BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30251_g1_i1 len=522 path=[1:0-521]

Length=522
                                                                      Score     E

ref|XP_009607861.1|  PREDICTED: ethylene-responsive transcription...  61.2    8e-09   
ref|XP_009609536.1|  PREDICTED: ethylene-responsive transcription...  60.8    2e-08   
ref|XP_006445412.1|  hypothetical protein CICLE_v10022986mg           57.8    6e-08   
gb|KDP28855.1|  hypothetical protein JCGZ_14626                       58.5    1e-07   
gb|KDP43273.1|  hypothetical protein JCGZ_22825                       58.2    1e-07   
ref|XP_009794568.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-07   
ref|XP_009628238.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-07   
ref|XP_009625878.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-07   
dbj|BAN58165.1|  ethylene response factor 115                         58.2    2e-07   
ref|XP_009781921.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-07   
ref|XP_007052301.1|  Ethylene-responsive element binding factor 1...  56.6    3e-07   
gb|KDO85532.1|  hypothetical protein CISIN_1g044584mg                 57.4    3e-07   
ref|XP_006282733.1|  hypothetical protein CARUB_v10005868mg           56.2    4e-07   
ref|XP_002511588.1|  Ethylene-responsive transcription factor, pu...  56.6    5e-07   Ricinus communis
ref|XP_010325364.1|  PREDICTED: ethylene-responsive transcription...  55.8    7e-07   
ref|XP_009609535.1|  PREDICTED: ethylene-responsive transcription...  56.2    7e-07   
gb|ADJ67441.1|  ethylene response factor 12                           56.2    9e-07   
ref|XP_002297926.1|  hypothetical protein POPTR_0001s11770g           56.6    9e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011026732.1|  PREDICTED: ethylene-responsive transcription...  56.6    1e-06   
ref|XP_009593489.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-06   
ref|XP_010089318.1|  Ethylene-responsive transcription factor 13      56.2    1e-06   
ref|XP_009787891.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-06   
ref|XP_007052303.1|  Ethylene-responsive element binding factor 1...  55.5    2e-06   
ref|XP_011094429.1|  PREDICTED: ethylene-responsive transcription...  54.7    2e-06   
gb|AGS80336.1|  ethylene response factor                              55.5    2e-06   
ref|XP_006345610.1|  PREDICTED: ethylene-responsive transcription...  54.7    2e-06   
gb|KCW62806.1|  hypothetical protein EUGRSUZ_G00397                   54.3    2e-06   
ref|XP_004231147.1|  PREDICTED: ethylene-responsive transcription...  54.3    3e-06   
ref|XP_011022365.1|  PREDICTED: ethylene-responsive transcription...  55.1    3e-06   
dbj|BAN58169.1|  ethylene response factor 91                          53.5    3e-06   
ref|XP_002304592.2|  hypothetical protein POPTR_0003s15030g           54.7    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003529037.1|  PREDICTED: ethylene-responsive transcription...  54.3    4e-06   
gb|KHN34531.1|  Ethylene-responsive transcription factor 2            53.9    4e-06   
ref|XP_009798817.1|  PREDICTED: ethylene-responsive transcription...  53.9    4e-06   
gb|AFI98122.1|  ethylene-responsive element-binding protein 6         54.3    4e-06   
ref|XP_009593488.1|  PREDICTED: ethylene-responsive transcription...  53.9    4e-06   
ref|XP_010089316.1|  Ethylene-responsive transcription factor 13      54.7    5e-06   
ref|XP_008232470.1|  PREDICTED: ethylene-responsive transcription...  54.7    5e-06   
ref|XP_007203750.1|  hypothetical protein PRUPE_ppa016903mg           54.3    5e-06   
gb|KCW62805.1|  hypothetical protein EUGRSUZ_G00396                   53.1    5e-06   
ref|XP_010068083.1|  PREDICTED: ethylene-responsive transcription...  54.3    6e-06   
ref|XP_002279585.2|  PREDICTED: ethylene-responsive transcription...  53.9    7e-06   Vitis vinifera
ref|XP_006375126.1|  hypothetical protein POPTR_0014s04600g           53.5    7e-06   
ref|XP_007038272.1|  AP2/ERF domain-containing transcription fact...  53.9    7e-06   
ref|XP_011042382.1|  PREDICTED: ethylene-responsive transcription...  53.5    8e-06   
dbj|BAN58167.1|  ethylene response factor 168                         53.5    8e-06   
ref|XP_006348008.1|  PREDICTED: ethylene-responsive transcription...  53.1    8e-06   
ref|XP_011016088.1|  PREDICTED: ethylene-responsive transcription...  53.5    8e-06   
gb|EPS69901.1|  ethylene-responsive transcription factor 2            52.8    8e-06   
gb|KCW62801.1|  hypothetical protein EUGRSUZ_G00393                   53.5    8e-06   
ref|XP_009781920.1|  PREDICTED: ethylene-responsive transcription...  53.5    9e-06   
ref|XP_002511589.1|  Ethylene-responsive transcription factor, pu...  53.5    9e-06   Ricinus communis
ref|XP_002511013.1|  Ethylene-responsive transcription factor, pu...  53.5    9e-06   Ricinus communis
ref|XP_006414077.1|  hypothetical protein EUTSA_v10027189mg           51.6    1e-05   
ref|XP_010065366.1|  PREDICTED: ethylene-responsive transcription...  53.1    1e-05   
ref|XP_008232503.1|  PREDICTED: ethylene-responsive transcription...  53.5    1e-05   
ref|XP_002511592.1|  Ethylene-responsive transcription factor, pu...  53.1    1e-05   Ricinus communis
gb|ADH04266.1|  ERF1                                                  53.1    1e-05   
ref|XP_010068081.1|  PREDICTED: ethylene-responsive transcription...  53.5    1e-05   
ref|XP_007052304.1|  Ethylene-responsive element binding factor 1...  52.8    1e-05   
gb|AFI98121.1|  ethylene-responsive element-binding protein 5         52.4    1e-05   
gb|AFB35653.1|  ERF8                                                  53.1    1e-05   
ref|XP_007134479.1|  hypothetical protein PHAVU_010G050700g           52.4    2e-05   
gb|KDP22469.1|  hypothetical protein JCGZ_26300                       52.8    2e-05   
ref|XP_007204071.1|  hypothetical protein PRUPE_ppb014367mg           52.8    2e-05   
dbj|BAN58166.1|  ethylene response factor 179                         52.8    2e-05   
gb|KHN40954.1|  Ethylene-responsive transcription factor 13           52.4    2e-05   
ref|XP_010089319.1|  Ethylene-responsive transcription factor 13      52.0    2e-05   
ref|XP_003633905.1|  PREDICTED: ethylene-responsive transcription...  52.0    2e-05   
gb|AGT21474.1|  ethylene responsive element binding factor-like       52.4    3e-05   
gb|ABU40945.1|  AP2-domain DNA-binding protein                        51.6    3e-05   Datura metel
gb|ABW77571.1|  AP2-domain DNA-binding protein ORCA3                  51.6    3e-05   Catharanthus roseus [chatas]
emb|CEF82730.1|  binding protein                                      51.6    3e-05   
emb|CAB96899.1|  AP2-domain DNA-binding protein                       51.6    3e-05   Catharanthus roseus [chatas]
ref|XP_007134477.1|  hypothetical protein PHAVU_010G050500g           51.6    3e-05   
ref|XP_011094406.1|  PREDICTED: ethylene-responsive transcription...  51.6    3e-05   
ref|XP_009335577.1|  PREDICTED: ethylene-responsive transcription...  52.0    3e-05   
ref|XP_010508242.1|  PREDICTED: ethylene-responsive transcription...  52.0    3e-05   
ref|XP_009335578.1|  PREDICTED: ethylene-responsive transcription...  52.4    3e-05   
gb|KCW62795.1|  hypothetical protein EUGRSUZ_G00386                   51.2    3e-05   
ref|XP_009341335.1|  PREDICTED: ethylene-responsive transcription...  52.4    3e-05   
ref|XP_010508240.1|  PREDICTED: ethylene-responsive transcription...  52.0    3e-05   
gb|AID51422.1|  ethylene response factor 17                           52.0    4e-05   
ref|XP_010508241.1|  PREDICTED: ethylene-responsive transcription...  51.6    4e-05   
ref|XP_008376227.1|  PREDICTED: ethylene-responsive transcription...  52.0    4e-05   
ref|XP_010506419.1|  PREDICTED: ethylene-responsive transcription...  52.0    4e-05   
ref|XP_008370005.1|  PREDICTED: ethylene-responsive transcription...  51.6    4e-05   
ref|XP_010518091.1|  PREDICTED: ethylene-responsive transcription...  51.6    4e-05   
gb|KCW62512.1|  hypothetical protein EUGRSUZ_G00002                   51.2    4e-05   
gb|KDP28854.1|  hypothetical protein JCGZ_14625                       50.8    5e-05   
ref|XP_010067932.1|  PREDICTED: ethylene-responsive transcription...  51.6    5e-05   
gb|AAM65925.1|  putative ethylene response element binding protei...  51.2    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182011.1|  ethylene-responsive transcription factor 13         51.2    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294915.1|  hypothetical protein CARUB_v10023967mg           51.6    5e-05   
ref|XP_007203292.1|  hypothetical protein PRUPE_ppa025748mg           51.2    5e-05   
ref|XP_008232505.1|  PREDICTED: ethylene-responsive transcription...  51.2    5e-05   
emb|CDY30489.1|  BnaA04g25900D                                        51.2    5e-05   
ref|XP_006397665.1|  hypothetical protein EUTSA_v10001758mg           51.2    5e-05   
ref|XP_002880142.1|  hypothetical protein ARALYDRAFT_903921           51.2    6e-05   
ref|XP_009759672.1|  PREDICTED: ethylene-responsive transcription...  51.2    6e-05   
ref|XP_010068077.1|  PREDICTED: ethylene-responsive transcription...  51.6    6e-05   
ref|XP_010426455.1|  PREDICTED: ethylene-responsive transcription...  50.4    6e-05   
gb|KCW62799.1|  hypothetical protein EUGRSUZ_G00391                   50.8    6e-05   
ref|XP_008344394.1|  PREDICTED: ethylene-responsive transcription...  51.2    6e-05   
emb|CAN82632.1|  hypothetical protein VITISV_028134                   50.4    7e-05   Vitis vinifera
gb|KFK42581.1|  hypothetical protein AALP_AA1G014000                  50.1    7e-05   
ref|XP_010544359.1|  PREDICTED: ethylene-responsive transcription...  50.1    7e-05   
emb|CAN81895.1|  hypothetical protein VITISV_007029                   50.4    8e-05   Vitis vinifera
ref|XP_010068078.1|  PREDICTED: ethylene-responsive transcription...  50.8    8e-05   
ref|XP_002271521.1|  PREDICTED: ethylene-responsive transcription...  50.4    8e-05   Vitis vinifera
gb|KCW62798.1|  hypothetical protein EUGRSUZ_G00390                   50.8    9e-05   
ref|XP_010089315.1|  Ethylene-responsive transcription factor 13      49.7    9e-05   
emb|CBJ55933.1|  ethylene response factor 2.2                         50.4    9e-05   
ref|XP_008232471.1|  PREDICTED: ethylene-responsive transcription...  50.4    1e-04   
ref|XP_002271614.1|  PREDICTED: ethylene-responsive transcription...  50.4    1e-04   Vitis vinifera
ref|XP_010424028.1|  PREDICTED: ethylene-responsive transcription...  49.7    1e-04   
ref|XP_010068079.1|  PREDICTED: ethylene-responsive transcription...  50.8    1e-04   
ref|XP_002872976.1|  hypothetical protein ARALYDRAFT_912253           49.3    1e-04   
ref|XP_010068075.1|  PREDICTED: ethylene-responsive transcription...  50.1    1e-04   
ref|XP_006375128.1|  ethylene-responsive element binding protein 1    48.5    1e-04   
gb|AEQ93554.1|  AP2/ERF transcription factor                          50.4    1e-04   
ref|XP_010065367.1|  PREDICTED: ethylene-responsive transcription...  50.4    1e-04   
ref|XP_002271494.1|  PREDICTED: ethylene-responsive transcription...  50.1    1e-04   Vitis vinifera
gb|KCW62802.1|  hypothetical protein EUGRSUZ_G00394                   50.4    1e-04   
gb|KCW62796.1|  hypothetical protein EUGRSUZ_G00388                   50.1    1e-04   
ref|XP_004308507.1|  PREDICTED: ethylene-responsive transcription...  49.7    2e-04   
ref|XP_009142287.1|  PREDICTED: ethylene-responsive transcription...  50.1    2e-04   
sp|Q40476.1|ERF1_TOBAC  RecName: Full=Ethylene-responsive transcr...  50.1    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_007204029.1|  hypothetical protein PRUPE_ppa020417mg           49.7    2e-04   
ref|XP_010109127.1|  Ethylene-responsive transcription factor 2       50.1    2e-04   
ref|XP_009771895.1|  PREDICTED: ethylene-responsive transcription...  50.1    2e-04   
ref|XP_007052302.1|  Ethylene-responsive element binding factor 1...  50.1    2e-04   
emb|CDY23459.1|  BnaC04g49870D                                        49.7    2e-04   
gb|EYU20174.1|  hypothetical protein MIMGU_mgv1a018364mg              49.7    2e-04   
ref|XP_003521070.1|  PREDICTED: ethylene-responsive transcription...  49.3    2e-04   
ref|XP_011076437.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  49.7    2e-04   
ref|XP_006421523.1|  hypothetical protein CICLE_v10005891mg           49.3    2e-04   
emb|CDP09437.1|  unnamed protein product                              49.3    3e-04   
gb|KDO39173.1|  hypothetical protein CISIN_1g028566mg                 49.3    3e-04   
ref|XP_003521071.1|  PREDICTED: ethylene-responsive transcription...  48.9    3e-04   
ref|XP_011094418.1|  PREDICTED: ethylene-responsive transcription...  48.9    3e-04   
ref|XP_010068071.1|  PREDICTED: ethylene-responsive transcription...  49.3    3e-04   
gb|ADE41124.1|  AP2 domain class transcription factor                 49.7    3e-04   
ref|XP_009598140.1|  PREDICTED: ethylene-responsive transcription...  48.9    3e-04   
ref|XP_006375130.1|  hypothetical protein POPTR_0014s04640g           48.9    3e-04   
ref|XP_007203094.1|  hypothetical protein PRUPE_ppa023698mg           48.9    3e-04   
ref|XP_009606945.1|  PREDICTED: ethylene-responsive transcription...  49.3    3e-04   
gb|AHB33881.1|  ERF transcription factor 10                           49.3    3e-04   
ref|XP_009335608.1|  PREDICTED: ethylene-responsive transcription...  49.3    3e-04   
emb|CDP05380.1|  unnamed protein product                              49.3    3e-04   
gb|AHA93900.1|  ethylene response factor 10                           49.3    3e-04   
emb|CDY56473.1|  BnaC04g53270D                                        48.9    3e-04   
ref|XP_008232472.1|  PREDICTED: ethylene-responsive transcription...  48.9    4e-04   
ref|XP_006490017.1|  PREDICTED: ethylene-responsive transcription...  48.5    4e-04   
emb|CDX74692.1|  BnaA05g04380D                                        48.9    4e-04   
ref|XP_009144089.1|  PREDICTED: ethylene-responsive transcription...  48.9    4e-04   
ref|XP_008363915.1|  PREDICTED: ethylene-responsive transcription...  48.5    4e-04   
ref|XP_010025350.1|  PREDICTED: ethylene-responsive transcription...  48.9    4e-04   
gb|EYU28602.1|  hypothetical protein MIMGU_mgv1a022521mg              48.9    4e-04   
ref|XP_009335609.1|  PREDICTED: ethylene-responsive transcription...  48.5    4e-04   
ref|XP_008345528.1|  PREDICTED: ethylene-responsive transcription...  48.1    5e-04   
dbj|BAN45683.1|  ethylene response factor                             48.5    5e-04   
ref|XP_006365341.1|  PREDICTED: ethylene-responsive transcription...  48.9    5e-04   
ref|XP_009765938.1|  PREDICTED: ethylene-responsive transcription...  48.5    5e-04   
gb|KDP28852.1|  hypothetical protein JCGZ_14623                       48.5    5e-04   
ref|XP_004239983.1|  PREDICTED: ethylene-responsive transcription...  48.5    6e-04   
ref|NP_001236246.1|  uncharacterized protein LOC100527194             48.5    6e-04   
ref|XP_011031988.1|  PREDICTED: ethylene-responsive transcription...  48.1    6e-04   
ref|XP_009625877.1|  PREDICTED: ethylene-responsive transcription...  48.1    6e-04   
ref|XP_004235186.2|  PREDICTED: ethylene-responsive transcription...  48.5    6e-04   
sp|Q84XB3.1|ERF1_SOLLC  RecName: Full=Ethylene-responsive transcr...  48.5    6e-04   Solanum lycopersicum
ref|XP_008370115.1|  PREDICTED: ethylene-responsive transcription...  48.1    6e-04   
gb|AAC50047.1|  Pti4                                                  48.5    6e-04   Solanum lycopersicum
ref|XP_003520428.1|  PREDICTED: ethylene-responsive transcription...  48.1    6e-04   
ref|XP_009608915.1|  PREDICTED: ethylene-responsive transcription...  48.5    6e-04   
ref|NP_001275437.1|  Pti4                                             48.1    6e-04   
gb|EPS62607.1|  hypothetical protein M569_12181                       47.4    7e-04   
ref|NP_001275603.1|  ethylene-responsive transcription factor 1-like  48.5    7e-04   
ref|XP_011016089.1|  PREDICTED: ethylene-responsive transcription...  48.1    7e-04   
ref|XP_006375127.1|  hypothetical protein POPTR_0014s04610g           48.1    7e-04   
gb|KHN26289.1|  Ethylene-responsive transcription factor 13           47.8    7e-04   
ref|XP_009611801.1|  PREDICTED: ethylene-responsive transcription...  48.1    7e-04   
gb|ADP37426.1|  ethylene-responsive-element-binding factor 11         47.8    7e-04   
ref|XP_011031966.1|  PREDICTED: ethylene-responsive transcription...  48.1    8e-04   
dbj|BAN45684.1|  ethylene response factor                             47.8    8e-04   
ref|XP_010321615.1|  PREDICTED: ethylene-responsive transcription...  47.4    0.001   
gb|EYU31898.1|  hypothetical protein MIMGU_mgv1a020883mg              47.0    0.001   



>ref|XP_009607861.1| PREDICTED: ethylene-responsive transcription factor 1-like [Nicotiana 
tomentosiformis]
Length=204

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE +ED A+AYDR+ YK+RG+RA+LNFPHLIGS +  +  RVKP+KR ++     P
Sbjct  94   WLGTYETSEDVALAYDRSTYKLRGARALLNFPHLIGS-NVVELNRVKPKKRLRSLELSFP  152

Query  341  sspsssvdgesPKRRKIELINAVAKTNL  258
            S  ++     + K+R + LIN++ K N 
Sbjct  153  SQTTTECTTPNLKKRNVALINSLTKANF  180



>ref|XP_009609536.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nicotiana tomentosiformis]
Length=215

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTY+  EDAA+AYD+AA+K+RGSRA LNFPHLIGS + P+P RV    R  +      
Sbjct  118  WLGTYQTPEDAALAYDQAAFKIRGSRARLNFPHLIGSNNMPEPTRVTG-IRHNSRSLEPS  176

Query  341  sspsssvdgesPKRRKIELINAVAKTNLMNAISGIQ  234
            S+ S++      ++R IE+IN++AK  L+  I  ++
Sbjct  177  STSSTTSSENGTRKRNIEVINSIAKAKLVGHIRDLE  212



>ref|XP_006445412.1| hypothetical protein CICLE_v10022986mg [Citrus clementina]
 gb|ESR58652.1| hypothetical protein CICLE_v10022986mg [Citrus clementina]
Length=106

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE  EDAA+AYDRAA+K+RG++A LNFPHLIGS    +P+RV PR+R Q+
Sbjct  12   WLGTYETPEDAAMAYDRAAFKLRGAKAKLNFPHLIGSAHCREPIRVNPRRRPQS  65



>gb|KDP28855.1| hypothetical protein JCGZ_14626 [Jatropha curcas]
Length=232

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+KMRGS+A LNFPHLIGS D   PVRV P++R
Sbjct  164  WLGTYETPEDAALAYDQAAFKMRGSKAKLNFPHLIGSADYQPPVRVSPKRR  214



>gb|KDP43273.1| hypothetical protein JCGZ_22825 [Jatropha curcas]
Length=210

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD AA+KMRG +A LNFPHLIGS D   PVRV P++R
Sbjct  144  WLGTYETPEDAALAYDEAAFKMRGCKAKLNFPHLIGSTDYQPPVRVSPKRR  194



>ref|XP_009794568.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=239

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE AEDAA+AYD+AA+K+RGSRA LNFPHLIGS + P P RV  R R +T      
Sbjct  143  WLGTYETAEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMPKPARVTAR-RSRTRSPEPS  200

Query  341  sspsssvdgesPKRRKIELINAVAKTNLM  255
            SS S+S     P++R I++IN++AK   +
Sbjct  201  SSSSTSSSENVPRKRNIDVINSIAKAKFL  229



>ref|XP_009628238.1| PREDICTED: ethylene-responsive transcription factor 1-like, partial 
[Nicotiana tomentosiformis]
Length=218

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYD+AA+K+R SRA LNFPHLIGS + P P RV  R R +T      
Sbjct  122  WLGTYETPEDAALAYDQAAFKIRSSRARLNFPHLIGS-NMPKPARVTAR-RSRTRSPEPS  179

Query  341  sspsssvdgesPKRRKIELINAVAKTNLM  255
            SS  +S   +  ++RKI+LIN++AK   +
Sbjct  180  SSSCTSSSEKGTRKRKIDLINSIAKAKFI  208



>ref|XP_009625878.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
 dbj|BAN57618.1| ethylene response factor 189 [Nicotiana tabacum]
Length=232

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE AEDAA+AYD+AA+K+RGSRA LNFPHLIGS + P P RV  R R +T      
Sbjct  136  WLGTYETAEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMPKPARVTAR-RSRTRSPEPS  193

Query  341  sspsssvdgesPKRRKIELINAVAKTNLM  255
            SS S+S     P++R I++IN++AK   +
Sbjct  194  SSSSTSSSENVPRKRNIDVINSIAKAKFL  222



>dbj|BAN58165.1| ethylene response factor 115 [Nicotiana tabacum]
Length=229

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYD+AA+K+R SRA LNFPHLIGS + P P RV  R R +T      
Sbjct  133  WLGTYETPEDAALAYDQAAFKIRSSRARLNFPHLIGS-NMPKPARVTAR-RSRTRSPEPS  190

Query  341  sspsssvdgesPKRRKIELINAVAKTNLM  255
            SS  +S   +  ++RKI+LIN++AK   +
Sbjct  191  SSSCTSSSEKGTRKRKIDLINSIAKAKFI  219



>ref|XP_009781921.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=223

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE AEDAA+AYD+AA+K+RGSRA LNFPHLIGS + P P RV  R R +T      
Sbjct  130  WLGTYETAEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMPKPARVTAR-RSRTRSPEPL  187

Query  341  sspsssvdgesPKRRKIELINAVAK  267
            SS S+S     P++RKI++IN++AK
Sbjct  188  SSSSTSSSVNVPRKRKIDVINSIAK  212



>ref|XP_007052301.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96458.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=188

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYD+AA+++RGS+A LNFPHLIGS ++ +PVRV PR+R 
Sbjct  132  WLGTYETPEDAALAYDKAAFEIRGSKAKLNFPHLIGSSNSTEPVRVCPRRRS  183



>gb|KDO85532.1| hypothetical protein CISIN_1g044584mg [Citrus sinensis]
Length=223

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE  EDAA+AYDRAA+K+RG++A LNFPHLIGS    +P+RV PR+R Q+
Sbjct  129  WLGTYETPEDAAMAYDRAAFKLRGAKAKLNFPHLIGSAHCREPIRVNPRRRPQS  182



>ref|XP_006282733.1| hypothetical protein CARUB_v10005868mg [Capsella rubella]
 gb|EOA15631.1| hypothetical protein CARUB_v10005868mg [Capsella rubella]
Length=176

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV-KPRKRQQT  360
            WLGTYE AE+AAVAYD+AA+KMRGS+A LNFPHLIG  D  +PVRV +  KRQ++
Sbjct  85   WLGTYETAEEAAVAYDKAAFKMRGSKAKLNFPHLIGCIDQAEPVRVTQCHKRQRS  139



>ref|XP_002511588.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50257.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=221

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+KMRG +A LNFPHLIGS D   PVRV P++R
Sbjct  153  WLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSNDYQPPVRVSPKRR  203



>ref|XP_010325364.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=180

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE  EDAA+AYD+AA+K+RGS+A LNFPHLIGS   P+P RV PR+R  +
Sbjct  112  WLGTYETPEDAALAYDQAAFKIRGSKARLNFPHLIGS-GVPEPARVNPRRRSHS  164



>ref|XP_009609535.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=217

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYD+AA+K+RGSRA LNFPHLIGS + P+P RVK   R  +      
Sbjct  121  WLGTYETPEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMPEPARVKG-SRHNSCSLEPS  178

Query  341  sspsssvdgesPKRRKIELINAVAKTNLMNAISGIQF  231
            SS S+ +     ++R I++IN++AK   +  I  +  
Sbjct  179  SSSSTPLSENGTRKRNIDVINSIAKAKSVGHIRNLHM  215



>gb|ADJ67441.1| ethylene response factor 12 [Actinidia deliciosa]
Length=248

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AAVAYD+AAY+MRGSRA+LNFPH IGS D P+PVRV  ++R
Sbjct  143  WLGTYETAEEAAVAYDKAAYRMRGSRALLNFPHRIGS-DEPEPVRVTSKRR  192



>ref|XP_002297926.1| hypothetical protein POPTR_0001s11770g [Populus trichocarpa]
 gb|EEE82731.1| hypothetical protein POPTR_0001s11770g [Populus trichocarpa]
Length=262

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE A++AA+AYDRAAY+MRGS+A+LNFPH IGS + PDPVR+  ++RQ
Sbjct  159  WLGTYETAKEAALAYDRAAYRMRGSKALLNFPHKIGS-NEPDPVRITAKRRQ  209



>ref|XP_011026732.1| PREDICTED: ethylene-responsive transcription factor 2-like [Populus 
euphratica]
Length=262

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE A++AA+AYDRAAY+MRGS+A+LNFPH IGS + PDPVR+  ++RQ
Sbjct  159  WLGTYETAKEAALAYDRAAYRMRGSKALLNFPHKIGS-NEPDPVRITAKRRQ  209



>ref|XP_009593489.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
 dbj|BAN58168.1| ethylene response factor 163 [Nicotiana tabacum]
Length=186

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE  EDAA+AYD+AA+K+RGS+A LNFPHL+GS   P+P RV PR+R  +
Sbjct  119  WLGTYETPEDAALAYDQAAFKIRGSKARLNFPHLVGS-GMPEPARVNPRRRSHS  171



>ref|XP_010089318.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37643.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=254

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA++MRG++A LNFPHLIGS +AP+PVR+ P++R
Sbjct  156  WLGTYETPEDAALAYDRAAFEMRGAKAKLNFPHLIGS-EAPEPVRITPKRR  205



>ref|XP_009787891.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=187

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE  EDAA+AYD+AA+K+RGS+A LNFPHL+GS   P+P RV PR+R  +
Sbjct  120  WLGTYETPEDAALAYDQAAFKIRGSKARLNFPHLVGS-GMPEPARVNPRRRSHS  172



>ref|XP_007052303.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96460.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=229

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 66/104 (63%), Gaps = 6/104 (6%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYDRAA+KMRG++A LNFPHLIGS D  +PVRV   KR+ +S     
Sbjct  120  WLGTYETPEDAALAYDRAAFKMRGAKAKLNFPHLIGS-DQVEPVRVTNNKRRSSSQSSAQ  178

Query  341  sspsssvdge----sPKRRKIELINAVAKTNLMNAISGIQFRPT  222
            S+  SS   +      KRR I  IN+  KT L  + S ++  PT
Sbjct  179  SASCSSYISDNGTPKSKRRMISEINSAVKTEL-GSESELELTPT  221



>ref|XP_011094429.1| PREDICTED: ethylene-responsive transcription factor 1-like [Sesamum 
indicum]
Length=185

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE  E+AA+AYD+AA+K+RGSRA +NFPHL+GS DAP+P+RV  R    +
Sbjct  105  WLGTYETPEEAALAYDKAAFKLRGSRARVNFPHLVGS-DAPEPIRVTKRSHAMS  157



>gb|AGS80336.1| ethylene response factor [Actinidia eriantha]
Length=248

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AAVAYD+AAY+MRGSRA+LNFPH IGS D P+P+RV  ++R
Sbjct  143  WLGTYETAEEAAVAYDKAAYRMRGSRALLNFPHRIGS-DDPEPIRVTSKRR  192



>ref|XP_006345610.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=189

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 10/102 (10%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTY   EDAA+AYDR A+K+RG+RA+LNFPHLIG+ +  +  RV+P++R ++      
Sbjct  90   WLGTYATPEDAALAYDRTAFKLRGTRALLNFPHLIGT-NVAELNRVRPKRRSRS------  142

Query  341  sspsssvdgesPKRRKIELINAVAKTN---LMNAISGIQFRP  225
            +      +  SPKRR  +LIN++AK N    M  I+ + F P
Sbjct  143  TEIIKEEEIPSPKRRNPQLINSIAKVNSIIHMFEITSLAFHP  184



>gb|KCW62806.1| hypothetical protein EUGRSUZ_G00397 [Eucalyptus grandis]
Length=190

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDA +AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV P++R 
Sbjct  88   WLGTYETPEDAGLAYDRAAFKMRGSKAKLNFPHLIGSAEH-EPVRVSPKRRS  138



>ref|XP_004231147.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=202

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTY   EDAA+AYD+AAYK+RGS+A LNFPHLIGS D  +PVRV PRKR  +
Sbjct  134  WLGTYGTPEDAALAYDQAAYKIRGSKARLNFPHLIGS-DISEPVRVAPRKRCHS  186



>ref|XP_011022365.1| PREDICTED: ethylene-responsive transcription factor 2-like [Populus 
euphratica]
Length=252

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+A +AYDRAAY+MRGS+A+LNFPH IGS + PDPVRV  ++R+
Sbjct  151  WLGTYETAEEAGLAYDRAAYRMRGSKALLNFPHKIGS-NEPDPVRVTTKRRE  201



>dbj|BAN58169.1| ethylene response factor 91 [Nicotiana tabacum]
Length=144

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AAYK+RGS+A LNFPHLIGS +  +PVRV PR+R
Sbjct  66   WLGTYETPEDAALAYDQAAYKIRGSKARLNFPHLIGS-NISEPVRVAPRRR  115



>ref|XP_002304592.2| hypothetical protein POPTR_0003s15030g [Populus trichocarpa]
 gb|EEE79571.2| hypothetical protein POPTR_0003s15030g [Populus trichocarpa]
Length=259

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+A +AYDRAAY+MRGS+A+LNFPH IGS + PDPVRV  ++R+
Sbjct  151  WLGTYETAEEAGLAYDRAAYRMRGSKALLNFPHKIGS-NEPDPVRVTTKRRE  201



>ref|XP_003529037.1| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=205

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  E A +AYDRAA+KMRGS+A LNFPHLIGS   P PVRV
Sbjct  112  WLGTYETEEAAGLAYDRAAFKMRGSKAKLNFPHLIGSHAPPQPVRV  157



>gb|KHN34531.1| Ethylene-responsive transcription factor 2 [Glycine soja]
Length=205

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  E A +AYDRAA+KMRGS+A LNFPHLIGS   P PVRV
Sbjct  112  WLGTYETEEAAGLAYDRAAFKMRGSKAKLNFPHLIGSHAPPQPVRV  157



>ref|XP_009798817.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798818.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X2 [Nicotiana sylvestris]
Length=210

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AAYK+RGS+A LNFPHLIGS +  +PVRV PR+R
Sbjct  130  WLGTYETPEDAALAYDQAAYKIRGSKARLNFPHLIGS-NISEPVRVAPRRR  179



>gb|AFI98122.1| ethylene-responsive element-binding protein 6 [Gossypium barbadense]
Length=222

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS D   PVR+   KRQ
Sbjct  131  WLGTYETLEDAALAYDRAAFKMRGSKAKLNFPHLIGS-DQVQPVRLSNNKRQ  181



>ref|XP_009593488.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
Length=204

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AAYK+RGS+A LNFPHLIGS +  +PVRV PR+R
Sbjct  126  WLGTYETPEDAALAYDQAAYKIRGSKARLNFPHLIGS-NISEPVRVAPRRR  175



>ref|XP_010089316.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37641.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=260

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA++MRG++A LNFPHLIGS +A +PVR+KP++R 
Sbjct  160  WLGTYETPEDAALAYDRAAFEMRGAKAKLNFPHLIGS-EAREPVRIKPKRRS  210



>ref|XP_008232470.1| PREDICTED: ethylene-responsive transcription factor 2-like [Prunus 
mume]
Length=272

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AEDAA+AYD+AA+KMRGS+A LNFPHLIGS +  +PVR+ P++R
Sbjct  154  WLGTYETAEDAALAYDKAAFKMRGSKAKLNFPHLIGS-EGCEPVRITPKRR  203



>ref|XP_007203750.1| hypothetical protein PRUPE_ppa016903mg [Prunus persica]
 gb|EMJ04949.1| hypothetical protein PRUPE_ppa016903mg [Prunus persica]
Length=256

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AEDAA+AYD+AA+KMRGS+A LNFPHLIGS +  +PVR+ P++R
Sbjct  154  WLGTYETAEDAALAYDKAAFKMRGSKAKLNFPHLIGS-EGCEPVRITPKRR  203



>gb|KCW62805.1| hypothetical protein EUGRSUZ_G00396, partial [Eucalyptus grandis]
Length=181

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV P++R 
Sbjct  87   WLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEY-EPVRVSPKRRS  137



>ref|XP_010068083.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=255

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDA +AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV P++R 
Sbjct  153  WLGTYETPEDAGLAYDRAAFKMRGSKAKLNFPHLIGSAEH-EPVRVSPKRRS  203



>ref|XP_002279585.2| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis 
vinifera]
Length=240

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AAVAYDRAAY+MRGSRA+LNFPH +GS + PDPVR+  ++R
Sbjct  142  WLGTYETAEEAAVAYDRAAYRMRGSRALLNFPHRVGSGE-PDPVRITAKRR  191



>ref|XP_006375126.1| hypothetical protein POPTR_0014s04600g [Populus trichocarpa]
 gb|ERP52923.1| hypothetical protein POPTR_0014s04600g [Populus trichocarpa]
Length=226

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +P RV  +KR
Sbjct  144  WLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGSNNNWEPTRVTSKKR  194



>ref|XP_007038272.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOY22773.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=272

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AE+AA+AYDRAAY+MRGSRA+LNFPH IG+ + P+PVRV  ++R+ 
Sbjct  170  WLGTYETAEEAALAYDRAAYRMRGSRALLNFPHRIGN-NEPEPVRVTAKRREH  221



>ref|XP_011042382.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=225

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +P RV  +KR
Sbjct  143  WLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGSNNNWEPARVTSKKR  193



>dbj|BAN58167.1| ethylene response factor 168 [Nicotiana tabacum]
Length=217

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYD+AA+K+RGSRA LNFPHLIGS + P+P RVK      +      
Sbjct  121  WLGTYETPEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMPEPARVKG-SCHNSCSLEPS  178

Query  341  sspsssvdgesPKRRKIELINAVAKTNLMNAISGIQ  234
            SS S+ +     ++R I++IN++AK   +  I  + 
Sbjct  179  SSSSTPLSENGTRKRNIDVINSIAKAKSVGHIRNLH  214



>ref|XP_006348008.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
tuberosum]
Length=202

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AAYK+RGS+A LNFPHLIGS +  +P+RV PR+R
Sbjct  134  WLGTYETPEDAALAYDQAAYKIRGSKARLNFPHLIGS-NKSEPIRVAPRRR  183



>ref|XP_011016088.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=225

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +P RV  +KR
Sbjct  143  WLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGSNNNWEPARVTSKKR  193



>gb|EPS69901.1| ethylene-responsive transcription factor 2, partial [Genlisea 
aurea]
Length=179

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA AYDRAAY+MRG +A+LNFPH IGS + P+P+R+ P++R 
Sbjct  111  WLGTYETAEEAASAYDRAAYRMRGCKALLNFPHKIGSGE-PEPIRISPKRRS  161



>gb|KCW62801.1| hypothetical protein EUGRSUZ_G00393 [Eucalyptus grandis]
Length=226

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV P++R 
Sbjct  148  WLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEY-EPVRVSPKRRS  198



>ref|XP_009781920.1| PREDICTED: ethylene-responsive transcription factor 1-like [Nicotiana 
sylvestris]
Length=227

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYD+AA+K+RGSRA LNFPHLIGS + P P RV  R+ ++       
Sbjct  131  WLGTYETPEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMPKPARVTARRSRRR-SPEPS  188

Query  341  sspsssvdgesPKRRKIELINAVAKTNLM  255
            SS  +S      ++RKI++IN++AK  L+
Sbjct  189  SSSCTSSSENGTRKRKIDVINSIAKAKLV  217



>ref|XP_002511589.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50258.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=225

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYEK EDAA+AYDRAA+KMRG+RA LNFPHLIGS D  +P+R    KR++ 
Sbjct  145  WLGTYEKPEDAALAYDRAAFKMRGARAKLNFPHLIGS-DEYEPIRAGNNKRKRC  197



>ref|XP_002511013.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF51615.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=256

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 3/52 (6%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYD AA++MRGSRA+LNFPH +GS   P+PVRV  ++R+
Sbjct  161  WLGTYETAEEAALAYDIAAFRMRGSRALLNFPHRVGS---PEPVRVTAKRRE  209



>ref|XP_006414077.1| hypothetical protein EUTSA_v10027189mg, partial [Eutrema salsugineum]
 gb|ESQ55530.1| hypothetical protein EUTSA_v10027189mg, partial [Eutrema salsugineum]
Length=136

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  35   WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  84



>ref|XP_010065366.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=231

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV P++R 
Sbjct  153  WLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEY-EPVRVSPKRRS  203



>ref|XP_008232503.1| PREDICTED: ethylene-responsive transcription factor 13-like [Prunus 
mume]
Length=241

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AEDA++AYDRAAYKMRGS+A LNFPHLIGS D+ +P RV P++
Sbjct  122  WLGTYETAEDASLAYDRAAYKMRGSKAKLNFPHLIGSHDS-EPGRVAPKR  170



>ref|XP_002511592.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50261.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=223

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRG++A LNFPHLIGS D  +PVRV  R+R 
Sbjct  126  WLGTYETPEDAALAYDRAAFKMRGTKAKLNFPHLIGSDDL-EPVRVSNRRRS  176



>gb|ADH04266.1| ERF1 [Nicotiana benthamiana]
Length=223

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE AEDAA+AYD+AA+K+RGSRA LNFPHLIGS +   P RV  R R +T      
Sbjct  130  WLGTYETAEDAALAYDQAAFKIRGSRARLNFPHLIGS-NMRKPARVTER-RSRTRSPEPS  187

Query  341  sspsssvdgesPKRRKIELINAVA  270
            SS S+S     P++RKI++IN++A
Sbjct  188  SSSSTSSSVNVPRKRKIDVINSIA  211



>ref|XP_010068081.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV P++R 
Sbjct  148  WLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEY-EPVRVSPKRRS  198



>ref|XP_007052304.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96461.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=210

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAP--DPVRVKPRKRQ  366
            WLGTYE  EDAA+AYD+AA+KMRGS+A LNFPHLIGS D    +P+R  P++R 
Sbjct  139  WLGTYETPEDAALAYDQAAFKMRGSKAKLNFPHLIGSGDLELVEPIRASPKRRS  192



>gb|AFI98121.1| ethylene-responsive element-binding protein 5 [Gossypium barbadense]
Length=190

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTY+  EDAA+AYD+AA+K+RGS+A LNFPHLIGS +  +PVRV PR+R 
Sbjct  117  WLGTYQTPEDAALAYDKAAFKIRGSKAKLNFPHLIGSSNV-EPVRVGPRRRS  167



>gb|AFB35653.1| ERF8 [Gossypium hirsutum]
Length=265

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AE+AA+AYDRAA+KMRGSRA+LNFPH IG+ + P PVR+  ++R+ 
Sbjct  164  WLGTYETAEEAALAYDRAAFKMRGSRALLNFPHRIGN-NEPAPVRITAKRREN  215



>ref|XP_007134479.1| hypothetical protein PHAVU_010G050700g [Phaseolus vulgaris]
 gb|ESW06473.1| hypothetical protein PHAVU_010G050700g [Phaseolus vulgaris]
Length=211

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  E+A +AYD+AA++MRG++A LNFPHLI S  A  PVR+    ++ T      
Sbjct  102  WLGTYESEEEAGLAYDKAAFEMRGNKAKLNFPHLIDSDMAMKPVRISKTSKESTLESYSS  161

Query  341  sspsssvdgesPKRRK-IELINAVAK  267
             SPSS  +  S KR+  +EL+N +AK
Sbjct  162  LSPSSDAEEGSKKRKNLVELLNRLAK  187



>gb|KDP22469.1| hypothetical protein JCGZ_26300 [Jatropha curcas]
Length=254

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE AE+AA+AYDRAA++MRGSRA+LNFPH IGS + P+PVR+   KR +T
Sbjct  156  WLGTYETAEEAALAYDRAAFRMRGSRALLNFPHKIGS-NEPEPVRIT-SKRSET  207



>ref|XP_007204071.1| hypothetical protein PRUPE_ppb014367mg [Prunus persica]
 gb|EMJ05270.1| hypothetical protein PRUPE_ppb014367mg [Prunus persica]
Length=237

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AEDA +AYDRAA+KMRGS+A LNFPHLIGS D+ +P RV P++
Sbjct  118  WLGTYETAEDAGLAYDRAAFKMRGSKAKLNFPHLIGSHDS-EPGRVAPKR  166



>dbj|BAN58166.1| ethylene response factor 179 [Nicotiana tabacum]
Length=236

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTY+  EDAA+AYD+AA+K+RGSRA LNFPHLIGS + P+P RV
Sbjct  118  WLGTYQTPEDAALAYDQAAFKIRGSRARLNFPHLIGSNNMPEPTRV  163



>gb|KHN40954.1| Ethylene-responsive transcription factor 13 [Glycine soja]
Length=223

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  E+A +AYD AA++MRGS+A LNFPHLIGS     P+RV  +  +Q   E   
Sbjct  112  WLGTYETEEEAGLAYDGAAFEMRGSKAKLNFPHLIGSHAPLKPIRVLTKTLKQNLLESDL  171

Query  341  sspsssvdgesPKRRKI-ELINAVAKT  264
            S  S+S   E  KR+ + +L+N +AK 
Sbjct  172  SYSSASETQELKKRKNLADLLNRLAKN  198



>ref|XP_010089319.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37644.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=195

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS    +  RV P++R 
Sbjct  95   WLGTYETQEDAALAYDRAAFKMRGSKAKLNFPHLIGSSHELELARVTPKRRS  146



>ref|XP_003633905.1| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
 emb|CBI16661.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AEDAA+AYDRAA+++RGSRA++NFP  IGS D P+PVR+ P++R 
Sbjct  109  WLGTYETAEDAALAYDRAAFRIRGSRALVNFPQRIGSGD-PEPVRITPKRRS  159



>gb|AGT21474.1| ethylene responsive element binding factor-like [Carica papaya]
Length=247

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA AYDRAAY+MRGS+A+LNFPH +GS + P+PVR+  ++R+
Sbjct  143  WLGTYETAEEAAFAYDRAAYRMRGSKALLNFPHRLGS-NEPEPVRITAKRRE  193



>gb|ABU40945.1| AP2-domain DNA-binding protein [Datura metel]
Length=203

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD AA+ MRG++A LNFPHLIGS +   PVRV PRKR
Sbjct  126  WLGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGS-NISGPVRVNPRKR  175



>gb|ABW77571.1| AP2-domain DNA-binding protein ORCA3 [Catharanthus roseus]
Length=200

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD AA+ MRG++A LNFPHLIGS +   PVRV PRKR
Sbjct  126  WLGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGS-NISGPVRVNPRKR  175



>emb|CEF82730.1| binding protein [Catharanthus roseus]
Length=200

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD AA+ MRG++A LNFPHLIGS +   PVRV PRKR
Sbjct  126  WLGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGS-NISGPVRVNPRKR  175



>emb|CAB96899.1| AP2-domain DNA-binding protein [Catharanthus roseus]
 emb|CAB96900.1| AP2-domain DNA-binding protein [Catharanthus roseus]
Length=203

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD AA+ MRG++A LNFPHLIGS +   PVRV PRKR
Sbjct  126  WLGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGS-NISGPVRVNPRKR  175



>ref|XP_007134477.1| hypothetical protein PHAVU_010G050500g [Phaseolus vulgaris]
 gb|ESW06471.1| hypothetical protein PHAVU_010G050500g [Phaseolus vulgaris]
Length=217

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AEDAA+AYDRAA+KM GS+A LNFPHLIGS DA + +RV  +KR
Sbjct  133  WLGTYESAEDAALAYDRAAFKMHGSKAKLNFPHLIGSDDA-ELIRVTSKKR  182



>ref|XP_011094406.1| PREDICTED: ethylene-responsive transcription factor 1-like [Sesamum 
indicum]
Length=211

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE  E+AAVAYDRAA+K+RGSRA +NFPHLIGS  AP+P RV  R+   
Sbjct  134  WLGTYETPEEAAVAYDRAAFKLRGSRARVNFPHLIGS-GAPEPTRVTKRRHHH  185



>ref|XP_009335577.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=237

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AEDA +AYDRAA+KMRGS+A LNFPHLIG+ D+ +P RV P++
Sbjct  121  WLGTYETAEDAGLAYDRAAFKMRGSKAKLNFPHLIGTHDS-EPGRVAPKR  169



>ref|XP_010508242.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X3 [Camelina sativa]
Length=236

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  145  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  194



>ref|XP_009335578.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009335605.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=263

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE AA+AYD+AA+KMRGS+A LNFPHLIGS +  +PVRV  ++R
Sbjct  156  WLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGS-EGCEPVRVTAKRR  205



>gb|KCW62795.1| hypothetical protein EUGRSUZ_G00386 [Eucalyptus grandis]
Length=181

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE   DAA+AYDRAA+KMRGS+A LNFPHLIG  +  DPVRV+ ++R 
Sbjct  95   WLGTYEMPGDAALAYDRAAFKMRGSKAKLNFPHLIGLAEY-DPVRVRHKRRS  145



>ref|XP_009341335.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009341336.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009348378.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=273

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE AA+AYD+AA+KMRGS+A LNFPHLIGS    +PVRV  ++R
Sbjct  156  WLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGS--GCEPVRVTAKRR  204



>ref|XP_010508240.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X1 [Camelina sativa]
Length=252

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  145  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  194



>gb|AID51422.1| ethylene response factor 17 [Diospyros kaki]
Length=242

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAAY+MRGSRA+LNFPH IG  D P+PVR+  ++R 
Sbjct  136  WLGTYETAEEAALAYDRAAYRMRGSRALLNFPHRIGL-DEPEPVRITAKRRS  186



>ref|XP_010508241.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X2 [Camelina sativa]
Length=237

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  145  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  194



>ref|XP_008376227.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=278

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE AA+AYD+AA+KMRGS+A LNFPHLIGS +  +PVRV  ++R
Sbjct  156  WLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGS-EGYEPVRVTXKRR  205



>ref|XP_010506419.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=250

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  146  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  195



>ref|XP_008370005.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=237

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AE+A +AYDRAA+KMRGS+A LNFPHLIG+ D+ +P RV P++
Sbjct  121  WLGTYETAEBAGLAYDRAAFKMRGSKAKLNFPHLIGTHDS-EPGRVAPKR  169



>ref|XP_010518091.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=252

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  148  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  197



>gb|KCW62512.1| hypothetical protein EUGRSUZ_G00002 [Eucalyptus grandis]
Length=212

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRG +A LNFP+LIGS D  +P+RV P++R 
Sbjct  116  WLGTYETPEDAALAYDRAAFKMRGCKAKLNFPNLIGSTDY-EPIRVSPKRRS  166



>gb|KDP28854.1| hypothetical protein JCGZ_14625 [Jatropha curcas]
Length=196

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS D  +P+RV
Sbjct  139  WLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGSDDY-EPIRV  183



>ref|XP_010067932.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=257

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRG +A LNFP+LIGS D  +P+RV P++R
Sbjct  161  WLGTYETPEDAALAYDRAAFKMRGCKAKLNFPNLIGSTDY-EPIRVSPKRR  210



>gb|AAM65925.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
Length=226

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R 
Sbjct  118  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRRS  168



>ref|NP_182011.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana]
 sp|Q8L9K1.2|ERF99_ARATH RecName: Full=Ethylene-responsive transcription factor 13; Short=AtERF13; 
AltName: Full=Ethylene-responsive element-binding 
factor 13; Short=EREBP-13 [Arabidopsis thaliana]
 gb|AAK17157.1|AF325089_1 putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AAK48967.1|AF370540_1 putative ethylene response element binding protein; EREBP [Arabidopsis 
thaliana]
 gb|AAC31840.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AAL66886.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AEC10473.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana]
Length=226

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  118  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  167



>ref|XP_006294915.1| hypothetical protein CARUB_v10023967mg [Capsella rubella]
 gb|EOA27813.1| hypothetical protein CARUB_v10023967mg [Capsella rubella]
Length=237

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R
Sbjct  133  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRR  182



>ref|XP_007203292.1| hypothetical protein PRUPE_ppa025748mg [Prunus persica]
 gb|EMJ04491.1| hypothetical protein PRUPE_ppa025748mg [Prunus persica]
Length=223

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDA +AYD+AA+K+RG +A LNFPHLIGS +  +PVRV P++R
Sbjct  134  WLGTYETPEDAGLAYDQAAFKIRGCKAKLNFPHLIGSSNM-EPVRVTPKRR  183



>ref|XP_008232505.1| PREDICTED: ethylene-responsive transcription factor 1-like [Prunus 
mume]
Length=217

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE  EDA +AYDRAA+K+RG +A LNFPHLIGS +  +PVRV P++R+ 
Sbjct  132  WLGTYETPEDAGLAYDRAAFKIRGCKAKLNFPHLIGSSNV-EPVRVTPKRRRS  183



>emb|CDY30489.1| BnaA04g25900D [Brassica napus]
Length=232

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA++++GS+A LNFPHLIGS +  +PVR++PR+R 
Sbjct  128  WLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGSCEY-EPVRIRPRRRS  178



>ref|XP_006397665.1| hypothetical protein EUTSA_v10001758mg [Eutrema salsugineum]
 gb|ESQ39118.1| hypothetical protein EUTSA_v10001758mg [Eutrema salsugineum]
Length=234

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R 
Sbjct  133  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRRS  183



>ref|XP_002880142.1| hypothetical protein ARALYDRAFT_903921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56401.1| hypothetical protein ARALYDRAFT_903921 [Arabidopsis lyrata subsp. 
lyrata]
Length=240

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA+++RGS+A LNFPHLIGS    +PVR++PR+R 
Sbjct  132  WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKY-EPVRIRPRRRS  182



>ref|XP_009759672.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
sylvestris]
Length=221

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYDR A+K+RGSRAVLNFPHLI S    +   +   + ++ S  P  
Sbjct  122  WLGTYETPEDAALAYDRTAFKLRGSRAVLNFPHLIES----NVTEINRVRPRRRSRSPDI  177

Query  341  sspsssvdgesPKRRKIELINAVAKTNLMNAI  246
               S   DG   KRR ++LIN++A  NL + I
Sbjct  178  ELSSDQNDGPISKRRNVDLINSLATANLDSQI  209



>ref|XP_010068077.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=303

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+KMRG +A LNFPHLIGS D  +P+RV  ++R
Sbjct  198  WLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDY-EPIRVSLKRR  247



>ref|XP_010426455.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=175

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 3/56 (5%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVK--PRKRQQT  360
            WLGTYE +E+AAVAYDRAA+KMRGS+A LNFPHLIG  D  +PVRV     KRQ++
Sbjct  83   WLGTYETSEEAAVAYDRAAFKMRGSKAKLNFPHLIG-IDQAEPVRVNHAGHKRQRS  137



>gb|KCW62799.1| hypothetical protein EUGRSUZ_G00391 [Eucalyptus grandis]
Length=208

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+KMRG +A LNFPHLIGS D  +P+RV  ++R
Sbjct  103  WLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDY-EPIRVSLKRR  152



>ref|XP_008344394.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=269

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE AA+AYD+AA+KMRGS+A LNFPHLIGS    +PVRV  ++R
Sbjct  153  WLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGS--GCEPVRVTGKRR  201



>emb|CAN82632.1| hypothetical protein VITISV_028134 [Vitis vinifera]
Length=202

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AEDAA+AYDRAA+++RGSRA+LNFP  +GS + P+PVR+ PR+R 
Sbjct  109  WLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSGE-PEPVRITPRRRS  159



>gb|KFK42581.1| hypothetical protein AALP_AA1G014000 [Arabis alpina]
Length=163

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE A +AAVAYDRAA+KMRG++A LNFPHLI S D+P+P RV  R+
Sbjct  67   WLGTYETAHEAAVAYDRAAFKMRGAKAKLNFPHLI-SIDSPEPARVTKRR  115



>ref|XP_010544359.1| PREDICTED: ethylene-responsive transcription factor 13-like [Tarenaya 
hassleriana]
Length=165

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AEDAA+AYDRAA++MRG++A LNFPHLIG+ D  +P RV  R+R+
Sbjct  83   WLGTYETAEDAAMAYDRAAFEMRGAKAKLNFPHLIGT-DGVEPARVSNRRRR  133



>emb|CAN81895.1| hypothetical protein VITISV_007029 [Vitis vinifera]
Length=202

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AEDAA+AYDRAA+++RGSRA+LNFP  +GS + P+PVR+ PR+R 
Sbjct  109  WLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSGE-PEPVRITPRRRS  159



>ref|XP_010068078.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=242

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+KMRG +A LNFPHLIGS D  +P+RV  ++R
Sbjct  137  WLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDY-EPIRVSLKRR  186



>ref|XP_002271521.1| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
 emb|CBI16659.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AEDAA+AYDRAA+++RGSRA+LNFP  +GS + P+PVR+ PR+R 
Sbjct  109  WLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSGE-PEPVRITPRRRS  159



>gb|KCW62798.1| hypothetical protein EUGRSUZ_G00390 [Eucalyptus grandis]
Length=237

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+KMRG +A LNFPHLIGS D  +P+RV  ++R
Sbjct  120  WLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDY-EPIRVSLKRR  169



>ref|XP_010089315.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37640.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=175

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 3/51 (6%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYEK EDAA+AYDRAA+KMRGS+A LNF HL+G   AP+PVRV  R R
Sbjct  77   WLGTYEKPEDAALAYDRAAFKMRGSKAKLNFAHLLG---APEPVRVLRRGR  124



>emb|CBJ55933.1| ethylene response factor 2.2 [Bupleurum kaoi]
Length=233

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYDRAAY+MRGS+A+LNFPH  GS + PDPVR+  +++
Sbjct  126  WLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRAGS-NEPDPVRITAKRK  175



>ref|XP_008232471.1| PREDICTED: ethylene-responsive transcription factor 13-like [Prunus 
mume]
Length=218

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSP-DAPDPVRVKPRKR  369
            WLGTYE AEDAA+AYDRAA+K+RGS+A+LNFPHLIGS  DA D  RV   +R
Sbjct  136  WLGTYETAEDAALAYDRAAFKIRGSKALLNFPHLIGSADDACDRARVTSTRR  187



>ref|XP_002271614.1| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis 
vinifera]
Length=214

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AEDAA+AYD+AAY+MRGSRA+LNFP  IGS + P+PVR+  ++R  
Sbjct  118  WLGTYETAEDAALAYDQAAYRMRGSRALLNFPLRIGSGE-PEPVRITAKRRSS  169



>ref|XP_010424028.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=175

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE +E+AAVAYDRAA+KMRGS+A LNFPHLIG  D  +PVRV
Sbjct  83   WLGTYETSEEAAVAYDRAAFKMRGSKAKLNFPHLIGI-DQAEPVRV  127



>ref|XP_010068079.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
 gb|KCW62800.1| hypothetical protein EUGRSUZ_G00392 [Eucalyptus grandis]
Length=276

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  +DAA+AYDRAA+KMRGS+A LNFPHLI S D  +P+RV  ++R 
Sbjct  180  WLGTYETPQDAALAYDRAAFKMRGSKAKLNFPHLISSSDY-EPIRVSTKRRS  230



>ref|XP_002872976.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49235.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE  E+AAVAYD+AA+KMRGS+A LNFPHLIG  D  +PVRV    ++Q
Sbjct  71   WLGTYETPEEAAVAYDQAAFKMRGSKAKLNFPHLIGI-DQAEPVRVTNGNKRQ  122



>ref|XP_010068075.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=208

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIG  +  DPVRV+ +++
Sbjct  116  WLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGLAEY-DPVRVRSKRQ  165



>ref|XP_006375128.1| ethylene-responsive element binding protein 1 [Populus trichocarpa]
 gb|ERP52925.1| ethylene-responsive element binding protein 1 [Populus trichocarpa]
Length=123

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  EDAA+AYD+AA+KMRG++A L+FPHLIGS  A  PVRV
Sbjct  68   WLGTYETPEDAALAYDQAAFKMRGAKAKLDFPHLIGSIIAHQPVRV  113



>gb|AEQ93554.1| AP2/ERF transcription factor [Artemisia annua]
Length=253

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA AYD AAY+MRGS+A+LNFPH IG  + P+PVRV  ++R
Sbjct  160  WLGTYETAEEAATAYDIAAYRMRGSKALLNFPHRIGL-NEPEPVRVTSKRR  209



>ref|XP_010065367.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=239

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV  ++R 
Sbjct  137  WLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEY-EPVRVSSKRRS  187



>ref|XP_002271494.1| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
 emb|CBI16660.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AEDAA+AYDRAA+++RGSRA+LNFP  IGS D P+PVR+  ++R 
Sbjct  109  WLGTYETAEDAALAYDRAAFRIRGSRAILNFPLRIGSGD-PEPVRITTKRRS  159



>gb|KCW62802.1| hypothetical protein EUGRSUZ_G00394 [Eucalyptus grandis]
Length=321

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV  ++R 
Sbjct  153  WLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEY-EPVRVSSKRRS  203



>gb|KCW62796.1| hypothetical protein EUGRSUZ_G00388 [Eucalyptus grandis]
Length=242

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIG  +  DPVRV+ +++
Sbjct  150  WLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGLAEY-DPVRVRSKRQ  199



>ref|XP_004308507.1| PREDICTED: ethylene-responsive transcription factor 13-like [Fragaria 
vesca subsp. vesca]
Length=213

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE  EDA +AYDRAA+K+RG +A LNFPHLIGS +  +PVRV P++R+ 
Sbjct  139  WLGTYETPEDAGLAYDRAAFKLRGRKAKLNFPHLIGSNNV-EPVRVTPKRRRS  190



>ref|XP_009142287.1| PREDICTED: ethylene-responsive transcription factor 13-like [Brassica 
rapa]
Length=235

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA++++GS+A LNFPHLIG+ +  +PVR++PR+R 
Sbjct  131  WLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGTCEY-EPVRIRPRRRS  181



>sp|Q40476.1|ERF1_TOBAC RecName: Full=Ethylene-responsive transcription factor 1; Short=NtERF1; 
AltName: Full=Ethylene-responsive element-binding 
factor 1; Short=EREBP-1 [Nicotiana tabacum]
 dbj|BAA07321.1| ERF1 [Nicotiana tabacum]
Length=236

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  E+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R    P    
Sbjct  131  WLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRRASPEPASSS  189

Query  341  sspsssvdgesPKRRKIELINAVAKTNLMNAISGIQF  231
             + S     ++    K E +   +K+N++     ++ 
Sbjct  190  ENSSPKRRRKAVATEKSEAVEVESKSNVLQTGCQVEL  226



>ref|XP_007204029.1| hypothetical protein PRUPE_ppa020417mg [Prunus persica]
 gb|EMJ05228.1| hypothetical protein PRUPE_ppa020417mg [Prunus persica]
Length=206

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGS-PDAPDPVRVKPRKR  369
            WLGTYE AEDAA+AYDRAA+K+RGS+A+LNFPHLIGS  DA D  RV   +R
Sbjct  136  WLGTYETAEDAALAYDRAAFKIRGSKALLNFPHLIGSDDDACDRARVTSTRR  187



>ref|XP_010109127.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
 gb|EXC21056.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
Length=275

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAA+ MRGS+A+LNFPH IGS + P PVR+  ++R+
Sbjct  174  WLGTYETAEEAALAYDRAAFGMRGSKALLNFPHRIGSGEPP-PVRITAKRRE  224



>ref|XP_009771895.1| PREDICTED: ethylene-responsive transcription factor 1 [Nicotiana 
sylvestris]
Length=236

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  E+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R    P    
Sbjct  131  WLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRRASPEPASSS  189

Query  341  sspsssvdgesPKRRKIELINAVAKTNLMNAISGIQF  231
             + S     ++    K E +   +K+N++     ++ 
Sbjct  190  ENSSPKRRRKAVAAEKSEAVEVESKSNVLQTGCQVEL  226



>ref|XP_007052302.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96459.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=270

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAA+AYDRAA+KMRG++A LNFPHLIGS +  +P+RV  R+R 
Sbjct  160  WLGTYETPEDAALAYDRAAFKMRGAKAKLNFPHLIGS-NTWEPIRVGGRRRS  210



>emb|CDY23459.1| BnaC04g49870D [Brassica napus]
Length=237

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA++++GS+A LNFPHLIG+ +  +PVR++PR+R 
Sbjct  133  WLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGTCEY-EPVRIRPRRRS  183



>gb|EYU20174.1| hypothetical protein MIMGU_mgv1a018364mg [Erythranthe guttata]
Length=243

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAA++MRGS+A+LNFPH IG  + P+PVR+  ++R 
Sbjct  130  WLGTYETAEEAALAYDRAAFRMRGSKALLNFPHKIGL-NEPEPVRITAKRRS  180



>ref|XP_003521070.1| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=195

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVK  381
            WLGTYE AEDAA+AYDRAA+KMRGS+A LNFPHLIGS   P  V +K
Sbjct  147  WLGTYETAEDAALAYDRAAFKMRGSKAKLNFPHLIGSDHEPIKVTLK  193



>ref|XP_011076437.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 2-like [Sesamum indicum]
Length=240

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAAYKMRGS+A+LNFPH IG  + P+PVRV  +++ 
Sbjct  135  WLGTYETAEEAALAYDRAAYKMRGSKALLNFPHKIGL-NEPEPVRVTAKRKS  185



>ref|XP_006421523.1| hypothetical protein CICLE_v10005891mg [Citrus clementina]
 gb|ADI34108.1| putative ethylene-responsive element binding protein [Citrus 
unshiu]
 gb|ESR34763.1| hypothetical protein CICLE_v10005891mg [Citrus clementina]
Length=207

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AE+AA+AYDRAA+ +RGS+A+LNFPH IGS D P PVRV  ++   
Sbjct  123  WLGTYETAEEAALAYDRAAFDIRGSKALLNFPHRIGS-DEPPPVRVTAKRSHS  174



>emb|CDP09437.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA++MRG++A LNFP+L GS +   PVRV PRKR
Sbjct  130  WLGTYETPEDAALAYDQAAFEMRGAKARLNFPNLFGS-NTLQPVRVNPRKR  179



>gb|KDO39173.1| hypothetical protein CISIN_1g028566mg [Citrus sinensis]
Length=207

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AE+AA+AYDRAA+ +RGS+A+LNFPH IGS D P PVRV  ++   
Sbjct  123  WLGTYETAEEAALAYDRAAFDIRGSKALLNFPHRIGS-DEPPPVRVTAKRSHS  174



>ref|XP_003521071.1| PREDICTED: ethylene-responsive transcription factor 2-like [Glycine 
max]
Length=197

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  E+A +AYDRAA+KMRGS+A LNFPHL+G     +P R++   +Q +S     
Sbjct  98   WLGTYETEEEAGLAYDRAAFKMRGSKAKLNFPHLVGEHVFLEPKRIRKASKQNSSKPDQS  157

Query  341  sspsssvdgesPKRRKIELINAVAKT  264
             SP+    G   +++  +L+N +AK+
Sbjct  158  FSPTPETQGSKKRKKLGDLLNRLAKS  183



>ref|XP_011094418.1| PREDICTED: ethylene-responsive transcription factor 13-like [Sesamum 
indicum]
Length=187

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  E+AA+AYDRAA+K+RG+RA +NFP+LIGS  AP+P+RV  R R 
Sbjct  110  WLGTYETPEEAALAYDRAAFKLRGARARVNFPNLIGS-GAPEPIRVTKRCRS  160



>ref|XP_010068071.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYDRAA+KMRGS+A LNFPHLIGS +  +PVRV  RKR
Sbjct  145  WLGTYEAPEDAALAYDRAAFKMRGSKAKLNFPHLIGSAEY-EPVRVG-RKR  193



>gb|ADE41124.1| AP2 domain class transcription factor [Malus domestica]
Length=278

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE AA+AYD+AA+K+RGS+A LNFPHLIGS +  +PVRV  ++R
Sbjct  156  WLGTYETAEGAALAYDQAAFKIRGSKAKLNFPHLIGS-EGYEPVRVTVKRR  205



>ref|XP_009598140.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=213

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYDR A+K+RGSRAVLNFPHLI S    +   +   + ++ S E   
Sbjct  113  WLGTYETPEDAALAYDRTAFKLRGSRAVLNFPHLIES----NVTEINRVRPRRRSRELDI  168

Query  341  sspsssvdge-sPKRRKIELINAVAKTNL  258
               SSS+    S KRR +ELIN++A  NL
Sbjct  169  ELSSSSLGDAPSSKRRNVELINSLATANL  197



>ref|XP_006375130.1| hypothetical protein POPTR_0014s04640g [Populus trichocarpa]
 gb|ERP52927.1| hypothetical protein POPTR_0014s04640g [Populus trichocarpa]
Length=193

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+K+RGS+A LNFPHLIGS +  +PVR+  ++R
Sbjct  126  WLGTYETPEDAALAYDQAAFKIRGSKAKLNFPHLIGSEEY-EPVRLSSKRR  175



>ref|XP_007203094.1| hypothetical protein PRUPE_ppa023698mg [Prunus persica]
 gb|EMJ04293.1| hypothetical protein PRUPE_ppa023698mg [Prunus persica]
Length=216

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPR  375
            WLGTYE  EDA +AYDRAA+K+RG +A LNFPHLIGS +  +PVRV P+
Sbjct  134  WLGTYETPEDAGLAYDRAAFKLRGCKAKLNFPHLIGSSNV-EPVRVNPK  181



>ref|XP_009606945.1| PREDICTED: ethylene-responsive transcription factor 2 [Nicotiana 
tomentosiformis]
 sp|Q40479.1|ERF2_TOBAC RecName: Full=Ethylene-responsive transcription factor 2; Short=NtERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Nicotiana tabacum]
 dbj|BAA07324.1| ethylene-responsive element binding protein [Nicotiana tabacum]
 dbj|BAN58170.1| ethylene response factor 32 [Nicotiana tabacum]
Length=233

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AAY+MRGS+A+LNFPH IG  + P+PVR+  ++R
Sbjct  125  WLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIGL-NEPEPVRLTAKRR  174



>gb|AHB33881.1| ERF transcription factor 10 [Coffea arabica]
Length=264

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAAY+MRGS+A+LNFPH +G  + P+PVRV  ++R 
Sbjct  146  WLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRVGL-NEPEPVRVTAKRRS  196



>ref|XP_009335608.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=229

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AEDA +AYDRAA+KMRGS+A LNFPHLIG+ D+ +P RV  ++
Sbjct  121  WLGTYETAEDAGLAYDRAAFKMRGSKAKLNFPHLIGTHDS-EPGRVASKR  169



>emb|CDP05380.1| unnamed protein product [Coffea canephora]
Length=264

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAAY+MRGS+A+LNFPH +G  + P+PVRV  ++R 
Sbjct  146  WLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRVGL-NEPEPVRVTAKRRS  196



>gb|AHA93900.1| ethylene response factor 10 [Coffea arabica]
 gb|AHB33880.1| ERF transcription factor 09 [Coffea arabica]
Length=264

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE AE+AA+AYDRAAY+MRGS+A+LNFPH +G  + P+PVRV  ++R 
Sbjct  146  WLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRVGL-NEPEPVRVTAKRRS  196



>emb|CDY56473.1| BnaC04g53270D [Brassica napus]
Length=231

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA++++GS+A LNFPHLIG+    +PVR++PR+R 
Sbjct  138  WLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGTCKY-EPVRIRPRRRS  188



>ref|XP_008232472.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Prunus 
mume]
Length=215

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPR  375
            WLGTYE  EDA +AYDRAA+K+RG +A LNFPHLIGS +  +PVRV P+
Sbjct  134  WLGTYETPEDAGLAYDRAAFKLRGCKARLNFPHLIGSSNV-EPVRVSPK  181



>ref|XP_006490017.1| PREDICTED: ethylene-responsive transcription factor 2-like [Citrus 
sinensis]
Length=207

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AE+AA+AYDRAA+ +RGS+A+LNFPH IGS D P PVRV  ++
Sbjct  123  WLGTYETAEEAALAYDRAAFDIRGSKALLNFPHRIGS-DEPPPVRVTAKR  171



>emb|CDX74692.1| BnaA05g04380D [Brassica napus]
Length=232

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA++++GS+A LNFPHLIG+    +PVR++PR+R 
Sbjct  135  WLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGTCKY-EPVRIRPRRRS  185



>ref|XP_009144089.1| PREDICTED: ethylene-responsive transcription factor 13-like [Brassica 
rapa]
Length=232

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQ  366
            WLGTYE  EDAAVAYDRAA++++GS+A LNFPHLIG+    +PVR++PR+R 
Sbjct  135  WLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGTCKY-EPVRIRPRRRS  185



>ref|XP_008363915.1| PREDICTED: ethylene-responsive transcription factor 1-like [Malus 
domestica]
Length=198

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE  EDA +AYDRAA+K+RG +A LNFPHLIGS  + +PVRV P++
Sbjct  116  WLGTYETPEDAGLAYDRAAFKLRGCKAKLNFPHLIGS-SSIEPVRVTPKR  164



>ref|XP_010025350.1| PREDICTED: ethylene-responsive transcription factor 2-like [Eucalyptus 
grandis]
 gb|KCW90884.1| hypothetical protein EUGRSUZ_A02924 [Eucalyptus grandis]
Length=281

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AE+AA+AYDRAAY+MRG++A+LNFPH IGS + P PVRV  +++  
Sbjct  176  WLGTYETAEEAALAYDRAAYRMRGAKALLNFPHRIGSGE-PAPVRVTAKRKDS  227



>gb|EYU28602.1| hypothetical protein MIMGU_mgv1a022521mg [Erythranthe guttata]
Length=247

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLGTYE AE+AA+AYDRAAY++RGS+A+LNFPH  GS + P+PVRV  ++R  
Sbjct  138  WLGTYETAEEAALAYDRAAYRIRGSKALLNFPHRAGS-NEPEPVRVAGKRRSS  189



>ref|XP_009335609.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
 ref|XP_009335623.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
Length=198

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQ  363
            WLG YE   DA +AYDRAA+K+RG +A LNFPHLIGS  + +PVRV P++R+ 
Sbjct  116  WLGIYETPVDAGLAYDRAAFKLRGCKAKLNFPHLIGS-SSIEPVRVTPKRRRS  167



>ref|XP_008345528.1| PREDICTED: ethylene-responsive transcription factor 1-like [Malus 
domestica]
Length=198

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE  EDA +AYDRAA+K+RG +A LNFPHLIGS  + +PVRV P++
Sbjct  116  WLGTYETPEDAGLAYDRAAFKLRGCKAKLNFPHLIGS-SSIEPVRVTPKR  164



>dbj|BAN45683.1| ethylene response factor, partial [Nicotiana umbratica]
Length=233

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  E+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R
Sbjct  131  WLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRR  180



>ref|XP_006365341.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum 
tuberosum]
Length=270

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R
Sbjct  168  WLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRR  217



>ref|XP_009765938.1| PREDICTED: ethylene-responsive transcription factor 2 [Nicotiana 
sylvestris]
 sp|Q9LW50.1|ERF2_NICSY RecName: Full=Ethylene-responsive transcription factor 2; Short=NsERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Nicotiana sylvestris]
 dbj|BAA97122.1| ethylene-responsive element binding factor [Nicotiana sylvestris]
Length=237

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AAY+MRGS+A+LNFPH IG  + P+PVR+  ++R
Sbjct  129  WLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIGL-NEPEPVRLTVKRR  178



>gb|KDP28852.1| hypothetical protein JCGZ_14623 [Jatropha curcas]
Length=229

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAAVAYDRAA++MRGS+A LNFPHLIGS D  +P R+  ++R
Sbjct  119  WLGTYETPEDAAVAYDRAAFEMRGSKAKLNFPHLIGS-DNVEPARLSHKRR  168



>ref|XP_004239983.1| PREDICTED: ethylene-responsive transcription factor 1 [Solanum 
lycopersicum]
Length=234

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R
Sbjct  132  WLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRR  181



>ref|NP_001236246.1| uncharacterized protein LOC100527194 [Glycine max]
 gb|ACU16246.1| unknown [Glycine max]
Length=223

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGT E  E+A +AYDRAA+KMRGS+A LNFPHLIGS     P+RV  +  +Q   E   
Sbjct  112  WLGTCETEEEAGLAYDRAAFKMRGSKAKLNFPHLIGSHAPLKPIRVLTKTLKQNLLESDL  171

Query  341  sspsssvdgesPKRRKI-ELINAVAKT  264
            S  S+    ES +R+ + +L+N +AK 
Sbjct  172  SYSSAPQTQESKRRKNLTDLLNRLAKN  198



>ref|XP_011031988.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=191

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AA+K+RGS+A LNFPHLIGS +  +PVR+  ++R
Sbjct  126  WLGTYETPEDAALAYDQAAFKIRGSKAKLNFPHLIGSKEY-EPVRLSSKRR  175



>ref|XP_009625877.1| PREDICTED: ethylene-responsive transcription factor 13-like [Nicotiana 
tomentosiformis]
Length=206

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 6/89 (7%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTYE  EDAA+AYD+AA+++RGS+A LNFPHLIGS     P RV  R R ++     P
Sbjct  113  WLGTYESPEDAALAYDQAAFEIRGSKARLNFPHLIGST-ITKPARVTTRCRMRS-----P  166

Query  341  sspsssvdgesPKRRKIELINAVAKTNLM  255
               SS+      ++ KI++IN++AK   +
Sbjct  167  EPSSSASSENRTRKSKIDVINSIAKAKFI  195



>ref|XP_004235186.2| PREDICTED: ethylene-responsive transcription factor 1 [Solanum 
lycopersicum]
Length=277

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AA++MRG++A+LNFPH IG  + P+PVRV  ++R
Sbjct  168  WLGTYESAEEAALAYDKAAFRMRGTKALLNFPHRIGL-NEPEPVRVTVKRR  217



>sp|Q84XB3.1|ERF1_SOLLC RecName: Full=Ethylene-responsive transcription factor 1; Short=LeERF1; 
AltName: Full=ERF1-like protein; AltName: Full=Ethylene-responsive 
element-binding factor 1; Short=EREBP-1 [Solanum 
lycopersicum]
 gb|AAO34703.1| ethylene response factor 1 [Solanum lycopersicum]
Length=244

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AY +AA++MRG++A+LNFPH IG  + P+PVRV  ++R
Sbjct  133  WLGTYESAEEAALAYGKAAFRMRGTKALLNFPHRIGL-NEPEPVRVTVKRR  182



>ref|XP_008370115.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=220

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE A DA +AYDRAA+KMRGS+A LNFPHLIG+ D+ +P RV
Sbjct  121  WLGTYETAVDAGLAYDRAAFKMRGSKAKLNFPHLIGTHDS-EPGRV  165



>gb|AAC50047.1| Pti4 [Solanum lycopersicum]
Length=234

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R
Sbjct  132  WLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRR  181



>ref|XP_003520428.1| PREDICTED: ethylene-responsive transcription factor 2-like [Glycine 
max]
Length=197

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  E+A +AYDRA +KMRGS+A LNFPHLIGS   P+ V V
Sbjct  93   WLGTYETEEEAGLAYDRACFKMRGSKAKLNFPHLIGSHAPPERVSV  138



>ref|XP_009608915.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Nicotiana 
tomentosiformis]
Length=242

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRK  372
            WLGTYE AEDAA AYD+AA++MRGSRA+LNFP  I S D PDP+RV  ++
Sbjct  163  WLGTYETAEDAAFAYDKAAFRMRGSRALLNFPLRINS-DEPDPIRVGSKR  211



>ref|NP_001275437.1| Pti4 [Solanum tuberosum]
 gb|ACF57857.1| Pti4 [Solanum tuberosum]
Length=234

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R
Sbjct  132  WLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRR  181



>gb|EPS62607.1| hypothetical protein M569_12181, partial [Genlisea aurea]
Length=175

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQT  360
            WLGTYE AE+AA+AYDRAAYK+RG++A+LNFPH IG  + P+PVR+  ++R   
Sbjct  117  WLGTYETAEEAALAYDRAAYKIRGTKALLNFPHKIGL-NEPEPVRITAKRRSHA  169



>ref|NP_001275603.1| ethylene-responsive transcription factor 1-like [Solanum tuberosum]
 gb|ABP35567.1| ERF transcription factor [Solanum tuberosum]
Length=247

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE AE+AA+AYD+AA++MRG++A+LNFPH IG  + P+PVRV  ++R
Sbjct  138  WLGTYESAEEAALAYDKAAFRMRGTKALLNFPHRIGL-NEPEPVRVTVKRR  187



>ref|XP_011016089.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=227

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  EDAA+AYDRAA+KMRG++A LNFPHLIGS +  +PVRV
Sbjct  145  WLGTYETPEDAAMAYDRAAFKMRGAKAKLNFPHLIGSSNY-EPVRV  189



>ref|XP_006375127.1| hypothetical protein POPTR_0014s04610g [Populus trichocarpa]
 gb|ERP52924.1| hypothetical protein POPTR_0014s04610g [Populus trichocarpa]
Length=227

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  EDAA+AYDRAA+KMRG++A LNFPHLIGS +  +PVRV
Sbjct  145  WLGTYETPEDAAMAYDRAAFKMRGAKAKLNFPHLIGSSNY-EPVRV  189



>gb|KHN26289.1| Ethylene-responsive transcription factor 13 [Glycine soja]
Length=188

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  E+A +AYDRA +KMRGS+A LNFPHLIGS   P+ V V
Sbjct  93   WLGTYETEEEAGLAYDRACFKMRGSKAKLNFPHLIGSHAPPERVSV  138



>ref|XP_009611801.1| PREDICTED: ethylene-responsive transcription factor 1 [Nicotiana 
tomentosiformis]
Length=236

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  EDAA+AYD+AAY+MRGS+A LNFPH IG  + P+PVRV  ++R
Sbjct  131  WLGTYETDEDAAIAYDKAAYRMRGSKAHLNFPHRIGL-NEPEPVRVTAKRR  180



>gb|ADP37426.1| ethylene-responsive-element-binding factor 11 [Petunia x hybrida]
Length=207

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE +EDAA+AYDRAAYK+RG+RA LNFPHLI S +  +  RVKP++R
Sbjct  133  WLGTYETSEDAALAYDRAAYKLRGARASLNFPHLISS-NVSEINRVKPKRR  182



>ref|XP_011031966.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=227

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRV  384
            WLGTYE  EDAA+AYDRAA+KMRG++A LNFPHLIGS +  +PVRV
Sbjct  145  WLGTYETPEDAAMAYDRAAFKMRGAKAKLNFPHLIGSSNY-EPVRV  189



>dbj|BAN45684.1| ethylene response factor [Nicotiana umbratica]
Length=216

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKR  369
            WLGTYE  E+AA+AYD+AAY+MRGS+A+LNFPH IG  + P+PVR+  ++R
Sbjct  108  WLGTYETGEEAALAYDKAAYRMRGSKALLNFPHRIGL-NEPEPVRLTIKRR  157



>ref|XP_010321615.1| PREDICTED: ethylene-responsive transcription factor 13-like [Solanum 
lycopersicum]
Length=189

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 10/102 (10%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAPDPVRVKPRKRQQTspeplp  342
            WLGTY   EDAA+AYDR A+K++G+RA+LNFPHLI + +  +  RV+P++R +       
Sbjct  90   WLGTYVTPEDAALAYDRTAFKLKGTRALLNFPHLIDT-NVAELNRVRPKQRSRL------  142

Query  341  sspsssvdgesPKRRKIELINAVAKTN---LMNAISGIQFRP  225
            S      +  SPKRR  +LIN +AK N    M  I+ + F P
Sbjct  143  SEIIKGEEIPSPKRRNPQLINNIAKVNSIIHMFEITSLAFHP  184



>gb|EYU31898.1| hypothetical protein MIMGU_mgv1a020883mg [Erythranthe guttata]
Length=172

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -2

Query  521  WLGTYEKaedaavaydraaYKMRGSRAVLNFPHLIGSPDAP-DPVRVKPRKR  369
            WLGTYE  EDAA+AYD AAY++RGSRA LNFPHLIGS  A   P RV  R++
Sbjct  101  WLGTYETPEDAALAYDEAAYELRGSRARLNFPHLIGSSGAARKPARVGKRRQ  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519518671360