A+ L  G R I+SKG+  +  +  Q
Sbjct  274  LASEIAKSHTTTCSVEYWVLNLLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQ  333

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+ AG+VGGLLGLGGGFI+GPLFLELGIPP VSSATATFAM FS+SMSVVEYY
Sbjct  334  LIMYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYY  393

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG--G  321
            LLKRFP+PY +YF+ V+T AAF+GQ +VRKL+ +LGRASLIIFIL+ TIFVSA++LG  G
Sbjct  394  LLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRASLIIFILSSTIFVSAISLGKCG  453

Query  320  VGISNMIWKINHHEYMGFENLCTYE  246
            VGISNMI +I + EYMGFENLCTY 
Sbjct  454  VGISNMIQRIANKEYMGFENLCTYS  478



>ref|XP_006580197.1| PREDICTED: uncharacterized protein LOC100818778 [Glycine max]
Length=469

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I K +T TCS L+W++NLLQ+P++V ++ YEA+ L KG R I+SKG+ +++  V Q
Sbjct  266  LALEIGKKHTTTCSRLFWLLNLLQVPIAVGMSSYEAVRLYKGKRIIASKGDQQTHWCVLQ  325

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG++ GLLGLGGGFI+GPLFL LGIPP V+SAT+T  M FS+SM+VVEYY
Sbjct  326  LVLFCACGTLAGMIAGLLGLGGGFILGPLFLGLGIPPQVASATSTLVMAFSASMAVVEYY  385

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF+ +AT AA +GQH+VRK I +LGRAS+IIFIL  T+ VSAV LGGVG
Sbjct  386  LLKRFPVPYALYFVAIATAAALVGQHLVRKAIAILGRASVIIFILTLTLSVSAVLLGGVG  445

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++MI KI + EYMGF +LCTY 
Sbjct  446  IAHMIQKIENKEYMGFGDLCTYR  468



>tpg|DAA39926.1| TPA: hypothetical protein ZEAMMB73_327447 [Zea mays]
Length=497

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  863  VSFLALQIIK-NYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISS-KG---ES  699
            ++FL LQ+ + NY A+CS  YW++N LQ+PV+V VT+YEA GL  G R +SS KG   + 
Sbjct  288  IAFLGLQLTRTNYAASCSVWYWVLNSLQVPVAVGVTVYEACGLRTGRRALSSNKGGSQQQ  347

Query  698  ESNLQVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfss  519
            +S L++ QLL YC FG+LAG+VGGLLG+GGGFIMGPLFLELGIPP VSSATATF MMFSS
Sbjct  348  QSALRIRQLLVYCLFGVLAGLVGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSS  407

Query  518  smSVVEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVS  339
            SMSVVEYYLL RFPVPYA YF  VA VAA  GQH VRKLI  LGRASLIIFILA  IFVS
Sbjct  408  SMSVVEYYLLHRFPVPYAAYFTGVAFVAAITGQHCVRKLIAWLGRASLIIFILASMIFVS  467

Query  338  AVTLGGVGISNMIWKINHHEYMGFENLC  255
            A+TLGGVGISN++ ++  H+YMGFE+LC
Sbjct  468  ALTLGGVGISNIVHRVERHQYMGFESLC  495



>ref|XP_007159525.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31519.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=347

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I KNY  TCS  YW +NL+Q+P++V ++ Y+A+ L KG R I+SKG+ +++ +V Q
Sbjct  142  LALEIGKNYATTCSEAYWALNLIQVPIAVGMSSYQAVRLYKGQRVIASKGDQQTHWRVWQ  201

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG + GLLGLGGGFI+ PLFL +GIPP V+SAT+  AM FS+SM+ VEYY
Sbjct  202  LILFCGCGTLAGTIAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAAVEYY  261

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPV YA+Y + VAT A+ +GQH+VRK++ +LGRAS+IIFIL FT+ VSAV LGGVG
Sbjct  262  LLKRFPVRYALYLVAVATAASLVGQHLVRKMVAVLGRASVIIFILTFTLSVSAVLLGGVG  321

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            +S+MI KI H EYMGF NLC Y+V
Sbjct  322  VSHMIQKIEHKEYMGFGNLCMYKV  345



>ref|XP_008228601.1| PREDICTED: uncharacterized protein LOC103327990 [Prunus mume]
Length=420

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI+KNY   CS  YW+V L QIPV+V VT Y+A+ L KG R I+SKGE  +   + +
Sbjct  220  LALQIVKNYVTKCSLTYWLVELSQIPVAVGVTSYQAVNLYKGRRVIASKGEETTKWPLYK  279

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L++YC  G  AG++GGLLGLGG F++GP+FLE+GIPP VSSATATFAM FSSSMSVVEYY
Sbjct  280  LVSYCACGTAAGMLGGLLGLGGAFMLGPMFLEMGIPPQVSSATATFAMTFSSSMSVVEYY  339

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL RFPVPYA+YF  V TV+A  GQHV  K+I  LGRASLIIFILAFT+FVS++ LGG+G
Sbjct  340  LLNRFPVPYALYFAAVTTVSAIAGQHVAGKVIKKLGRASLIIFILAFTVFVSSLMLGGIG  399

Query  314  ISNMIWKINHHEYMGFENLCT  252
            + NMI  I H + +GF+N+CT
Sbjct  400  VKNMIKNIEHKDSLGFQNICT  420



>ref|XP_006585192.1| PREDICTED: uncharacterized protein LOC100801244 [Glycine max]
Length=406

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I KNYT TCS +YW++NLLQ+P++V ++ Y+A+ L KG R I SKG+ ++N +V Q
Sbjct  201  LALEIGKNYTTTCSGVYWVINLLQVPIAVGMSSYQAMRLYKGQRIIGSKGDQQTNWRVLQ  260

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G+LAG + GLLGLGGGFI+ PLFL +GIPP V+SAT+  AM FS+SM+VVEYY
Sbjct  261  LILFCACGILAGTIAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAVVEYY  320

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+ YA+YF+ VAT AA +GQH+VRK+I +LGRAS+IIFIL  T+ VSAV LGGVG
Sbjct  321  LLKRFPISYALYFVAVATAAALVGQHLVRKVIAILGRASVIIFILTLTLCVSAVLLGGVG  380

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            ++NMI +I + EYMGF NLCTY+V
Sbjct  381  VANMIKRIENKEYMGFGNLCTYKV  404



>ref|XP_009800425.1| PREDICTED: uncharacterized protein LOC104246320 isoform X1 [Nicotiana 
sylvestris]
Length=473

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L L I KNY  TCS  YWI+NL Q+PV+V  + YEA+ L KG R I S GE+    +V Q
Sbjct  271  LVLHISKNYAPTCSTTYWILNLSQVPVAVGASAYEAVCLYKGSRTIMSSGETVITWKVHQ  330

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA F M+FSSSMSV++YY
Sbjct  331  LILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYY  390

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL+RFPVPYA+YF+ VA +AA +GQHVVR++I ++GRAS+IIFILAFTIFVSA++LGGVG
Sbjct  391  LLRRFPVPYALYFIAVAGIAALVGQHVVRRIISIVGRASVIIFILAFTIFVSAISLGGVG  450

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++ I KI   ++MGF+N+C Y 
Sbjct  451  IADTIKKIEEGQHMGFDNICAYN  473



>ref|XP_006580862.1| PREDICTED: uncharacterized protein LOC100818240 [Glycine max]
Length=422

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I KNYT TCS +YW++NLLQ+P++V ++ Y+A+ L KG R I+SKG+ +++ +V Q
Sbjct  217  LALEIGKNYTTTCSGVYWVINLLQVPIAVGMSSYQAMRLYKGQRIIASKGDQQTHWRVLQ  276

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G+LAG + GLLGLGGGFI+ PLFL LGIPP V+SAT+  AM FS+S++VVEYY
Sbjct  277  LIVFCACGILAGTIAGLLGLGGGFILAPLFLGLGIPPQVASATSILAMAFSASIAVVEYY  336

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+ YA+YF+ VAT AA +GQH+VRK+I +LGRAS+IIFIL  T+ VSAV LGGVG
Sbjct  337  LLKRFPISYALYFVAVATAAALVGQHLVRKVIAMLGRASVIIFILTLTLCVSAVLLGGVG  396

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            ++NMI +I + EYMGF NLCTY+V
Sbjct  397  VANMIKRIENKEYMGFGNLCTYKV  420



>gb|AET03944.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=473

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K Y+ TCS  YW++N LQ+P++++VTL+EAI L KG R I+S+G+ E   +
Sbjct  264  VAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGK-EITWK  322

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              ++  YCF G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  323  FHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  382

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY L RFP+PYA Y +LVAT+AA  GQHVVRK+I + GRAS+I+FILAFTIFVSA++LG
Sbjct  383  QYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLG  442

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NM+ K+ + EYMGF+NLC
Sbjct  443  GVGIGNMVEKMENEEYMGFDNLC  465



>ref|XP_003629468.1| hypothetical protein MTR_8g077830 [Medicago truncatula]
Length=480

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K Y+ TCS  YW++N LQ+P++++VTL+EAI L KG R I+S+G+ E   +
Sbjct  271  VAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGK-EITWK  329

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              ++  YCF G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  330  FHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  389

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY L RFP+PYA Y +LVAT+AA  GQHVVRK+I + GRAS+I+FILAFTIFVSA++LG
Sbjct  390  QYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLG  449

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NM+ K+ + EYMGF+NLC
Sbjct  450  GVGIGNMVEKMENEEYMGFDNLC  472



>ref|XP_007216194.1| hypothetical protein PRUPE_ppa015991mg [Prunus persica]
 gb|EMJ17393.1| hypothetical protein PRUPE_ppa015991mg [Prunus persica]
Length=402

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI+KNY   CS  YW+V L QIPV+V VT Y+A+ L KG R I+SKGE  +   + +
Sbjct  202  LALQIVKNYVTKCSLTYWLVELSQIPVAVGVTSYQAVKLYKGRRVIASKGEETTKWPLYK  261

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G  AG++GGLLGLGG F++GP+FLE+GIPP VSSATATFAM FSSSMSVVEYY
Sbjct  262  LVFYCACGTAAGMLGGLLGLGGAFMLGPMFLEMGIPPQVSSATATFAMTFSSSMSVVEYY  321

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL RFPVPYA+YF  V TV+A  GQHV  K+I  LGRASLIIFILAFT+FVS++ LGG+G
Sbjct  322  LLNRFPVPYALYFAAVTTVSAIAGQHVAGKVIKKLGRASLIIFILAFTVFVSSLMLGGIG  381

Query  314  ISNMIWKINHHEYMGFENLCT  252
            I NMI  I H + +GF+N+CT
Sbjct  382  IKNMIKNIEHKDSLGFQNICT  402



>ref|XP_002460083.1| hypothetical protein SORBIDRAFT_02g022500 [Sorghum bicolor]
 gb|EER96604.1| hypothetical protein SORBIDRAFT_02g022500 [Sorghum bicolor]
Length=455

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESES--N  690
            V+FL LQ+ KNY A+CS  YW++N LQIPV+V VT+YEA GL  G R +SSKG S+    
Sbjct  249  VAFLGLQVTKNYVASCSVWYWVLNSLQIPVAVGVTVYEAYGLRTGKRVLSSKGSSQQQST  308

Query  689  LQVTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmS  510
            L++ QLL YC FG+LAG++GGLLG+GGGFIMGPLFLELGIPP VSSATATF MMFSSSMS
Sbjct  309  LRIRQLLVYCLFGILAGLIGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMS  368

Query  509  VVEYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVT  330
            VVEYYLL RFPVPYA YF  VA VAA  GQH VRKLI  LGRASLIIFILA  IFVSA+T
Sbjct  369  VVEYYLLHRFPVPYAAYFTGVAFVAAITGQHFVRKLIAWLGRASLIIFILASMIFVSALT  428

Query  329  LGGVGISNMIWKINHHEYMGFENLC  255
            LGGVGISN++ ++  HEYMGFE+LC
Sbjct  429  LGGVGISNIVHRMERHEYMGFESLC  453



>gb|AFK35007.1| unknown [Medicago truncatula]
Length=473

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K Y+ TCS  YW++N LQ+P++++VTL+EAI L KG R I+S+G+ E   +
Sbjct  264  VAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGK-EITWK  322

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              ++  YCF G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  323  FHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  382

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY L RFP+PYA Y +LVAT+AA  GQHVVRK+I + GRAS+I+FILAFTIFVSA++LG
Sbjct  383  QYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLG  442

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NM+ K+ + EYMGF+NLC
Sbjct  443  GVGIGNMVEKMENAEYMGFDNLC  465



>gb|KHN48050.1| hypothetical protein glysoja_015520 [Glycine soja]
Length=465

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I KNYT TCS +YW++NLLQ+P++V ++ Y+A+ L KG R I SKG+ ++N +V Q
Sbjct  260  LALEIGKNYTTTCSGVYWVINLLQVPIAVGMSSYQAMRLYKGQRIIGSKGDQQTNWRVLQ  319

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G+LAG + GLLGLGGGFI+ PLFL +GIPP V+SAT+  AM FS+SM+VVEYY
Sbjct  320  LILFCACGILAGTIAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAVVEYY  379

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+ YA+YF+ VAT AA +GQH+VRK+I +LGRAS+IIFIL  T+ VSAV LGGVG
Sbjct  380  LLKRFPISYALYFVAVATAAALVGQHLVRKVIAILGRASVIIFILTLTLCVSAVLLGGVG  439

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            ++NMI +I + EYMGF NLCTY+V
Sbjct  440  VANMIKRIENKEYMGFGNLCTYKV  463



>ref|XP_009338073.1| PREDICTED: uncharacterized protein LOC103930451 [Pyrus x bretschneideri]
Length=462

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI K Y   CS  YW++ LLQIPV+V VT Y+A+ L KG R I+SKGE+ +   V +
Sbjct  262  LALQIAKTYVKKCSGTYWLIELLQIPVAVGVTSYQAVNLYKGRRVIASKGEASTKWPVYK  321

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+AYC  G+ AG++GGLLGLGG F++GPLFLE+GIPP VSSATATFAM FSSSMSVVEYY
Sbjct  322  LIAYCAGGIAAGILGGLLGLGGAFMLGPLFLEMGIPPQVSSATATFAMTFSSSMSVVEYY  381

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  V T++A +GQHV  K+I  LGRASLIIF+LA TI VS+VTLGG+G
Sbjct  382  LLKRFPVPYALYFAAVTTISAVVGQHVAGKVIKKLGRASLIIFVLASTILVSSVTLGGIG  441

Query  314  ISNMIWKINHHEYMGFENLCT  252
            + NM+  I   + +GF+N+CT
Sbjct  442  VGNMVKNIEQKKPLGFQNICT  462



>ref|XP_007159524.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31518.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=462

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LAL+I KNY  TCS  YW +NL+Q+P++V ++ Y+A+ L KG R I+SKG+ +++ +V Q
Sbjct  257  LALEIGKNYATTCSEAYWALNLIQVPIAVGMSSYQAVRLYKGQRVIASKGDQQTHWRVWQ  316

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG + GLLGLGGGFI+ PLFL +GIPP V+SAT+  AM FS+SM+ VEYY
Sbjct  317  LILFCGCGTLAGTIAGLLGLGGGFILAPLFLGIGIPPQVASATSILAMAFSASMAAVEYY  376

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPV YA+Y + VAT A+ +GQH+VRK++ +LGRAS+IIFIL FT+ VSAV LGGVG
Sbjct  377  LLKRFPVRYALYLVAVATAASLVGQHLVRKMVAVLGRASVIIFILTFTLSVSAVLLGGVG  436

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            +S+MI KI H EYMGF NLC Y+V
Sbjct  437  VSHMIQKIEHKEYMGFGNLCMYKV  460



>ref|XP_007159577.1| hypothetical protein PHAVU_002G249100g [Phaseolus vulgaris]
 gb|ESW31571.1| hypothetical protein PHAVU_002G249100g [Phaseolus vulgaris]
Length=463

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L+L+I KNY  TCS +YW VNLLQ+P++V ++ Y+A+ L KG R I+SKG+ +   +V Q
Sbjct  258  LSLEIGKNYATTCSKVYWAVNLLQVPIAVGMSSYQAMRLYKGQRVIASKGDQQRKWRVWQ  317

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ +C  G LAG V GLLGLGGGFI+ PLFL LGIPP V+SAT+  AM FS+SM+ +EYY
Sbjct  318  LILFCGCGTLAGTVAGLLGLGGGFILAPLFLGLGIPPQVASATSILAMAFSASMAALEYY  377

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPV YA+Y + VAT A+ +GQH+VRK++ +LGRAS+IIFIL FT+ VSAV LGG G
Sbjct  378  LLKRFPVRYALYLVAVATAASLVGQHLVRKMVAVLGRASVIIFILTFTLCVSAVLLGGSG  437

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            +++MI KI H EYMGF NLCTY+V
Sbjct  438  VAHMIQKIEHKEYMGFGNLCTYKV  461



>ref|XP_009338074.1| PREDICTED: uncharacterized protein LOC103930452 [Pyrus x bretschneideri]
Length=462

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI K Y   CS  YW++ LLQIPV+V VT Y+A+ L KG R I+SKGE+ +   V +
Sbjct  262  LALQIAKTYVKKCSRTYWLIELLQIPVAVGVTSYQAVNLYKGRRVIASKGEASTKWPVYK  321

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+AYC  G+ AG++GGLLGLGG F++GPLFLE+GIPP VSSATATFAM FSSSMSVVEYY
Sbjct  322  LIAYCAGGIAAGILGGLLGLGGAFMLGPLFLEMGIPPQVSSATATFAMTFSSSMSVVEYY  381

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFPVPYA+YF  V T++A +GQHV  K+I  LGRASLIIF+LA TI VS+VTLGG+G
Sbjct  382  LLKRFPVPYALYFAAVTTISAVVGQHVAGKVIKKLGRASLIIFVLASTILVSSVTLGGIG  441

Query  314  ISNMIWKINHHEYMGFENLCT  252
            + NM+  I   + +GF+N+CT
Sbjct  442  VGNMVKNIEQKKPLGFQNICT  462



>gb|ACJ85296.1| unknown [Medicago truncatula]
Length=474

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  863  VSFLALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQ  684
            V+FL +QI+K Y+ TCS  YW++N LQ+P++++VTL+EAI L KG R I+S+G+ E   +
Sbjct  265  VAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVTLFEAICLCKGTRVIASRGK-EITWK  323

Query  683  VTQLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVV  504
              ++  YCF G++AG+V GLLGLGGGFI+GPLFLELGIPP V+SAT+TFAM+FSSSMSVV
Sbjct  324  FHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSSMSVV  383

Query  503  EYYLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLG  324
            +YY L RFP+PYA Y +LVAT+AA  GQHVVRK+I + GRAS+I+FILAFTIFVSA++LG
Sbjct  384  QYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIFGRASIIVFILAFTIFVSAISLG  443

Query  323  GVGISNMIWKINHHEYMGFENLC  255
            GVGI NM+ K+ + EYMGF+N C
Sbjct  444  GVGIGNMVEKMENAEYMGFDNFC  466



>ref|XP_006343068.1| PREDICTED: uncharacterized protein LOC102587876 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343069.1| PREDICTED: uncharacterized protein LOC102587876 isoform X2 [Solanum 
tuberosum]
 ref|XP_006343070.1| PREDICTED: uncharacterized protein LOC102587876 isoform X3 [Solanum 
tuberosum]
Length=483

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            L L + KNY  TCS  YW ++LLQ+P++V  + YEA+ L KG R I S GE+    +V Q
Sbjct  280  LFLHVSKNYAPTCSTTYWTLSLLQLPIAVGASAYEAVCLYKGSRVILSSGEAVITWKVHQ  339

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G+LAG+VGGLLGLGGGFI+GPLFLELGIPP VSSATA F M+FSSSMSV++YY
Sbjct  340  LILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYY  399

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LL RFPVPYA+YF+ VA++AA +GQHVVRK+I ++GRAS+IIFILAFTIFVSA++LGG G
Sbjct  400  LLGRFPVPYALYFIAVASIAALVGQHVVRKIISIVGRASVIIFILAFTIFVSAISLGGFG  459

Query  314  ISNMIWKINHHEYMGFENLCTYE  246
            I++ I KIN  ++MGF+N+C Y 
Sbjct  460  IADTIKKINEGQHMGFDNICAYN  482



>gb|AET04372.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=474

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKGESESNLQVTQ  675
            LALQI K+YT TCS  YWI+NLLQ+P++V V+ YEA+ L KG + I+SKG+   N  V Q
Sbjct  269  LALQIGKSYTITCSVAYWILNLLQVPIAVGVSSYEAVLLYKGKKVIASKGDQGINWSVKQ  328

Query  674  LLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEYY  495
            L+ YC  G++AG++GGLLGLGGGFI+ PLFL LGIPP VSSAT+TFAM FS+SMSVVEYY
Sbjct  329  LILYCSCGIIAGLIGGLLGLGGGFILAPLFLGLGIPPQVSSATSTFAMTFSASMSVVEYY  388

Query  494  LLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGVG  315
            LLKRFP+PYA+YF++VATVAA +GQH+VRKLI+LLGRAS+IIFILA T+FVS ++LGG G
Sbjct  389  LLKRFPIPYALYFVVVATVAALVGQHLVRKLIVLLGRASIIIFILALTVFVSGISLGGTG  448

Query  314  ISNMIWKINHHEYMGFENLCTYEV  243
            I+++I +  + EYMGF +LC Y V
Sbjct  449  IASLIKRTENKEYMGFGSLCAYRV  472



>ref|XP_004302905.1| PREDICTED: uncharacterized protein LOC101293605 [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = -1

Query  854  LALQIIKNYTATCSALYWIVNLLQIPVSVAVTLYEAIGLNKGWRKISSKG-ESESNLQVT  678
            L LQI KNY   CS  YW +NLLQIPV+VAVT YE I L++G R ++SKG E      V 
Sbjct  275  LGLQIAKNYVTKCSVAYWSLNLLQIPVTVAVTSYEVIKLSQGKRILASKGSEIGEKWSVY  334

Query  677  QLLAYCffgllagvvggllglgggfimgplfLELGIPPHVssatatfammfsssmSVVEY  498
            +L++YC  GL+AG+VGGLLGLGGGFIMGPLFLE+GIPP VSSAT+TF M FSSSMSVVEY
Sbjct  335  KLVSYCSCGLIAGLVGGLLGLGGGFIMGPLFLEMGIPPQVSSATSTFIMAFSSSMSVVEY  394

Query  497  YLLKRFPVPYAIYFMLVATVAAFIGQHVVRKLIMLLGRASLIIFILAFTIFVSAVTLGGV  318
            YLL RFPVPYA+YF  VATV+A IGQHV+ K+I  LGRASLIIFILAFTIFVS +TLGGV
Sbjct  395  YLLNRFPVPYALYFAGVATVSAIIGQHVIGKVIKALGRASLIIFILAFTIFVSTLTLGGV  454

Query  317  GISNMIWKINHHEYMGFENLCTYE  246
            GI +M+ KI   E +GF+ +C ++
Sbjct  455  GIEHMVKKIERKEDLGFDKMCAHK  478



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1713026438760