BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30195_g1_i1 len=1006 path=[1:0-1005]

Length=1006
                                                                      Score     E

emb|CBA10126.1|  PME inhibitor                                          260   2e-82   Nicotiana benthamiana
ref|XP_009779202.1|  PREDICTED: 21 kDa protein-like                     259   4e-82   
gb|ABG47806.1|  pectin methlyesterase inhibitor protein 1               256   1e-80   Capsicum annuum
ref|XP_009594970.1|  PREDICTED: 21 kDa protein-like                     255   3e-80   
gb|AAX20046.1|  DC1.2-like                                              253   1e-79   Capsicum annuum
ref|XP_006362111.1|  PREDICTED: 21 kDa protein-like isoform X2          252   2e-79   
ref|XP_009779211.1|  PREDICTED: 21 kDa protein-like                     251   5e-79   
ref|XP_006367638.1|  PREDICTED: 21 kDa protein-like                     250   2e-78   
gb|ABY81888.1|  pectin methylesterase inhibitor-like protein            249   4e-78   Capsicum annuum
ref|XP_009597893.1|  PREDICTED: 21 kDa protein-like                     248   9e-78   
ref|XP_006362110.1|  PREDICTED: 21 kDa protein-like isoform X1          248   1e-77   
ref|XP_011076332.1|  PREDICTED: 21 kDa protein                          245   2e-76   
emb|CDP05319.1|  unnamed protein product                                242   3e-75   
ref|XP_004234934.1|  PREDICTED: 21 kDa protein-like                     241   9e-75   
ref|XP_004234935.1|  PREDICTED: 21 kDa protein-like                     240   1e-74   
emb|CDP05320.1|  unnamed protein product                                239   3e-74   
ref|XP_006367807.1|  PREDICTED: 21 kDa protein-like                     236   3e-73   
gb|ABG49144.1|  pectin methylesterase inhibitor isoform                 236   6e-73   Solanum phureja [chaucha]
ref|XP_006362121.1|  PREDICTED: 21 kDa protein-like                     235   9e-73   
ref|XP_010550579.1|  PREDICTED: 21 kDa protein                          228   4e-70   
emb|CAN70288.1|  hypothetical protein VITISV_015784                     228   5e-70   Vitis vinifera
ref|XP_002264028.1|  PREDICTED: 21 kDa protein                          227   2e-69   Vitis vinifera
ref|XP_007038418.1|  DC1.2-like, putative                               227   2e-69   
ref|XP_002263991.1|  PREDICTED: 21 kDa protein                          226   4e-69   Vitis vinifera
ref|XP_010091300.1|  21 kDa protein                                     225   1e-68   
ref|XP_002264101.1|  PREDICTED: 21 kDa protein-like                     224   3e-68   Vitis vinifera
ref|XP_010035021.1|  PREDICTED: 21 kDa protein-like                     223   5e-68   
gb|KDP22409.1|  hypothetical protein JCGZ_26240                         222   2e-67   
ref|XP_009374503.1|  PREDICTED: 21 kDa protein-like                     218   4e-66   
ref|XP_002264167.1|  PREDICTED: 21 kDa protein                          216   3e-65   Vitis vinifera
emb|CDX87244.1|  BnaC09g05590D                                          216   3e-65   
ref|XP_007218426.1|  hypothetical protein PRUPE_ppa011607mg             215   7e-65   
ref|XP_009112019.1|  PREDICTED: 21 kDa protein-like                     213   3e-64   
ref|XP_008234384.1|  PREDICTED: 21 kDa protein                          213   8e-64   
ref|XP_009372896.1|  PREDICTED: 21 kDa protein-like                     211   3e-63   
ref|XP_009370483.1|  PREDICTED: 21 kDa protein-like                     211   4e-63   
ref|XP_002322404.2|  ripening-related family protein                    210   6e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004307823.1|  PREDICTED: 21 kDa protein-like                     209   1e-62   
gb|EYU24972.1|  hypothetical protein MIMGU_mgv1a023170mg                208   2e-62   
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg             208   3e-62   
ref|XP_009370516.1|  PREDICTED: 21 kDa protein-like                     208   3e-62   
ref|XP_010062118.1|  PREDICTED: 21 kDa protein-like                     208   3e-62   
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                   208   4e-62   
ref|XP_002510935.1|  21 kDa protein precursor, putative                 207   6e-62   Ricinus communis
ref|XP_004307822.1|  PREDICTED: 21 kDa protein-like                     207   1e-61   
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                     205   4e-61   
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...    205   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...    205   5e-61   
gb|AAN60276.1|  unknown                                                 205   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                    204   8e-61   
ref|XP_008376226.1|  PREDICTED: 21 kDa protein-like                     204   9e-61   
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg             205   1e-60   
gb|ABK96280.1|  unknown                                                 204   1e-60   Populus trichocarpa x Populus deltoides
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                     202   4e-60   
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1          202   5e-60   
ref|XP_011041731.1|  PREDICTED: 21 kDa protein-like                     202   6e-60   
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                     202   7e-60   
ref|XP_002322405.2|  ripening-related family protein                    201   1e-59   Populus trichocarpa [western balsam poplar]
gb|KEH29361.1|  plant invertase/pectin methylesterase inhibitor         200   4e-59   
ref|XP_008376217.1|  PREDICTED: 21 kDa protein-like                     200   4e-59   
ref|XP_009370481.1|  PREDICTED: 21 kDa protein-like                     199   1e-58   
gb|AFK35257.1|  unknown                                                 199   1e-58   
ref|XP_008357027.1|  PREDICTED: 21 kDa protein-like                     199   1e-58   
gb|AFK49039.1|  unknown                                                 199   2e-58   
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1          198   2e-58   
ref|XP_009372895.1|  PREDICTED: 21 kDa protein-like                     198   2e-58   
emb|CDX86901.1|  BnaC03g51710D                                          198   2e-58   
ref|XP_007039951.1|  Plant invertase/pectin methylesterase inhibi...    198   4e-58   
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                          197   5e-58   
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg             197   6e-58   
ref|XP_006421706.1|  hypothetical protein CICLE_v10005926mg             197   7e-58   
ref|XP_010919458.1|  PREDICTED: 21 kDa protein                          197   7e-58   
ref|XP_002322403.1|  ripening-related family protein                    197   8e-58   Populus trichocarpa [western balsam poplar]
ref|NP_001236761.1|  uncharacterized protein LOC100305537 precursor     197   9e-58   
emb|CDY00279.1|  BnaA06g21800D                                          196   1e-57   
ref|XP_006490094.1|  PREDICTED: 21 kDa protein-like                     196   2e-57   
emb|CBI24572.3|  unnamed protein product                                194   6e-57   
ref|XP_011010937.1|  PREDICTED: 21 kDa protein-like isoform X2          193   2e-56   
gb|KGN57276.1|  hypothetical protein Csa_3G176245                       192   3e-56   
ref|XP_004148163.1|  PREDICTED: 21 kDa protein-like                     191   4e-56   
gb|KDP25617.1|  hypothetical protein JCGZ_20773                         192   4e-56   
ref|XP_007039937.1|  Plant invertase/pectin methylesterase inhibi...    192   4e-56   
ref|XP_004148138.1|  PREDICTED: 21 kDa protein-like                     192   4e-56   
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                     192   7e-56   
ref|XP_009370482.1|  PREDICTED: 21 kDa protein-like                     191   1e-55   
ref|XP_007131336.1|  hypothetical protein PHAVU_011G005300g             191   1e-55   
ref|XP_003635233.1|  PREDICTED: 21 kDa protein-like                     191   1e-55   
ref|XP_002264799.1|  PREDICTED: 21 kDa protein-like                     191   2e-55   Vitis vinifera
ref|XP_004506603.1|  PREDICTED: 21 kDa protein-like                     191   2e-55   
ref|XP_004160872.1|  PREDICTED: 21 kDa protein-like                     190   2e-55   
ref|XP_008791710.1|  PREDICTED: 21 kDa protein                          190   6e-55   
gb|KGN57274.1|  hypothetical protein Csa_3G175740                       190   1e-54   
ref|XP_007039938.1|  Plant invertase/pectin methylesterase inhibi...    188   1e-54   
gb|KHN32444.1|  21 kDa protein                                          187   3e-54   
gb|ACU13418.1|  unknown                                                 187   7e-54   Glycine max [soybeans]
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                     188   1e-53   
ref|XP_002510934.1|  21 kDa protein precursor, putative                 184   3e-53   Ricinus communis
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                     185   4e-53   
gb|AFK37116.1|  unknown                                                 183   2e-52   
ref|XP_004298672.1|  PREDICTED: 21 kDa protein-like                     182   2e-52   
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                          182   3e-52   
ref|XP_011010938.1|  PREDICTED: 21 kDa protein-like                     182   4e-52   
ref|XP_006440385.1|  hypothetical protein CICLE_v10023344mg             182   5e-52   
ref|XP_002263715.1|  PREDICTED: 21 kDa protein                          182   5e-52   Vitis vinifera
ref|XP_011041732.1|  PREDICTED: 21 kDa protein-like                     182   6e-52   
ref|XP_006421708.1|  hypothetical protein CICLE_v10007178mg             182   8e-52   
gb|AFK47771.1|  unknown                                                 181   9e-52   
ref|XP_007131335.1|  hypothetical protein PHAVU_011G005200g             180   2e-51   
gb|KDO65436.1|  hypothetical protein CISIN_1g028434mg                   180   2e-51   
ref|XP_006490092.1|  PREDICTED: 21 kDa protein-like                     180   4e-51   
ref|XP_002264891.1|  PREDICTED: 21 kDa protein                          179   1e-50   Vitis vinifera
ref|XP_008387667.1|  PREDICTED: 21 kDa protein-like                     177   4e-50   
ref|XP_007209621.1|  hypothetical protein PRUPE_ppa011699mg             177   5e-50   
ref|XP_010093663.1|  21 kDa protein                                     176   1e-49   
ref|XP_006421710.1|  hypothetical protein CICLE_v10005968mg             175   2e-49   
ref|XP_002510932.1|  21 kDa protein precursor, putative                 174   4e-49   Ricinus communis
ref|XP_006490090.1|  PREDICTED: 21 kDa protein-like                     174   6e-49   
gb|EYU24974.1|  hypothetical protein MIMGU_mgv1a014119mg                174   6e-49   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   184   7e-49   
ref|XP_008796852.1|  PREDICTED: 21 kDa protein-like                     173   1e-48   
ref|XP_006385730.1|  hypothetical protein POPTR_0003s11310g             173   1e-48   
ref|XP_010933727.1|  PREDICTED: 21 kDa protein                          173   1e-48   
ref|XP_009603391.1|  PREDICTED: 21 kDa protein-like                     172   2e-48   
ref|XP_006357906.1|  PREDICTED: 21 kDa protein-like                     172   2e-48   
ref|XP_008234382.1|  PREDICTED: 21 kDa protein                          172   2e-48   
ref|XP_006838616.1|  hypothetical protein AMTR_s00002p00229990          172   2e-48   
ref|XP_008364822.1|  PREDICTED: 21 kDa protein-like                     173   2e-48   
ref|XP_009151354.1|  PREDICTED: 21 kDa protein                          172   3e-48   
ref|XP_009362111.1|  PREDICTED: 21 kDa protein-like                     172   3e-48   
ref|XP_007220475.1|  hypothetical protein PRUPE_ppa011831mg             172   3e-48   
ref|XP_009370484.1|  PREDICTED: 21 kDa protein-like                     171   4e-48   
ref|XP_009372897.1|  PREDICTED: 21 kDa protein-like                     171   5e-48   
ref|XP_008376261.1|  PREDICTED: 21 kDa protein                          171   6e-48   
emb|CDX86904.1|  BnaC03g51740D                                          171   1e-47   
gb|KFK27962.1|  hypothetical protein AALP_AA8G453900                    170   1e-47   
ref|XP_007039940.1|  Plant invertase/pectin methylesterase inhibi...    170   2e-47   
ref|XP_009374505.1|  PREDICTED: 21 kDa protein                          169   2e-47   
ref|XP_006440386.1|  hypothetical protein CICLE_v10022313mg             170   2e-47   
gb|KDP22408.1|  hypothetical protein JCGZ_26239                         169   2e-47   
ref|XP_010426179.1|  PREDICTED: 21 kDa protein-like                     169   3e-47   
ref|XP_002304431.2|  hypothetical protein POPTR_0003s20640g             169   3e-47   Populus trichocarpa [western balsam poplar]
ref|NP_001268141.1|  ripening-related protein-like precursor            169   4e-47   
ref|XP_004307821.1|  PREDICTED: 21 kDa protein-like                     168   7e-47   
gb|KDP25618.1|  hypothetical protein JCGZ_20774                         169   8e-47   
ref|XP_010503338.1|  PREDICTED: 21 kDa protein-like                     168   8e-47   
ref|XP_011101127.1|  PREDICTED: 21 kDa protein-like                     168   1e-46   
ref|XP_009401795.1|  PREDICTED: 21 kDa protein-like                     168   1e-46   
ref|XP_010515044.1|  PREDICTED: 21 kDa protein-like                     167   2e-46   
ref|XP_002864786.1|  hypothetical protein ARALYDRAFT_496412             167   2e-46   
gb|KFK34035.1|  hypothetical protein AALP_AA5G093500                    167   2e-46   
ref|XP_009618650.1|  PREDICTED: 21 kDa protein-like                     167   2e-46   
ref|XP_006291874.1|  hypothetical protein CARUB_v10018051mg             167   2e-46   
ref|XP_010035020.1|  PREDICTED: 21 kDa protein-like                     167   3e-46   
ref|XP_009796710.1|  PREDICTED: 21 kDa protein-like                     166   3e-46   
gb|AFK45022.1|  unknown                                                 166   4e-46   
ref|XP_007218408.1|  hypothetical protein PRUPE_ppa011478mg             166   6e-46   
gb|KCW77718.1|  hypothetical protein EUGRSUZ_D02018                     166   9e-46   
ref|XP_003598239.1|  21 kDa protein                                     165   1e-45   
ref|XP_009149923.1|  PREDICTED: 21 kDa protein                          166   1e-45   
ref|XP_004147611.1|  PREDICTED: 21 kDa protein-like                     166   1e-45   
emb|CDY70789.1|  BnaCnng69780D                                          165   1e-45   
ref|XP_010053423.1|  PREDICTED: 21 kDa protein-like                     166   1e-45   
ref|XP_010259039.1|  PREDICTED: 21 kDa protein-like                     165   1e-45   
ref|XP_004162668.1|  PREDICTED: 21 kDa protein-like                     166   2e-45   
emb|CDX99059.1|  BnaA06g17500D                                          165   2e-45   
ref|XP_009799203.1|  PREDICTED: pectinesterase 1-like                   170   2e-45   
emb|CAA72315.1|  putative 21kD protein precursor                        164   2e-45   Medicago sativa [alfalfa]
ref|NP_201041.1|  plant invertase/pectin methylesterase inhibitor...    164   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238450.1|  uncharacterized protein LOC100305900 precursor     164   2e-45   
gb|KDP22406.1|  hypothetical protein JCGZ_26237                         164   3e-45   
gb|ACJ83861.1|  unknown                                                 164   3e-45   Medicago truncatula
ref|XP_004309057.1|  PREDICTED: 21 kDa protein-like                     164   3e-45   
gb|EYU43527.1|  hypothetical protein MIMGU_mgv1a024700mg                164   3e-45   
ref|XP_010093661.1|  21 kDa protein                                     164   3e-45   
ref|XP_004240754.1|  PREDICTED: 21 kDa protein-like                     164   3e-45   
ref|XP_010259198.1|  PREDICTED: 21 kDa protein-like                     164   4e-45   
gb|AAM67138.1|  ripening-related protein-like                           164   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003598238.1|  21 kDa protein                                     163   6e-45   
ref|XP_009362113.1|  PREDICTED: 21 kDa protein-like                     163   1e-44   
ref|XP_004499663.1|  PREDICTED: 21 kDa protein-like                     162   1e-44   
ref|XP_006281134.1|  hypothetical protein CARUB_v10027165mg             162   1e-44   
ref|XP_010444080.1|  PREDICTED: 21 kDa protein-like                     162   2e-44   
ref|XP_004511656.1|  PREDICTED: 21 kDa protein-like                     162   2e-44   
ref|XP_010264393.1|  PREDICTED: 21 kDa protein-like                     162   2e-44   
ref|XP_010264193.1|  PREDICTED: 21 kDa protein-like                     162   3e-44   
ref|XP_002318880.1|  invertase/pectin methylesterase inhibitor fa...    162   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_008234383.1|  PREDICTED: 21 kDa protein-like                     162   4e-44   
sp|P17407.1|21KD_DAUCA  RecName: Full=21 kDa protein; AltName: Fu...    161   4e-44   Daucus carota [carrots]
ref|XP_007038423.1|  Plant invertase/pectin methylesterase inhibi...    162   4e-44   
gb|KFK40568.1|  hypothetical protein AALP_AA2G013000                    161   5e-44   
ref|XP_010672019.1|  PREDICTED: 21 kDa protein-like                     161   5e-44   
ref|XP_010264194.1|  PREDICTED: 21 kDa protein-like                     161   6e-44   
ref|XP_006368687.1|  invertase/pectin methylesterase inhibitor fa...    161   6e-44   
ref|XP_010483947.1|  PREDICTED: 21 kDa protein-like                     160   7e-44   
emb|CDX94463.1|  BnaC01g17210D                                          160   1e-43   
ref|XP_009398112.1|  PREDICTED: 21 kDa protein-like                     160   1e-43   
ref|XP_010458832.1|  PREDICTED: 21 kDa protein-like                     160   1e-43   
ref|XP_009139088.1|  PREDICTED: 21 kDa protein                          160   1e-43   
ref|XP_010546069.1|  PREDICTED: 21 kDa protein-like                     160   1e-43   
ref|XP_006362112.1|  PREDICTED: 21 kDa protein-like                     160   1e-43   
ref|XP_004234936.1|  PREDICTED: 21 kDa protein-like                     160   1e-43   
ref|XP_010646817.1|  PREDICTED: 21 kDa protein                          159   2e-43   
ref|XP_008369524.1|  PREDICTED: 21 kDa protein                          159   2e-43   
ref|XP_008439100.1|  PREDICTED: 21 kDa protein-like                     159   2e-43   
ref|XP_010555621.1|  PREDICTED: 21 kDa protein                          159   3e-43   
ref|XP_011018248.1|  PREDICTED: 21 kDa protein                          159   4e-43   
gb|AIT42255.1|  pectinmethylesterase inhibitor                          158   4e-43   
ref|XP_010062095.1|  PREDICTED: 21 kDa protein-like                     159   5e-43   
ref|XP_011076330.1|  PREDICTED: 21 kDa protein-like                     158   5e-43   
emb|CDX89429.1|  BnaA01g14640D                                          158   6e-43   
emb|CDP05316.1|  unnamed protein product                                158   7e-43   
ref|XP_006284547.1|  hypothetical protein CARUB_v10005764mg             158   7e-43   
ref|XP_010438899.1|  PREDICTED: 21 kDa protein-like                     158   7e-43   
ref|XP_004148136.1|  PREDICTED: 21 kDa protein-like                     157   8e-43   
ref|XP_006477257.1|  PREDICTED: 21 kDa protein-like                     158   8e-43   
gb|AIT42253.1|  pectinmethylesterase inhibitor                          157   9e-43   
ref|XP_008377851.1|  PREDICTED: 21 kDa protein                          157   1e-42   
gb|AIT42251.1|  pectinmethylesterase inhibitor                          157   1e-42   
ref|XP_007148704.1|  hypothetical protein PHAVU_005G007600g             157   1e-42   
ref|XP_011033917.1|  PREDICTED: 21 kDa protein-like                     157   1e-42   
ref|XP_011029961.1|  PREDICTED: 21 kDa protein                          157   2e-42   
ref|NP_176463.2|  plant invertase/pectin methylesterase inhibitor...    160   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235143.1|  uncharacterized protein LOC100527116 precursor     156   3e-42   
ref|XP_006355502.1|  PREDICTED: 21 kDa protein-like                     156   4e-42   
ref|XP_009595798.1|  PREDICTED: 21 kDa protein-like                     157   4e-42   
gb|AIT42252.1|  pectinmethylesterase inhibitor                          156   4e-42   
ref|XP_010433659.1|  PREDICTED: 21 kDa protein-like                     156   4e-42   
ref|XP_006362116.1|  PREDICTED: 21 kDa protein-like                     155   4e-42   
ref|XP_010056361.1|  PREDICTED: 21 kDa protein-like                     155   6e-42   
ref|XP_009130208.1|  PREDICTED: 21 kDa protein-like                     155   6e-42   
emb|CDY30715.1|  BnaA02g33370D                                          155   6e-42   
ref|XP_002322406.1|  21K protein precursor                              155   7e-42   Populus trichocarpa [western balsam poplar]
gb|AGJ76633.1|  PMEI/InvI                                               155   9e-42   
ref|XP_002875836.1|  invertase/pectin methylesterase inhibitor fa...    155   1e-41   
emb|CDY46918.1|  BnaA09g12760D                                          155   1e-41   
ref|XP_004234937.1|  PREDICTED: 21 kDa protein-like                     154   2e-41   
ref|XP_006404390.1|  hypothetical protein EUTSA_v10010734mg             154   2e-41   
ref|NP_190322.1|  plant invertase/pectin methylesterase inhibitor...    154   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25616.1|  hypothetical protein JCGZ_20772                         154   3e-41   
ref|XP_011010941.1|  PREDICTED: 21 kDa protein-like                     154   3e-41   
emb|CDY31839.1|  BnaC09g13100D                                          154   3e-41   
ref|XP_009113052.1|  PREDICTED: 21 kDa protein                          154   3e-41   
ref|XP_007039952.1|  Plant invertase/pectin methylesterase inhibi...    154   3e-41   
ref|XP_004245727.1|  PREDICTED: 21 kDa protein-like                     153   4e-41   
ref|NP_194256.1|  plant invertase/pectin methylesterase inhibitor...    153   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002509582.1|  21 kDa protein precursor, putative                 154   5e-41   Ricinus communis
ref|XP_002318283.1|  21K protein precursor                              153   6e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006440387.1|  hypothetical protein CICLE_v10022285mg             153   6e-41   
ref|XP_006413324.1|  hypothetical protein EUTSA_v10027588mg             153   7e-41   
ref|XP_010273892.1|  PREDICTED: 21 kDa protein-like                     153   7e-41   
ref|XP_002867618.1|  invertase/pectin methylesterase inhibitor fa...    152   8e-41   
ref|XP_011010939.1|  PREDICTED: 21 kDa protein-like                     152   8e-41   
emb|CDX92687.1|  BnaC07g39450D                                          152   8e-41   
ref|XP_009767669.1|  PREDICTED: 21 kDa protein                          152   1e-40   
gb|ABK94287.1|  unknown                                                 152   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011029962.1|  PREDICTED: 21 kDa protein-like                     152   1e-40   
ref|XP_006394408.1|  hypothetical protein EUTSA_v10004933mg             152   1e-40   
ref|XP_002509585.1|  21 kDa protein precursor, putative                 152   1e-40   Ricinus communis
ref|XP_004147584.1|  PREDICTED: 21 kDa protein-like                     152   1e-40   
ref|XP_009610995.1|  PREDICTED: 21 kDa protein                          152   2e-40   
gb|KFK29033.1|  hypothetical protein AALP_AA7G080100                    152   2e-40   
ref|XP_010550578.1|  PREDICTED: 21 kDa protein-like                     151   2e-40   
ref|XP_009779184.1|  PREDICTED: 21 kDa protein-like                     152   3e-40   
ref|XP_009137508.1|  PREDICTED: 21 kDa protein-like                     151   3e-40   
ref|XP_011041730.1|  PREDICTED: 21 kDa protein-like                     150   4e-40   
ref|XP_008437134.1|  PREDICTED: 21 kDa protein-like                     150   4e-40   
gb|ABS01356.1|  unknown                                                 150   5e-40   Carica papaya [mamon]
ref|XP_010418274.1|  PREDICTED: 21 kDa protein-like                     152   6e-40   
ref|XP_007210220.1|  hypothetical protein PRUPE_ppa015829mg             150   6e-40   
ref|XP_010553474.1|  PREDICTED: 21 kDa protein-like                     150   7e-40   
ref|XP_011081197.1|  PREDICTED: 21 kDa protein-like                     150   8e-40   
gb|AIT42250.1|  pectinmethylesterase inhibitor                          150   8e-40   
ref|XP_009370518.1|  PREDICTED: 21 kDa protein-like                     150   1e-39   
gb|KCW73050.1|  hypothetical protein EUGRSUZ_E01498                     149   1e-39   
gb|AFK45126.1|  unknown                                                 149   1e-39   
gb|ACJ83345.1|  unknown                                                 149   1e-39   Medicago truncatula
emb|CDY11066.1|  BnaA03g47250D                                          149   2e-39   
ref|XP_003517432.1|  PREDICTED: 21 kDa protein                          149   2e-39   
gb|ACU15105.1|  unknown                                                 149   2e-39   Glycine max [soybeans]
ref|XP_010473498.1|  PREDICTED: 21 kDa protein-like                     151   2e-39   
ref|XP_003611258.1|  Pectinesterase                                     149   3e-39   
ref|XP_002263511.1|  PREDICTED: 21 kDa protein                          149   4e-39   
emb|CAN79278.1|  hypothetical protein VITISV_005236                     149   4e-39   
ref|XP_002321835.2|  hypothetical protein POPTR_0015s14670g             148   5e-39   
ref|XP_010056360.1|  PREDICTED: 21 kDa protein-like                     148   5e-39   
ref|XP_008238631.1|  PREDICTED: 21 kDa protein                          148   5e-39   
gb|AFK49081.1|  unknown                                                 148   5e-39   
ref|XP_002886456.1|  hypothetical protein ARALYDRAFT_893206             146   1e-38   
ref|XP_002321836.1|  hypothetical protein POPTR_0015s14660g             147   1e-38   
ref|XP_011010940.1|  PREDICTED: 21 kDa protein-like                     147   1e-38   
ref|XP_007151983.1|  hypothetical protein PHAVU_004G091900g             147   1e-38   
ref|XP_010055534.1|  PREDICTED: 21 kDa protein-like                     147   1e-38   
ref|XP_007039950.1|  Plant invertase/pectin methylesterase inhibi...    147   1e-38   
gb|ABK22631.1|  unknown                                                 147   1e-38   
emb|CDY46921.1|  BnaA09g12730D                                          147   1e-38   
ref|XP_003550896.1|  PREDICTED: 21 kDa protein-like                     147   2e-38   
ref|XP_002510933.1|  21 kDa protein precursor, putative                 146   2e-38   
ref|XP_006421712.1|  hypothetical protein CICLE_v10007113mg             145   3e-38   
gb|KFK40567.1|  hypothetical protein AALP_AA2G012900                    145   3e-38   
ref|XP_006385731.1|  hypothetical protein POPTR_0003s11320g             145   3e-38   
ref|XP_009113050.1|  PREDICTED: 21 kDa protein                          146   3e-38   
ref|XP_006843218.1|  hypothetical protein AMTR_s00080p00031010          145   3e-38   
emb|CDY31841.1|  BnaC09g13080D                                          145   4e-38   
ref|XP_010533759.1|  PREDICTED: 21 kDa protein-like                     145   5e-38   
gb|ACJ86212.1|  unknown                                                 145   5e-38   
ref|XP_006291868.1|  hypothetical protein CARUB_v10018045mg             144   9e-38   
dbj|BAB17684.1|  DC 1.2 homolog                                         143   1e-37   
ref|XP_004298673.1|  PREDICTED: 21 kDa protein-like                     144   2e-37   
ref|XP_008779098.1|  PREDICTED: 21 kDa protein-like                     144   2e-37   
ref|XP_010062106.1|  PREDICTED: 21 kDa protein                          144   2e-37   
ref|XP_006850694.1|  hypothetical protein AMTR_s00034p00240210          143   2e-37   
ref|XP_009372932.1|  PREDICTED: 21 kDa protein-like                     143   3e-37   
ref|XP_010672011.1|  PREDICTED: 21 kDa protein-like                     143   3e-37   
ref|XP_006490091.1|  PREDICTED: 21 kDa protein-like                     143   4e-37   
ref|XP_010430352.1|  PREDICTED: 21 kDa protein-like                     145   4e-37   
ref|XP_010055532.1|  PREDICTED: 21 kDa protein-like                     143   4e-37   
ref|XP_011041729.1|  PREDICTED: 21 kDa protein-like                     143   4e-37   
ref|XP_008357096.1|  PREDICTED: 21 kDa protein-like                     140   5e-37   
ref|XP_010934409.1|  PREDICTED: 21 kDa protein-like                     142   5e-37   
gb|KDO48403.1|  hypothetical protein CISIN_1g038081mg                   142   5e-37   
ref|XP_002509583.1|  21 kDa protein precursor, putative                 143   7e-37   
ref|XP_006421709.1|  hypothetical protein CICLE_v10005888mg             142   9e-37   
ref|XP_010055533.1|  PREDICTED: 21 kDa protein-like                     142   9e-37   
emb|CDY34685.1|  BnaC04g19980D                                          141   1e-36   
ref|XP_011081381.1|  PREDICTED: 21 kDa protein                          140   3e-36   
ref|XP_010546336.1|  PREDICTED: 21 kDa protein-like                     140   3e-36   
ref|XP_007155620.1|  hypothetical protein PHAVU_003G217200g             140   3e-36   
ref|XP_011033915.1|  PREDICTED: 21 kDa protein-like                     140   4e-36   
ref|XP_008448897.1|  PREDICTED: 21 kDa protein-like                     139   5e-36   
ref|XP_010919055.1|  PREDICTED: 21 kDa protein-like                     140   5e-36   
ref|XP_002304432.2|  invertase/pectin methylesterase inhibitor fa...    139   7e-36   
ref|XP_002886455.1|  hypothetical protein ARALYDRAFT_475076             139   8e-36   
ref|XP_010931030.1|  PREDICTED: 21 kDa protein-like                     139   1e-35   
gb|AES90968.2|  plant invertase/pectin methylesterase inhibitor         139   1e-35   
gb|KDP22407.1|  hypothetical protein JCGZ_26238                         139   1e-35   
ref|XP_010473499.1|  PREDICTED: 21 kDa protein-like                     139   2e-35   
ref|XP_008784634.1|  PREDICTED: 21 kDa protein-like                     138   2e-35   
ref|XP_007045219.1|  Plant invertase/pectin methylesterase inhibi...    140   2e-35   
ref|XP_006391825.1|  hypothetical protein EUTSA_v10023696mg             138   3e-35   
gb|KHN42712.1|  21 kDa protein                                          137   3e-35   
emb|CDY52309.1|  BnaCnng22160D                                          138   3e-35   
ref|XP_007225804.1|  hypothetical protein PRUPE_ppa011318mg             138   4e-35   
ref|XP_006826919.1|  hypothetical protein AMTR_s00010p00168350          137   4e-35   
emb|CDP09903.1|  unnamed protein product                                137   4e-35   
ref|XP_010093662.1|  21 kDa protein                                     137   4e-35   
ref|XP_004297460.1|  PREDICTED: 21 kDa protein-like                     137   4e-35   
ref|NP_564802.1|  plant invertase/pectin methylesterase inhibitor...    137   6e-35   
gb|KCW77722.1|  hypothetical protein EUGRSUZ_D02022                     136   6e-35   
ref|XP_010553774.1|  PREDICTED: 21 kDa protein                          137   6e-35   
ref|NP_178270.1|  invertase/pectin methylesterase inhibitor-like ...    137   6e-35   
gb|EPS67841.1|  hypothetical protein M569_06935                         136   7e-35   
ref|XP_010424933.1|  PREDICTED: 21 kDa protein-like                     137   8e-35   
ref|XP_007012560.1|  Plant invertase/pectin methylesterase inhibi...    136   9e-35   
gb|AAM67063.1|  putative ripening-related protein                       137   1e-34   
ref|XP_006826916.1|  hypothetical protein AMTR_s00010p00166600          136   1e-34   
ref|XP_006302816.1|  hypothetical protein CARUB_v10020941mg             137   1e-34   
ref|XP_010053424.1|  PREDICTED: 21 kDa protein                          136   1e-34   
ref|XP_011070592.1|  PREDICTED: 21 kDa protein-like                     136   2e-34   
ref|XP_010418275.1|  PREDICTED: 21 kDa protein-like                     136   2e-34   
ref|XP_009801663.1|  PREDICTED: 21 kDa protein-like                     137   2e-34   
ref|XP_010261745.1|  PREDICTED: 21 kDa protein-like                     135   2e-34   
ref|XP_007038422.1|  Plant invertase/pectin methylesterase inhibi...    136   2e-34   
gb|EYU26823.1|  hypothetical protein MIMGU_mgv1a020375mg                135   2e-34   
ref|XP_002876765.1|  invertase/pectin methylesterase inhibitor fa...    136   2e-34   
gb|KCW86259.1|  hypothetical protein EUGRSUZ_B02943                     135   3e-34   
ref|XP_008389193.1|  PREDICTED: 21 kDa protein-like                     135   3e-34   
ref|XP_006396768.1|  hypothetical protein EUTSA_v10029144mg             135   3e-34   
ref|XP_006448207.1|  hypothetical protein CICLE_v10016684mg             135   3e-34   
ref|XP_010513891.1|  PREDICTED: 21 kDa protein-like                     135   4e-34   
ref|XP_004147977.1|  PREDICTED: 21 kDa protein-like                     134   4e-34   
ref|XP_009589629.1|  PREDICTED: 21 kDa protein-like                     135   4e-34   
ref|XP_009392885.1|  PREDICTED: 21 kDa protein-like                     134   5e-34   
gb|KFK33383.1|  hypothetical protein AALP_AA5G006000                    135   5e-34   
ref|XP_010044213.1|  PREDICTED: 21 kDa protein-like                     135   5e-34   
ref|XP_002322408.2|  hypothetical protein POPTR_0015s14620g             134   6e-34   
ref|XP_010502142.1|  PREDICTED: 21 kDa protein-like                     135   7e-34   
ref|XP_010430353.1|  PREDICTED: 21 kDa protein-like                     134   8e-34   
ref|XP_002284784.1|  PREDICTED: 21 kDa protein                          134   9e-34   
gb|KHN04328.1|  21 kDa protein                                          134   1e-33   
gb|KFK32788.1|  hypothetical protein AALP_AA6G288400                    134   1e-33   
gb|AFK44781.1|  unknown                                                 134   1e-33   
ref|XP_010455677.1|  PREDICTED: 21 kDa protein-like                     134   1e-33   
ref|XP_006469216.1|  PREDICTED: 21 kDa protein-like                     134   1e-33   
ref|NP_192976.1|  pectin methylesterase inhibitor 1                     134   1e-33   
gb|AAM63827.1|  unknown                                                 134   1e-33   
emb|CDX86708.1|  BnaA09g20980D                                          134   1e-33   
ref|XP_009144492.1|  PREDICTED: 21 kDa protein-like                     133   2e-33   
ref|XP_009114623.1|  PREDICTED: 21 kDa protein                          134   2e-33   
ref|XP_010422204.1|  PREDICTED: 21 kDa protein-like                     133   2e-33   
ref|XP_008437716.1|  PREDICTED: 21 kDa protein-like                     134   2e-33   
ref|XP_004503384.1|  PREDICTED: 21 kDa protein-like                     133   3e-33   
ref|XP_004250403.1|  PREDICTED: 21 kDa protein-like                     132   4e-33   
gb|ABK22757.1|  unknown                                                 132   4e-33   
ref|XP_009351520.1|  PREDICTED: 21 kDa protein-like                     132   4e-33   
ref|XP_008783567.1|  PREDICTED: 21 kDa protein-like                     132   4e-33   
gb|ACN40648.1|  unknown                                                 132   4e-33   
ref|XP_009595722.1|  PREDICTED: 21 kDa protein-like                     133   5e-33   
ref|XP_002516226.1|  21 kDa protein precursor, putative                 133   7e-33   
ref|XP_009611479.1|  PREDICTED: 21 kDa protein-like                     132   8e-33   
ref|XP_006292770.1|  hypothetical protein CARUB_v10019019mg             132   8e-33   
ref|XP_002312451.2|  hypothetical protein POPTR_0008s13190g             131   1e-32   
gb|EYU26822.1|  hypothetical protein MIMGU_mgv1a014006mg                131   1e-32   
ref|XP_010433531.1|  PREDICTED: 21 kDa protein                          131   1e-32   
emb|CDP00817.1|  unnamed protein product                                132   1e-32   
ref|XP_009793698.1|  PREDICTED: 21 kDa protein-like                     131   1e-32   
ref|XP_010066596.1|  PREDICTED: 21 kDa protein                          131   2e-32   
ref|XP_009780736.1|  PREDICTED: 21 kDa protein-like                     130   2e-32   
emb|CDX97343.1|  BnaA02g21340D                                          130   2e-32   
ref|XP_008467116.1|  PREDICTED: 21 kDa protein                          130   2e-32   
ref|XP_009411399.1|  PREDICTED: 21 kDa protein-like                     130   2e-32   
ref|XP_008451567.1|  PREDICTED: 21 kDa protein                          130   2e-32   
ref|XP_003525240.1|  PREDICTED: 21 kDa protein-like                     130   2e-32   
ref|XP_010049367.1|  PREDICTED: 21 kDa protein                          130   2e-32   
ref|XP_006416961.1|  hypothetical protein EUTSA_v10008807mg             130   3e-32   
ref|XP_003530773.1|  PREDICTED: 21 kDa protein-like                     130   3e-32   
ref|XP_006361367.1|  PREDICTED: 21 kDa protein-like                     130   3e-32   
ref|XP_007052101.1|  21 kDa protein, putative                           130   3e-32   
gb|KEH32318.1|  plant invertase/pectin methylesterase inhibitor         130   3e-32   
ref|XP_009767771.1|  PREDICTED: 21 kDa protein                          129   4e-32   
gb|KEH21383.1|  plant invertase/pectin methylesterase inhibitor         130   4e-32   
ref|XP_004243686.1|  PREDICTED: 21 kDa protein                          129   4e-32   
ref|XP_009608759.1|  PREDICTED: 21 kDa protein-like                     129   4e-32   
emb|CDY65618.1|  BnaC02g46740D                                          129   4e-32   
ref|XP_004150119.1|  PREDICTED: 21 kDa protein-like                     129   4e-32   
ref|XP_002872657.1|  invertase/pectin methylesterase inhibitor fa...    129   5e-32   
gb|KDP23996.1|  hypothetical protein JCGZ_25384                         130   5e-32   
ref|XP_004160554.1|  PREDICTED: 21 kDa protein-like                     129   5e-32   
emb|CDY11064.1|  BnaA03g47230D                                          130   6e-32   
ref|XP_002529634.1|  21 kDa protein precursor, putative                 129   7e-32   
ref|NP_194255.1|  invertase/pectin methylesterase inhibitor famil...    129   7e-32   
ref|XP_010471074.1|  PREDICTED: 21 kDa protein-like                     129   8e-32   
ref|XP_003590138.1|  Pectinesterase inhibitor                           129   1e-31   
gb|AFK34211.1|  unknown                                                 129   1e-31   
ref|XP_010431474.1|  PREDICTED: 21 kDa protein-like                     128   1e-31   
gb|ABK21023.1|  unknown                                                 129   1e-31   
ref|XP_009137507.1|  PREDICTED: 21 kDa protein-like                     128   1e-31   
ref|XP_011023856.1|  PREDICTED: 21 kDa protein-like                     128   1e-31   
ref|XP_006349456.1|  PREDICTED: 21 kDa protein-like                     128   1e-31   
ref|XP_002280585.1|  PREDICTED: 21 kDa protein                          128   2e-31   
emb|CDY11065.1|  BnaA03g47240D                                          128   2e-31   
ref|XP_006358402.1|  PREDICTED: 21 kDa protein-like                     128   2e-31   
ref|XP_007160400.1|  hypothetical protein PHAVU_002G318700g             128   2e-31   
ref|XP_010916195.1|  PREDICTED: 21 kDa protein                          127   2e-31   
ref|XP_009393953.1|  PREDICTED: 21 kDa protein-like                     127   2e-31   
ref|XP_004499666.1|  PREDICTED: 21 kDa protein-like                     128   2e-31   
ref|XP_004249077.1|  PREDICTED: 21 kDa protein-like                     128   2e-31   
gb|EMT21002.1|  21 kDa protein                                          127   3e-31   
ref|XP_002869681.1|  invertase/pectin methylesterase inhibitor fa...    127   3e-31   
ref|XP_011038600.1|  PREDICTED: 21 kDa protein-like                     127   3e-31   
ref|XP_004300721.1|  PREDICTED: 21 kDa protein-like                     127   3e-31   
ref|XP_010259553.1|  PREDICTED: 21 kDa protein-like                     127   3e-31   
ref|XP_010676189.1|  PREDICTED: 21 kDa protein                          127   3e-31   
gb|AAM62643.1|  ripening-related protein-like                           127   4e-31   
ref|XP_002314795.2|  hypothetical protein POPTR_0010s11950g             127   4e-31   
ref|XP_010089668.1|  21 kDa protein                                     127   4e-31   
ref|XP_006579621.1|  PREDICTED: 21 kDa protein-like                     127   5e-31   
ref|XP_006353777.1|  PREDICTED: 21 kDa protein-like                     126   5e-31   
ref|XP_008242280.1|  PREDICTED: 21 kDa protein                          126   6e-31   
ref|XP_004244713.1|  PREDICTED: 21 kDa protein-like                     126   6e-31   
gb|ADE76337.1|  unknown                                                 126   8e-31   
emb|CDP05318.1|  unnamed protein product                                126   8e-31   
ref|XP_010415758.1|  PREDICTED: 21 kDa protein-like                     126   9e-31   
gb|AAF79226.1|AC006917_11  F10B6.30                                     126   9e-31   
ref|XP_010427856.1|  PREDICTED: 21 kDa protein-like                     126   9e-31   
ref|XP_010438903.1|  PREDICTED: 21 kDa protein-like                     125   1e-30   
ref|NP_563960.2|  plant invertase/pectin methylesterase inhibitor...    126   1e-30   
ref|XP_010681916.1|  PREDICTED: 21 kDa protein-like                     126   1e-30   
gb|KDO65431.1|  hypothetical protein CISIN_1g029020mg                   125   1e-30   
ref|NP_197574.1|  plant invertase/pectin methylesterase inhibitor...    125   1e-30   
emb|CDY09429.1|  BnaA02g25810D                                          125   2e-30   
ref|XP_010101980.1|  21 kDa protein                                     125   2e-30   
gb|KFK32950.1|  hypothetical protein AALP_AA6G310500                    125   2e-30   
ref|XP_002890079.1|  invertase/pectin methylesterase inhibitor fa...    125   2e-30   
ref|XP_011075388.1|  PREDICTED: 21 kDa protein-like                     124   2e-30   
ref|XP_009110513.1|  PREDICTED: 21 kDa protein-like                     125   2e-30   
ref|XP_010420924.1|  PREDICTED: 21 kDa protein-like                     125   3e-30   
ref|XP_010271276.1|  PREDICTED: 21 kDa protein-like                     125   3e-30   
ref|XP_009139038.1|  PREDICTED: 21 kDa protein-like                     124   4e-30   
ref|XP_006358403.1|  PREDICTED: 21 kDa protein-like                     124   4e-30   
ref|XP_010266694.1|  PREDICTED: 21 kDa protein-like                     124   4e-30   
ref|XP_002276089.1|  PREDICTED: 21 kDa protein                          124   4e-30   
ref|XP_010493188.1|  PREDICTED: 21 kDa protein-like                     124   5e-30   
emb|CDY52024.1|  BnaA08g31370D                                          124   6e-30   
ref|XP_009129219.1|  PREDICTED: 21 kDa protein-like                     124   6e-30   
ref|XP_006395872.1|  hypothetical protein EUTSA_v10004939mg             124   6e-30   
ref|XP_010552689.1|  PREDICTED: 21 kDa protein-like                     123   7e-30   
ref|XP_008221461.1|  PREDICTED: 21 kDa protein-like                     125   7e-30   
gb|AAM62905.1|  ripening-related protein-like                           123   8e-30   
gb|KDP38091.1|  hypothetical protein JCGZ_04734                         123   8e-30   
ref|XP_010533758.1|  PREDICTED: 21 kDa protein                          123   9e-30   
ref|XP_006421715.1|  hypothetical protein CICLE_v10005928mg             123   9e-30   
ref|XP_008366993.1|  PREDICTED: 21 kDa protein-like                     123   9e-30   
emb|CDY48809.1|  BnaC02g34050D                                          123   9e-30   
ref|XP_010454384.1|  PREDICTED: 21 kDa protein-like                     123   1e-29   
ref|XP_003608771.1|  Pectinesterase/pectinesterase inhibitor            127   1e-29   
ref|XP_009605202.1|  PREDICTED: 21 kDa protein-like                     123   1e-29   
gb|AFX95923.1|  pectin methylesterase inhibitor                         121   1e-29   
ref|XP_002527780.1|  21 kDa protein precursor, putative                 123   1e-29   
gb|EYU33115.1|  hypothetical protein MIMGU_mgv1a026685mg                122   1e-29   
ref|XP_006826917.1|  hypothetical protein AMTR_s00010p00167000          122   1e-29   



>emb|CBA10126.1| PME inhibitor [Nicotiana benthamiana]
Length=205

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG TNTEFIRTSC++T+YP LCF+SLSS A  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  36   AAGDTNTEFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQSTSAMM  95

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   GLT RE+GAM DCVEELS++VDE+R+SLGEMKQLRG+DF++KMNDIQTWVSAA
Sbjct  96   LKLAHVRGLTPREVGAMHDCVEELSDTVDEMRKSLGEMKQLRGKDFDLKMNDIQTWVSAA  155

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VRGKI++VAHLTSNALALIN  A LHG
Sbjct  156  LTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAALHG  205



>ref|XP_009779202.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=206

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  37   AAGDTNTEFIRTSCKSTTYPNLCFSSLSSRSAAIGVSPQLLAHESLTVSLETAQSTSAMM  96

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   GLT RE+GAM DCVEELS++VDELR+SLGEMKQLRG+DF++KMNDIQTWVSAA
Sbjct  97   LKLAHVQGLTPREVGAMHDCVEELSDTVDELRKSLGEMKQLRGKDFDLKMNDIQTWVSAA  156

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VRGKI++VAHLTSNALAL+N  A LHG
Sbjct  157  LTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALVNSVAALHG  206



>gb|ABG47806.1| pectin methlyesterase inhibitor protein 1 [Capsicum annuum]
 gb|ABG81102.1| pectin methlyesterase inhibitor protein 1 [Capsicum annuum]
Length=200

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A G TNTEFIRTSC++T+YP LCF+SLSS A  I A PQL+AH +LTV+L+TAQST++ M
Sbjct  31   AVGETNTEFIRTSCKSTTYPNLCFSSLSSRASAIGASPQLLAHESLTVSLETAQSTSSMM  90

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   G+T REIGAM DCVEELS++V  LR+SLGEMKQLRG+DF++KMNDIQTWVSAA
Sbjct  91   LKLAHGQGMTPREIGAMHDCVEELSDTVVGLRKSLGEMKQLRGKDFDLKMNDIQTWVSAA  150

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GF GKV    VKT VRGKI++VAHLTSNALALINR A LHG
Sbjct  151  LTDEDTCTEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINRLAALHG  200



>ref|XP_009594970.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=204

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG TNTEFIRTSC++T+YP LCF+SLS  A  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  35   AAGDTNTEFIRTSCKSTTYPNLCFSSLSGRATAIGVSPQLLAHESLTVSLETAQSTSAMM  94

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   GLT RE+GAM DCVEELS++VDELR+SLGEMKQLRG+DF++KM+DIQTWVSAA
Sbjct  95   LKLAHVQGLTPREVGAMHDCVEELSDTVDELRKSLGEMKQLRGKDFDLKMSDIQTWVSAA  154

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VRGKI++VAHLTSNALALIN  A L G
Sbjct  155  LTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAALRG  204



>gb|AAX20046.1| DC1.2-like [Capsicum annuum]
Length=205

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A G TNTEFIRTSC++TSYP LCF+SLSS A  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  36   AVGETNTEFIRTSCKSTSYPNLCFSSLSSRASAIGVSPQLLAHESLTVSLETAQSTSAMM  95

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   G+T RE+GAM DCVEELS++V  LR+SLGEMKQLRG+DF++K+NDIQTWVSAA
Sbjct  96   LKLAHGQGMTPREVGAMHDCVEELSDTVAGLRKSLGEMKQLRGKDFDLKINDIQTWVSAA  155

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GF GKV    VKT VRGKI++VAHLTSNALALIN  A LHG
Sbjct  156  LTDEDTCTEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINSLASLHG  205



>ref|XP_006362111.1| PREDICTED: 21 kDa protein-like isoform X2 [Solanum tuberosum]
Length=201

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            +AG TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +L+V+L+TAQST+A M
Sbjct  32   SAGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQSTSAMM  91

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +L+ S G+T RE+GAMRDCVEELS++V  +++SLGEMK+LRG+DF++KMNDIQTWVSAA
Sbjct  92   IKLSHSQGMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAA  151

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VR KI++VAH+TSNALALINR A LHG
Sbjct  152  LTDEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINRLAALHG  201



>ref|XP_009779211.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=205

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  36   AAGDTNTEFIRTSCKSTTYPNLCFSSLSSRSTAIGVSPQLLAHESLTVSLETAQSTSATM  95

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   G+T RE+GAM DCVEELS++V ELR+SLGEMKQLRG+DF++KMNDIQTWVSAA
Sbjct  96   LKLAHGQGMTAREVGAMHDCVEELSDAVVELRKSLGEMKQLRGKDFDLKMNDIQTWVSAA  155

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTD+DTCT+GFAGKV    VKT VRG+I++VAH+TSNALALIN  A LH
Sbjct  156  LTDEDTCTEGFAGKVMNGKVKTVVRGRILEVAHMTSNALALINSLAALH  204



>ref|XP_006367638.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=203

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  34   AAGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMM  93

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA S G+  RE+GAMRDCVEELS++V  +++SLGEMK+LRG+DF++KMNDIQTWVSAA
Sbjct  94   LKLAYSQGMAPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAA  153

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VR KI++VAH+TSNALALIN  A LHG
Sbjct  154  LTDEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLAALHG  203



>gb|ABY81888.1| pectin methylesterase inhibitor-like protein [Capsicum annuum]
Length=205

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A G TNTEFIRTSC++TSYP LCF+SLSS A  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  36   AVGETNTEFIRTSCKSTSYPNLCFSSLSSRASAIGVAPQLLAHESLTVSLETAQSTSAMM  95

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA   G+T RE+GAM DCVEELS++V  LR+SLGEMKQLRG+DF++K+NDIQTWVSAA
Sbjct  96   LKLAHGQGMTPREVGAMHDCVEELSDTVAGLRKSLGEMKQLRGKDFDLKINDIQTWVSAA  155

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GF GKV    VKT VRGKI +VAHLTS+ALALIN  A LHG
Sbjct  156  LTDEDTCTEGFDGKVMNGKVKTVVRGKIFEVAHLTSSALALINSLASLHG  205



>ref|XP_009597893.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
 dbj|BAA95794.1| DC1.2 homologue [Nicotiana tabacum]
Length=205

 Score =   248 bits (634),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            AG TNTEFIRTSC++T+YP LCF+SLSS A  I   PQL+AH +LTV+L+TAQST+  M 
Sbjct  37   AGDTNTEFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQSTSVTMV  96

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
             LA   G+T REIGAM DCVEELS++V ELR+SLGEMKQLRG+DF++KM+DIQTWVSAAL
Sbjct  97   ELAHGQGMTPREIGAMHDCVEELSDAVVELRKSLGEMKQLRGKDFDLKMSDIQTWVSAAL  156

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+DTCT+GFAGKV    VKT VRG+I+ VAH+TSNALALIN  A  HG
Sbjct  157  TDEDTCTEGFAGKVMNGKVKTVVRGRILDVAHMTSNALALINSLAAFHG  205



>ref|XP_006362110.1| PREDICTED: 21 kDa protein-like isoform X1 [Solanum tuberosum]
 ref|XP_006367637.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=201

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            +AG TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +L+V+L+TAQST+A M
Sbjct  32   SAGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQSTSAMM  91

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +L+ S G+T RE+GAMRDCVEELS++V  +++SLGEMK+LRG+DF++KM+DIQTWVSAA
Sbjct  92   IKLSHSQGMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMSDIQTWVSAA  151

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VR KI++VAH+TSNALALIN  A LHG
Sbjct  152  LTDEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLAALHG  201



>ref|XP_011076332.1| PREDICTED: 21 kDa protein [Sesamum indicum]
Length=201

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A GATNTEFIRTSC  T+YPRLC+++L+SHA  I+ DP+L+AH AL+V+L TA+ST+  M
Sbjct  32   AGGATNTEFIRTSCSATTYPRLCYSALASHASTIQQDPKLLAHAALSVSLDTARSTSVDM  91

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +L+RS G+T R++GAMRDCVEELS+SV++LR+S+ EM  ++G +F M M+DIQTWVSAA
Sbjct  92   VKLSRSTGMTPRQVGAMRDCVEELSDSVEQLRKSVEEMNLMKGSNFGMMMSDIQTWVSAA  151

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTDDDTC DGFAGK     VKTAVRG+I+ VAH+TSNALALIN FA LHG
Sbjct  152  LTDDDTCMDGFAGKFMNGAVKTAVRGRIVNVAHMTSNALALINSFAALHG  201



>emb|CDP05319.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  351  AMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAA  530
            A++   TNTEFIRTSC TT+YP LC+ SLS  A  IR+DP+L+AH AL+V+L TA+ST++
Sbjct  34   ALSGVTTNTEFIRTSCSTTTYPELCYASLSDQATIIRSDPELLAHAALSVSLDTAKSTSS  93

Query  531  AMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVS  710
             M +L++SHG+T RE+GAMRDCVEEL +SVDEL++S+GEM QLRG +F + +NDIQTWVS
Sbjct  94   MMVKLSQSHGMTPREVGAMRDCVEELGDSVDELKKSMGEMPQLRGPNFALTVNDIQTWVS  153

Query  711  AALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            AALTD+DTC DGFAGK      K AVR +I+ VAH+TSNALALIN +A LH
Sbjct  154  AALTDEDTCMDGFAGKAMNGNTKIAVRNQIVNVAHMTSNALALINSYASLH  204



>ref|XP_004234934.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=200

 Score =   241 bits (614),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A G TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +L+V+L+TAQST+A M
Sbjct  31   ATGHTNTEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMM  90

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +L+ S G+T RE+GAM+DCVEELS++V ELR+SLGEMKQLRGRDF+MKM+DIQTWVSAA
Sbjct  91   LKLSHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMKQLRGRDFDMKMSDIQTWVSAA  150

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LT++DTCT+GFAGK     VKTA+RGKI++VAH+TSNALALIN    LHG
Sbjct  151  LTNEDTCTEGFAGKAMNGKVKTAIRGKIVEVAHMTSNALALINTLDALHG  200



>ref|XP_004234935.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=201

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A+G TNT+FIRTSC++T+YP LCF+SLSS +  I   PQL+AH +L+V+L+TAQST+A M
Sbjct  32   ASGETNTDFIRTSCKSTTYPTLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMM  91

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +L+ S G+T RE+GAMRDCVEELS++V  +++SLGEMK+L+G+DF++KMNDIQTWVSAA
Sbjct  92   LKLSHSQGMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELKGKDFDLKMNDIQTWVSAA  151

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            LTD+DTCT+GFAGKV    VKT VRGKI++VA LTSNALALINR A +HG
Sbjct  152  LTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAQLTSNALALINRLAAIHG  201



>emb|CDP05320.1| unnamed protein product [Coffea canephora]
Length=201

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            +GATN EFIRTSC TT+YP+LC+ +LS+ A  I++DP+L+AH AL+ +L TA+ST++ M 
Sbjct  33   SGATNAEFIRTSCSTTTYPKLCYATLSNQATIIQSDPKLLAHAALSASLDTAKSTSSMMA  92

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHG+T R+ GAMRDCVEEL ESVDEL+ SL EM QL G +F + MNDIQTWVSAAL
Sbjct  93   KLSQSHGMTPRQGGAMRDCVEELRESVDELKNSLDEMPQLTGSNFALTMNDIQTWVSAAL  152

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TDDDTC +GFAGK T    K AVR +I+ VAH+TSNALALIN +A LHG
Sbjct  153  TDDDTCMEGFAGKATNGNTKIAVRDQIVNVAHVTSNALALINSYAALHG  201



>ref|XP_006367807.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=198

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            +G TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +L+V+++TAQST+  M 
Sbjct  30   SGETNTEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSIETAQSTSTMMI  89

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            ++A S G+T RE+GAM+DCVEELS++V ELR+SLGEMKQLRGRDF+MKM+DIQTWVSAAL
Sbjct  90   KVAHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMKQLRGRDFDMKMSDIQTWVSAAL  149

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            T++DTCT+GFAGK     VKT VRGKI++VAH+TSNALALIN    LHG
Sbjct  150  TNEDTCTEGFAGKAMNGKVKTVVRGKIVEVAHMTSNALALINTLDALHG  198



>gb|ABG49144.1| pectin methylesterase inhibitor isoform [Solanum phureja]
Length=198

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            +G TN EFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +L+V+++TAQST+  M 
Sbjct  30   SGETNREFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSIETAQSTSTMMI  89

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            ++A S G+T RE+GAM+DCVEELS++V ELR+SLGEMKQLRGRDF+MKM+DIQTWVSAAL
Sbjct  90   KVAHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMKQLRGRDFDMKMSDIQTWVSAAL  149

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            T++DTCT+GFAGK     VKT VR KI++VAH+TSNALALINR A LHG
Sbjct  150  TNEDTCTEGFAGKAMNGKVKTVVREKILEVAHMTSNALALINRLAALHG  198



>ref|XP_006362121.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=200

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG TNTEFIRTSC++T+YP LCF+SLSS +  I   PQL+AH +LTV+L+TAQST+A M
Sbjct  34   AAGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMM  93

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             +LA S G+  RE+GAMRDCVEELS++V  +++SLGEMK+LRG+DF++KMNDIQTWVSAA
Sbjct  94   LKLAYSQGMAPREVGAMRDCVEELSDTVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAA  153

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALI  842
              D+DTCT+GFAGKV    VKT VR KI++VAH+TSN+LALI
Sbjct  154  FADEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNSLALI  195



>ref|XP_010550579.1| PREDICTED: 21 kDa protein [Tarenaya hassleriana]
Length=197

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEFIR+SC  T+YPRLCF SLSSHA FI+  P+LMAH AL V+L +A+ST+A M RL+
Sbjct  32   TNTEFIRSSCSVTTYPRLCFTSLSSHATFIQTSPKLMAHAALNVSLSSAKSTSAMMTRLS  91

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            RSHG+   E  A+RDCVEELS +VDELR S+GEM +LRG ++E+ M+DI+TWVSAALTD+
Sbjct  92   RSHGIKPLEASAVRDCVEELSNTVDELRSSVGEMDRLRGSNYEVYMSDIETWVSAALTDE  151

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCTDGF G      VK  VR +I+ +A LTSNALALIN FA LHG
Sbjct  152  NTCTDGFEGSAMDGKVKVLVRERILAIARLTSNALALINHFASLHG  197



>emb|CAN70288.1| hypothetical protein VITISV_015784 [Vitis vinifera]
Length=200

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA   NTEFIRTSC TT YPRLCF SLS+HA  I+  P+L+A TAL+VTL TA+ST++ M
Sbjct  31   AARKDNTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTSSVM  90

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
              L  SHGL  RE+ AM+DCVEELS+SVD+LR+++GEM Q++G +F + MNDIQTWVSAA
Sbjct  91   SNLLLSHGLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWVSAA  150

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LT +DTCTDGFAG      +K AVR +I+K+AH+TSNALALIN +A LH
Sbjct  151  LTYEDTCTDGFAGNTMDGKLKKAVRARIVKIAHMTSNALALINSYASLH  199



>ref|XP_002264028.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CBI24573.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA   +TEFIRTSC TT+YP+LC+ SLS+HA  I+  P+L+A TAL VTL TA+ST++ M
Sbjct  32   AAEKASTEFIRTSCGTTTYPKLCYTSLSAHASVIQTSPKLLADTALAVTLSTARSTSSLM  91

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             ++ +SHGL  RE+ AM DCVEELS+SVD+LR+++GEM Q++G +F + MNDIQTWVSAA
Sbjct  92   SKMVQSHGLKPREVAAMHDCVEELSDSVDQLRKAMGEMTQIKGSNFGLMMNDIQTWVSAA  151

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTD+DTCTDGFAG      +KT VR +++ +AH+TSNAL LIN +A LH
Sbjct  152  LTDEDTCTDGFAGNAMNGNLKTTVRARVVNMAHMTSNALGLINSYASLH  200



>ref|XP_007038418.1| DC1.2-like, putative [Theobroma cacao]
 gb|EOY22919.1| DC1.2-like, putative [Theobroma cacao]
Length=201

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  ++ EFIRTSC +T+YP+LCF +LS+HA  I+  PQL+AH AL VTL T +ST+A M 
Sbjct  33   APQSSAEFIRTSCSSTTYPKLCFETLSTHASLIQTSPQLLAHAALNVTLSTTESTSAMMV  92

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
             L++SHGL  RE  AM+DCVEELS+S+DELR+S+ EM Q++G +F + +ND+QTWVSAAL
Sbjct  93   TLSKSHGLKPREAEAMQDCVEELSDSIDELRKSISEMGQVKGSNFGLMINDVQTWVSAAL  152

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGF G      VKTAVR KI+++AHLTSNALALIN +A LHG
Sbjct  153  TDESTCSDGFQGNNMNGNVKTAVRTKILRIAHLTSNALALINNYASLHG  201



>ref|XP_002263991.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA   NTEFIRTSC TT YPRLCF SLS+HA  I+  P+L+A TAL+VTL TA+ST++ M
Sbjct  31   AARKDNTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTSSVM  90

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
              L  SHGL  RE+ AM+DCVEELS+SVD+LR+++GEM Q++G +F + MNDIQTWVSAA
Sbjct  91   SNLLLSHGLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWVSAA  150

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LT +DTCTDGFAG      +K AVR +I+K+AH+TSNALALIN +A  H
Sbjct  151  LTYEDTCTDGFAGNTMDGKLKKAVRTRIVKIAHMTSNALALINSYASFH  199



>ref|XP_010091300.1| 21 kDa protein [Morus notabilis]
 gb|EXC36884.1| 21 kDa protein [Morus notabilis]
Length=205

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEFIRTSC +T+YP+LCF+SLS+HA  I++ PQL+A T+L+VTL +A++T+A M RL+
Sbjct  38   TNTEFIRTSCVSTTYPKLCFSSLSTHASTIQSSPQLLAITSLSVTLSSAKTTSAEMTRLS  97

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RGRD-FEMKMNDIQTWVSAALT  722
             SHGL  RE+ AM+DC+EEL +SVDELR+S+GEM QL +G+  F++ +NDIQTWVSAALT
Sbjct  98   LSHGLKPREVDAMKDCIEELRDSVDELRKSMGEMSQLVKGKSGFKLMINDIQTWVSAALT  157

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            D++TCTDGF  K     +KTAVRG+++ VA LTSNALALINR+  +HG
Sbjct  158  DENTCTDGFEEKPMNGNLKTAVRGQVVNVAQLTSNALALINRYGLIHG  205



>ref|XP_002264101.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
 ref|XP_002264204.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
 emb|CAN82970.1| hypothetical protein VITISV_006071 [Vitis vinifera]
 emb|CBI24574.3| unnamed protein product [Vitis vinifera]
 emb|CBI24575.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA   +TEFIRTSC TT+YPRLC+ SLS+HA  I+  P+L+A TAL VTL TA+ST++ M
Sbjct  33   AADKASTEFIRTSCGTTTYPRLCYTSLSAHASVIQTSPKLLADTALAVTLSTARSTSSLM  92

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
             ++ +SHGL  RE+ AM DCVEELS+SVD+LR ++GEM Q++G +F + M+DIQTWVS A
Sbjct  93   SKMVQSHGLKPREVAAMHDCVEELSDSVDQLRRAMGEMTQIKGSNFGLMMDDIQTWVSTA  152

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTD+DTCTDGFAG      +KT VR +I+ +AH+TSNAL LIN +A LH
Sbjct  153  LTDEDTCTDGFAGNAMNGNLKTTVRARIVNMAHMTSNALGLINSYASLH  201



>ref|XP_010035021.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW46288.1| hypothetical protein EUGRSUZ_K00155 [Eucalyptus grandis]
Length=200

 Score =   223 bits (568),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A  +TNT+FIRTSC  T+YPRLC+ SLSSHA  I+  P+L+  TAL VTL  A+ST+A M
Sbjct  30   AQTSTNTQFIRTSCSKTTYPRLCYTSLSSHANLIQTSPKLLTSTALNVTLNKARSTSAMM  89

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RGRDFEMKMNDIQTWVSA  713
             RL+R+HG+  RE+GAM+DCVEELS +VDELR S+ EM Q+ R  +F + MND+QTWVSA
Sbjct  90   VRLSRAHGMKPREVGAMQDCVEELSSTVDELRRSIHEMGQIKRSSNFGLIMNDVQTWVSA  149

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            ALTD++TC+DGF G       KT VR  I+ +AHLTSNALALINR+A+L G
Sbjct  150  ALTDENTCSDGFTGSTMNGNTKTVVRNAILTIAHLTSNALALINRYAELQG  200



>gb|KDP22409.1| hypothetical protein JCGZ_26240 [Jatropha curcas]
Length=203

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEFIRTSC TT+YP+LC+ SLS HA  I+  P+L+A+ AL VTL +A+ST+A M +L+
Sbjct  38   TNTEFIRTSCSTTTYPKLCYTSLSVHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKLS  97

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +SHG+   E+ AM+DCVEELS++V+ LR+S+GEMK  +  DF++ +ND+QTWVSAALTD+
Sbjct  98   QSHGMKPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKESDFKLMINDVQTWVSAALTDE  157

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TC+DGFAGK      KT VR  I+ +AHLTSNALALIN +A LHG
Sbjct  158  NTCSDGFAGKTMNGNTKTLVREMILNIAHLTSNALALINNYASLHG  203



>ref|XP_009374503.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TN EF++TSC  T+YP+LC  SLSSHA  I+  P+LMA TALTVTL +A+ST+  M 
Sbjct  34   AQKTNNEFVKTSCSATTYPKLCLTSLSSHASAIQTSPKLMASTALTVTLASAKSTSTVMS  93

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++ HG+  RE+GAMRDC+EELS+SVD ++ S+ EM   R  DF++ ++D+QTWVSAAL
Sbjct  94   KLSQRHGMKPREVGAMRDCIEELSDSVDVIQRSIAEMGNFRSSDFQLMISDVQTWVSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGF G      +KT VRG+++ +A LTSNALALINR+A +HG
Sbjct  154  TDETTCSDGFGGNGMNSNLKTVVRGRVVNIAQLTSNALALINRYASVHG  202



>ref|XP_002264167.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEFIRT+C TT+YP+LCF SL++HA  I+ +P+L+A TAL+VTL TA+ST++ M  L +
Sbjct  36   STEFIRTACGTTTYPQLCFTSLAAHASVIQTNPKLLASTALSVTLATARSTSSDMSTLLK  95

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
             HGLT RE+ AMRDCVEELS+SVD+L++S+GEM Q++  +F + +NDIQTWVSAALTD+D
Sbjct  96   RHGLTPREVSAMRDCVEELSDSVDQLKKSMGEMSQIKSSNFGLMINDIQTWVSAALTDED  155

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TC +GF        V+T V  +I+ +AH+TSNALALIN +A LH
Sbjct  156  TCANGFTENAMTENVRTVVNARIVNIAHMTSNALALINSYASLH  199



>emb|CDX87244.1| BnaC09g05590D [Brassica napus]
Length=199

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L ++   ATNTEF+++SC  T+YPRLC  SLS+HA  I+  P+LMAH AL +TL +A++T
Sbjct  26   LKSVHTTATNTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKAT  85

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +  M RL+ S  L  RE+ AMRDCVEEL +++DELR+S+GEM QL G  +E+ M+DIQTW
Sbjct  86   SVMMVRLSSSSQLKPREVSAMRDCVEELGDTLDELRKSIGEMGQLIGSSYEVYMSDIQTW  145

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            VSAALTD++TCTDGF G      VK  VR +I+ +AHLTSNALALIN FA +HG
Sbjct  146  VSAALTDENTCTDGFEGDDMNGKVKVFVRERILVIAHLTSNALALINHFASIHG  199



>ref|XP_007218426.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
 gb|EMJ19625.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
Length=203

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TNTEFI+TSC  T+YP+LC  SLSSHA  I+  P+LMA  AL VTL +A+ST+A M 
Sbjct  35   APKTNTEFIKTSCSATTYPKLCLTSLSSHASTIQTSPKLMAGAALNVTLSSAKSTSAVML  94

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHGL  +E+GAMRDC+EELS+SVDEL+ S+ EM   +  DF++ ++D+QTWVSAAL
Sbjct  95   KLSQSHGLKPKEVGAMRDCLEELSDSVDELQSSIAEMGNFKSYDFQLMISDVQTWVSAAL  154

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD++TC++GF G      +KTAVRG+I+ +A LTSNALALINR+A +HG
Sbjct  155  TDENTCSEGFGGNGMNGNLKTAVRGRIVNIAQLTSNALALINRYASVHG  203



>ref|XP_009112019.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
 emb|CDY16779.1| BnaA09g06030D [Brassica napus]
Length=199

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            ATNTEF+++SC  T+YPRLC  SLS+HA  I+  P+LMAH AL +TL +A++T+  M RL
Sbjct  33   ATNTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKATSVMMVRL  92

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
            + S  L  RE+ AMR CVEEL +++DELR+S+GEM QL G  +E+ M+DIQTWVSAALTD
Sbjct  93   SSSSQLKPREVSAMRVCVEELGDTLDELRKSIGEMGQLSGSSYEVYMSDIQTWVSAALTD  152

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            ++TCTDGF G      VK  VR +I+ +AHLTSNALALIN FA +HG
Sbjct  153  ENTCTDGFGGDDMNGKVKIFVRERILVIAHLTSNALALINHFASIHG  199



>ref|XP_008234384.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=203

 Score =   213 bits (541),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TNTEFI+TSC  T+YP+LC  SLSSHA  I+  P+LMA  AL VTL +A+ST+A M 
Sbjct  35   APKTNTEFIKTSCRATTYPKLCRTSLSSHASTIQTSPKLMAGAALNVTLSSAKSTSATML  94

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHGL  +E+GAMRDC+EELS+SVDEL+ S+ EM   +  DF++ ++D+QTWVSAAL
Sbjct  95   KLSQSHGLKPKEVGAMRDCLEELSDSVDELQSSIAEMGNFKSYDFQLMISDVQTWVSAAL  154

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD++TC++GF G      +KTAVRG+I+ +A LTSNALALINR+A +HG
Sbjct  155  TDENTCSEGFGGNGMNGNLKTAVRGRIVNIAQLTSNALALINRYASVHG  203



>ref|XP_009372896.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TN EF++TSC  T Y +LC  SLSSHA  I+  P+LMA  ALTVTL +A+ST+  M 
Sbjct  34   AQKTNNEFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKSTSIMML  93

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHG+  RE+GAMRDCVEELS+SVD ++ S+ EM   R  DF++ ++D+QTWVSAAL
Sbjct  94   KLSQSHGMKPREVGAMRDCVEELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWVSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGF G +    +KT VRG+I+ +A LTSN+LAL+NR+A +HG
Sbjct  154  TDETTCSDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYASVHG  202



>ref|XP_009370483.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TN EF++TSC  T Y +LC  SLSSHA  I+  P+LMA  ALTVTL +A+ST+  M 
Sbjct  34   AQKTNNEFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKSTSIIML  93

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHG+  RE+GAMRDCVEELS+SVD ++ S+ EM   R  DF++ ++D+QTWVSAAL
Sbjct  94   KLSQSHGMKPREVGAMRDCVEELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWVSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGF G +    +KT VRG+I+ +A LTSN+LAL+NR+A +HG
Sbjct  154  TDETTCSDGFGGNLMNGNLKTIVRGRIVNIAQLTSNSLALVNRYASVHG  202



>ref|XP_002322404.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06531.2| ripening-related family protein [Populus trichocarpa]
Length=195

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++ EFIRTSC TT+YPRLC+ SLS H+R I   P+L+A+ AL VTL +A+ST+  M +L+
Sbjct  30   SSIEFIRTSCSTTTYPRLCYTSLSIHSRTIHTSPKLIANAALNVTLSSAKSTSTMMSKLS  89

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +SHGL  +E+ AM+DCVEELS++V ELRES+ EM  ++  DFE+ ++D++TWVSAA+TD+
Sbjct  90   QSHGLKPKEVSAMKDCVEELSDAVYELRESIDEMDHVKRSDFEVMISDVRTWVSAAMTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
             TC+DGFAG      +K AVRG+IM +A LTSNALAL+N +A L G
Sbjct  150  STCSDGFAGNAMNGNLKRAVRGRIMNIAQLTSNALALVNNYALLDG  195



>ref|XP_004307823.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=199

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TNTEF++TSC  T+YP+LC  SL+S A  I+  P+LMA  AL+VTL +A+ST+  M 
Sbjct  31   APKTNTEFMKTSCSATTYPKLCLTSLASQATAIQTSPKLMASAALSVTLSSAKSTSNLML  90

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
             L+  HG+  RE+ AMRDCVE L +SVDEL+ S+ EM   +  D+EM ++D+QTWVSAAL
Sbjct  91   SLSHGHGMKPREVAAMRDCVEVLGDSVDELQRSISEMGNFKSSDYEMMISDVQTWVSAAL  150

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC DGFAG      +KT VRGKI+ +A LTSNALALINR+A +HG
Sbjct  151  TDESTCADGFAGNGLNGNLKTVVRGKIVTIAQLTSNALALINRYASVHG  199



>gb|EYU24972.1| hypothetical protein MIMGU_mgv1a023170mg [Erythranthe guttata]
Length=187

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 132/173 (76%), Gaps = 0/173 (0%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            +A A G  +T FIRTSC TT+YP LC+ +LS+HA  I+ DP+L+AH AL+V+L TA++T+
Sbjct  15   AAAAGGKPDTRFIRTSCSTTTYPTLCYTALSNHASAIQQDPKLLAHVALSVSLDTARTTS  74

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWV  707
              M R++R  G+T RE GAMRDCVEELS+SV++L  S+ EM ++   +F   M+DIQTWV
Sbjct  75   VDMVRISRRAGITPREAGAMRDCVEELSDSVEQLGRSMSEMNRMNRSNFGRTMSDIQTWV  134

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            SAA+TD+DTC +GFAGK      K+A+R +I+ VAH+TSNALALIN +A +HG
Sbjct  135  SAAMTDEDTCMEGFAGKFMNGAAKSAIRTRIVNVAHMTSNALALINSYAAVHG  187



>ref|XP_006421707.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
 gb|ESR34947.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
Length=196

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEFI+TSC +T+YP LC+ SL+ HA  I+  P+L+AH +L VTL  A+ST+A M ++++
Sbjct  35   STEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSK  94

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            S G+  RE  AM+DC+EELS+SVDELR+S+GEM  ++  +FE+ MNDIQTWVSAALTDD 
Sbjct  95   SPGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDDT  154

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TC+DGF        V   VRG+I+K+AH+TSNALALIN +A LH 
Sbjct  155  TCSDGFEKNTVNGKV---VRGQIVKIAHMTSNALALINSYASLHA  196



>ref|XP_009370516.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TN EF++TSC  T+YP+LC  SLSSHA  I+  P+LMA+ ALTVTL +++ST+  M 
Sbjct  34   AQKTNNEFLKTSCSATTYPKLCLTSLSSHANAIQTSPKLMANEALTVTLASSKSTSIMML  93

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHG+  RE+GAMRDC++ELS+SVD ++ S+ EM   R  DF++ ++D+QTW SAAL
Sbjct  94   KLSQSHGMKPREVGAMRDCIQELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWDSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGF G +    +KT VRG+I+ +A LTSN+LAL+NR+A + G
Sbjct  154  TDETTCSDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYASVQG  202



>ref|XP_010062118.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW90824.1| hypothetical protein EUGRSUZ_A02883 [Eucalyptus grandis]
Length=201

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +T+FIRTSC  T+YP+LCF+SLSSHA  I+  P+L+A TAL VTL+ A+S +  M  L+R
Sbjct  37   STDFIRTSCSKTTYPKLCFSSLSSHAAAIQMSPKLLACTALDVTLKNARSVSVLMVNLSR  96

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            S GL  RE  AM+DC+E L ++VDELR S+ EMK L+ RDF++ ++D+QTW SAALTD+D
Sbjct  97   SQGLKPREAAAMQDCMELLGDAVDELRRSIAEMKDLKERDFKLMISDVQTWASAALTDED  156

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TC+DGFAGK     VKT VR  I+ ++HLTSNALALIN +A LHG
Sbjct  157  TCSDGFAGKEMDGKVKTVVRAWIVTLSHLTSNALALINAYASLHG  201



>gb|KDO65437.1| hypothetical protein CISIN_1g029238mg [Citrus sinensis]
Length=196

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEFI+TSC +T+YP LC+ SL+ HA  I+  P+L+AH +L VTL  A+ST+A M ++++
Sbjct  35   STEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAKAKSTSAVMLKMSK  94

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            S G+  RE  AM+DC+EELS+SVDELR+S+GEM  ++  +FE+ MNDIQTWVSAALTDD 
Sbjct  95   SPGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDDT  154

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TC+DGF        V   VRG+I+K+AH+TSNALALIN +A LH 
Sbjct  155  TCSDGFEKNTVNGKV---VRGQIVKIAHMTSNALALINSYASLHA  196



>ref|XP_002510935.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51537.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=201

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  T+TEFIRTSC TT+YPRLC++SL  HA  I+  P L+A+ AL VTL + +ST+  M 
Sbjct  33   AQTTSTEFIRTSCSTTTYPRLCYSSLKIHASKIQTSPMLLANAALNVTLASTRSTSTMMQ  92

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHG+  RE+ AM+DC++EL++SVDELR+S+ E+ + +G  F + MND+QTWVSAAL
Sbjct  93   KLSKSHGMKPREVSAMQDCMDELTDSVDELRKSIDELGKAQGSKFGLMMNDVQTWVSAAL  152

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGFAG      +KT VR + +K+AHLTSNAL+L+N +A +HG
Sbjct  153  TDESTCSDGFAGSTMNGELKTLVRQQTVKIAHLTSNALSLVNSYASVHG  201



>ref|XP_004307822.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=203

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 125/169 (74%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TNTEFI TSC  T+YP+LC  SLSS A  I+  P+L+A  AL VTL +A+ST+A M 
Sbjct  35   APKTNTEFIETSCGATTYPKLCLASLSSQASVIQRSPKLIACAALNVTLSSAKSTSAMML  94

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            RL+  +G+  RE  AMRDCVE +S+SVDE++ S+ EM   R   FEM ++D+QTWVSAAL
Sbjct  95   RLSHGYGMKPREAAAMRDCVEMVSDSVDEIQRSISEMVNFRSAGFEMMISDVQTWVSAAL  154

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGFAG      +KT VRG+I+K+A LTSNALALINR+A +HG
Sbjct  155  TDESTCSDGFAGNELNGNLKTVVRGRIVKIAQLTSNALALINRYASVHG  203



>ref|XP_006490093.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=196

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEFI+TSC +T+YP LC+ SL+ HA  I+  P+L+AH +L VTL  A+ST+A M ++++
Sbjct  35   STEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKISK  94

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            S G+  RE  AM+DC+EELS+SVDELR+S+GEM  ++  +FE+ MNDIQTWVSAALTD+ 
Sbjct  95   SLGMKPREAEAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDET  154

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TC+DGF        V   VRG+I+K+AH+TSNALALIN +A LH 
Sbjct  155  TCSDGFEKNTVNGKV---VRGQIVKIAHMTSNALALINSYASLHA  196



>ref|NP_201042.2| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAA97200.1| ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 gb|AAO41999.1| putative DC1.2 homolog [Arabidopsis thaliana]
 gb|AED97600.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=203

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF+++SC  T+YPRLCF+SLS+HA  I+  P+LMAH AL +TL +A+ T+A M RL+ S 
Sbjct  42   EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKLMAHAALNITLASAKVTSAMMVRLSNSR  101

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  +E+ AMRDCVEEL ++++ELR+S+GEM QL G ++E+ ++DIQTWVSAALTD +TC
Sbjct  102  -LKPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALTDVNTC  160

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TDGF G+     VK  VRG+I+ +AHLTSNALALIN FA +HG
Sbjct  161  TDGFEGEDMDGKVKVLVRGRILVIAHLTSNALALINHFASIHG  203



>ref|XP_002864788.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41047.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=196

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF+++SC  T+YPRLCF+SLS+HA  I+  P++MAH AL +TL +A++T+A M RL+ S 
Sbjct  35   EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKIMAHAALNITLASAKATSAMMVRLSNSR  94

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  REI AMRDCVEEL ++++ELR+S+GEM +L G ++E+ M+DIQTWVSAALTD +TC
Sbjct  95   -LKPREISAMRDCVEELGDTLEELRKSIGEMCRLSGSNYEVYMSDIQTWVSAALTDVNTC  153

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            T+GF G      VK  VRG+I+ +AHLTSNALALIN FA +HG
Sbjct  154  TEGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFASIHG  196



>gb|AAN60276.1| unknown [Arabidopsis thaliana]
Length=204

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF+++SC  T+YPRLCF+SLS+HA  I+  P+LMAH AL +TL +A+ T+A M RL+ S 
Sbjct  43   EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKLMAHAALNITLASAKVTSAMMVRLSNSR  102

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  +E+ AMRDCVEEL ++++ELR+S+GEM QL G ++E+ ++DIQTWVSAALTD +TC
Sbjct  103  -LKPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALTDVNTC  161

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TDGF G+     VK  VRG+I+ +AHLTSNALALIN FA +HG
Sbjct  162  TDGFEGEDMDGKVKVLVRGRILVIAHLTSNALALINHFASIHG  204



>gb|KFK27963.1| hypothetical protein AALP_AA8G454300 [Arabis alpina]
Length=199

 Score =   204 bits (520),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF++++C  T+YPRLC  SLS+HA  I+  P+LMAH AL +TL +A++T+A M RL+ + 
Sbjct  37   EFVKSACTYTTYPRLCIASLSTHATLIQTSPKLMAHAALNITLASAKATSAMMVRLSSNV  96

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  RE+ AMRDCVEEL ++V+ELR+S+GEM QL   ++E+ ++DIQTWVSAALTD++TC
Sbjct  97   QLKPREVSAMRDCVEELGDTVEELRKSIGEMGQLNSSNYEVYISDIQTWVSAALTDENTC  156

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TDGF G       K  VRG+I+ +AHLTSNALALIN FA +HG
Sbjct  157  TDGFQGDEMNGKAKVFVRGRILFIAHLTSNALALINHFASIHG  199



>ref|XP_008376226.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=202

 Score =   204 bits (520),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TN EF++TSC  T+YP+LC  SLS H+  I+  P+LMA TALTVTL +A+ST+  M 
Sbjct  34   AQKTNNEFMKTSCSATTYPKLCLTSLSRHSSEIQTSPKLMASTALTVTLASAKSTSTMMS  93

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L++SHG+  RE+GAMRDC+EELS+SVD ++ S+ EM      DF++ ++D+QTWVSAAL
Sbjct  94   KLSQSHGMKPREVGAMRDCIEELSDSVDVIQRSIAEMGNFTSSDFQLMISDVQTWVSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC+DGF G      +KT VRG+++ +A LTSNALALINR+A +HG
Sbjct  154  TDETTCSDGFGGNGMNGNLKTVVRGRVVNIAQLTSNALALINRYASVHG  202



>ref|XP_006281048.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
 gb|EOA13946.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
Length=228

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEF+++SC  T+YPRLCF SL++ A  I+  P+LMAH AL +TL +A++T+A M RL+
Sbjct  64   TNTEFVKSSCTFTTYPRLCFTSLATQASLIQTSPKLMAHAALNITLASAKATSAMMVRLS  123

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             +  L  RE+ AMRDCVEEL +++DELR+S+GEM +L   ++E+ M+DIQTWVSAALTD+
Sbjct  124  NTR-LKPREVAAMRDCVEELGDTLDELRKSIGEMCRLSNSNYEVYMSDIQTWVSAALTDE  182

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCT+GF G       K  VRG+I+ +AHLTSNALALIN FA +HG
Sbjct  183  NTCTEGFEGDDMNGKAKVLVRGRILVIAHLTSNALALINHFASIHG  228



>gb|ABK96280.1| unknown [Populus trichocarpa x Populus deltoides]
Length=194

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EFIRTSC TT+YPRLC+ SLS H+R I   P+L+A+ AL VTL +A+ST+  M +L++SH
Sbjct  33   EFIRTSCSTTTYPRLCYTSLSIHSRTIHTSPKLIANAALNVTLSSAKSTSTMMSKLSQSH  92

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
            GL  +E+ AM+DCVEELS++V ELRES+ EM   +  +FE+ ++D++TWVSAA+TD+ TC
Sbjct  93   GLKPKEVSAMKDCVEELSDAVYELRESIDEMGHAKQSNFEVMISDVRTWVSAAMTDESTC  152

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQL  860
            +DGFAG      +K A+RG+IM +A LTSNALAL+N +A +
Sbjct  153  SDGFAGNAMNGNLKRAIRGRIMNIAQLTSNALALVNNYALI  193



>ref|XP_010458855.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEF+++SC  T+YPRLCF SLS+ A  I+  P+LMAH AL +TL +A++T+A M RL+
Sbjct  31   TNTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLS  90

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             S  L  RE  AMRDCVEEL++++DELR+S+GEM +L   ++E+ M+D+QTWVSAALTD+
Sbjct  91   SSR-LNPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCT+GF         K  VRGKI+ VAHLTSNALALIN FA +HG
Sbjct  150  NTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFASIHG  195



>ref|XP_010483948.1| PREDICTED: 21 kDa protein-like isoform X1 [Camelina sativa]
 ref|XP_010483950.1| PREDICTED: 21 kDa protein-like isoform X2 [Camelina sativa]
Length=195

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEF+++SC  T+YPRLCF SLS+ A  I+  P+LMAH AL +TL +A++T+A M RL+
Sbjct  31   TNTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLS  90

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             S  L  RE  AMRDCVEEL++++DELR+S+GEM +L   ++E+ M+D+QTWVSAALTD+
Sbjct  91   SSR-LKPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCT+GF         K  VRGKI+ VAHLTSNALALIN FA +HG
Sbjct  150  NTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFASIHG  195



>ref|XP_011041731.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=197

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L+A A   ++ EFIRTSC TT YP+LC+ SLS H+  I+  P+L+A+ AL VTL +A+ST
Sbjct  24   LAARATPQSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKST  83

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +A M  L++ HGL  RE+ AM DCVEELS++V EL+ S+ EM   +  +F + +ND+QTW
Sbjct  84   SAKMSTLSQRHGLKRREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQTW  143

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            VSAALTD+ TC+DGF G      +KTAVRG+I+ +A LTSNALALI+ ++Q HG
Sbjct  144  VSAALTDESTCSDGFEGNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYSQRHG  197



>ref|XP_010444081.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEF+++SC  T+YPRLCF SLS+ A  I+  P+LMAH AL +TL +A++T+A M RL+
Sbjct  31   TNTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLS  90

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             S  L  RE  AMRDCVEEL++++DELR+S+GEM +L   ++E+ M+D+QTWVSAALTD+
Sbjct  91   SSR-LNPREAAAMRDCVEELADTLDELRKSIGEMCRLSTSNYEVYMSDMQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCT+GF         K  VRGKI+ VAHLTSNALALIN FA +HG
Sbjct  150  NTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFASIHG  195



>ref|XP_002322405.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06532.2| ripening-related family protein [Populus trichocarpa]
Length=197

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++ +FIRTSC TT YP+LC++SLS H+  I+  P+L+A+ AL VTL +A+ST+A M  L+
Sbjct  32   SSIDFIRTSCSTTIYPKLCYSSLSIHSSTIQTSPELLANAALNVTLSSAKSTSAKMSTLS  91

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +SHGL  RE+ AM DCVEEL+++V EL++S+ EM   +  +F M ++D+QTWVSAALTD+
Sbjct  92   QSHGLKPREVSAMEDCVEELTDAVYELKKSIDEMSHAKKSNFRMMISDVQTWVSAALTDE  151

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
             TC+DGF G      +KTAVRGKI+  A LTSNALALIN +A  HG
Sbjct  152  STCSDGFEGNAMNGNLKTAVRGKIVHTAQLTSNALALINNYAFRHG  197



>gb|KEH29361.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            +NT FIR SC +T+YPRLC+ SL  HA FI+ +  L+  TAL VTL +A+ST+A M  L+
Sbjct  32   SNTLFIRNSCSSTTYPRLCYTSLVKHADFIQTNRMLLTGTALNVTLASAKSTSALMSTLS  91

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +  GL  RE  AM+DCVE LS+SVDELR S+ EM +LR  +FE+ M+D+QTWVSAALTD 
Sbjct  92   KGQGLNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFELTMSDVQTWVSAALTDQ  151

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCTDGF        VKT VRG I++VA LTSNALALIN+ +  HG
Sbjct  152  NTCTDGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLSTSHG  197



>ref|XP_008376217.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=202

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  TN EF++TSC  T+Y +LC  SLSSHA  I+  P+LMA TALTVTL + +ST+  M 
Sbjct  34   AQKTNNEFVKTSCSATTYXKLCLTSLSSHASAIQTSPKLMASTALTVTLASTKSTSTMMS  93

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +L +SHG+  RE+GAMRDC+EELS+SVD ++ S+ EM   R  DF+   +D+QTWVSAAL
Sbjct  94   KLXQSHGMKPREVGAMRDCIEELSDSVDAIQRSIAEMGNFRSSDFQXMXSDVQTWVSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TD+ TC DGF G      +KT VRG+++ +A LTSNALALINR+A ++G
Sbjct  154  TDETTCFDGFGGNGMNGNLKTVVRGRVVNIAQLTSNALALINRYASVYG  202



>ref|XP_009370481.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=199

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = +3

Query  339  PKLSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQ  518
            P ++   A  TN EF++TSC  T+YP+LC  SLSS A  I+  P+LMA  AL VTL +A+
Sbjct  24   PSVARNDAQKTNNEFMKTSCSATTYPKLCLASLSSDAGAIQTSPKLMACAALNVTLASAK  83

Query  519  STAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQ  698
            ST+  M +L+ SHG+  +E+ AMRDCVEELS+SV EL+ S+ EM      DF++ ++D+Q
Sbjct  84   STSTMMSKLSHSHGMEPKEVEAMRDCVEELSDSVYELKRSIAEMGSFENSDFQLMISDVQ  143

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TWVSAALTD+ TC+DGF        +KT V G+I+K+A LTSNALALINR+A +HG
Sbjct  144  TWVSAALTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALINRYASVHG  199



>gb|AFK35257.1| unknown [Medicago truncatula]
 gb|KEH29362.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 120/166 (72%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            +NT FIR SC +T+YPRLC+ SL  HA FI+ +  L+  TAL VTL +A+ST+A M  L+
Sbjct  32   SNTLFIRNSCSSTTYPRLCYTSLVKHADFIQTNQMLLTGTALNVTLASAKSTSALMSTLS  91

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +   L  RE  AM+DCVE LS+SVDELR S+ EM +LR  +FE+ M+D+QTWVSAALTD 
Sbjct  92   KGQQLNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFEITMSDVQTWVSAALTDQ  151

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +TCTDGF        VKT VRG I++VA LTSNALALIN+ A  HG
Sbjct  152  NTCTDGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLATSHG  197



>ref|XP_008357027.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=199

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = +3

Query  339  PKLSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQ  518
            P ++   A  TN EF++TSC  T+YP+LC  SLSSHA  I+  P+LMA  AL VTL +A+
Sbjct  24   PSVARNDAQKTNNEFMKTSCSATTYPKLCLASLSSHAGAIQTSPKLMACAALNVTLASAK  83

Query  519  STAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQ  698
            ST+  M +L+ SHG+  +E+GAMRDCVEELS+SV EL+ S+ EM + +  DF++ ++D+Q
Sbjct  84   STSTMMSKLSHSHGMEPKEVGAMRDCVEELSDSVYELKRSIAEMGRFKSSDFQLMISDVQ  143

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TW SAALTD+ TC+DGF        +KT V G+I+K+A LTSNALALIN +A +H
Sbjct  144  TWASAALTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALINIYASVH  198



>gb|AFK49039.1| unknown [Medicago truncatula]
 gb|KEH29367.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FI+ SC +T+YPRLC+ SL  HA  I+ +  L+  TAL VTL +A+ST+A +  L++
Sbjct  33   NTLFIKNSCSSTTYPRLCYTSLVKHADSIQTNHVLLTCTALNVTLASAKSTSAMISTLSK  92

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            S GL  RE  AM+DCVEELS+SVDELR S+GEM +LR  +FE+ M+D+QTWVSAALTD+ 
Sbjct  93   SQGLKPREAAAMKDCVEELSDSVDELRRSIGEMSRLRTSNFELTMSDVQTWVSAALTDES  152

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TCTDGF        V+T VRGKI++VA LTSNALALIN+ A  H
Sbjct  153  TCTDGFQEVNAPGNVQTTVRGKIVQVAQLTSNALALINKLATSH  196



>ref|XP_011010936.1| PREDICTED: 21 kDa protein-like isoform X1 [Populus euphratica]
Length=197

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 0/174 (0%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L+A A   ++ EFIRTSC TT YP+LC+ SLS H+  I+  P+L+A+ AL VTL +A+ST
Sbjct  24   LAARATPQSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKST  83

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +A M  L++ HGL  RE+ AM DCVEELS++V EL+ S+ EM   +  +F + +ND+QTW
Sbjct  84   SAKMSTLSQRHGLKPREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQTW  143

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            VSAALTD+ TC+DGF        +KTAVRG+I+ +A LTSNALALI+ ++Q HG
Sbjct  144  VSAALTDESTCSDGFERNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYSQRHG  197



>ref|XP_009372895.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=199

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 127/176 (72%), Gaps = 0/176 (0%)
 Frame = +3

Query  339  PKLSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQ  518
            P ++   A  TN EF++TSC  T+YP+LC  SLSSHA  I+  P+LMA  AL VTL +A+
Sbjct  24   PSVARNDAQKTNNEFMKTSCSATTYPKLCLTSLSSHAGAIQTSPKLMACAALNVTLASAK  83

Query  519  STAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQ  698
            ST+  M +L+ SHG+  +E+ AMRDCVEELS+SV EL+ S+  M   +  DF++ ++D+Q
Sbjct  84   STSTMMSKLSHSHGMEPKEVEAMRDCVEELSDSVYELKRSIAGMGSFKNSDFQLMISDVQ  143

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TWVSAALTD+ TC+DGF        +KT V G+I+K+A LTSNALALI+R+A +HG
Sbjct  144  TWVSAALTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALIDRYASVHG  199



>emb|CDX86901.1| BnaC03g51710D [Brassica napus]
Length=200

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF+++SC  T+YPRLC  SLS+ +  I+   +L+AH AL +TL +A++T+A M RL+ S 
Sbjct  38   EFVKSSCTFTTYPRLCVTSLSTQSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSSS  97

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  RE+ AMRDCVEEL ++++ELR+S+GEM QL G ++E+ M+DIQTWVSAALT+++TC
Sbjct  98   RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMSDIQTWVSAALTNENTC  157

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            +DGF G      VK  VRG+I+ +AHLTSNALALIN FA +HG
Sbjct  158  SDGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFASIHG  200



>ref|XP_007039951.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24452.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=204

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            N E+I++SC TT+YPRLC+ SLS +A  I   P+L+ HTAL VTL+ ++ST+  M +++R
Sbjct  37   NIEYIKSSCSTTTYPRLCYRSLSIYASKINTSPRLLVHTALNVTLKASKSTSRLMIKISR  96

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
             HGL  R   AM DC+E + +SVDEL++S+GE+  +R  +F + M+DIQTWVSAALTD+D
Sbjct  97   IHGLRPRVAAAMADCIEVMGDSVDELQQSIGELGHIRSSNFSLTMSDIQTWVSAALTDED  156

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGFAGK      KT VR +I+K+AHLTSNALALIN +A
Sbjct  157  TCMDGFAGKAMNGYAKTMVRKRIVKIAHLTSNALALINNYA  197



>ref|XP_009151355.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=198

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF+++ C  T+YPRLC  SLS+ +  I+   +LMAH AL +TL +A++T+A M R++RS 
Sbjct  36   EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRSS  95

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  RE+ AMRDCVEEL ++++ELR+S+GEM QL G ++E+ MNDIQTWVSAALTD+ TC
Sbjct  96   RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTC  155

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             DGF G      VK  VRG+I+ +AHLTSNALALIN FA +H
Sbjct  156  LDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFAYIH  197



>ref|XP_006394407.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
 gb|ESQ31693.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
Length=198

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEF+++SC  T Y RLC  SLS+ A  I+  P+LMAH AL +TL +A++T+  M RL+
Sbjct  33   TNTEFVKSSCNFTQYQRLCVASLSTQASLIQTSPKLMAHAALNITLASAKATSVMMVRLS  92

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            R+  L  RE  AMRDCVEEL ++++ELR+S+GEM QL G ++E+ M+D+QTWVSAALTD 
Sbjct  93   RTSPLKPREASAMRDCVEELGDTLEELRKSIGEMGQLSGSNYELYMSDVQTWVSAALTDV  152

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
             TCTDGF G      VK  VR +I+ +  LTSNALALIN FA +HG
Sbjct  153  TTCTDGFEGDDMNGKVKVLVRRRILVITQLTSNALALINHFASIHG  198



>ref|XP_006421706.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
 gb|ESR34946.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
Length=200

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            A +  FI+TSC +T+YP LC+ SL+ HA  I+  P+L+AH +L VTL  A+ST+A M ++
Sbjct  37   AADRRFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKM  96

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
            ++S G+  RE+ AM+DC+EELS+SVDELR+S+GEM  ++  +FE+ M+DIQTWVSAALTD
Sbjct  97   SKSPGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAALTD  156

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            + TC+DGF        V   VR +I+K+AH+TSNALALIN +A L G
Sbjct  157  ETTCSDGFEKNTVNGKV---VRAQIVKIAHMTSNALALINSYASLRG  200



>ref|XP_010919458.1| PREDICTED: 21 kDa protein [Elaeis guineensis]
Length=208

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNT FIRTSC  T YP LCFNSLSS+A  I+  P  +AH AL+V+L TA+ST+  M R+ 
Sbjct  41   TNTRFIRTSCSATKYPILCFNSLSSYASTIQNSPMKLAHAALSVSLSTARSTSTMMSRMC  100

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             +  +  RE+ A+ DC+E L +SVDEL+ESL EM  +RG++  + +NDIQTWVSAALTDD
Sbjct  101  TAGRMKPREVAAVSDCMENLGDSVDELQESLAEMAHMRGKNMGLTINDIQTWVSAALTDD  160

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALIN  845
            DTC DGFAG      VK AVRG ++KVA LTSNALALIN
Sbjct  161  DTCMDGFAGNAMNGEVKNAVRGHVVKVARLTSNALALIN  199



>ref|XP_002322403.1| ripening-related family protein [Populus trichocarpa]
 gb|EEF06530.1| ripening-related family protein [Populus trichocarpa]
Length=203

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFIRTSC TT+YPRLC+ SLS H+  I+  P+L+A+ AL VTL +A+ST+  +  L+
Sbjct  35   SSTEFIRTSCSTTTYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTMISTLS  94

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            ++H +  RE+ AM+DCVEEL ++V+EL +S+ EM   R  +F+  ++D+QTWVSAALTD+
Sbjct  95   QTHRMKPREVSAMKDCVEELGDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDE  154

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
             TC+DGFAG      +KTAVRG+I+ +A LTSNALALIN +A
Sbjct  155  STCSDGFAGNAMNGNLKTAVRGRIVNIAQLTSNALALINNYA  196



>ref|NP_001236761.1| uncharacterized protein LOC100305537 precursor [Glycine max]
 gb|ACU13268.1| unknown [Glycine max]
 gb|KHN11658.1| 21 kDa protein [Glycine soja]
Length=207

 Score =   197 bits (500),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 122/167 (73%), Gaps = 2/167 (1%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +T FIRTSC +T+YPRLC++SL  HA  I+ +  ++  TAL VTL +A+ST+A M  LA+
Sbjct  41   STVFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGTALNVTLASAKSTSAMMSTLAK  100

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              GL  RE+ AM+DCVEEL++SVDELR S+ EM QL   +FEM M+D++TWVSAALTD+ 
Sbjct  101  RQGLKPREVAAMKDCVEELADSVDELRRSISEMAQLTPSNFEMTMSDVETWVSAALTDES  160

Query  732  TCTDGFAGKVTRRG--VKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TCTDGF       G  VK  VRG+I++VA LTSNALALIN+ A  H 
Sbjct  161  TCTDGFQETAAAGGSNVKNTVRGQILQVAQLTSNALALINQLANSHA  207



>emb|CDY00279.1| BnaA06g21800D [Brassica napus]
Length=198

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EF+++ C  T+YPRLC  SLS+ +  I+   +LMAH AL +TL +A++T+A M R++ S 
Sbjct  36   EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSSS  95

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L  RE+ AMRDCVEEL ++++ELR+S+GEM QL G ++E+ MNDIQTWVSAALTD+ TC
Sbjct  96   RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTC  155

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +DGF G      VK  VRG+I+ +AHLTSNALALIN FA +H
Sbjct  156  SDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFASIH  197



>ref|XP_006490094.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65438.1| hypothetical protein CISIN_1g027094mg [Citrus sinensis]
Length=228

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            A +  FI+TSC +T+YP LC+ SL+ HA  I+  P+L+AH +L VTL  A+ST+A M ++
Sbjct  65   AADRRFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKM  124

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
            ++S G+  RE+ AM+DC+EELS+SVDELR+S+GEM  ++  +FE+ M+DIQTWVSAALTD
Sbjct  125  SKSPGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAALTD  184

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            + TC+DGF        V   VR +I+K+AH+TSNALALIN +A L G
Sbjct  185  ETTCSDGFEKNTVNGKV---VRAQIVKIAHMTSNALALINSYASLRG  228



>emb|CBI24572.3| unnamed protein product [Vitis vinifera]
Length=187

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA   NTEFIRTSC TT YPRLCF SLS+HA  I+  P+L+A TAL+VTL TA+ST++ M
Sbjct  31   AARKDNTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTSSVM  90

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
              L  SHGL  RE+ AM+DCVEELS+SVD+LR+++GEM Q++G +F + MNDIQTWVSAA
Sbjct  91   SNLLLSHGLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWVSAA  150

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKI  800
            LT +DTCTDGFAG      +K AVR +I
Sbjct  151  LTYEDTCTDGFAGNTMDGKLKKAVRTRI  178



>ref|XP_011010937.1| PREDICTED: 21 kDa protein-like isoform X2 [Populus euphratica]
Length=190

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 0/173 (0%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L+A A   ++ EFIRTSC TT YP+LC+ SLS H+  I+  P+L+A+ AL VTL +A+ST
Sbjct  9    LAARATPQSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKST  68

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +A M  L++ HGL  RE+ AM DCVEELS++V EL+ S+ EM   +  +F + +ND+QTW
Sbjct  69   SAKMSTLSQRHGLKPREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQTW  128

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            VSAALTD+ TC+DGF        +KTAVRG+I+ +A LTSNALALI+ ++ L+
Sbjct  129  VSAALTDESTCSDGFERNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYSLLN  181



>gb|KGN57276.1| hypothetical protein Csa_3G176245 [Cucumis sativus]
Length=194

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFI++SC +T+YPRLCF+SLS HA  I+  P+L+A  AL+V+L + +STA  + +L+
Sbjct  30   SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  89

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             SHGL  R++ A+ DC+EELS+SVD L  S+ EM +LRG +F++ M+++QTWVSAALTD+
Sbjct  90   HSHGLPSRDVSALDDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC++GF GK    GVK AVR KI+ +A LTSNAL+LINR A LH
Sbjct  150  TTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIADLH  194



>ref|XP_004148163.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=171

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFI++SC +T+YPRLCF+SLS HA  I+  P+L+A  AL+V+L + +STA  + +L+
Sbjct  7    SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  66

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             SHGL  R++ A+ DC+EELS+SVD L  S+ EM +LRG +F++ M+++QTWVSAALTD+
Sbjct  67   HSHGLPSRDVSALNDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  126

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC++GF GK    GVK AVR KI+ +A LTSNAL+LINR   LH
Sbjct  127  TTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIGDLH  171



>gb|KDP25617.1| hypothetical protein JCGZ_20773 [Jatropha curcas]
Length=204

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNT++I+TSC  T+YPRLC++SLS +A  I+ +P+L+ + AL VTL+  +ST+  M RL+
Sbjct  36   TNTQYIKTSCTNTTYPRLCYHSLSIYASKIKTNPKLLTNIALNVTLKATKSTSRLMKRLS  95

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            R HGL  RE  A+ DCVE + +SV EL+ S+GEM Q  G  F   ++DIQTWVSAALTDD
Sbjct  96   RIHGLKRREAAALVDCVEVVGDSVYELQRSIGEMGQAEGSKFAQVIDDIQTWVSAALTDD  155

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            DTC DGF+     R VK   R  ++K+AHLTSNALALIN FA  H 
Sbjct  156  DTCMDGFSEVSMNRKVKIIARKHLLKIAHLTSNALALINNFASSHN  201



>ref|XP_007039937.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24438.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=202

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT+FI+TSC +T YP +CF +LSS+A  I+A P+L+A TAL+VTL   +S +  M + ++
Sbjct  36   NTQFIKTSCSSTVYPDVCFTTLSSYASEIQASPKLLASTALSVTLNATRSASTTMIKRSK  95

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            S G+  RE  A+ DC+EEL +SV EL+ S+GEM Q  G++F ++MNDI+TWVSAALTD+ 
Sbjct  96   SQGMKPREAEALSDCMEELRDSVYELQRSVGEMDQPGGKNFGLQMNDIETWVSAALTDEH  155

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGF+GK     VK +VR +I+KVAH+TSNALAL+N +A
Sbjct  156  TCMDGFSGKAMNGNVKNSVRSQIVKVAHMTSNALALVNSYA  196



>ref|XP_004148138.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=194

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFI++SC +T+YPRLCF+SLS HA  I+  P+L+A  AL+V+L + +STA  + +L+
Sbjct  30   SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  89

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             SHGL  R++ A+ DC+EELS+SVD L  S+ EM +LRG +F++ M+++QTWVSAALTD+
Sbjct  90   HSHGLPSRDVSALNDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC++GF GK    GVK  VR KI+ +A LTSNAL+LINR A LH
Sbjct  150  TTCSEGFQGKTVNGGVKAEVRTKIVNIAQLTSNALSLINRIADLH  194



>ref|XP_010259038.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=208

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  363  GATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGR  542
            G TNTEFI+TSC+TT YP+LC +SLS +A  I+ DP+L+A  AL V+L  A+ST+  M  
Sbjct  41   GTTNTEFIKTSCDTTMYPKLCISSLSGYASAIQTDPKLLADAALNVSLTNARSTSTMMTE  100

Query  543  LARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALT  722
            L+RSHG+  RE  AM+DCVE + +SVDEL+ S+ EM  L G +   ++++IQTWVSAALT
Sbjct  101  LSRSHGMKPREAAAMQDCVETVGDSVDELQRSMAEMGHLGGPNLAFQISNIQTWVSAALT  160

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            ++DTC DGFAGK     +KT VR +I+ +A LTSNAL+ IN   +
Sbjct  161  NEDTCMDGFAGKAVDGSIKTTVRARILNLAQLTSNALSFINGLVK  205



>ref|XP_009370482.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=199

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 125/176 (71%), Gaps = 0/176 (0%)
 Frame = +3

Query  339  PKLSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQ  518
            P ++   A  TN EF++TSC  T+YP+LC  SLSS A  I+  P+LMA  AL VTL +A+
Sbjct  24   PSVARNDAQKTNNEFMKTSCSATTYPKLCLASLSSDAGAIQTSPKLMACAALNVTLASAK  83

Query  519  STAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQ  698
            ST+  M +L+ SHG+  +E+ AMRDCVEELS+SV +L+ S+  M   +  DF++ ++D+Q
Sbjct  84   STSTMMSKLSHSHGMEPKEVEAMRDCVEELSDSVYDLKRSIAGMGSFKNSDFQLMISDVQ  143

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TWVSAALTD+ TC+DGF        +KT V G+I+K+A LTSNAL LI+R+A +HG
Sbjct  144  TWVSAALTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALPLIDRYASVHG  199



>ref|XP_007131336.1| hypothetical protein PHAVU_011G005300g [Phaseolus vulgaris]
 gb|ESW03330.1| hypothetical protein PHAVU_011G005300g [Phaseolus vulgaris]
Length=203

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 119/163 (73%), Gaps = 1/163 (1%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FIRTSC +T+YP LC++SL  HA  I+ +  ++  TAL VTL +A+STAA M  L +  G
Sbjct  41   FIRTSCSSTTYPTLCYSSLVKHADLIQTNRMVLTGTALNVTLASAKSTAAMMLALGKRQG  100

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTCT  740
            L  RE+ AM+DCVEEL +SVDELR S+ EM  LR  +FEM M+D+QTWVSAALTD+ TC+
Sbjct  101  LKPREVAAMKDCVEELRDSVDELRRSIDEMSHLRTSNFEMTMSDVQTWVSAALTDESTCS  160

Query  741  DGFAGKVT-RRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            DGF    T    +K+ VRG+++++A LTSNALALIN+ A  HG
Sbjct  161  DGFQETATGATNIKSTVRGEVVQIAQLTSNALALINQLANSHG  203



>ref|XP_003635233.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
Length=204

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +3

Query  363  GATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGR  542
            G TNTEFI+ SC  T YPRLC +SLSS+A  I + P+L+A TAL+++L+TA ST+ A+ +
Sbjct  34   GETNTEFIQKSCHVTPYPRLCISSLSSYASKIESSPKLLAVTALSMSLETALSTSTAITK  93

Query  543  LARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALT  722
            L++ HGL   E  A+ DCVE++ +SVDEL+ SL EMK   G +F   MND+QTWVSAALT
Sbjct  94   LSKIHGLQPAEAAAISDCVEQIRDSVDELQRSLQEMKHPGGSNFVFPMNDVQTWVSAALT  153

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DD TC DGFA   ++  V T VR +I+ VA +TSNAL+LIN +A
Sbjct  154  DDHTCMDGFAEIASKGKVHTMVRSRILHVAQMTSNALSLINNYA  197



>ref|XP_002264799.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
Length=201

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNT++I+TSC  T+YP LC++SLS +A  I+  P+ +A TAL+V   +A+ST  +M +L+
Sbjct  32   TNTDYIKTSCLATTYPHLCYDSLSIYANKIQTSPKRLATTALSVASSSARSTLVSMKQLS  91

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            ++HGL  RE  AM DCVEE+++SVDEL +S+GEM    G DFE +M +IQTWVSAALTD+
Sbjct  92   KTHGLKPREASAMIDCVEEVADSVDELHKSIGEMGHAGGPDFEFRMGNIQTWVSAALTDE  151

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TCTDGFAG+     +K  V+  I KVA LTSNALAL+N++A  H
Sbjct  152  ETCTDGFAGRAMNGNLKKTVQRHINKVARLTSNALALVNKYASTH  196



>ref|XP_004506603.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FIRTSC +T+YPRLC+ SL  HA  I+ +  L+  TAL VTL T +ST A M  LA+
Sbjct  34   NTLFIRTSCSSTTYPRLCYASLVKHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSLAK  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
            +  L  RE  AM+DC+E LS+S+DELR+S+ EM +LR  +FE+ M+DIQTWVSAALTD  
Sbjct  94   TRELKPRETAAMKDCIELLSDSIDELRKSINEMSRLRTSNFELTMSDIQTWVSAALTDQS  153

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TC+DGF        +KT V+ KI++VA LTSNALALIN+ A  HG
Sbjct  154  TCSDGFEEINATGDIKTIVQVKIVQVAQLTSNALALINKLATSHG  198



>ref|XP_004160872.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=194

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFIR+SC +T+YPRLCF+SLS HA  I+  P+L+A  AL+V+L + +STA  + +L+
Sbjct  30   SSTEFIRSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILQLS  89

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             SHGL  R++ A+ DC+EELS+SVD L  S+ EM +LRG +F++ M+++QTWVSAALTD+
Sbjct  90   HSHGLPSRDVSALNDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC++GF GK    GVK  VR KI+  A LTSNAL+LINR A LH
Sbjct  150  TTCSEGFQGKTVNGGVKAEVRTKIVNSAQLTSNALSLINRIADLH  194



>ref|XP_008791710.1| PREDICTED: 21 kDa protein [Phoenix dactylifera]
Length=208

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTEFIRTSC  T YP LCF+SLSS+A  I+  P  +A  ALTV+L TA+ST+  M R++
Sbjct  41   TNTEFIRTSCSATEYPILCFDSLSSYASTIQNSPMKLADAALTVSLSTARSTSTMMSRMS  100

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             + G+  RE  A+ DC+E L +SVDEL+ESL EM  +R ++  +++NDIQTWVSAALTDD
Sbjct  101  AAGGMKPREAAAVSDCMENLGDSVDELQESLAEMAHMRSKNMGLQINDIQTWVSAALTDD  160

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DTC DG A       VK AVRG ++ VA LTSNALA IN  +
Sbjct  161  DTCMDGLAANAMNGEVKNAVRGHVVNVAQLTSNALAFINALS  202



>gb|KGN57274.1| hypothetical protein Csa_3G175740 [Cucumis sativus]
Length=236

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFI++SC +T+YPRLCF+SLS HA  I+  P+L+A  AL+V+L + +STA  + +L+
Sbjct  72   SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  131

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             SHGL  R++ A+ DC+EELS+SVD L  S+ EM +LRG +F++ M+++QTWVSAALTD+
Sbjct  132  HSHGLPSRDVSALDDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  191

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC++GF GK    GVK AVR KI+ +A LTSNAL+LINR   LH
Sbjct  192  TTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIGDLH  236



>ref|XP_007039938.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24439.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=200

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T+TEFI+TSC  TSYP LCF + SS+A  I+A P+++A  +L++TL T  S +  +  L+
Sbjct  35   TDTEFIKTSCGATSYPDLCFTTFSSYASEIQASPKILASKSLSLTLNTTLSASKFLTELS  94

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +S  L  +E  A++DCVEE+S+SVDEL+ S+GE+ ++ G+ F  +M+DI+TWVSAALTD+
Sbjct  95   KSQDLEPQEAAALQDCVEEISDSVDELKRSIGEIDEIEGKSFAFRMSDIETWVSAALTDE  154

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DTCTDGF+   T   VK  VR +I KVAH+TS ALA +NR+A
Sbjct  155  DTCTDGFSENATDGDVKATVRSQIEKVAHMTSIALAFVNRYA  196



>gb|KHN32444.1| 21 kDa protein [Glycine soja]
Length=202

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FIRTSC +T+YPRLC++SL  HA  I+ +  ++   AL VTL + +ST+A M  LA+
Sbjct  40   NTLFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAK  99

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              GL  RE+ AM+DCVE+LS++VDELR S+ EM  LR  +FEM M+D+QTWVSAALTD+ 
Sbjct  100  KQGLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDET  159

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGF        +K+ VR  +++VA LTSNALALIN+ A
Sbjct  160  TCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  200



>gb|ACU13418.1| unknown [Glycine max]
Length=202

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FIRTSC +T+YPRLC++SL  HA  I+ +  ++   AL VTL + +ST+A M  LA+
Sbjct  40   NTLFIRTSCSSTTYPRLCYSSLVRHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAK  99

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              GL  RE+ AM+DCVE+LS++VDELR S+ EM  LR  +FEM M+D+QTWVSAALTD+ 
Sbjct  100  KQGLKLREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDET  159

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGF        +K+ VR  +++VA LTSNALALIN+ A
Sbjct  160  TCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  200



>ref|XP_003541070.2| PREDICTED: 21 kDa protein-like [Glycine max]
Length=251

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FIRTSC +T+YPRLC++SL  HA  I+ +  ++   AL VTL + +ST+A M  LA+
Sbjct  89   NTLFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAK  148

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              GL  RE+ AM+DCVE+LS++VDELR S+ EM  LR  +FEM M+D+QTWVSAALTD+ 
Sbjct  149  KQGLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDET  208

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGF        +K+ VR  +++VA LTSNALALIN+ A
Sbjct  209  TCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  249



>ref|XP_002510934.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51536.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=185

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            +GA++ +FI+TSC  T YP LC+ +LS++A  I+ +P  +A+ AL VTL++A+ST+ ++ 
Sbjct  22   SGASD-DFIKTSCGATRYPDLCYQTLSAYASSIQENPLQLANAALNVTLESAESTSNSVL  80

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAAL  719
             + ++H L+ +E GA+ DCVE + +SVDELRESL  M  L G DF MKM++IQTWVSAAL
Sbjct  81   NMLKAHNLSPKEAGAISDCVENMKDSVDELRESLMTMTDLEGPDFNMKMSNIQTWVSAAL  140

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TD+DTC DGF G      VK  +R  I KVA LTSNALALIN+ A
Sbjct  141  TDEDTCMDGFEGNAMNGKVKNTIRSYIEKVAQLTSNALALINKVA  185



>ref|XP_010264195.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=210

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +T+FI+TSC TT YP+LCF++LS +A  I+ DP+L+A TAL+V+L  A+S++A +  L++
Sbjct  44   STDFIKTSCGTTMYPKLCFSTLSGYASAIQTDPKLLADTALSVSLTNARSSSAMISELSK  103

Query  552  SHGLT--HREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
            S   T   RE  AMRDCVE + +SVDEL++S+ EM  L G D   ++++IQTWVSAALT+
Sbjct  104  SQLATMKPREAAAMRDCVEMVGDSVDELQKSMAEMSHLGGPDLGFQISNIQTWVSAALTN  163

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            +DTC DGFAGK     +KT++RG+I+ +A LTSNAL+LIN+ 
Sbjct  164  EDTCMDGFAGKAMDSNIKTSIRGRILNLAQLTSNALSLINKL  205



>gb|AFK37116.1| unknown [Lotus japonicus]
Length=206

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 119/169 (70%), Gaps = 4/169 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +T FI+TSC +T+YPRLCF SL  HA  I+ D   +  TAL VTL  A+ST+A +  +A+
Sbjct  38   STVFIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAK  97

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              G+  RE+ AM+DCVE LS+SVDELR S+ E+  L+  +FEM M+D+QTWVSAALTD+ 
Sbjct  98   KQGMKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALTDES  157

Query  732  TCTDGFAGKVTRRGV----KTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TCTDGF  + +   V    K+AVR ++++ A LTSNALALINR A   G
Sbjct  158  TCTDGFRQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASSRG  206



>ref|XP_004298672.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=197

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            +A ++   NTE+I+TSC  T YP+LC+ SLS +A  I+  P+++AHTAL VTL+  ++T+
Sbjct  25   AAASSSKVNTEYIKTSCSVTLYPKLCYTSLSIYAGKIKTSPKVLAHTALNVTLRATKATS  84

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQ-LRG-RDFEMKMNDIQT  701
            A + R ++ HGL   E+ A  DCVEE+S+++DELR+S+GE+   ++G R F  +++DIQT
Sbjct  85   AVINRCSKVHGLKPIEVAATLDCVEEISDALDELRKSIGELGHAVKGSRSFLFQISDIQT  144

Query  702  WVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            WVSAALTD+DTC DGF        V+T VR +I K+AHLTSNALALIN +A
Sbjct  145  WVSAALTDEDTCLDGFDEPKLNGRVETIVRREITKIAHLTSNALALINNYA  195



>ref|XP_008238630.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=200

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 118/167 (71%), Gaps = 1/167 (1%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A G TNT++I+ SC  T YPRLC++SLS +A  I+ DP+++AHTAL VTL   Q ++  M
Sbjct  27   ATGKTNTQYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIM  86

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQ-LRGRDFEMKMNDIQTWVSA  713
             RL+  HGL   E  A+ DC+EE+ +++DEL++SL E+   LRG +F  +M+DIQTWVSA
Sbjct  87   RRLSEIHGLKPIETAAVHDCMEEIGDAIDELQQSLDELGHVLRGSNFWFQMSDIQTWVSA  146

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            ALTD+DTC DGF     R  V+  VR   + VAHLTSNALALIN +A
Sbjct  147  ALTDEDTCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYA  193



>ref|XP_011010938.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFIRTSC T +YPRLC+ SLS H+  I+  P+L+A+ AL VTL +A+ST+  +  L+
Sbjct  35   SSTEFIRTSCSTATYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTTISTLS  94

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            ++HG+  RE+ AM+DCVEELS++V+EL +S+ EM   R  +F+  ++D+QTWVSAALTD+
Sbjct  95   QTHGMKPREVSAMKDCVEELSDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDE  154

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            +TC+DGFAG      +KT+VRG+I+ +A LTSNALALIN +A
Sbjct  155  NTCSDGFAGNAMNGNLKTSVRGRIVNIARLTSNALALINNYA  196



>ref|XP_006440385.1| hypothetical protein CICLE_v10023344mg [Citrus clementina]
 gb|ESR53625.1| hypothetical protein CICLE_v10023344mg [Citrus clementina]
 gb|KDO37980.1| hypothetical protein CISIN_1g042707mg [Citrus sinensis]
Length=203

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNT+FI+TSC  T+YP LC  +LS +A  I+A P+L+A TAL+V L+TA  T+  M +L+
Sbjct  36   TNTQFIKTSCRVTTYPDLCITTLSGYATKIQASPKLLASTALSVALKTALVTSTTMNKLS  95

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +S GL  RE  A+ DCV++L ++VDEL+ S+ EM +    +F ++MN++QTWVSAALT++
Sbjct  96   KSQGLNPREAAALYDCVDQLRDAVDELQNSISEMGRNERSNFALQMNNVQTWVSAALTNE  155

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQL  860
            DTC DGF+ K     VK  VR +I  VAHLTSN LAL+N +A +
Sbjct  156  DTCMDGFSRKSMNGNVKATVRRQISNVAHLTSNGLALVNSYASI  199



>ref|XP_002263715.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CAN82390.1| hypothetical protein VITISV_030086 [Vitis vinifera]
Length=212

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T+FIRTSC  T YP+LCF +LS++A  I+     +A+ AL V+L+ AQS++  + +L++ 
Sbjct  46   TQFIRTSCGVTMYPKLCFKTLSAYASTIQTSHMELANAALCVSLKGAQSSSNKVLKLSKG  105

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDT  734
             GL+ RE  A+ DC+E + +SVDEL++SL  MK L+G DF+MKM+DI TWVSAALTD+DT
Sbjct  106  QGLSRREAAAITDCIENMQDSVDELQQSLVAMKDLQGPDFQMKMSDIVTWVSAALTDEDT  165

Query  735  CTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            C DGFA    +  +K+ +R  I+ VA LTSNALA+IN+F  + G
Sbjct  166  CMDGFAEHAMKGDLKSTIRSNIVSVAQLTSNALAIINKFLSIQG  209



>ref|XP_011041732.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFIRTSC T +YPRLC+ SLS H+  I+  P+L+A+ AL VTL +A+ST+  +  L+
Sbjct  35   SSTEFIRTSCSTATYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTTISTLS  94

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            ++HG+  RE+ AM+DCVEELS++V+EL +S+ EM   R  +F+  ++D+QTWVSAALTD+
Sbjct  95   QTHGMKPREVSAMKDCVEELSDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDE  154

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            +TC+DGFAG      +KT+VRG+I+ +A LTSNALALIN +A
Sbjct  155  NTCSDGFAGNAMNGNLKTSVRGRIVNIARLTSNALALINYYA  196



>ref|XP_006421708.1| hypothetical protein CICLE_v10007178mg [Citrus clementina]
 gb|ESR34948.1| hypothetical protein CICLE_v10007178mg [Citrus clementina]
Length=209

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            S + +  ++TEFI+TSC  T YP LC+N+LSS+A  I+ +P  +A+ AL+V+L  A+ST+
Sbjct  40   SPVKSNPSSTEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTS  99

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWV  707
            A + +L++   L  RE GA++DCVE   +SVDEL++SL  MK L+G +FE K+ND+QTWV
Sbjct  100  ALVLKLSKGLELRPREAGAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWV  159

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            SAALT++DTC D F G      VK  +RG+I++ + L SNALALIN+  Q
Sbjct  160  SAALTNEDTCMDNFEGNGMNGKVKDTIRGRIVRASQLISNALALINQLNQ  209



>gb|AFK47771.1| unknown [Lotus japonicus]
Length=205

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 117/168 (70%), Gaps = 3/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +T FI+TSC +T+YPRLCF SL  HA  I+ D   +  TAL VTL  A+ST+A +  +A+
Sbjct  38   STVFIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAK  97

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              G+  RE+ AM+DCVE LS+SVDELR S+ E+  L+  +FEM M+D+QTWVSAALTD+ 
Sbjct  98   KQGMKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALTDES  157

Query  732  TCTDGFAGK---VTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            TCTDGF  +         K+AVR ++++ A LTSNALALINR A   G
Sbjct  158  TCTDGFQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASSRG  205



>ref|XP_007131335.1| hypothetical protein PHAVU_011G005200g [Phaseolus vulgaris]
 gb|ESW03329.1| hypothetical protein PHAVU_011G005200g [Phaseolus vulgaris]
Length=204

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FIRTSC +T+YPRLC++SL  HA  I+ +  ++   AL VTL +A+ST+A M  +A+
Sbjct  38   NTVFIRTSCSSTTYPRLCYSSLVKHAELIQTNRVVLTGAALNVTLASAKSTSAVMSAMAK  97

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              GL  RE+ AM+DCVE L+ESV+ELR S+  M  LR  +FEM M+D+QTWVSAALTD+ 
Sbjct  98   RRGLKPREVAAMKDCVEVLNESVEELRRSINGMSDLRRSNFEMTMSDVQTWVSAALTDES  157

Query  732  TCTDGFAG---KVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            TC DGF      +     K+ VRG +++VA LTSNALALIN+ A 
Sbjct  158  TCMDGFEESEMSIDGTNTKSRVRGLVVQVAQLTSNALALINQLAN  202



>gb|KDO65436.1| hypothetical protein CISIN_1g028434mg [Citrus sinensis]
Length=209

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            S + + +++TEFI+TSC  T YP LC+N+LSS+A  I+ +P  +A+ AL+V+L  A+ST+
Sbjct  40   SPVKSNSSSTEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTS  99

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWV  707
            A + +L++   L  RE  A++DCVE   +SVDEL++SL  MK L+G +FE K+ND+QTWV
Sbjct  100  ALVLKLSKGLELRPREASAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWV  159

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            SAALT++DTC D F G      VK  +RG+I++ + L SNALALIN+  Q
Sbjct  160  SAALTNEDTCMDNFEGNGVNGKVKDTIRGRIVRASQLISNALALINQLNQ  209



>ref|XP_006490092.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=209

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            S + + +++TEFI+TSC  T YP LC+N+LSS+A  I+ +P  +A+ AL+V+L  A+ST+
Sbjct  40   SPVKSNSSSTEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTS  99

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWV  707
            A + +L++   L  RE  A++DCVE   +SVDEL++SL  MK L+G +FE K+ND+QTWV
Sbjct  100  ALVLKLSKGLELRPREASAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWV  159

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            SAALT++DTC D F G      VK  +RG+I++ + L SNALALIN+  Q
Sbjct  160  SAALTNEDTCMDNFEGNGMNGKVKDTIRGRIVRASQLISNALALINQLNQ  209



>ref|XP_002264891.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CAN71118.1| hypothetical protein VITISV_041020 [Vitis vinifera]
Length=204

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            EFI+TSC TT+YP+LC +SL S+A  I+  P+++A TAL++ L TA ST+ A+ +L+++ 
Sbjct  39   EFIKTSCRTTTYPQLCTSSLLSYASKIQTSPKILADTALSIALATAHSTSTAITKLSKTQ  98

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTC  737
             L   E  A+RDCVE L +S DEL+ S+ EM+   G+ F ++M+DIQTWVSAALT+DDTC
Sbjct  99   SLKPGEAAAIRDCVEVLGDSEDELQMSIQEMEHPEGKSFGLQMSDIQTWVSAALTNDDTC  158

Query  738  TDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
             D FAG      VKT VRG I+ VA +TS ALALIN +A
Sbjct  159  MDSFAGNAMNGNVKTIVRGYILHVAQMTSVALALINNYA  197



>ref|XP_008387667.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=200

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 115/163 (71%), Gaps = 1/163 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            +NT++IRTSC  T+YPRLC+NSLS +A  I+ +P+ +AHTAL VT+   Q T+  M RL+
Sbjct  29   SNTQYIRTSCSVTNYPRLCYNSLSIYAGKIKTNPKALAHTALNVTIAATQETSVIMRRLS  88

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RGRDFEMKMNDIQTWVSAALTD  725
            + HGL   E  A  DC+EE+ ++VDEL+ S+ E+  + RG +F ++M+DIQTWVS ALTD
Sbjct  89   KIHGLKPIEXAAALDCMEEIGDAVDELQNSIDELSHVXRGSNFWLQMSDIQTWVSXALTD  148

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            +DTC DGF        V+  VR  I+ VAHLT NALALIN +A
Sbjct  149  EDTCMDGFDEHNXSGRVENLVRRYIVNVAHLTCNALALINSYA  191



>ref|XP_007209621.1| hypothetical protein PRUPE_ppa011699mg [Prunus persica]
 gb|EMJ10820.1| hypothetical protein PRUPE_ppa011699mg [Prunus persica]
Length=200

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A G TNT++I+ SC  T YPRLC++SLS +A  I+ DP+++AHTAL VTL   Q ++  M
Sbjct  27   ATGKTNTQYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIM  86

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQ-LRGRDFEMKMNDIQTWVSA  713
             RL+  HGL   E  A+ DC+EE+ +++ EL++SL E+   +RG +F  +M+DIQTWVSA
Sbjct  87   RRLSEIHGLKPIETAAVLDCMEEIGDAILELQQSLDELGHVVRGSNFWFQMSDIQTWVSA  146

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            ALTD+DTC DGF     R  V+  VR   + VAHLTSNALALIN +A
Sbjct  147  ALTDEDTCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYA  193



>ref|XP_010093663.1| 21 kDa protein [Morus notabilis]
 gb|EXB54443.1| 21 kDa protein [Morus notabilis]
Length=222

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 126/179 (70%), Gaps = 14/179 (8%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNT+F++TSC  TSYP LCF +LS HA  I+  P+L+A  AL+ TL+T +S + AM +L+
Sbjct  43   TNTQFVKTSCGATSYPDLCFTTLSCHASQIKRSPKLLATAALSETLKTVRSASTAMSKLS  102

Query  549  RS---HGLTHREIGAMRDCVEELSESVDELRESLGEM------KQLRG-RDFEMKMNDIQ  698
            ++   HGLT R+  A+ DCVEEL +SV+EL+ S+ EM      K+  G  +F ++M+DI+
Sbjct  103  KAKTRHGLTPRDAEALSDCVEELRDSVEELQRSIEEMGVGFRKKENNGTSEFGLRMSDIE  162

Query  699  TWVSAALTDDDTCTDGFAGKV----TRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TWVSAALTD+DTC DGF+ K     +   +K+ VRG IM VAH+T NALAL+N +A LH
Sbjct  163  TWVSAALTDEDTCVDGFSEKFMNGSSGSAIKSNVRGHIMNVAHMTRNALALVNHYALLH  221



>ref|XP_006421710.1| hypothetical protein CICLE_v10005968mg [Citrus clementina]
 gb|ESR34950.1| hypothetical protein CICLE_v10005968mg [Citrus clementina]
Length=193

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG  +T FIR+SC++T+YP LC  SLS++A  I+  P+ +A TAL+V+L  AQS  + +
Sbjct  22   AAGIADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFV  81

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGE---MKQLRGRDFEMKMNDIQTWV  707
             +L +   L HRE  A+ DC++E+ ++VD L +S+ E   M Q +G+DF   M++++TWV
Sbjct  82   TKLRKFRNLKHREYEAIADCLDEMGDTVDRLSKSVQELNHMGQAKGQDFLWHMSNVETWV  141

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            SAALTD++TCTDGF GK     VK++VR +++ VAH+TSNAL+LIN+FA  H
Sbjct  142  SAALTDENTCTDGFGGKALEGKVKSSVRAQVVNVAHVTSNALSLINKFAGKH  193



>ref|XP_002510932.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51534.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=196

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI+ SC TT+YP LC  SLS++A  I+ +P  +  TAL+V+L+ AQST   + +L +  G
Sbjct  33   FIKASCRTTTYPALCIQSLSAYATSIQQNPLQLTQTALSVSLENAQSTRTFVYKLTKFKG  92

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDDD  731
            +  RE+ A++DC+EE+ ++ D L +S  E+K L   +G+DF+  M++++TWVSAALTD++
Sbjct  93   VKPREMAALKDCLEEIDDTADRLSKSYNELKNLGHYKGKDFQWHMSNVETWVSAALTDEN  152

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TCTDGFAGK     +K++++ +I+KVA +TSNAL+LIN++A  H
Sbjct  153  TCTDGFAGKALNGKMKSSIKARIVKVAQVTSNALSLINKYASKH  196



>ref|XP_006490090.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65434.1| hypothetical protein CISIN_1g029436mg [Citrus sinensis]
Length=193

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AAG  +T FIR+SC++T+YP LC  SLS++A  I+  P+ +A TAL+V+L  AQS  + +
Sbjct  22   AAGIADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFV  81

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWV  707
             +L +   L HRE GA+ DC++E+ ++VD L +S+ E+  +   +G+DF   M++++TWV
Sbjct  82   TKLRKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWV  141

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            SAALTD++TCTDGF GK     VK++VR +++ VA +TSNAL+LIN+FA  H
Sbjct  142  SAALTDENTCTDGFGGKALEGKVKSSVRAQVVNVAQVTSNALSLINKFAGKH  193



>gb|EYU24974.1| hypothetical protein MIMGU_mgv1a014119mg [Erythranthe guttata]
Length=200

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 117/169 (69%), Gaps = 3/169 (2%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA  T T FIRTSC  T+YP +C  SL +HA  I+  P+ +  TAL+V+++ AQST   +
Sbjct  29   AAAVTTTSFIRTSCRATTYPSVCVQSLYTHAAAIKKSPKQLVTTALSVSVEKAQSTKTFV  88

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWV  707
              L R  GL  RE  A++DC+EE+S+SVD L +S+ E+K+L   RG +F   M+++QTWV
Sbjct  89   SMLTRFRGLKPREYAAIKDCLEEVSDSVDRLSKSVKELKKLGPARGPEFVWHMSNLQTWV  148

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            SAALTDD TC DGF+G+     +K+++R ++  VA +TSNALAL NRFA
Sbjct  149  SAALTDDSTCMDGFSGRAMNGRIKSSIRARMTHVAQVTSNALALCNRFA  197



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   184 bits (468),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            ++TEFI++SC +T+YPRLCF+SLS HA  I+  P+L+A  AL+V+L + +STA  + +L+
Sbjct  30   SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  89

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
             SHGL  R++ A+ DC+EELS+SVD L  S+ EM +LRG +F++ M+++QTWVSAALTD+
Sbjct  90   HSHGLPSRDVSALDDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQL  860
             TC++GF GK    GVK  VR KI+ +A LTSNAL+LIN+ A L
Sbjct  150  TTCSEGFQGKTVNGGVKGVVRTKIVNIAQLTSNALSLINQIANL  193



>ref|XP_008796852.1| PREDICTED: 21 kDa protein-like [Phoenix dactylifera]
Length=209

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = +3

Query  363  GATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGR  542
            G  + EF+RTSC  T YP LCFNSL+++A  I+  P  +A  AL+V+L  A+  +  M R
Sbjct  40   GTISLEFVRTSCNKTKYPSLCFNSLAAYATTIQTSPVQLAEAALSVSLSYARGASTMMTR  99

Query  543  LARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALT  722
            L++  G++ RE  AM DC+E L +SV+ELR+SL  M  L G++ ++++NDIQTWVS+ALT
Sbjct  100  LSKGKGMSSREAEAMSDCIESLGDSVEELRQSLKAMGHLSGKNLKLRVNDIQTWVSSALT  159

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            D+ TC DGFA    + G ++A+R  I+KVA LTSNAL++I+  A + 
Sbjct  160  DESTCMDGFANDGMKAGGRSALRSHIVKVAQLTSNALSIISGLAAIE  206



>ref|XP_006385730.1| hypothetical protein POPTR_0003s11310g, partial [Populus trichocarpa]
 gb|ERP63527.1| hypothetical protein POPTR_0003s11310g, partial [Populus trichocarpa]
Length=198

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSC-ETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            SA      N  +I+TSC +TT YP+LC+++L+ +A  I+ +P+L+A+TAL V+L++  ST
Sbjct  22   SATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSLKSTNST  81

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +  M R +++ GL  R + AM DCVEE+ ++V EL+ S+ EM    G +F M MND++TW
Sbjct  82   SRLMKRASKTPGLDPRVLAAMLDCVEEVGDAVYELQRSIEEMDHAGGSNFSMVMNDVETW  141

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            VSAALTDDDTC DGFA     + VKT V+  + ++A LTSNALAL+NR+A 
Sbjct  142  VSAALTDDDTCMDGFAEGAVNKKVKTTVKRHLGRIARLTSNALALVNRYAS  192



>ref|XP_010933727.1| PREDICTED: 21 kDa protein [Elaeis guineensis]
Length=211

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 116/164 (71%), Gaps = 0/164 (0%)
 Frame = +3

Query  363  GATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGR  542
            G    EFIRTSC  T YP LCFNSL+++A  I+  P  +A  +L+V+L  A+ T+  M R
Sbjct  41   GTIGLEFIRTSCNKTKYPSLCFNSLAAYAPTIQTSPTQLAEASLSVSLSYARGTSTMMTR  100

Query  543  LARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALT  722
            L++  G++ RE  A+ DC+E L +SVDEL++SL  M  L G + ++++NDIQTWVS+ALT
Sbjct  101  LSKDKGMSSREAEAISDCMESLGDSVDELKQSLKVMGHLSGENLKLRVNDIQTWVSSALT  160

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            D++TC DGFA    + G ++ VRG+I++VA LTSNAL++I+  A
Sbjct  161  DENTCLDGFASNGMKTGERSNVRGRIVRVAQLTSNALSIISGLA  204



>ref|XP_009603391.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=194

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 118/166 (71%), Gaps = 3/166 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T  I++SC+ T+YP +CF SL+  A  I+  PQ +A TAL+V+L  AQST A + +L + 
Sbjct  29   TSSIKSSCKFTTYPEVCFTSLAGFAPAIKRSPQQLAQTALSVSLDRAQSTQAFVNKLCKF  88

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
             GL  RE  A++DCVE++S+++  + +S+ E+K +   RG+DFE  M++I+TW+SAALTD
Sbjct  89   KGLKPREYAALKDCVEQMSDTISRISKSVKELKNMGSARGKDFEWHMSNIETWISAALTD  148

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC DGFAGK     +K +VR ++  VA +TSNALALIN+FA  H
Sbjct  149  ENTCGDGFAGKTFNGRIKASVRARVTHVAQVTSNALALINQFAAKH  194



>ref|XP_006357906.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=192

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            A  T FI++SC+ T+YP++C +SL+ +A  I+  PQ +A TAL+V+L  AQS    + +L
Sbjct  24   ALPTSFIKSSCKITTYPQVCVSSLAVYAPTIKRSPQQLAQTALSVSLDRAQSAHTFITKL  83

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAA  716
             +  GL  RE  A++DC+EE+SE++D + +S+ E+K +   RG+DF+ +M++I+TW+SAA
Sbjct  84   NKFKGLKQREYAALKDCLEEMSETIDRINKSVKELKSMGSARGKDFQWRMSNIETWISAA  143

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +T+++TC DGFAG+     +KT++R ++  V  +TSNALALIN+FA  H
Sbjct  144  ITNENTCADGFAGRALNGRIKTSIRARVTHVTQVTSNALALINQFAAKH  192



>ref|XP_008234382.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=194

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  ++T FI++SC  T+YP++C  SLSS+A  I+  P+ +A  AL+V+L  AQ     + 
Sbjct  24   ATTSDTNFIKSSCSATTYPQVCIQSLSSYATSIQQSPRQLAQAALSVSLTRAQKAKTFVT  83

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVS  710
            +LA+  GL  RE GA++DC+EE+ ++VD L +S+ E+K +   +G+DF   M++++TWVS
Sbjct  84   KLAKFKGLKAREYGALKDCLEEMGDTVDRLSKSVQELKNMGKSKGQDFVWHMSNVETWVS  143

Query  711  AALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            AALTDD+TC DGF+GK     +K ++R +++ VA  TSNALAL NRFA  H
Sbjct  144  AALTDDNTCLDGFSGKALDGKIKASIRAQVLNVAQCTSNALALCNRFASKH  194



>ref|XP_006838616.1| hypothetical protein AMTR_s00002p00229990 [Amborella trichopoda]
 gb|ERN01185.1| hypothetical protein AMTR_s00002p00229990 [Amborella trichopoda]
Length=205

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            A  T FIR SC TT YP LC +SLS++A  IR  P+ +AH AL+V+L  A+ST++ + +L
Sbjct  41   AAATSFIRASCRTTRYPALCVSSLSAYAPAIRTSPRQLAHAALSVSLTRAKSTSSFVAKL  100

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
              + GL  RE GA+RDCVE + +SVDE++ SLGEM ++ G  F+ +M+++QTWVSAALT+
Sbjct  101  GTTRGLRAREAGAIRDCVENMGDSVDEIKRSLGEMGRVGGGTFQWRMSNVQTWVSAALTN  160

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            ++TC DGF G       K+AV+ +I  VA +TSNALAL+N  A
Sbjct  161  ENTCVDGFQG--VDGSTKSAVKARIQNVAQVTSNALALVNCLA  201



>ref|XP_008364822.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=214

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FIR SC  T+YP +C  SLSS+A  I+  P+ +A  AL+V+L  AQS    + +LA+  G
Sbjct  51   FIRDSCSATTYPEVCIKSLSSYASSIKQSPRQLAQAALSVSLTKAQSAKTFVTKLAKFKG  110

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDDD  731
            L  RE GA++DC+EE+ ++VD L +S+ E+K +   +G+DF   M++++TWVSAALTDD+
Sbjct  111  LKSREYGAIKDCMEEIGDTVDRLSKSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  170

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TC DGF+GK     +K+AVR +++ VA  TSNAL+L NRFA  H
Sbjct  171  TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFAGKH  214



>ref|XP_009151354.1| PREDICTED: 21 kDa protein [Brassica rapa]
 emb|CDY00278.1| BnaA06g21790D [Brassica napus]
Length=204

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 126/179 (70%), Gaps = 8/179 (4%)
 Frame = +3

Query  348  SAMAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQS  521
            +A+ AGA+N    FI++SC+TT+YP +CF+SLS++A  I+  P+ +A TAL VTL  AQS
Sbjct  27   TALRAGASNKAVNFIQSSCKTTTYPAVCFHSLSAYANAIQTSPKRLAETALAVTLSRAQS  86

Query  522  TAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----RDFEMKM  686
            T   + RL R  GL  REI A++DCVEE+++++D L +S+ EMK L G       F   M
Sbjct  87   TKLFVSRLTRFKGLKKREIEAIKDCVEEINDTIDRLTKSVQEMK-LCGSAKNQEQFAFHM  145

Query  687  NDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++ QTW SAALTD++TC+DGF+G+V    +K +VR +I+ V H TSNAL+LIN FA+ +
Sbjct  146  SNAQTWTSAALTDENTCSDGFSGRVMDGRIKNSVRARIVNVGHETSNALSLINAFAKKY  204



>ref|XP_009362111.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=201

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 117/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            +NT++I+ SC  T+YP+LC+NSLS +A  I+ +P+++A TAL VT+   Q T   M RL+
Sbjct  30   SNTQYIKRSCSVTTYPKLCYNSLSIYAGKIKTNPKVLARTALNVTIAATQETYVTMKRLS  89

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RGRDFEMKMNDIQTWVSAALTD  725
            ++HGL   E  A  DCVEE+ ++V+E+++S+ E   + RG +F ++M+DIQTWVSAALTD
Sbjct  90   KTHGLNPIEAAAALDCVEEIGDAVEEVQKSIDEFGHVARGSNFWVQMSDIQTWVSAALTD  149

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            +DTC DGF        V++ VR  I+ VAHLTSNALALIN +A
Sbjct  150  EDTCMDGFDEHHMSGRVESLVRRYIVNVAHLTSNALALINSYA  192



>ref|XP_007220475.1| hypothetical protein PRUPE_ppa011831mg [Prunus persica]
 gb|EMJ21674.1| hypothetical protein PRUPE_ppa011831mg [Prunus persica]
Length=194

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  ++T FI++SC  T+YP++C  SLSS+A  I+  P+ +A  AL+V+L  AQ     + 
Sbjct  24   ATTSDTNFIKSSCSATTYPQVCIQSLSSYATSIQQSPRQLAQAALSVSLTRAQKAKTFVT  83

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVS  710
            +LA+  GL  RE GA++DC+EE+ ++VD L +S+ E+K +   +G+DF   M++++TWVS
Sbjct  84   KLAKFKGLKAREYGAVKDCLEEMGDTVDRLSKSVQELKNMGKSKGQDFVWHMSNVETWVS  143

Query  711  AALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            AALTDD+TC DGF+GK     +K ++R +++ VA  TSNALAL NRFA  H
Sbjct  144  AALTDDNTCLDGFSGKALDGKIKASIRAQVLNVAQCTSNALALCNRFASKH  194



>ref|XP_009370484.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=194

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 115/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI  SC  T+YP +C  SLSS+A  I+ +P+ +A  AL+V+L+ AQS    + +LA+  
Sbjct  30   NFISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLKKAQSAKTFVTKLAKFK  89

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDD  728
            GL  RE GA++DC+EE+ ++VD L  S+ E+K +   +G+DF   M++++TWVSAALTDD
Sbjct  90   GLKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDD  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC DGF+GK     +K+AVR +++ VA  TSNAL+L NRFA  H
Sbjct  150  NTCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFAGKH  194



>ref|XP_009372897.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=194

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 114/165 (69%), Gaps = 3/165 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI  SC  T+YP +C  SLSS+A  I+ +P+ +A  AL+V+L  AQS    + RLA+  
Sbjct  30   NFISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLTKAQSAKTFVTRLAKFK  89

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDD  728
            GL  RE GA++DC+EE+ ++VD L  S+ E+K +   +G+DF   M++++TWVSAALTDD
Sbjct  90   GLKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDD  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC DGF+GK     +K+AVR +++ VA  TSNAL+L NRFA  H
Sbjct  150  NTCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFAGKH  194



>ref|XP_008376261.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=194

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI TSC  T+YP++C  SLSS+A  I+  P+ +A  AL+V+L  A+S    + +LA+  
Sbjct  30   NFIETSCRATTYPQVCIQSLSSYANSIQQSPRQLAQAALSVSLTKAKSAKTFVTKLAKFK  89

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDD  728
            GL  RE GA++DC+EE+ +SVD + +S+ E+K +   +G+DF   M++++TWVSAALTDD
Sbjct  90   GLKSREYGAIKDCLEEMGDSVDRMSKSVTELKNMGKSKGQDFLWHMSNVETWVSAALTDD  149

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC DGF+GK     +K++VR +++ VA  TSNALAL NRFA  H
Sbjct  150  NTCLDGFSGKALNGKIKSSVRAQVLNVAQCTSNALALCNRFAGNH  194



>emb|CDX86904.1| BnaC03g51740D [Brassica napus]
Length=204

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 127/186 (68%), Gaps = 12/186 (6%)
 Frame = +3

Query  339  PKLSAMAA----GATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTV  500
            P L+A  A    G +N    FI++SC+TT+YP +CF+SLS++A  I+  P+ +A TAL V
Sbjct  20   PALTAATAASRAGTSNKAVNFIQSSCKTTTYPAVCFHSLSAYANAIQTSPKRLAETALAV  79

Query  501  TLQTAQSTAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----  665
            TL  AQST   + RL R  GL  RE+ A++DCVEE+++++D L +S+ EMK L G     
Sbjct  80   TLSRAQSTKLFVSRLTRFKGLKKREVEAIKDCVEEINDTIDRLTKSVQEMK-LCGSAKNQ  138

Query  666  RDFEMKMNDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALIN  845
              F   M++ QTW SAALTD++TC+DGF+G+VT   +K +VR +I+ V H TSNAL+LIN
Sbjct  139  EQFAFHMSNAQTWTSAALTDENTCSDGFSGRVTDGRIKNSVRARIVNVGHETSNALSLIN  198

Query  846  RFAQLH  863
             FA+ +
Sbjct  199  AFAKKY  204



>gb|KFK27962.1| hypothetical protein AALP_AA8G453900 [Arabis alpina]
Length=198

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = +3

Query  339  PKLSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQ  518
            P+L+   A      F++ SC+TTSYP +C NSLSS+A  I+  P+ +A TAL VTL+ AQ
Sbjct  20   PELTVATAATPAVNFVQASCKTTSYPTVCVNSLSSYANAIQTSPKRLAETALAVTLKRAQ  79

Query  519  STAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGR-DFEMKM  686
            ST   + RL R  GL  RE+ A++DCVEE+++++D L +S+ E+K     +G+ DF   M
Sbjct  80   STKLFVSRLTRFKGLKKREVEAIKDCVEEINDTIDRLTKSVQELKLCGMAKGKEDFYFHM  139

Query  687  NDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            ++ QTW SAALTD++TC+DGF+G+V    +K +VR +I+ V   TSNAL+LIN F +
Sbjct  140  SNAQTWTSAALTDENTCSDGFSGRVMDGRIKNSVRARIVHVGQETSNALSLINAFGK  196



>ref|XP_007039940.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24441.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=201

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 110/162 (68%), Gaps = 2/162 (1%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            NT FIRTSC  T YP LCF + S +   IR  P+L+A TAL++   T +ST  A   L++
Sbjct  37   NTRFIRTSCRATLYPNLCFTTFSRYTTRIRGSPRLLASTALSMAFNTTRSTTKAFINLSK  96

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RGRDFEMKMNDIQTWVSAALTDD  728
              GL   E  A+RDCVE+L +SVDEL++S+  M    RG DF  +M+D+QTWVSAALT+D
Sbjct  97   HRGLERSEAAALRDCVEQLGDSVDELKDSISAMSPPRRGDDFRSRMSDLQTWVSAALTND  156

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DTC  GF  K  +R  KT VR +++KVAHLTS ALA +NR+A
Sbjct  157  DTCMGGFPRKAMKRDFKT-VRRQVVKVAHLTSIALAFVNRYA  197



>ref|XP_009374505.1| PREDICTED: 21 kDa protein [Pyrus x bretschneideri]
Length=195

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI TSC  T+YP++C  SLSS+A  I+  P+ +A  +L+V+L  A+S    + +LA+  G
Sbjct  32   FIETSCRATTYPQVCIQSLSSYATSIQQSPRQLAQASLSVSLTRAKSAKTFVTKLAKFKG  91

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDDD  731
            L  RE GA++DC+EE+ +SVD L +S+ E+K +   +G+DF   M++++TWVSAALTDD+
Sbjct  92   LKSREYGAIKDCLEEMGDSVDRLSKSVTELKDMGKSKGQDFLWHMSNVETWVSAALTDDN  151

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TC DGF+GK     +K++VR +++ VA  TSNALAL NRFA  H
Sbjct  152  TCLDGFSGKALNGKIKSSVRAQVLNVAQCTSNALALCNRFAGKH  195



>ref|XP_006440386.1| hypothetical protein CICLE_v10022313mg [Citrus clementina]
 gb|ESR53626.1| hypothetical protein CICLE_v10022313mg [Citrus clementina]
 gb|KDO48402.1| hypothetical protein CISIN_1g028904mg [Citrus sinensis]
Length=202

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = +3

Query  342  KLSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQS  521
             L++  +  +N E+IRTSC  T Y RLC+ SLS +A  I+++P+ +A+TAL +TL+  +S
Sbjct  23   NLASNPSDNSNIEYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKS  82

Query  522  TAAAMGRLARSHGLTHREI-GAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQ  698
            T+  M +++R  G+  RE  GA+ DC+E + +S+DEL++S+ E+  +R  +F + M D+Q
Sbjct  83   TSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLTMGDVQ  142

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TWVSAALT +DTC DG  G+      KT +R  I+KVAHLTSNALALIN +A
Sbjct  143  TWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINSYA  194



>gb|KDP22408.1| hypothetical protein JCGZ_26239 [Jatropha curcas]
Length=186

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIR-ADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            +FI++SC  T YP LC+ +LS++A  I+  +P  +A+ AL VTL++A++T+  + ++ ++
Sbjct  25   DFIKSSCLVTRYPDLCYQTLSAYATSIQDNNPTQLANAALNVTLKSAEATSNMVSKMLKA  84

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDT  734
            H L  +E  A++DCVE + +SVDE+++SL  M  L G DFEMKM++IQTWVSAALTD+DT
Sbjct  85   HNLMPKEAAAIKDCVETMRDSVDEIKQSLLVMSDLEGPDFEMKMSNIQTWVSAALTDEDT  144

Query  735  CTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            C DGF G      VK  +R  + +V+ LTSNALALIN+ A
Sbjct  145  CMDGFQGNAMNGKVKLKIRQYVERVSQLTSNALALINKVA  184



>ref|XP_010426179.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=201

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = +3

Query  354  MAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            +AAGA+     F+++SC+ T+YP +C NSLSS+A  I+  P+ +A TALTVT+  AQST 
Sbjct  26   VAAGASKRAINFVQSSCKATTYPTVCVNSLSSYANSIQTSPRRLAETALTVTVSQAQSTK  85

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDI  695
              + RLAR  GL  RE+ A+RDC+EE++++VD L +S+ EMK     +GRD F   M++ 
Sbjct  86   LFVSRLARFKGLKKREVQAIRDCLEEINDTVDRLTKSIQEMKMCGSAKGRDQFWFHMSNA  145

Query  696  QTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            QTW SAALT+ +TC+DGFAG++    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  146  QTWTSAALTNANTCSDGFAGRIMDGRIKNSVRSRIVNLGRGTSNALALINAFAKKY  201



>ref|XP_002304431.2| hypothetical protein POPTR_0003s20640g [Populus trichocarpa]
 gb|EEE79410.2| hypothetical protein POPTR_0003s20640g [Populus trichocarpa]
Length=203

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSC-ETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            SA      N  +I+TSC +TT YP+LC+++L+ +A  I+ +P+L+A+TAL V+L++  ST
Sbjct  27   SATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSLKSTNST  86

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +  M R +++ GL  R + AM DCVEE+ ++V EL+ S+ EM    G +F M MND+ TW
Sbjct  87   SRLMKRASKTPGLDPRVLAAMLDCVEEVGDAVYELQRSIEEMDHAGGSNFSMVMNDVVTW  146

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            VSA+LTDDDTC DGFA     + VKT V+  + ++A LTSNALAL+NR+A 
Sbjct  147  VSASLTDDDTCMDGFAEGAVNKKVKTTVKRHLGRIARLTSNALALVNRYAS  197



>ref|NP_001268141.1| ripening-related protein-like precursor [Vitis vinifera]
 emb|CAB85625.1| putative ripening-related protein [Vitis vinifera]
 emb|CAN79279.1| hypothetical protein VITISV_005237 [Vitis vinifera]
 emb|CBI24569.3| unnamed protein product [Vitis vinifera]
 gb|AGB13718.1| putative pectin methylesterase inhibitor [Vitis vinifera]
Length=198

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            AA + +T FI+  C  T YP LC  SLS +A  I+  P+ +AHTALTV+L  AQS  A +
Sbjct  27   AANSGSTSFIKAKCSATRYPALCVQSLSVYASTIQKSPKQLAHTALTVSLAKAQSAKAFV  86

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWV  707
             +L +  G+  RE+ A++DC+EE+++S+D L  S+ E+++    +G+DF   M+++ TWV
Sbjct  87   SKLGKIKGMKARELEAVQDCLEEMNDSIDRLSRSVQELEEAGKSKGQDFLWHMSNVDTWV  146

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            SAALTDD+TC DGFAG+     VK ++RG ++ VA +TSNALAL+N+FA
Sbjct  147  SAALTDDNTCVDGFAGRALDGRVKASIRGWLVTVAQVTSNALALVNQFA  195



>ref|XP_004307821.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=193

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +3

Query  357  AAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAM  536
            A+  T + FI+TSC  T+YP LC  SLSS++  I+  P+ +A TAL+V+L  AQ   + +
Sbjct  21   ASTTTASNFIKTSCSATTYPDLCVQSLSSYSNAIQQSPRQLAQTALSVSLTRAQYAKSFV  80

Query  537  GRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL----RGRDFEMKMNDIQTW  704
             +L +  GL+H+E  A+ DC+EE+ +SVD L +S+ E+K++    +G+DF   M++++TW
Sbjct  81   TKLTKFKGLSHKEYEAIDDCLEEMGDSVDRLSKSVDELKKMGKSSKGQDFIWHMSNVETW  140

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            VSAALTDD+TC DGF+GK     +K ++R +++ VA +TSNALAL N FA
Sbjct  141  VSAALTDDNTCLDGFSGKAMDGKIKASIRAQVLNVAKVTSNALALCNHFA  190



>gb|KDP25618.1| hypothetical protein JCGZ_20774 [Jatropha curcas]
Length=205

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNT++++ SC  T+YP LC++SLS +AR I+ +P+ +A+ AL VTL   +S +  +  L 
Sbjct  32   TNTQYVQASCSNTTYPELCYSSLSCYARKIQRNPKTLAYVALNVTLTATKSASEFIKTLY  91

Query  549  RS--HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALT  722
             +  HGL  +E  AM DCVE   E+VDEL  S+G+M + RG + +  +NDIQTWVSAALT
Sbjct  92   NNKLHGLKPKEAAAMADCVELADEAVDELERSIGKMGRARGSNSDPVINDIQTWVSAALT  151

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            DD+TC DGF+G V    VK+ V   + +VA LTS ALAL+NRFA   G
Sbjct  152  DDNTCMDGFSGDVLDGEVKSIVLKNMTQVAQLTSVALALVNRFASSKG  199



>ref|XP_010503338.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=201

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = +3

Query  354  MAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            +AAGA+     F+++SC+ T+YP +C NSLS +A  I+  P+ +A TALTVT+  AQST 
Sbjct  26   VAAGASKRAINFVQSSCKATTYPTVCVNSLSVYANSIQTSPRRLAETALTVTVSQAQSTK  85

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDI  695
              + RLAR  GL  RE+ A+RDC+EE++++VD L +S+ EMK     +GRD F   M++ 
Sbjct  86   LFVSRLARFKGLKKREVQAIRDCLEEINDTVDRLTKSIQEMKMCGSAKGRDQFWFHMSNA  145

Query  696  QTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            QTW SAALT+ +TC+DGFAG++    +K +VR +I+ +   TSNALALIN FAQ +
Sbjct  146  QTWTSAALTNANTCSDGFAGRIMDGRIKNSVRSRIVNLGRGTSNALALINAFAQKY  201



>ref|XP_011101127.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=205

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            + FIRTSC+ T+YP +C  SLS++A  I   P+ +  TAL+V+++ A+ST A + +L + 
Sbjct  40   SSFIRTSCKATTYPAVCVESLSAYASTIHKSPRQLVMTALSVSVKRAESTKAFVAKLTKF  99

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
            HGL  RE  A++DC+EE+S+SVD L +S+ E+K++   RG +F   M+++QTWVSAALTD
Sbjct  100  HGLKPRERSALKDCLEEVSDSVDRLSKSVRELKKMGRARGPEFAWHMSNLQTWVSAALTD  159

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            + TC DGFAG+     +KT++R ++  VA +TSNALAL N+FA
Sbjct  160  ESTCMDGFAGRAVNGRIKTSIRARMTNVAQVTSNALALCNKFA  202



>ref|XP_009401795.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=209

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEFIR SC  T YP LCF+SLSS+A  IR  P  +A  AL+V+L  A+S +AAM R   
Sbjct  43   STEFIRASCAATMYPDLCFSSLSSYASTIRTSPVQLADVALSVSLAGARSASAAMSRSIA  102

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDD  731
              G+  R   A++DC+E + +SVDELRESL  M  + GR+   ++N IQTWVSAALTD+D
Sbjct  103  GRGMAPRVAAAVKDCLETMGDSVDELRESLAAMGHVAGRNAAYQINSIQTWVSAALTDED  162

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGFA       VK  VR  ++ VA L+SNALAL+N  A
Sbjct  163  TCVDGFASGAMDGEVKNMVRSHVVYVAQLSSNALALVNGLA  203



>ref|XP_010515044.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=199

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +3

Query  354  MAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAA  533
            +AA      F+++SC+ T+YP +C NSLSS+A  I+  P+ +A TALTVT+  AQST   
Sbjct  26   VAASKRAINFVQSSCKATTYPTVCVNSLSSYANSIQTSPRRLAETALTVTVSQAQSTKLF  85

Query  534  MGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDIQT  701
            + RLAR  GL  RE+ A+RDC+EE++++VD L +S+ EMK     +GRD F   M++ QT
Sbjct  86   VSRLARFKGLRKREVQAIRDCLEEINDTVDRLTKSIQEMKMCGSAKGRDQFWFHMSNAQT  145

Query  702  WVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            W SAALT+ +TC+DGFAG++    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  146  WTSAALTNANTCSDGFAGRIMDGRIKNSVRSRIVNLGRGTSNALALINAFAKKY  199



>ref|XP_002864786.1| hypothetical protein ARALYDRAFT_496412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41045.1| hypothetical protein ARALYDRAFT_496412 [Arabidopsis lyrata subsp. 
lyrata]
Length=202

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 126/185 (68%), Gaps = 10/185 (5%)
 Frame = +3

Query  339  PKLSAMAA----GATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTV  500
            P+L+A  A    GA+     FI++SC+TT+YP LC +SLS +A  I+  P+ +A TAL V
Sbjct  18   PELTAATAASQTGASKKAINFIQSSCKTTTYPALCVHSLSVYANDIQTSPKRLAETALAV  77

Query  501  TLQTAQSTAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD  671
            TL  AQST   + RL R  GL  RE+ A++DCVEE++++VD L +S+ E+K     R +D
Sbjct  78   TLNRAQSTKLFVSRLTRMKGLKKREVEAVKDCVEEINDTVDRLTKSVQELKLCGSARDQD  137

Query  672  -FEMKMNDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINR  848
             F   M++ QTW SAALTD++TC+DGF+G+V    +K +VR +IM V H TSNAL+LIN 
Sbjct  138  QFAYHMSNAQTWTSAALTDENTCSDGFSGRVMDGRIKNSVRARIMNVGHETSNALSLINA  197

Query  849  FAQLH  863
            FA+ +
Sbjct  198  FAKTY  202



>gb|KFK34035.1| hypothetical protein AALP_AA5G093500 [Arabis alpina]
Length=201

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI+ SC++T+YP +CFNSLS +A  I+  P+ +A TALTVTL  AQST   + RLAR  
Sbjct  36   NFIQASCKSTTYPTVCFNSLSGYANSIQTSPRRLAETALTVTLTQAQSTKLFVSRLARFK  95

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDIQTWVSAALTD  725
            GL  RE+ A+RDC+EE++++VD L +S+ E+K     +GRD F   M++ QTW SAALT+
Sbjct  96   GLKKREVQAIRDCIEEINDTVDRLTKSVQEVKMCGSAKGRDQFWFHMSNAQTWTSAALTN  155

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             +TC+DGFAG++    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  156  ANTCSDGFAGQIMDGRIKNSVRTRIVNLGRGTSNALALINAFAKKY  201



>ref|XP_009618650.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=191

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  T T FI+ SC+ T+YP LC  SLS +A+ I+   + +  TAL+V+L  AQST   + 
Sbjct  21   AADTATSFIKNSCKPTTYPDLCVASLSGYAQTIKNSQEQLIKTALSVSLDRAQSTKGFVS  80

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVS  710
            +L +  GL  RE  A++DCVEE S+SVD L +S+ E+K++   RG+DF   +++++TWVS
Sbjct  81   KLLKFKGLKPREYEAIKDCVEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVETWVS  140

Query  711  AALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            AA+TD++TCTDGFAG+     +K ++R +I  +A +TSNALALIN++A  H
Sbjct  141  AAITDENTCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYAAKH  191



>ref|XP_006291874.1| hypothetical protein CARUB_v10018051mg [Capsella rubella]
 gb|EOA24772.1| hypothetical protein CARUB_v10018051mg [Capsella rubella]
Length=199

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 6/178 (3%)
 Frame = +3

Query  348  SAMAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQS  521
            +A+  GA+     F++ SC+ T+YP +C NSL+S+A  I+  P+ +A TALTVT+  AQS
Sbjct  22   AAVTVGASKRAVNFVQASCKATTYPTVCVNSLTSYANSIQTSPRRLAETALTVTVSQAQS  81

Query  522  TAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMN  689
            T   + RLAR  GL  RE+ A+RDCVEE++++VD L +S+ EMK     +GRD F   M+
Sbjct  82   TKLFVSRLARFKGLKKREVQAIRDCVEEINDTVDRLTKSVHEMKMCGSAKGRDQFWFHMS  141

Query  690  DIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            + QTW SAALT+ +TC+DGFAG+V    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  142  NAQTWTSAALTNANTCSDGFAGRVMDGRIKNSVRSRIVNLGRGTSNALALINAFAKKY  199



>ref|XP_010035020.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW46287.1| hypothetical protein EUGRSUZ_K00154 [Eucalyptus grandis]
Length=222

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 114/170 (67%), Gaps = 2/170 (1%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            S      + TEFI+TSC  T YP +C+ +LS +A  I+  P+ MA+ AL VTL  A S +
Sbjct  52   SGFDPSPSYTEFIKTSCGFTIYPDVCYQTLSPYASTIQTSPKEMANAALLVTLDGALSAS  111

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWV  707
              + RL+ + GL+ RE  A+ DCVE +S+SVDE+R+SL  MK L G +FE  M+D++TWV
Sbjct  112  NMVSRLSNAGGLSKREARAVIDCVETMSDSVDEIRQSLVAMKTLDGPEFETNMSDMRTWV  171

Query  708  SAALTDDDTCTDGFA--GKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            SAALTD+DTC DGF   G    + V+  +R  I++VA LTSNALALINR 
Sbjct  172  SAALTDEDTCMDGFQERGISNNKKVEGPIRSSIVRVAQLTSNALALINRL  221



>ref|XP_009796710.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=191

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A  T T FI+ SC+ T+YP LC  SLS +A  I+   + +  TAL+V+L  AQST   + 
Sbjct  21   AADTATSFIKNSCKPTTYPDLCVASLSGYAPTIKNSQEQLIKTALSVSLDRAQSTKGFVS  80

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVS  710
            +L +  GL  RE  A++DC+EE S+SVD L +S+ E+K++   RG+DF   +++++TWVS
Sbjct  81   KLLKFKGLKPREYAAIKDCIEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVETWVS  140

Query  711  AALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            AA+TD++TCTDGFAG+     +K ++R +I  +A +TSNALALIN++A  H
Sbjct  141  AAITDENTCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYAAKH  191



>gb|AFK45022.1| unknown [Lotus japonicus]
Length=189

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 113/168 (67%), Gaps = 2/168 (1%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            A  T FI++SC TT YP LC  SLS++A  I+ DP  +  TAL++TL   QST A + R 
Sbjct  22   ANPTNFIKSSCSTTQYPTLCVESLSAYATTIQQDPHQLVQTALSLTLNRTQSTKAFVSRC  81

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQ--LRGRDFEMKMNDIQTWVSAAL  719
                GL  +E  A+ DC EE+S+SVD L  SL E+K   ++G DF   +++++TWVS+AL
Sbjct  82   KNFRGLKPKEYAALHDCSEEISDSVDRLSRSLKELKMCTIKGEDFTWHISNVETWVSSAL  141

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC+DGFAG      +KT++R +++ +A +TSNAL+L+N++A  H
Sbjct  142  TDESTCSDGFAGNAMNGKIKTSIRARMVNIAQVTSNALSLVNQYAANH  189



>ref|XP_007218408.1| hypothetical protein PRUPE_ppa011478mg [Prunus persica]
 gb|EMJ19607.1| hypothetical protein PRUPE_ppa011478mg [Prunus persica]
Length=208

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 117/171 (68%), Gaps = 2/171 (1%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L+  ++  T   +++T+C TT+YP +C+ SLSS+A  +++DPQ +   AL+VTL+ A++ 
Sbjct  36   LATSSSSQTYKTYVKTACNTTTYPLICYKSLSSYASKVKSDPQKLCTYALSVTLKAAKNA  95

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL--RGRDFEMKMNDIQ  698
            ++ + +L ++ GLT  E G ++DC+E + +S+DEL++S+  M  L   G D +++++DI+
Sbjct  96   SSVVSKLYKNTGLTPSEKGVVKDCIENIKDSIDELKQSVSSMSNLGVSGSDVQLQLDDIK  155

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            TWVSA +TDD TCTDGF G      VKTA+R  I+  A L SNAL+LI+  
Sbjct  156  TWVSAVITDDATCTDGFDGVKVSAAVKTAIRNSIVNAARLASNALSLIDSL  206



>gb|KCW77718.1| hypothetical protein EUGRSUZ_D02018 [Eucalyptus grandis]
Length=212

 Score =   166 bits (420),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI +SC  T YP LC + L+++ R I+     +A  AL V+L  A+S A+ M +L+R+
Sbjct  39   TSFIVSSCRATRYPALCVHCLAAYGRAIQRSDHHLAQAALIVSLARARSAASFMSKLSRA  98

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR--GRDFEMKMNDIQTWVSAALTDD  728
              +  RE+ AMRDCVE + ++VD L +S+ E+ + R  GRDF   M++++TWVSAALTD+
Sbjct  99   RRIKLRELRAMRDCVENMGDTVDRLADSVRELGRSRYVGRDFAWHMSNVETWVSAALTDE  158

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TCTDGF G+V   GVK AVRG+++ VA +TSNALAL+NR+A  H
Sbjct  159  NTCTDGFGGRVMDGGVKVAVRGRVVDVARVTSNALALVNRYASRH  203



>ref|XP_003598239.1| 21 kDa protein [Medicago truncatula]
 gb|AES68490.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
 gb|AFK36590.1| unknown [Medicago truncatula]
Length=187

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A +T T FI++SC TTSYP LC  SLS +A  I+ DP  +  TAL+++L   QST   + 
Sbjct  18   ATSTPTNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKGFVT  77

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSA  713
            +     GL  RE  A+ DCVEE+++SVD L  SL E+K  +++G DF   +++++TWVS+
Sbjct  78   KCKSFKGLKPREYAALHDCVEEITDSVDRLSRSLKELKLCKIQGEDFSWHISNVETWVSS  137

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ALTD+ TC+DGF GK     +K ++R +++ VA +TSNAL+LIN++A  H
Sbjct  138  ALTDESTCSDGFGGKALDGRMKASIRSRMVNVAQVTSNALSLINQYATKH  187



>ref|XP_009149923.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=202

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 122/177 (69%), Gaps = 6/177 (3%)
 Frame = +3

Query  351  AMAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            A AAG +     FI+ SC++T+YP +CF+SLS +A  I+  PQ +A TALTVT+  AQST
Sbjct  26   AAAAGTSKRAVNFIQASCKSTTYPTVCFSSLSGYANSIQTSPQRLAETALTVTVSQAQST  85

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD-FEMKMND  692
               + RLAR  GL  RE+ A+RDC+EE+S++VD L +S+ E+K   + +GRD F   M++
Sbjct  86   KVFVSRLARFKGLKKREVQAIRDCIEEISDTVDRLTKSVQEVKMCGRAKGRDQFWFHMSN  145

Query  693  IQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             QTW SAALT+  TC+DGFA ++    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  146  AQTWTSAALTNAITCSDGFARRIMDGRIKNSVRARIVNLGRGTSNALALINAFAKKY  202



>ref|XP_004147611.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=215

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTE++RTSC TTSYPRLC+NSLS +A  I+ +P+ +A  AL V L  A+S+AA+M RLA
Sbjct  42   TNTEYVRTSCSTTSYPRLCYNSLSVYAGKIKTNPKTLALAALHVNLAAARSSAASMRRLA  101

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            ++ GL  R+  A+ DCVEE+ +SV EL+ ++ E+ + RG DF   ++DI+TWVS+ALTD+
Sbjct  102  KTRGLRRRDASAISDCVEEVGDSVFELQRAIRELGRPRGYDFMGLISDIETWVSSALTDE  161

Query  729  DTCTDGFAG-KVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            +TC +GF G +V    VK  VR  I++VAHLTSN+LALIN +A
Sbjct  162  ETCMEGFGGRRVNGVSVKAKVRRHIVRVAHLTSNSLALINSYA  204



>emb|CDY70789.1| BnaCnng69780D [Brassica napus]
Length=202

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (69%), Gaps = 6/178 (3%)
 Frame = +3

Query  348  SAMAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQS  521
            SA  AG +     FI+ SC++T+YP +CF+SLS +A  I+  PQ +A TALTVT+  AQS
Sbjct  25   SAAPAGTSKRAVNFIQASCKSTTYPTVCFSSLSGYANSIQTSPQRLAETALTVTVNQAQS  84

Query  522  TAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD-FEMKMN  689
            T   + RLAR  GL  RE+ A+RDC+EE+S++VD L +S+ E+K   + +GRD F   M+
Sbjct  85   TKVFVSRLARFKGLKKREVQAIRDCIEEISDTVDRLTKSVQEVKMCGRAKGRDQFWFHMS  144

Query  690  DIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            + QTW SAALT+  TC+DGFA ++    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  145  NAQTWTSAALTNAITCSDGFARRIMDGRIKNSVRARIVNLGRGTSNALALINAFAKKY  202



>ref|XP_010053423.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
Length=225

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI +SC  T YP LC + L+++ R I+     +A  AL V+L  A+S A+ M +L+R+
Sbjct  52   TSFIVSSCRATRYPALCVHCLAAYGRAIQRSDHHLAQAALIVSLARARSAASFMSKLSRA  111

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR--GRDFEMKMNDIQTWVSAALTDD  728
              +  RE+ AMRDCVE + ++VD L +S+ E+ + R  GRDF   M++++TWVSAALTD+
Sbjct  112  RRIKLRELRAMRDCVENMGDTVDRLADSVRELGRSRYVGRDFAWHMSNVETWVSAALTDE  171

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TCTDGF G+V   GVK AVRG+++ VA +TSNALAL+NR+A  H
Sbjct  172  NTCTDGFGGRVMDGGVKVAVRGRVVDVARVTSNALALVNRYASRH  216



>ref|XP_010259039.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=197

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            + M   +++T+FI+TSC  T YP +C  SL+ +A  I+  P+ +A TAL V+L  A+ST 
Sbjct  18   AGMVESSSSTDFIKTSCGATRYPTVCVESLAVYANAIQQSPRQLAQTALKVSLDRAKSTK  77

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RG--RDFEMKMNDIQ  698
              + ++ R HGL  R+  A++DCV+ +  SVD L  S+ E+ Q+ RG  +DF   M+++Q
Sbjct  78   VFVSKMTRMHGLKGRQYQAVKDCVDTMGNSVDRLSRSIQELGQISRGSSQDFMWHMSNVQ  137

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TWVSAALTD++TC DGFAG+     VK A+RGKI+ VA +TSNALAL+N++A
Sbjct  138  TWVSAALTDENTCMDGFAGRGMDGHVKMAIRGKIVNVAQVTSNALALVNQYA  189



>ref|XP_004162668.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=229

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TNTE++RTSC TTSYPRLC+NSLS +A  I+ +P+ +A  AL V L  A+S+AA+M RLA
Sbjct  56   TNTEYVRTSCSTTSYPRLCYNSLSVYAGKIKTNPKTLALAALHVNLAAARSSAASMRRLA  115

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            ++ GL  R+  A+ DCVEE+ +SV EL+ ++ E+ + RG DF   ++DI+TWVS+ALTD+
Sbjct  116  KTRGLRRRDASAISDCVEEVGDSVFELQRAIRELGRPRGYDFMGLISDIETWVSSALTDE  175

Query  729  DTCTDGFAG-KVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            +TC +GF G +V    VK  VR  I++VAHLTSN+LALIN +A
Sbjct  176  ETCMEGFGGRRVNGVSVKAKVRRHIVRVAHLTSNSLALINSYA  218



>emb|CDX99059.1| BnaA06g17500D [Brassica napus]
Length=202

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = +3

Query  357  AAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAA  530
            AAG +     FI+ SC++T+YP +CF+SLS +A  I+  PQ +A TALTVT+  AQST  
Sbjct  28   AAGTSKRAVNFIQASCKSTTYPTVCFSSLSGYANSIQTSPQRLAETALTVTVSQAQSTKV  87

Query  531  AMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD-FEMKMNDIQ  698
             + RLAR  GL  RE+ A+RDC+EE+S++VD L +S+ E+K   + +GRD F   M++ Q
Sbjct  88   FVSRLARFKGLKKREVQAIRDCIEEISDTVDRLTKSVQEVKMCGRAKGRDQFWFHMSNAQ  147

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TW SAALT+  TC+DGFA ++    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  148  TWTSAALTNAITCSDGFARRIMDGRIKNSVRARIVNLGRGTSNALALINAFAKKY  202



>ref|XP_009799203.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=393

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 119/166 (72%), Gaps = 3/166 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC+ T+YP +C  SL+ +A  I+  PQ +A TAL+V+L  AQST A + +L + 
Sbjct  228  TSFIKSSCKFTTYPVVCVTSLAGYAPAIKRSPQQLAQTALSVSLTRAQSTQAFVNKLRKF  287

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
             GL  RE  A++DCVE++S+++D + +S+ E+K +   RG+DF+  M++I+TW+SAALTD
Sbjct  288  KGLKPREYAALKDCVEQMSDTIDRISKSVKELKNMGSARGKDFQWHMSNIETWISAALTD  347

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC DGF+GK     +K ++R ++  V  +TSNALALIN+FA  H
Sbjct  348  ENTCGDGFSGKALNGRIKASIRARVTHVTQVTSNALALINQFAAKH  393



>emb|CAA72315.1| putative 21kD protein precursor [Medicago sativa subsp. x varia]
Length=187

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A +T T FI++SC TTSYP LC  SLS +A  I+ DP  +  TAL+++L   QST + + 
Sbjct  18   ATSTPTNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKSFVT  77

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSA  713
            +     GL  RE  A+ DCVEE+++SVD LR SL  +K  +++G DF   +++++TWVS+
Sbjct  78   KCKSFRGLKPREYAALHDCVEEITDSVDRLRRSLKGLKLCKIQGEDFSWHISNVETWVSS  137

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ALTD+ TC+DGF GK     +K ++R +++ VA +TSNAL+LIN++A  H
Sbjct  138  ALTDESTCSDGFGGKALDGRMKASIRSRMVNVAQVTSNALSLINQYATKH  187



>ref|NP_201041.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 gb|AAK62409.1|AF386964_1 ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 dbj|BAA97199.1| ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 gb|AAL66944.1| ripening-related protein-like [Arabidopsis thaliana]
 gb|AED97599.1| invertase/pectin methylesterase inhibitor family protein / DC 
1.2-like protein [Arabidopsis thaliana]
Length=202

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 117/165 (71%), Gaps = 4/165 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC+TT+YP LC +SLS +A  I+  P+ +A TA+ VTL  AQST   + RL R  G
Sbjct  38   FIQSSCKTTTYPALCVHSLSVYANDIQTSPKRLAETAIAVTLSRAQSTKLFVSRLTRMKG  97

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD-FEMKMNDIQTWVSAALTDD  728
            L  RE+ A++DCVEE++++VD L +S+ E+K     + +D F   M++ QTW SAALTD+
Sbjct  98   LKKREVEAIKDCVEEMNDTVDRLTKSVQELKLCGSAKDQDQFAYHMSNAQTWTSAALTDE  157

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC+DGF+G+V    +K +VR +IM V H TSNAL+LIN FA+ +
Sbjct  158  NTCSDGFSGRVMDGRIKNSVRARIMNVGHETSNALSLINAFAKTY  202



>ref|NP_001238450.1| uncharacterized protein LOC100305900 precursor [Glycine max]
 gb|ACU13809.1| unknown [Glycine max]
 gb|KHN43825.1| 21 kDa protein [Glycine soja]
Length=193

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            +T T FI++SC TT YP LC  SLS +A  I+ DP  +  TAL+++L   ++T   + + 
Sbjct  26   STPTNFIKSSCSTTQYPALCIQSLSVYASTIQQDPHELVQTALSLSLNHTEATKTFVAKC  85

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSAAL  719
             +  GL  RE  A++DC EE+S+SVD L  SL E+K  +++G DF   +++++TWVS+AL
Sbjct  86   NKFRGLKPREYAALKDCAEEISDSVDRLSRSLKELKLCKVKGEDFTWHISNVETWVSSAL  145

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC DGFAGK     +K A+R +++ VA +TSNAL+LIN++A  H
Sbjct  146  TDESTCGDGFAGKALNGKIKEAIRARMVNVAQVTSNALSLINQYAAQH  193



>gb|KDP22406.1| hypothetical protein JCGZ_26237 [Jatropha curcas]
Length=195

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI+ SC TT+YP LC  SLS++A  I+ +P+ +   AL+V++  AQ+T   + +L +  G
Sbjct  35   FIKASCRTTTYPVLCVESLSAYAPSIQQNPRQLTEAALSVSVARAQATRTFVYKLTKFKG  94

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTCT  740
            +  RE  A+ DC+EE+ ++VD L +S  E+K  +G+DF+  M++++TWVSAALTD++TC 
Sbjct  95   VKPREREAINDCLEEIDDTVDRLSKSFKELKSAKGKDFQWHMSNVETWVSAALTDENTCV  154

Query  741  DGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            DGFAGK     +K +++ +I+ VA +TSNAL+LIN+FA  H
Sbjct  155  DGFAGKALDGKLKASIKARIVNVAQVTSNALSLINKFASKH  195



>gb|ACJ83861.1| unknown [Medicago truncatula]
 gb|AFK36719.1| unknown [Medicago truncatula]
Length=186

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A +T T FI++SC TTSYP LC  SLS++A  I+ DP  +  TAL+++L   QST   + 
Sbjct  17   ATSTPTNFIKSSCSTTSYPTLCVESLSAYATTIQQDPHQLVQTALSLSLNKTQSTKGFVT  76

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSA  713
            +  +  GL  RE  A+ DCVEE+++SVD L  SL E+K  ++ G+DF   ++++QTWVS+
Sbjct  77   KCKKFKGLKPREYAALHDCVEEITDSVDRLSRSLKELKLCKINGQDFNWHISNVQTWVSS  136

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TD  TC+DGF GK     +KT++R +++ +A +TSNAL+LIN++   H
Sbjct  137  SMTDASTCSDGFGGKALDGRMKTSIRSRMVNLAQVTSNALSLINQYGTNH  186



>ref|XP_004309057.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=191

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            +++T+C +T+YP++C+ SLSS+A  I+++PQ +   AL+VTL+ A+++A+ + +LA+  G
Sbjct  33   YVKTACNSTTYPQICYKSLSSYATSIKSNPQKLCSYALSVTLKAAKTSASTVSKLAKKKG  92

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDTCT  740
            +T  E G +  C+E + +SVDEL++S+  MK L G D + ++++I+TWVSA+LTD+DTCT
Sbjct  93   ITKAEAGVVGACIETIKDSVDELKQSVTAMKNLGGADMQYQLDNIKTWVSASLTDEDTCT  152

Query  741  DGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            DGF  +     VK  +R  I+ VA L SNAL+LI+  
Sbjct  153  DGFDEQKVSTAVKNTIRKSILTVARLASNALSLIDNL  189



>gb|EYU43527.1| hypothetical protein MIMGU_mgv1a024700mg, partial [Erythranthe 
guttata]
Length=181

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FIR+SC  T+YP +C  SLS HA  I+  P  +  TALTV++  A+S    +  LA+  G
Sbjct  18   FIRSSCRATTYPAVCVQSLSPHATTIQKSPGQLVTTALTVSVDRARSAKVFVANLAKFRG  77

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDDD  731
            L  RE  A++DC+EE+++SVD L +S+ E+K +   RG D+   M+++QTWVSAALTDD 
Sbjct  78   LKPRERAALKDCLEEVTDSVDRLSKSIQELKNMGRARGPDYVWHMSNLQTWVSAALTDDS  137

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGFAG+V    VKT++R ++  VA +TSNALAL N+FA
Sbjct  138  TCMDGFAGRVMEGRVKTSIRARMTNVAQVTSNALALCNKFA  178



>ref|XP_010093661.1| 21 kDa protein [Morus notabilis]
 gb|EXB54441.1| 21 kDa protein [Morus notabilis]
Length=215

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            +T T FIR SC+TTSYP LC   LS+ A+ IR   + +A TALTV+L  A+S +  + ++
Sbjct  38   STPTNFIRASCKTTSYPALCVQCLSAFAKQIRRSERQLAQTALTVSLSRARSASHLVSKM  97

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
             R  G+  RE  A++DC+E + ++V+ L  S+ E+ Q+  +DF   M+++QTWVSAALTD
Sbjct  98   TRVRGIKPREYQAVKDCIENMGDTVNTLSHSVRELGQVGQQDFVWHMSNVQTWVSAALTD  157

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC DGF+G+     VK A+R +++ VA +TSNALAL+NRFA  H
Sbjct  158  ENTCLDGFSGRFMDGNVKAAIRRRVVNVAQVTSNALALVNRFASKH  203



>ref|XP_004240754.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=192

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            A  T FI+TSC+ T+YP++C  SLS +A  I+  PQ +A TAL+V+L  AQS    + +L
Sbjct  24   ALPTSFIKTSCKITTYPQVCVTSLSVYAPTIKRSPQQLAQTALSVSLDRAQSAHTFITKL  83

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAA  716
             +  GL  RE  A++DC+EE+SE+VD + +S+ E+ ++   RG+D +  M++IQTW+SAA
Sbjct  84   NKFKGLKSREYAALKDCLEEMSETVDRINKSVKELTRMGSSRGKDVQWHMSNIQTWMSAA  143

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +T++++C DGFAG+     +K+++R ++  V  +TSNALALIN+F   H
Sbjct  144  ITNENSCADGFAGRALNGRIKSSIRARVTHVTQVTSNALALINQFPAKH  192



>ref|XP_010259198.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=209

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 116/162 (72%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T T FIR+SC  T YP+LC+ SLSS+A  I+     +A+TAL V++++A+ST+A +  ++
Sbjct  41   TITNFIRSSCGVTLYPQLCYTSLSSYASSIQTSHMKLAYTALNVSMKSARSTSAMISNMS  100

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +   L  RE  A++DCVEE+ +S+DEL++SL +M++L G + + +M++I+TWVSAAL++D
Sbjct  101  QRQDLMPREAAAVKDCVEEIGDSIDELKQSLRQMQELGGSNVDFQMSNIKTWVSAALSND  160

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DTC DG         VK  ++ +I++VA LTSNALALIN  +
Sbjct  161  DTCVDGIDSNDINAEVKNTIKKRILRVAKLTSNALALINNLS  202



>gb|AAM67138.1| ripening-related protein-like [Arabidopsis thaliana]
Length=202

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 116/165 (70%), Gaps = 4/165 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC+TT+YP LC +SLS +A  I+  P+ +A TA+ VTL  AQST   + RL R  G
Sbjct  38   FIQSSCKTTTYPALCVHSLSVYANDIQTSPKRLAETAIAVTLSRAQSTKLFVSRLTRMKG  97

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD-FEMKMNDIQTWVSAALTDD  728
            L  RE+ A++DCVEE++++VD L  S+ E+K     + +D F   M++ QTW SAALTD+
Sbjct  98   LKKREVEAIKDCVEEMNDTVDRLTRSVQELKLCGSAKDQDQFAYHMSNAQTWTSAALTDE  157

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC+DGF+G+V    +K +VR +IM V H TSNAL+LIN FA+ +
Sbjct  158  NTCSDGFSGRVMDGRIKNSVRARIMNVGHETSNALSLINAFAKTY  202



>ref|XP_003598238.1| 21 kDa protein [Medicago truncatula]
 gb|AES68489.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=186

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A +T T FI++SC TTSYP LC  SLS +A  I+ DP  +  TAL+++L   QST   + 
Sbjct  17   ATSTPTNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKGFVT  76

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSA  713
            +  +  GL  RE  A+ DCVEE+++SVD L  SL E+K  ++ G+DF   ++++QTWVS+
Sbjct  77   KCKKFKGLKPREYAALHDCVEEITDSVDRLSRSLKELKLCKINGQDFNWHISNVQTWVSS  136

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TD  TC+DGF GK     +KT++R +++ +A +TSNAL+LIN++   H
Sbjct  137  SMTDASTCSDGFGGKALDGRMKTSIRSRMVNLAQVTSNALSLINQYGTNH  186



>ref|XP_009362113.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=205

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  351  AMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAA  530
            A+A  +++T+FI+ SC TT YP LC  SL+++A  IR   + +A TALTV+L   +S A+
Sbjct  30   AVARHSSSTDFIKASCRTTQYPALCVQSLAAYASAIRQSERQLAETALTVSLARVRSAAS  89

Query  531  AMGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQT  701
             + +L R  G+  RE  A++DC+E + +SVD L +S   LG M +  G+DF   M++++T
Sbjct  90   FVTKLTRVRGIKPRECRAVKDCIENMGDSVDRLGQSVRELGHMGRAFGQDFMWHMSNVET  149

Query  702  WVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            WVSAALTD+ TC DGF+G+     +K A+R ++  VAH+TSNALAL+NRFA  H
Sbjct  150  WVSAALTDEGTCLDGFSGRFMDGNIKNAIRRRVNNVAHVTSNALALVNRFAAKH  203



>ref|XP_004499663.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=192

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 112/170 (66%), Gaps = 2/170 (1%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A +T T FI++SC TT YP LC  SLS++A  I+ DP  +  TA++++L   QST   + 
Sbjct  23   AISTPTNFIKSSCSTTQYPTLCVESLSTYASTIQQDPHQLVQTAISISLNKTQSTKDFVT  82

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSA  713
            R     GL  RE  A+ DC EE+S+SVD L  SL E+K  +++G DF   +++++TWVS+
Sbjct  83   RCKNIKGLKAREYAALHDCSEEISDSVDRLIRSLKELKICKIKGEDFNWHISNVETWVSS  142

Query  714  ALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ALTD+ TC DGF GK     +K ++R +++ VA +TSNALAL+N +A  H
Sbjct  143  ALTDETTCGDGFGGKALNGRIKASIRSRMINVAQVTSNALALVNHYASNH  192



>ref|XP_006281134.1| hypothetical protein CARUB_v10027165mg [Capsella rubella]
 gb|EOA14032.1| hypothetical protein CARUB_v10027165mg [Capsella rubella]
Length=199

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 115/165 (70%), Gaps = 4/165 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI +SC+TT+YP LC  SLS +A  I+  P+ +A TAL VTL  AQST   + R+ R  G
Sbjct  35   FIESSCKTTTYPALCVQSLSVYANNIQTSPKRLAETALAVTLSRAQSTKLFVSRITRMKG  94

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRD-FEMKMNDIQTWVSAALTDD  728
            L  REI A+ DCVEE+++++D L +S+ E+K     +G++ F   M++ QTW SAALTD+
Sbjct  95   LKKREIEAIHDCVEEINDTIDRLTKSVQELKLCGSAKGQEQFAYHMSNAQTWTSAALTDE  154

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC+DGF+G+V    +K +VR +I+ V H TSNAL+LIN FA+ +
Sbjct  155  NTCSDGFSGRVMDGRIKNSVRARIVNVGHETSNALSLINAFAKTY  199



>ref|XP_010444080.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=200

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 115/166 (69%), Gaps = 6/166 (4%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC+TT+YP LC  SLS +A  I+  P+ +A TA+ VTL  AQST   + RL R  G
Sbjct  36   FIQSSCKTTTYPALCVQSLSVYANDIQTSPKRLAETAIAVTLSRAQSTKLFVSRLTRMKG  95

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----RDFEMKMNDIQTWVSAALTD  725
            L  RE+ A+ DCVEE++++VD L +S+ E+K L G       F   M++ QTW SAALTD
Sbjct  96   LKKREVEAVHDCVEEINDTVDRLTKSVQELK-LCGSAKNQEQFAYHMSNAQTWTSAALTD  154

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC+DGF+G+V    +KT+VR +I+ V H TSNAL+LIN FA+ +
Sbjct  155  ENTCSDGFSGRVMDGRIKTSVRARIVNVGHETSNALSLINAFAKTY  200



>ref|XP_004511656.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=202

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 111/168 (66%), Gaps = 3/168 (2%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T TEFIR+SCE TSYP LC   L+ +A  I    Q +A TA++V++   Q +A+ +  ++
Sbjct  29   TPTEFIRSSCEATSYPALCVQCLTGYASAIGQSDQQLAITAISVSISRTQLSASFVNTMS  88

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQTWVSAAL  719
            +S G+  RE  AM+DC+E +++S+D L +S   LG +    G DF   M+++QTWVSAAL
Sbjct  89   KSRGIKQREYRAMQDCIENMADSLDRLSKSVTELGNIGHAVGEDFRWHMSNVQTWVSAAL  148

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TDDD+C DGF        VK A++ K++ VA +TSNALAL+NRFA  H
Sbjct  149  TDDDSCLDGFTDLFMNENVKAAIKDKVVNVAQVTSNALALVNRFASNH  196



>ref|XP_010264393.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=204

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 117/169 (69%), Gaps = 0/169 (0%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L+   +    T+FIRTSC  T+YP+LC+ SLSS A  I+A+P+ +A TAL +++ +AQST
Sbjct  35   LATNTSNPNTTDFIRTSCGVTTYPQLCYTSLSSFASSIQANPRKLAQTALNISITSAQST  94

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +  + +L++   L   E   ++DCV+++ +S+DEL++SL ++++L G   + KM++I+TW
Sbjct  95   SVLVSKLSQRRDLKTWEAATVKDCVDQIEDSIDELKQSLEQLQKLEGPGIDFKMSNIKTW  154

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            +SAAL++D+TC DG  GK     V + ++  I+ VA LTSNALA+IN  
Sbjct  155  LSAALSNDETCMDGIDGKDINEEVNSTIKKSILNVAKLTSNALAIINHL  203



>ref|XP_010264193.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=202

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            ++ T+FI+ SC  T YP +C  SLS +A  I+  P+ +A  AL V+L  A+S  A + ++
Sbjct  26   SSPTDFIKASCGVTRYPAVCVESLSVYANAIQQSPRQLAQAALQVSLGRARSATAFVSKM  85

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-RG--RDFEMKMNDIQTWVSAA  716
             R  GL  R+  A++DCV+ L +SVD +  S+ E+ Q+ RG  +DF   M+++QTWVSAA
Sbjct  86   TRLRGLKGRQYQAVKDCVDNLGDSVDRISRSIHELGQINRGASQDFMWHMSNVQTWVSAA  145

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTD++TC DGFAG      VKTA+RGKI+ VA +TSNALAL+NRFA  H
Sbjct  146  LTDENTCMDGFAGHGMDGHVKTAIRGKILNVAQVTSNALALLNRFASGH  194



>ref|XP_002318880.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
 gb|EEE97100.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
Length=202

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T T +++T+C +T+YP+LCF SLSS+   I+ +   +  TALTVTL+ A +T++ +  L+
Sbjct  40   TYTNYLQTACNSTTYPQLCFKSLSSYTSTIKTNYLKLCRTALTVTLKAASNTSSLVKALS  99

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +  GL+  E G ++DC+EE+ +S+DEL +SL  +  L+G D E ++ +I+TW+SAA+TD+
Sbjct  100  KQKGLSKTEAGIVKDCIEEIGDSIDELNQSLKALGSLKGSDIEFQIANIKTWISAAITDE  159

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DTCT+GF  +     V   +R  I+ VA LTSNALALIN+ +
Sbjct  160  DTCTEGFEERNITDEVMIKIRKSIVNVARLTSNALALINKLS  201



>ref|XP_008234383.1| PREDICTED: 21 kDa protein-like [Prunus mume]
Length=208

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 116/171 (68%), Gaps = 2/171 (1%)
 Frame = +3

Query  345  LSAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            L+  ++  T   +++T+C TT+YP +C+ SLSS+A  +++DP  +   AL+VTL+ A++ 
Sbjct  36   LATSSSSQTYKSYVKTACNTTTYPLICYKSLSSYASKVKSDPHKLCTYALSVTLKAAKNA  95

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL--RGRDFEMKMNDIQ  698
            ++ + +L ++ GLT  E G ++DC++ + +S+DEL++S+  M  L   G D +++++DI+
Sbjct  96   SSVVSKLYKNTGLTPSEKGVVKDCIDNIKDSIDELKQSVSSMSNLGVSGSDVQLQLDDIK  155

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            TWVSA +TDD TCTDGF G      VKTA++  I+  A L SNAL+LI+  
Sbjct  156  TWVSAVITDDATCTDGFDGVKVSTAVKTAIKNSIVNAARLASNALSLIDSL  206



>sp|P17407.1|21KD_DAUCA RecName: Full=21 kDa protein; AltName: Full=1.2 protein; Flags: 
Precursor [Daucus carota]
 emb|CAA36642.1| precursor polypeptide (AA -22 to 171) [Daucus carota]
Length=193

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 111/165 (67%), Gaps = 3/165 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
            +FI+TSC  T+YP +C  SLS++A+ I+ +PQ +A TAL V+L   Q     M RL +  
Sbjct  27   QFIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFK  86

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDD  728
            GL  R+  A+ DC+EE+ +S+D +  S  EMK L   +G DF  +M++++TWVSAALTD+
Sbjct  87   GLKARQYAAIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDE  146

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC DGFAGK     +K +VR +++ VA +TSNALAL+N FA  H
Sbjct  147  TTCMDGFAGKGMDGKIKESVRAQVVAVARVTSNALALVNNFAAKH  191



>ref|XP_007038423.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
 gb|EOY22924.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
Length=230

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 112/161 (70%), Gaps = 3/161 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI+ SC  T YP LC  SL++ A  I+  P+ +A TAL V+L  AQST A + ++ +  G
Sbjct  67   FIKASCSATKYPALCVQSLAAFAPSIQQSPRQLAQTALNVSLARAQSTEAFVSKMKKFKG  126

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMK---QLRGRDFEMKMNDIQTWVSAALTDDD  731
            L  RE  A++DC+EE+S+SVD L +S+ E+K   Q +G+DF   +++++TWVSAALTD+ 
Sbjct  127  LEKREYEAIKDCIEEMSDSVDRLSKSVQELKHMGQAKGQDFLWHVSNVETWVSAALTDES  186

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGFA +     VK ++R ++M VA +TSNAL+L+N+FA
Sbjct  187  TCVDGFASQGLDGKVKASIRARVMNVAQVTSNALSLVNQFA  227



>gb|KFK40568.1| hypothetical protein AALP_AA2G013000 [Arabis alpina]
Length=201

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 114/173 (66%), Gaps = 9/173 (5%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            +  TN ++I+TSC  T Y  +C+NSLS +A  I + PQ +A TAL +TL +A+S    + 
Sbjct  31   SNKTNLDYIKTSCNLTLYKNICYNSLSPYASTIDSKPQKLAVTALNLTLSSAKSALKVIK  90

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRD---FEMKMNDIQTWVS  710
             ++   GLT  E+ A+ DCVEE+ +SV EL++SL E+  +  +D   FEM ++D+QTW S
Sbjct  91   AISHKTGLTRLEVAAVNDCVEEIGDSVSELQDSLRELDSINNKDSSKFEMVVSDVQTWAS  150

Query  711  AALTDDDTCTDGF--AGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            AALT+DDTC DGF  AG V    +K  VR  ++ VA LTSNALALIN +A  H
Sbjct  151  AALTNDDTCMDGFGRAGTV----MKDLVRQHVVNVARLTSNALALINMYASTH  199



>ref|XP_010672019.1| PREDICTED: 21 kDa protein-like [Beta vulgaris subsp. vulgaris]
Length=207

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = +3

Query  366  ATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
             T T+F++TSC+ T YP LC+NSLS++   I+  P+ +A+ AL+VTL T ++T   + R+
Sbjct  38   PTYTDFLKTSCKATLYPELCYNSLSTYTNVIQTSPEKLANAALSVTLTTTRTTTDMISRM  97

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-RDFEMKMNDIQTWVSAALT  722
            +   G+   E GA+RDC+EEL++++ EL+ES+ EM  ++G +   +K+N+IQTWVSAALT
Sbjct  98   SNGPGIRPSEAGALRDCLEELNDAIYELQESIMEMFHIKGSKKLGLKINNIQTWVSAALT  157

Query  723  DDDTCTDGFAGKVTRRG-VKTAVRGKIMKVAHLTSNALALINRFA  854
            D+DTC DG +G     G +K+ VRG+I+ + HLTSN+LALIN +A
Sbjct  158  DEDTCMDGSSGGEAMDGKLKSVVRGRIVNICHLTSNSLALINDYA  202



>ref|XP_010264194.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=211

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 111/161 (69%), Gaps = 0/161 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T+TEFI+ SC  T YP++C  SLS++A  I+  P+L+A  AL+V+L++A+ST   +  L+
Sbjct  42   TSTEFIKNSCRRTLYPQVCVESLSAYASTIQESPKLLAQVALSVSLKSARSTEKLVLNLS  101

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            + + +  RE  A+ DCVE + + V+ELR+SL EMK L G DF +K+++I+TWVSAALT++
Sbjct  102  KVNDIRPREAAALMDCVETMGDCVEELRQSLQEMKHLGGPDFALKLSNIKTWVSAALTNE  161

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            DTC DGF  K     +K  +   I  VA LTSNALALIN  
Sbjct  162  DTCRDGFQDKSMNGNIKNTITKSIDYVAKLTSNALALINNI  202



>ref|XP_006368687.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
 gb|ERP65256.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
Length=206

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 111/163 (68%), Gaps = 1/163 (1%)
 Frame = +3

Query  369  TNTEFIRTSC-ETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            T  E+I+TSC  TT YP+LC+++L  +A  I+ +P+L+A TAL V+L    ST+  M R+
Sbjct  37   TYIEYIKTSCYNTTFYPKLCYHTLVIYASTIKTNPKLLAKTALNVSLINTNSTSRLMIRV  96

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
            ++  GL  R + A  DCVEE+ +SV EL+ S+ E+    G DF   M+D++TWVSAALTD
Sbjct  97   SKIPGLEPRVVAATLDCVEEVGDSVYELQRSMEEIGHAGGSDFSKAMSDVETWVSAALTD  156

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DD C DGFA +V  + V   V+  I ++A LTSNALAL+NR+A
Sbjct  157  DDACLDGFAEEVMNKKVTAIVKRHIRRIARLTSNALALVNRYA  199



>ref|XP_010483947.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=202

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC+TT+YP LC  SLS +A  I+  P+ +A TA+ VTL  AQST   + RL R  G
Sbjct  38   FIQSSCKTTTYPALCVQSLSVYANDIQTSPKRLAETAIAVTLSRAQSTKLFVSRLTRMKG  97

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----RDFEMKMNDIQTWVSAALTD  725
            L  RE+ A+ DCVEE++++VD L +S+ E+K L G       F   M++ QTW SAALTD
Sbjct  98   LKKREVEAVHDCVEEINDTVDRLTKSVQELK-LCGSAKNQEQFAYHMSNAQTWTSAALTD  156

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC+DGF+G+V    +K +VR +I+ V H TSNAL+LIN FA+ +
Sbjct  157  ENTCSDGFSGRVMDGRIKNSVRARIVNVGHETSNALSLINAFAKTY  202



>emb|CDX94463.1| BnaC01g17210D [Brassica napus]
Length=201

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 111/165 (67%), Gaps = 4/165 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEF++ SCETT+YP LCF SLSS+A  I+  P+ +A TAL V+L  A+S    +  ++ 
Sbjct  34   DTEFVKASCETTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMSD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DC+EE+ ++VD LR SL E+K L     G DF + + +++TW SAAL
Sbjct  94   YKGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLEEGESGEDFWLCLGNVRTWTSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TD+ TC DGF GK     +K+ +R  I++VA  TSNALALIN FA
Sbjct  154  TDETTCLDGFGGKAMDGELKSLIREHILRVAQDTSNALALINVFA  198



>ref|XP_009398112.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=217

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +3

Query  363  GATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGR  542
            G  N  FIR+SC  T YP LCF+SLS++A  I+  P  +A  AL+V+L  A++TAA + +
Sbjct  49   GGKNLNFIRSSCGATQYPSLCFSSLSAYATTIQRSPVQLAQAALSVSLTGARTTAATITK  108

Query  543  LARSHG--LTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAA  716
            L +  G  +  RE  AM DC+E +  SV+ELR+SL EM  L+G+D  +++ND+QTWVS+A
Sbjct  109  LLKGSGAGVGAREAEAMNDCLENMGNSVEELRDSLKEMGHLKGKDLRLRVNDMQTWVSSA  168

Query  717  LTDDDTCTDGFAGKVTRR-GVKTAVRGKIMKVAHLTSNALALIN  845
            LTD++TC +G     + + GV+  +RG+I+K   LTSNAL+LIN
Sbjct  169  LTDENTCMEGLPTTASMKVGVRGTIRGEIVKAVQLTSNALSLIN  212



>ref|XP_010458832.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=202

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC+TT+YP LC  SLS +A  I+  P+ +A TA+ VTL  AQST   + RL R  G
Sbjct  38   FIQSSCKTTTYPALCVQSLSVYANDIQTSPKRLAETAIAVTLSRAQSTKLFVSRLTRMKG  97

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----RDFEMKMNDIQTWVSAALTD  725
            L  RE+ A+ DCVEE+++++D L +S+ E+K L G       F   M++ QTW SAALTD
Sbjct  98   LKKREVEAVHDCVEEINDTIDRLTKSVQELK-LCGSAKNQEQFAYHMSNAQTWTSAALTD  156

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC+DGF+G+V    +K +VR +I+ V H TSNAL+LIN FA+ +
Sbjct  157  ENTCSDGFSGRVMDGRIKNSVRARIVNVGHETSNALSLINAFAKTY  202



>ref|XP_009139088.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=202

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEF++ SCETT+YP LCF SLSS+A  I+  P+ +A TAL V+L  A+S    +  +  
Sbjct  35   DTEFVKASCETTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMTD  94

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DC+EE+ ++VD LR SL E+K L     G DF + + +++TW SAAL
Sbjct  95   YKGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLEEGESGEDFWLCLGNVRTWTSAAL  154

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC DGF GK     +K  +R  I++VA  TSNALALIN FA  H
Sbjct  155  TDETTCLDGFGGKAMDGELKRLIREHILRVAQDTSNALALINVFASKH  202



>ref|XP_010546069.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=200

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 7/177 (4%)
 Frame = +3

Query  345  LSAMAAGATNTE----FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQT  512
             S  AA AT  +    F++ +C TT+YP  C  SLS +A  I+A PQ +AHTAL V+L  
Sbjct  20   FSIAAANATAPKRAENFVKATCRTTTYPTECVRSLSLYADAIQASPQRLAHTALAVSLNR  79

Query  513  AQSTAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR---GRDFEMK  683
            A ST   + R  R  GLT RE  A+ DCVEE+S++VD L +S+ E K      G  F   
Sbjct  80   ALSTKIFVSRFTRFKGLTKREYRAIEDCVEEISDTVDRLTKSVKEFKMCSRGDGNGFWYH  139

Query  684  MNDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            M+++QTW+SAALTD++TC+DGFAG++    VK +VR +I+ ++  TSNALALIN FA
Sbjct  140  MSNVQTWMSAALTDENTCSDGFAGRIMDGRVKNSVRARIVNMSQETSNALALINYFA  196



>ref|XP_006362112.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=209

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            ++FI+TSC TT YP+LC  +LS ++  I+ +P  +A++ALTV+L+ A+ST   + ++++ 
Sbjct  47   SDFIKTSCGTTLYPKLCIETLSPYSNSIQTNPMELANSALTVSLKGAKSTTNKIAKMSKE  106

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDT  734
              L   E  A+ DCVE + +SVDEL++SL EMK L G DFE KM ++ TWVSAALTD+DT
Sbjct  107  ESLGPAEAHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDEDT  166

Query  735  CTDGFA-GKVTRRGVKTAVRGKIMKVAHLTSNALAL  839
            C DGF         VK  +R  I+ VA LTSNALAL
Sbjct  167  CMDGFQENSAMNAKVKATIRNYIVNVAQLTSNALAL  202



>ref|XP_004234936.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=209

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            ++FI+TSC TT YP+LC  +LS ++  I+  P  +A++ALTV+L+ A+ST   + ++++ 
Sbjct  47   SDFIKTSCGTTLYPKLCIETLSPYSNSIQTSPMELANSALTVSLKGAKSTTNKIAKMSKE  106

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDT  734
              L   E  A+ DCVE + +SVDEL++SL EMK L G DFE KM ++ TWVSAALTD+DT
Sbjct  107  ESLGPAEAHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDEDT  166

Query  735  CTDGFA-GKVTRRGVKTAVRGKIMKVAHLTSNALAL  839
            C DGF         VK  +R  I+ VA LTSNALAL
Sbjct  167  CMDGFQDNSAMNSKVKATIRNYIVNVAQLTSNALAL  202



>ref|XP_010646817.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=199

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SA A  +  T FI+ SC  T YP LCF  LS +A  IR   + +A TAL+V+L  A+S  
Sbjct  23   SAAARNSAATSFIKASCRVTRYPVLCFQCLSGYASTIRQSDRQLALTALSVSLSRARSAT  82

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQ  698
                +L +  GL  RE  A++DC+E ++++VD L  S   LG   +   +DF   M+++Q
Sbjct  83   VFASKLTKVRGLKPREHEAVKDCIENMADTVDRLSHSVQELGRTGKAVSQDFMWHMSNVQ  142

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TWVSAALTD++TC DGFAG+V    VKTAVR K++ VA +TSNALALINRFA
Sbjct  143  TWVSAALTDENTCLDGFAGRVMEGNVKTAVRRKVIDVAQVTSNALALINRFA  194



>ref|XP_008369524.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=205

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            +A+A  +++T+FI+ SC TT YP LC  SL+++A  IR   + +A TALTV+L   +S  
Sbjct  29   AAIARHSSSTDFIKASCRTTQYPALCVQSLAAYASAIRQSERQLAQTALTVSLARVRSAT  88

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQ  698
            + + +L R  G+  RE  A++DC+E + +SVD L +S   LG M +  G+DF   M++++
Sbjct  89   SFVTKLTRVRGIKPREYRAVKDCIENMGDSVDRLGQSVRELGHMGRAFGQDFMWHMSNVE  148

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TWVSAALTD+ TC DGF+G+     +K A+R ++  VAH+TSNALAL+ RFA  H
Sbjct  149  TWVSAALTDEGTCLDGFSGRFMDGNIKNAIRRRVNNVAHVTSNALALVTRFAAKH  203



>ref|XP_008439100.1| PREDICTED: 21 kDa protein-like [Cucumis melo]
Length=193

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SA   GA+N  FI++ C   +YP LC  SLSS A  I+ +P+ +  TAL V+L  AQST 
Sbjct  20   SAFNGGASN--FIKSKCSAATYPDLCVQSLSSFASTIQRNPRQLVQTALAVSLSRAQSTR  77

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG---RDFEMKMNDIQ  698
            + + +L +  GL  RE  A++DC+EE+ ++VD L +S+ E+K++ G   +DF   +++++
Sbjct  78   SFVWKLTKFSGLKPRERAALKDCMEEVGDTVDRLNKSVEELKRVSGSKKKDFLWHISNVE  137

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            TWVSAA+TD++TC+DGFAG      +K++VRG+I+ V  + SNAL+LIN++A+
Sbjct  138  TWVSAAMTDENTCSDGFAGSALNGRIKSSVRGRIVDVTRVISNALSLINKYAE  190



>ref|XP_010555621.1| PREDICTED: 21 kDa protein [Tarenaya hassleriana]
Length=202

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 109/169 (64%), Gaps = 5/169 (3%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            + EF+RTSCE  SYP LCF SLSS+A  I+  P+ +  TAL V+L  A+S    +  L  
Sbjct  34   DIEFVRTSCEAASYPDLCFQSLSSYASEIKKRPRQLTETALAVSLDRARSAKVYISELTD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL-----RGRDFEMKMNDIQTWVSAA  716
              G+T R+ GA+ DC EE+ ++VD L +SL E+K L       +DF   ++++QTW SAA
Sbjct  94   YKGITKRQHGAVSDCAEEMGDTVDRLNKSLKELKHLGEEGQSDQDFWFCLSNVQTWTSAA  153

Query  717  LTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTD++TC DGF GK     +K++V+  I++VA  TSNALALIN F   H
Sbjct  154  LTDENTCLDGFGGKAMEGELKSSVKTHIVRVAQETSNALALINEFGSKH  202



>ref|XP_011018248.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=206

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  369  TNTEFIRTSC-ETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRL  545
            T  E+I+TSC  +T YP+LC+++L  +A  I+  P+L+A TAL V+L    S +  M R+
Sbjct  37   TYIEYIKTSCYNSTFYPKLCYHTLVIYASTIKTSPKLLAKTALNVSLINTNSASRLMIRV  96

Query  546  ARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTD  725
            ++  GL  R + A  DC+EE+ +SV EL+ S+ E+    G DF   M+D++TWVSAALTD
Sbjct  97   SKIPGLEPRVVAATLDCLEEVGDSVYELQRSMEEIGHAGGSDFSKAMSDVETWVSAALTD  156

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            DDTC DGFA +V  + V   V+  I ++A LTSNALAL+NR+A
Sbjct  157  DDTCLDGFAEEVVNKKVTAIVKRHIQRIARLTSNALALVNRYA  199



>gb|AIT42255.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 116/167 (69%), Gaps = 4/167 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC++T+YP +C  SLS +A+ I+     +  TAL+V+L  A+ST   + +L + 
Sbjct  30   TSFIKSSCKSTTYPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGR-DFEMKMNDIQTWVSAALT  722
             GL  RE  A++DCVEE ++SVD L  S+ E+K+L    G+ DF+  M++++TWVSAA+T
Sbjct  90   KGLKPREYAAIKDCVEETNDSVDRLSRSVNELKRLDRSHGKADFQWHMSNVETWVSAAIT  149

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            D++TCTDGFAG+     +K ++R  I  +A +TSNALALIN++A  H
Sbjct  150  DENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAANH  196



>ref|XP_010062095.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
Length=204

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 115/165 (70%), Gaps = 4/165 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI+ SC  TSYP +C  SLS++A  ++   + +A  ALTVTL  AQ+T   + R  +  G
Sbjct  40   FIKASCSETSYPAVCVQSLSAYANTVKLSRKELAQAALTVTLAKAQATRDFVTRSTKLKG  99

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMK----QLRGRDFEMKMNDIQTWVSAALTDD  728
            L  RE  A++DC+EE+ ++VD L +S+ E+K    Q + +DF+  +++++TWVSAALTD+
Sbjct  100  LKAREYEAVKDCLEEMGDTVDRLSKSMKELKGMGSQSKAQDFQWHVSNVETWVSAALTDE  159

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TC DGF+GK T   +K ++R +I++VA +TSNALAL+NRFA  H
Sbjct  160  NTCMDGFSGKATEGRLKKSIRTRIVEVAQVTSNALALVNRFAAKH  204



>ref|XP_011076330.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=202

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 112/161 (70%), Gaps = 3/161 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FIRTSC  T+YP +C  SLS++A  I+  P+ +  TAL+V++  AQST   + +L +  G
Sbjct  39   FIRTSCRATTYPAVCVQSLSTYATVIQKSPKQLVMTALSVSVDRAQSTKTFVSKLTKFRG  98

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDDD  731
            L  RE  A++DC+EE+S+SVD L +S  E+K+L    G ++   ++++QTWVSAALTDD 
Sbjct  99   LKPREYAAIKDCLEEVSDSVDRLSKSAQELKRLGRAGGPEYIWHLSNLQTWVSAALTDDS  158

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            TC DGF+G+     +KT++R ++  VA +TSNALAL N++A
Sbjct  159  TCLDGFSGRALNGRIKTSIRARMTNVAQVTSNALALCNKYA  199



>emb|CDX89429.1| BnaA01g14640D [Brassica napus]
Length=201

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +T+F++ SC+TT+YP LCF SLSS+A  I+  P+ +A TAL V+L  A+S    +  +  
Sbjct  34   DTKFVKASCQTTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMTD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DC+EE+ ++VD LR SL E+K L     G DF + + +++TW SAAL
Sbjct  94   YKGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLEEGESGEDFWLCLGNVRTWTSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC DGF GK     +K+ +R  I++VA  TSNALALIN FA  H
Sbjct  154  TDETTCLDGFGGKAMDGELKSLIREHILRVAQDTSNALALINVFASKH  201



>emb|CDP05316.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 110/163 (67%), Gaps = 3/163 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FIR  C TT+YP LC  SLS+ A  I+  P  +A TAL+V+L  AQST A + +L++ 
Sbjct  29   TSFIRAKCRTTTYPSLCVESLSTFAATIQRSPNQLAQTALSVSLDRAQSTRAFVAKLSKF  88

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
             GL  RE  A+RDC+E++++SVD L  S+ E+K L   RG +    +++ QTWVSAALTD
Sbjct  89   RGLKGREYAALRDCLEQMADSVDRLGNSVQEIKNLGRSRGPELFWHISNAQTWVSAALTD  148

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            D TC DGFAG+     VK+++  ++  VA +TSNALALIN+ A
Sbjct  149  DSTCADGFAGRTLNGRVKSSITTRMTNVAQVTSNALALINQMA  191



>ref|XP_006284547.1| hypothetical protein CARUB_v10005764mg [Capsella rubella]
 gb|EOA17445.1| hypothetical protein CARUB_v10005764mg [Capsella rubella]
Length=202

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            A   +TEFI+ SCETTSYP  CF SLSS+A  I+  P+ +A TAL V++  A+S    + 
Sbjct  31   ASGGDTEFIKASCETTSYPERCFQSLSSYASEIKQQPRKLAETALAVSMARAKSAKTYVS  90

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWV  707
             +   +G+T R+  A+ DCVEE+ ++VD L +SL E+K L     G DF   +++++TW 
Sbjct  91   GMTDYNGITKRQHEAVEDCVEEMGDTVDRLSKSLKELKHLEEGDSGEDFWFCLSNVRTWT  150

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            SAALTD+ TC DGF GK     +K+ +R  I+ VA  TSNALALIN FA  H
Sbjct  151  SAALTDETTCLDGFGGKAMDGELKSLIRTHIVSVAEETSNALALINDFASKH  202



>ref|XP_010438899.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=201

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            + EFI+TSC+TTSYP LCF SLSS+A  I+  P  +A TAL V++  A+S    +  ++ 
Sbjct  34   DIEFIKTSCKTTSYPDLCFQSLSSYASEIKQQPGKLAETALAVSMARAKSAKTYVSGMSD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DC+EE+ ++VD L +SL E+K L     G DF + +++++TW SAAL
Sbjct  94   YKGITKRQHEAVEDCIEEMGDTVDRLSKSLKELKHLEEGDSGEDFWLCLSNVRTWTSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC DGF GK     +K+ +R  I+ VA  TSNALALIN FA  H
Sbjct  154  TDETTCLDGFGGKAMDGELKSLIRTHIVSVAEETSNALALINDFASKH  201



>ref|XP_004148136.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
 ref|XP_004160871.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
 gb|KGN57279.1| hypothetical protein Csa_3G176260 [Cucumis sativus]
Length=192

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SA   GA++  FI++ C   +YP LC  SLSS +  I+ +P+ +  TAL V+L  AQST 
Sbjct  20   SAFNGGASS--FIKSKCSAATYPDLCVQSLSSFSSTIQRNPRQLVQTALAVSLSHAQSTR  77

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG--RDFEMKMNDIQT  701
            + + +L +  GL  RE  A++DC+EE+ ++VD L +S+ E+K++ G  +DF+  +++++T
Sbjct  78   SFVWKLTKFSGLKPRERAALKDCMEEVGDTVDRLNKSVEELKRVSGSKKDFQWHISNVET  137

Query  702  WVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            WVSAA+TD++TC+DGFAG      +K++VRG+I+ V  + SNAL+LIN++A+
Sbjct  138  WVSAAMTDENTCSDGFAGSALNGRIKSSVRGRIVDVTRVISNALSLINKYAE  189



>ref|XP_006477257.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=205

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SA+   +T   FIR SC  T YP LC   LS +   IR + QL A TAL+V+L  A+S A
Sbjct  23   SAIPGHSTPANFIRNSCRATRYPALCVQCLSGYGHAIRNEHQL-AVTALSVSLSRARSAA  81

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQ  698
            A +G+L +  G+  RE  A++DC+E + + VD L +S   LG + +  G+DF   M+++Q
Sbjct  82   AFVGKLTKVRGIKKREFLAVKDCIENMGDGVDRLSQSVRELGHVGRAVGQDFTWHMSNVQ  141

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TWVSAALTD++TC DGF G+     VK A+R ++  VA +TSNALAL+NRFA  H
Sbjct  142  TWVSAALTDENTCLDGFDGRFMDGNVKAAIRRRVTNVAQVTSNALALVNRFAARH  196



>gb|AIT42253.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC++T+YP +C  SLS +A+ I+     +  TAL+V+L  A+ST   + +L + 
Sbjct  30   TSFIKSSCKSTTYPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGR-DFEMKMNDIQTWVSAALT  722
             GL  RE  A++DCVEE ++SVD L  S+ E+K L    G+ DF+  M++++TWVSAA+T
Sbjct  90   KGLKPREYAAIKDCVEETNDSVDRLSRSVNELKGLDRSHGKADFQWHMSNVETWVSAAIT  149

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            D++TCTDGFAG+     +K ++R  I  +A +TSNALALIN++A  H
Sbjct  150  DENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAANH  196



>ref|XP_008377851.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=208

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            +++T+C +T+YP +C+ SLSS+A  ++++P+ +   AL+VTLQ +++ ++ + +L++  G
Sbjct  48   YVKTACNSTTYPLVCYQSLSSYASKVKSNPRKLCIYALSVTLQASKNASSXVSKLSKRAG  107

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL--RGRDFEMKMNDIQTWVSAALTDDDT  734
            LT  E G + DC+E + ES+DEL++SL  MK L  +G D + +++DI+TWVSA +TDD T
Sbjct  108  LTPTEKGIINDCLESIKESIDELKDSLSSMKNLGVKGADMQAQLDDIKTWVSAVITDDVT  167

Query  735  CTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            CTDGF G      VKT +   I+ VA L SNAL+LI+  
Sbjct  168  CTDGFDGLKVSTAVKTPINNSIVYVARLASNALSLIDSL  206



>gb|AIT42251.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC++T++P +C  SLS +A+ I+     +  TAL+V+L  A+ST   + +L + 
Sbjct  30   TSFIKSSCKSTTFPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR---GR-DFEMKMNDIQTWVSAALT  722
             GL  RE  A++DCVEE ++SV+ L  S+ E+K L    G+ DF+  MN+++TWVSAA+T
Sbjct  90   KGLKPREYAAIKDCVEETNDSVNRLNRSVNELKGLERNHGKADFQWHMNNVKTWVSAAIT  149

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            D++TCTDGFAG+     +K ++R  I  +A +TSNALALIN++A  H
Sbjct  150  DENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAANH  196



>ref|XP_007148704.1| hypothetical protein PHAVU_005G007600g [Phaseolus vulgaris]
 gb|ESW20698.1| hypothetical protein PHAVU_005G007600g [Phaseolus vulgaris]
Length=189

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 111/165 (67%), Gaps = 2/165 (1%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC  T YP LC  SLS +A  I+ DP  +  TAL++ L   +ST   + +  + 
Sbjct  25   TNFIKSSCSATQYPALCVESLSVYAAAIQQDPHQLVQTALSLALNKTESTKTFVAKCNKF  84

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR--GRDFEMKMNDIQTWVSAALTDD  728
             GL  RE  A++DCVEE+S+ VD L  SL E+K  +  G+DF+  M++++TWVS+ALTD+
Sbjct  85   KGLKPREYAALKDCVEEISDGVDRLSRSLKELKLCKLKGQDFDWHMSNVETWVSSALTDE  144

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             TC DGFAGK     +K A+RG+++ VA +TSNAL+LIN++A  H
Sbjct  145  STCGDGFAGKALSGKIKDAIRGRMVNVAQVTSNALSLINQYAAKH  189



>ref|XP_011033917.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSC-ETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQST  524
            SA      N  +I+TSC +TT YP+LC+++L+ +A  I+ +P+L+A+TAL V+L++  ST
Sbjct  27   SATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSLKSTNST  86

Query  525  AAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTW  704
            +  + R +++ GL  R   AM DCVEE+ ++V EL+ S+ EM    G +F M MND++TW
Sbjct  87   SRLIKRASKTPGLDPRVHAAMLDCVEEVGDAVGELQRSIEEMDHAGGSNFSMAMNDVETW  146

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQ  857
            VSAALTDDDTC DGFA    ++ VKT V+  + ++A LTSNALAL+NR+A 
Sbjct  147  VSAALTDDDTCMDGFAEGAMKKKVKTTVKRHLRRIARLTSNALALVNRYAS  197



>ref|XP_011029961.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=202

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 110/161 (68%), Gaps = 0/161 (0%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T T +++T+C +T+YP+LCF SLSS+   I+ +   +  TALTVTL+ A +T++ +  L+
Sbjct  40   TYTNYLQTACNSTTYPQLCFKSLSSYTSTIKTNDLKLCRTALTVTLKAASNTSSLVKALS  99

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDD  728
            +  GL+  E G ++DC+E + +S+DEL +SL  +  L+G D E ++ +I+TW+SAA+TD+
Sbjct  100  KQKGLSKTEAGIIKDCIEVIGDSIDELNQSLKALGSLKGSDIEFQIANIKTWISAAITDE  159

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            DTCT+GF  +     V   +R  I+ V  LTSNALALIN+ 
Sbjct  160  DTCTEGFEERNITDEVMIKIRKSIVNVTRLTSNALALINKL  200



>ref|NP_176463.2| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
 gb|AAF19547.1|AC007190_15 F23N19.12 [Arabidopsis thaliana]
 gb|AEE34001.1| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=312

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 116/168 (69%), Gaps = 5/168 (3%)
 Frame = +3

Query  360  AGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMG  539
            +  TN ++I+TSC  T Y  +C+NSLS +A  IR++PQ +A  AL +TL +A+S +  + 
Sbjct  140  SNQTNLDYIKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVK  199

Query  540  RLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRD---FEMKMNDIQTWVS  710
             ++   GLT  E+ A+ DCVEE+ +SV  L++S+ E+  +  +D   FEM M+D++TWVS
Sbjct  200  NISHGGGLTRLEVVAVADCVEEIGDSVTSLQDSIRELDSINYKDSAKFEMVMSDVETWVS  259

Query  711  AALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
            AALT+DDTC DGF+  + +  VK  VR  +++VA LTSNALALIN +A
Sbjct  260  AALTNDDTCMDGFS--LVKTAVKDLVRRHVVEVARLTSNALALINMYA  305



>ref|NP_001235143.1| uncharacterized protein LOC100527116 precursor [Glycine max]
 gb|ACU16163.1| unknown [Glycine max]
 gb|KHN20594.1| 21 kDa protein [Glycine soja]
Length=198

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 2/163 (1%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC +T YP LC +SLS +A  I+ DP  +  TAL+++L   Q+T   +    +  G
Sbjct  36   FIKSSCSSTQYPALCVSSLSVYASSIQQDPHQLVQTALSLSLNRTQATKTFVANCNKFRG  95

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMK--QLRGRDFEMKMNDIQTWVSAALTDDDT  734
            L  RE  A++DC EE+S+SVD L  SL E+K  +++G DF   +++++TWVS+ALTD+ T
Sbjct  96   LKPREHAALKDCAEEISDSVDRLSRSLKELKLCKVKGEDFTWHISNVETWVSSALTDEST  155

Query  735  CTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            C DGF+GK     +K ++R +++ VA +TSNAL+LIN +A  H
Sbjct  156  CGDGFSGKALNGKIKDSIRARMLNVAQVTSNALSLINHYAAQH  198



>ref|XP_006355502.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=206

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 116/176 (66%), Gaps = 4/176 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SAM +     +FI+ SC+ T YP LC   LS+ A  ++   Q +AH AL+V+L  A+ST 
Sbjct  27   SAMTSNPAAIKFIKVSCKATLYPVLCVQCLSAFANTVKQSEQQLAHAALSVSLSKAKSTM  86

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL----RGRDFEMKMNDI  695
              + +L R  GL  RE  A++DC++ +S+S+D++ +S+ E+        G+DF   ++++
Sbjct  87   IFVSKLNRMRGLKPREKQAVKDCLDTMSDSIDQINKSIPELGHTGQFSTGQDFMWHVSNV  146

Query  696  QTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            QTWVSAALTD++TC DGF+G+     VK A+R +I+ VA +TSNALAL+NRFA  H
Sbjct  147  QTWVSAALTDENTCLDGFSGRGMNGNVKAALRLRILHVAQVTSNALALVNRFADRH  202



>ref|XP_009595798.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=215

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 105/156 (67%), Gaps = 1/156 (1%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            +EFI  SC TT Y +LC  +LS ++  I+ +P+ +A+ ALTV+L+ A+ST   + ++++ 
Sbjct  53   SEFITNSCGTTLYTKLCIETLSPYSNSIQTNPKELANAALTVSLKGAKSTTNKISKMSKE  112

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWVSAALTDDDT  734
              L   E  A+ DCVE + +SVDEL++SL EMK L G DFE KM ++ TWVSAALTD+DT
Sbjct  113  QDLGPAETHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDEDT  172

Query  735  CTDGFAGKVT-RRGVKTAVRGKIMKVAHLTSNALAL  839
            C DGF G       VK  +R  I+ VA LTSNALAL
Sbjct  173  CMDGFDGNDNMNEKVKATIRNYIVNVAQLTSNALAL  208



>gb|AIT42252.1| pectinmethylesterase inhibitor [Solanum tuberosum]
 gb|AIT42254.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC++T++P +C  SLS +A+ I+     +  TAL+V+L  A+ST   + +L + 
Sbjct  30   TSFIKSSCKSTTFPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGR-DFEMKMNDIQTWVSAALT  722
             GL  RE  A++DCVEE ++SVD L  S+ E+K L    G+ DF+  M++++TWVSAA+T
Sbjct  90   KGLKPREYAAIKDCVEETNDSVDRLSRSVNELKGLDRNHGKADFQWHMSNVETWVSAAIT  149

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            D++TCTDGFAG+     +K ++R  I  +A +TSNALALIN++A  H
Sbjct  150  DENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAANH  196



>ref|XP_010433659.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=201

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            + EFI+ SC+TTSYP LCF SLSS+A  I+  P+ +A TAL V++  A+S    +  ++ 
Sbjct  34   DIEFIKASCKTTSYPDLCFQSLSSYASEIKQQPRKLAETALAVSMARAKSAKTYVSGMSD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DC+EE+ ++VD L +SL E+K L     G DF   +++++TW SAAL
Sbjct  94   YKGITKRQHEAVEDCIEEMGDTVDRLSKSLKELKHLEEGDSGEDFWFCLSNVRTWTSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC DGF GK     +K+ +R  I+ VA  TSNALALIN FA  H
Sbjct  154  TDETTCLDGFGGKAMDGELKSLIRTHIVSVAEETSNALALINDFASKH  201



>ref|XP_006362116.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
 gb|AIT42249.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC++T++P +C  SLS +A+ I+     +  TAL+V+L  A+ST   + +L + 
Sbjct  30   TSFIKSSCKSTTFPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGR-DFEMKMNDIQTWVSAALT  722
             GL  RE  A++DCVEE ++SVD L  S+ E+K L    G+ DF+  M++++TWVSAA+T
Sbjct  90   KGLKPREYAAIKDCVEETNDSVDRLSRSVNELKGLDRSHGKADFQWHMSNVETWVSAAIT  149

Query  723  DDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            D++TCTDGFAG+     +K ++R  I  +A +TSNALALIN++A  H
Sbjct  150  DENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAANH  196



>ref|XP_010056361.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW73051.1| hypothetical protein EUGRSUZ_E01499 [Eucalyptus grandis]
Length=198

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 3/163 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            T FI++SC T  YP LC  SL  +A  I+  PQ +A  AL V+L  AQST   + R A+ 
Sbjct  33   TNFIKSSCSTVQYPALCVQSLVVYASTIKQSPQQLAQAALAVSLARAQSTKDFVARAAKF  92

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
             GL  RE  A++DC+EE+ +SVD L  S  E+K+    +G+DF+  ++++QTWVSAA TD
Sbjct  93   RGLKAREYAAIKDCLEEMDDSVDRLANSGKELKRAGASKGQDFQWHVSNVQTWVSAASTD  152

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
              TC DG+A       +KT++R +++ VA +TSNALAL+NR+A
Sbjct  153  TTTCLDGYASTALNGRLKTSIRSRVLNVAQVTSNALALVNRYA  195



>ref|XP_009130208.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
Length=201

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 121/183 (66%), Gaps = 9/183 (5%)
 Frame = +3

Query  339  PKL-SAMAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQ  509
            P+L +A  AGA+     FI++SC+TT+YP +CF SLS++A  I+  PQ +A TAL VTL 
Sbjct  20   PELITASPAGASQKAVNFIQSSCKTTTYPAVCFRSLSAYANAIQTSPQRLAETALAVTLS  79

Query  510  TAQSTAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----RDF  674
              QST   + RL R   L  RE+ A++DCVEE++++++ L +S+ EMK L G       F
Sbjct  80   RVQSTKLFVSRLTRFKTLKKREVEAIKDCVEEINDTIERLTKSVQEMK-LCGSAKNQEQF  138

Query  675  EMKMNDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
               M++ QTW SAALTD++TC+DGF+G+     +K +VR +I+ +   TSNAL+LIN + 
Sbjct  139  AFHMSNAQTWTSAALTDENTCSDGFSGRFMDGRIKNSVRARIVNMGQETSNALSLINAYG  198

Query  855  QLH  863
            + +
Sbjct  199  KKY  201



>emb|CDY30715.1| BnaA02g33370D [Brassica napus]
Length=201

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 121/183 (66%), Gaps = 9/183 (5%)
 Frame = +3

Query  339  PKL-SAMAAGATN--TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQ  509
            P+L +A  AGA+     FI++SC+TT+YP +CF SLS++A  I+  PQ +A TAL VTL 
Sbjct  20   PELIAASPAGASQKAVNFIQSSCKTTTYPAVCFRSLSAYANAIQTSPQRLAETALAVTLS  79

Query  510  TAQSTAAAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRG-----RDF  674
              QST   + RL R   L  RE+ A++DCVEE++++++ L +S+ EMK L G       F
Sbjct  80   RVQSTKLFVSRLTRFKTLKKREVEAIKDCVEEINDTIERLTKSVQEMK-LCGSAKNQEQF  138

Query  675  EMKMNDIQTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFA  854
               M++ QTW SAALTD++TC+DGF+G+     +K +VR +I+ +   TSNAL+LIN + 
Sbjct  139  AFHMSNAQTWTSAALTDENTCSDGFSGRFMDGRIKNSVRARIVNMGQETSNALSLINAYG  198

Query  855  QLH  863
            + +
Sbjct  199  KKY  201



>ref|XP_002322406.1| 21K protein precursor [Populus trichocarpa]
 gb|ABK93773.1| unknown [Populus trichocarpa]
 gb|EEF06533.1| 21K protein precursor [Populus trichocarpa]
Length=199

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 112/166 (67%), Gaps = 3/166 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            + FI+ SC  T+YP LC  SLS +A  I+  P+ +  TAL+V+L  AQST   + +L + 
Sbjct  34   SNFIKASCSATTYPALCVQSLSLYASSIKQSPRQLIQTALSVSLDKAQSTKTFVYKLTKF  93

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
             G+  RE  A++DC EE+ +++D+L +S+ E+K +   +G+D++  ++++QTW+SAALTD
Sbjct  94   KGIKPREKAAIKDCFEEIDDTLDKLVKSVKELKNMGSSKGQDYQWHISNVQTWISAALTD  153

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC DGFAGK     VK ++  + + V  +TSNALALIN+F   +
Sbjct  154  ENTCVDGFAGKALDGRVKNSITARFVHVERVTSNALALINKFGSQY  199



>gb|AGJ76633.1| PMEI/InvI [Citrus sinensis]
Length=205

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SA+   +T   FIR SC  T YP LC   LS +   IR + QL A TAL+V+L  A+S A
Sbjct  23   SAIPGHSTPANFIRNSCRATRYPALCVQCLSGYGHAIRNEHQL-AVTALSVSLSRARSAA  81

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQ  698
            A +G+L +  G+  RE  A++DC+E + + VD L +S   LG + +  G+DF   M+ +Q
Sbjct  82   AFVGKLTKVRGIKKREFLAVKDCIENMGDGVDRLSQSVRELGHVGRAVGQDFTWHMSSVQ  141

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TWVSAALTD++TC +GF G+     VK A+R ++  VA +TSNALAL+NRFA  H
Sbjct  142  TWVSAALTDENTCLEGFDGRFMDGNVKAAIRRRVTNVAQVTSNALALVNRFAARH  196



>ref|XP_002875836.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52095.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=201

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 112/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI+ SC+ T+YP +C N+LS +A  I+  P+ +A TAL VT+  AQST   + RL R  
Sbjct  36   NFIQASCKATTYPTVCVNALSGYANSIQTSPRRLAETALNVTVTEAQSTKVFVWRLGRFK  95

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDIQTWVSAALTD  725
             L  REI A++DC+EE+ ++VD L +S+ E+K     +GRD F   M++ QTW SAALT+
Sbjct  96   TLNKREIQAIKDCIEEIHDAVDRLTKSIHEVKMCGSAKGRDQFWFHMSNAQTWTSAALTN  155

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             +TC+DGFAG+V    +K +VR +I+ +   TSNALALIN FA+ +
Sbjct  156  ANTCSDGFAGRVMDGRIKNSVRARIVNLGRGTSNALALINAFAKKY  201



>emb|CDY46918.1| BnaA09g12760D [Brassica napus]
Length=204

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 114/171 (67%), Gaps = 7/171 (4%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TN ++I+TSC  T Y  LC+ SLS +A  I ++PQ +A TAL +TL +A S A  +  + 
Sbjct  33   TNLDYIKTSCNLTHYKTLCYISLSPYALKIDSNPQRLAVTALNLTLSSANSAAKFIKNIP  92

Query  549  RSH-GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRD---FEMKMNDIQTWVSAA  716
                GLT  E GA+ DCVEE+ +SV EL++S+ E++ +   D   FEM M+D++TWVSAA
Sbjct  93   HGRGGLTRFEAGAVADCVEEIGDSVSELQDSIRELESINYEDSSKFEMVMSDVETWVSAA  152

Query  717  LTDDDTCTDGFA--GKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTDDDTC DGF   G+  +  VK  VR  ++KVA LTSNALA+IN +A  H
Sbjct  153  LTDDDTCMDGFGQDGR-AKAVVKDLVRRHVVKVARLTSNALAVINMYASTH  202



>ref|XP_004234937.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=196

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 114/165 (69%), Gaps = 4/165 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI++SC++T++P +C  SLS +A+ I+ +   +  TAL+V+L  A ST   + ++ +  G
Sbjct  32   FIKSSCKSTTFPDVCVASLSGYAQAIKNNQLQLVKTALSVSLNKAGSTKGFVSKMLKFKG  91

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGR-DFEMKMNDIQTWVSAALTDD  728
            L  RE  A++DCVEE S+S+D L  S+ E+K L    G+ DF+  M++++TWVSAA+TD+
Sbjct  92   LKPREYAAIKDCVEETSDSIDRLSRSVNELKSLDHSHGKADFQWHMSNVETWVSAAITDE  151

Query  729  DTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            +TCTDGFAG+     +K ++R  I  +A +TSNALALIN++A  H
Sbjct  152  NTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAANH  196



>ref|XP_006404390.1| hypothetical protein EUTSA_v10010734mg [Eutrema salsugineum]
 gb|ESQ45843.1| hypothetical protein EUTSA_v10010734mg [Eutrema salsugineum]
Length=201

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI+ SC+ T+YP +C +SLS +A  I+  P+ +A TALTVT+  AQST   + RLAR  
Sbjct  36   NFIQASCKATTYPTICISSLSGYANSIQTSPRRLAETALTVTVTQAQSTKVFVSRLARFK  95

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDIQTWVSAALTD  725
            GL  RE+ A++DC+EE++++VD L +S+ E+K     +G D F   M++ QTW SAALT+
Sbjct  96   GLKKREVQAIKDCIEEVNDTVDRLTKSIHEVKMCGSAKGHDQFWFHMSNAQTWTSAALTN  155

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             +TC+DGF+ ++    +K +VR +I  ++  TSNALALIN FAQ +
Sbjct  156  ANTCSDGFSRRIMDGRIKNSVRARIANLSRGTSNALALINAFAQKY  201



>ref|NP_190322.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 emb|CAB51210.1| putative protein [Arabidopsis thaliana]
 gb|AEE78274.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=202

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  378  EFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSH  557
             FI+ SC+ T+YP +C NSL+ +A  I+  P+ +A TAL VT+  AQST   + RL R  
Sbjct  37   NFIQASCKATTYPTVCVNSLTGYANSIQTSPRRLAETALNVTVTQAQSTKVFVWRLGRFT  96

Query  558  GLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRD-FEMKMNDIQTWVSAALTD  725
             L  REI A++DC+EE+ ++VD L  S+ E+K     +GRD F   M++ QTW SAALT+
Sbjct  97   SLKKREIQAVKDCIEEIHDAVDRLTMSIHEVKMCGSAKGRDQFWFHMSNAQTWTSAALTN  156

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
             +TC+DGFAG+V    VK +VR +I+ +   TSNALALIN FA+ +
Sbjct  157  ANTCSDGFAGRVMDGRVKNSVRARILNLGRGTSNALALINAFAKKY  202



>gb|KDP25616.1| hypothetical protein JCGZ_20772 [Jatropha curcas]
Length=202

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = +3

Query  354  MAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAA  533
            + +G++ T+FI++SC+ T YP LC   LS +A  I+ + + +A  AL+V+L  A+S    
Sbjct  21   IVSGSSPTDFIKSSCKATRYPDLCVECLSGYASAIQQNEKHLAEVALSVSLARAKSATDY  80

Query  534  MGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQTW  704
            +  L +  G+  RE  A++DC+E + +SVD L +S   LG M    G+DF   M+++QTW
Sbjct  81   VTTLTKVRGIKAREYQAVKDCIENMGDSVDRLSQSIKELGHMGGAVGQDFVWHMSNVQTW  140

Query  705  VSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            VSAALTD++TC DGFAG+     VK A++ +I  V  +TSNALAL+NRFA  H
Sbjct  141  VSAALTDENTCLDGFAGRRMDGSVKAAIKHRITNVVKVTSNALALVNRFASRH  193



>ref|XP_011010941.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=199

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 111/166 (67%), Gaps = 3/166 (2%)
 Frame = +3

Query  375  TEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARS  554
            + FI+ SC  T+YP LC   LS +A  I+  P+ +  TAL+V+L  AQST   + +L + 
Sbjct  34   SNFIKASCSATTYPALCVQCLSLYASSIKQSPRQLIQTALSVSLDKAQSTKTFVYKLTKF  93

Query  555  HGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTD  725
             G+  RE  A++DC EE+ +++D+L +S+ E+K +   +G+D++  ++++QTW+SAALTD
Sbjct  94   KGIKPREKAAIKDCFEEIDDTLDKLVKSVKELKNMGSSKGQDYQWHISNVQTWISAALTD  153

Query  726  DDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            ++TC DGFAGK     VK ++  + + V  +TSNALALIN+F   +
Sbjct  154  ENTCVDGFAGKALNGRVKNSITARFVHVERVTSNALALINKFGSKY  199



>emb|CDY31839.1| BnaC09g13100D [Brassica napus]
Length=204

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 114/171 (67%), Gaps = 7/171 (4%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TN ++I+TSC  T Y  LC+ SLS +A  I ++PQ +A TAL +TL +A+S A  +    
Sbjct  33   TNLDYIKTSCNLTHYKTLCYISLSPYALKIDSNPQRLAVTALNLTLSSAKSAAKFIKNFP  92

Query  549  RSH-GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRD---FEMKMNDIQTWVSAA  716
                GLT  E GA+ DCVEE+ +SV EL++S+ E++ +   D   FEM M+D++TWVSAA
Sbjct  93   HGRSGLTRFEAGAVADCVEEIGDSVSELQDSIRELESINYEDSSKFEMVMSDVETWVSAA  152

Query  717  LTDDDTCTDGFA--GKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTDDDTC DGF   G+  +  VK  VR  ++KVA +TSNALA+IN +A  H
Sbjct  153  LTDDDTCMDGFGQDGR-AKAVVKDLVRRHVVKVARMTSNALAVINMYASTH  202



>ref|XP_009113052.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=220

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 113/171 (66%), Gaps = 7/171 (4%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            TN ++I+TSC  T Y  LC+ SLS +A  I ++PQ +A TAL +TL +A S A  +  + 
Sbjct  49   TNLDYIKTSCNLTHYKTLCYISLSPYALKIDSNPQRLAVTALNLTLSSANSAAKFIKNIP  108

Query  549  RSH-GLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRD---FEMKMNDIQTWVSAA  716
                GLT  E GA+ DCVEE+ +SV EL++S+ E+  +   D   FEM M+D++TWVSAA
Sbjct  109  HGRGGLTRFEAGAVADCVEEIGDSVSELQDSIRELDSINYEDSSKFEMVMSDVETWVSAA  168

Query  717  LTDDDTCTDGFA--GKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            LTDDDTC DGF   G+  +  VK  VR  ++KVA LTSNALA+IN +A  H
Sbjct  169  LTDDDTCMDGFGQDGRA-KAVVKDLVRRHVVKVARLTSNALAVINMYASTH  218



>ref|XP_007039952.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
 gb|EOY24453.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
Length=206

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            +I  SC+ T YP LC   LS +A  IR D Q +A TAL+V+L  AQS AA + ++ +  G
Sbjct  34   YIVASCKATRYPALCVQCLSGYASEIRQDEQHLARTALSVSLSKAQSAAAFVAKMTQVRG  93

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQLR---GRDFEMKMNDIQTWVSAALTDDD  731
            +  RE  A++DC+E + + VD L +S+ E+  +    G+DF   M+++QTWVSAALTD++
Sbjct  94   IKPRERQAVKDCIENMGDGVDRLSKSVKELSHVGRAVGQDFMWHMSNVQTWVSAALTDEN  153

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALIN  845
            TC DGFAG+V    +KTA+R +++ VA +TSNALAL+N
Sbjct  154  TCLDGFAGRVMDGNIKTAIRRRVVNVAQVTSNALALVN  191



>ref|XP_004245727.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=206

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 114/176 (65%), Gaps = 4/176 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SAMA+     +FI+ SC+ T YP LC   LS+ A  ++   + +AH AL+V+L  A+ST 
Sbjct  27   SAMASNPAAIKFIKVSCKATLYPVLCVQCLSAFANTVKQSEKQLAHAALSVSLSKAKSTI  86

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL----RGRDFEMKMNDI  695
              + +L R  GL   E  A++DC++ +S+SVD++ +S+ E+        G+DF   ++++
Sbjct  87   IFVSKLNRMRGLKPIEKQAVKDCMDTMSDSVDQINKSIPELGHTGQFSSGQDFMWHVSNV  146

Query  696  QTWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            QTWVSAALTD+ TC DGF+G      VK A+R +I+ VA +TSNALAL+NRFA  H
Sbjct  147  QTWVSAALTDESTCLDGFSGPGVNVNVKAALRLRILHVAQVTSNALALVNRFADRH  202



>ref|NP_194256.1| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
 emb|CAA23067.1| putative protein [Arabidopsis thaliana]
 emb|CAB81337.1| putative protein [Arabidopsis thaliana]
 gb|AAL24241.1| AT4g25260/F24A6_100 [Arabidopsis thaliana]
 gb|AAL79588.1| AT4g25260/F24A6_100 [Arabidopsis thaliana]
 gb|AEE85032.1| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=201

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 107/168 (64%), Gaps = 4/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEFI+ SCETTSYP  CF SLSS+A  I+  P+ +A TAL V++  A+S    +  +  
Sbjct  34   DTEFIKASCETTSYPDRCFQSLSSYASEIKKQPRKLAETALAVSIARAKSAKTYVSEMTD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DC+EE+ ++VD L  SL E+K L     G DF   +++++TW SAAL
Sbjct  94   YKGITKRQHEAVADCLEEMGDTVDRLSNSLKELKHLEEGDSGEDFWFCLSNVRTWTSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+  C DGF GK     +K+ +R  I+ VA  TSNALALIN FA  H
Sbjct  154  TDETACMDGFGGKAMAGELKSLIRTHIVSVAEETSNALALINDFASKH  201



>ref|XP_002509582.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF50969.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=212

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 111/164 (68%), Gaps = 4/164 (2%)
 Frame = +3

Query  369  TNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLA  548
            T+T+++ TSC  T+YP+LC++SL+ +A  I ++P+++A+ ++ VTL   +S +  M  L+
Sbjct  37   TSTQYVETSCRNTTYPKLCYDSLAIYATKIDSNPKMLAYVSMNVTLTATRSASELMKNLS  96

Query  549  RSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAAL  719
            R   LT R+  A+ DCV E+ ++V EL++S+GEM +     G D  + +ND+QTWVSAAL
Sbjct  97   RLKSLTPRQAAAIADCVAEIGQAVYELKKSIGEMGRATSGSGTD-PIIINDVQTWVSAAL  155

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRF  851
            TDD TC DGFAG      VK  V+  + KVA LTS ALALIN F
Sbjct  156  TDDTTCMDGFAGHAIDGEVKNIVKENMTKVARLTSIALALINSF  199



>ref|XP_002318283.1| 21K protein precursor [Populus trichocarpa]
 gb|ABK94466.1| unknown [Populus trichocarpa]
 gb|EEE96503.1| 21K protein precursor [Populus trichocarpa]
Length=198

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 107/164 (65%), Gaps = 3/164 (2%)
 Frame = +3

Query  381  FIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLARSHG  560
            FI+ SC  T+YP LC  SLS +A  I   P+ +  TAL V+L  AQST   + +L +  G
Sbjct  35   FIKASCTATTYPALCVQSLSLYATSINQSPRQLIQTALAVSLDKAQSTKTFVYKLTKFKG  94

Query  561  LTHREIGAMRDCVEELSESVDELRESLGEMKQL---RGRDFEMKMNDIQTWVSAALTDDD  731
            +  RE  A++DC EE+ ++VD L +S+ E+K +   +G DF+  ++++QTW+SA LTD++
Sbjct  95   VKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDEN  154

Query  732  TCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TC DGFAGK     +K +++ + + V  +TSNALALIN+F   +
Sbjct  155  TCVDGFAGKALNGRIKNSIKARFVHVERVTSNALALINKFGSKY  198



>ref|XP_006440387.1| hypothetical protein CICLE_v10022285mg [Citrus clementina]
 gb|ESR53627.1| hypothetical protein CICLE_v10022285mg [Citrus clementina]
Length=205

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            SA+   +T   FIR SC  + YP LC   LS +   IR + QL A TAL+V+L  A+S A
Sbjct  23   SAIPGHSTPANFIRNSCRASRYPALCVQCLSGYGHAIRNEHQL-AVTALSVSLSRARSAA  81

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRES---LGEMKQLRGRDFEMKMNDIQ  698
            A +G+L +  G+  RE  A++DC+E + + VD L +S   LG + +  G+DF   M+ +Q
Sbjct  82   AFVGKLTKVRGIKKREFLAVKDCIENMGDGVDRLSQSVRELGHVGRAVGQDFTWHMSSVQ  141

Query  699  TWVSAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TWVSAALTD++TC D F G+     VK A+R ++  VA +TSNALAL+NRFA  H
Sbjct  142  TWVSAALTDENTCLDDFDGRFMDGNVKAAIRRRVTNVAQVTSNALALVNRFAARH  196



>ref|XP_006413324.1| hypothetical protein EUTSA_v10027588mg [Eutrema salsugineum]
 gb|ESQ54777.1| hypothetical protein EUTSA_v10027588mg [Eutrema salsugineum]
Length=201

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 108/168 (64%), Gaps = 4/168 (2%)
 Frame = +3

Query  372  NTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTAAAMGRLAR  551
            +TEF++ SCETT+YP  CF SLSS+A  I+  P+ +A TAL V    A+S    +  +  
Sbjct  34   DTEFVKASCETTTYPDQCFQSLSSYASEIKKRPRQLAETALAVITARAKSAKTYVSDMTD  93

Query  552  SHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLR----GRDFEMKMNDIQTWVSAAL  719
              G+T R+  A+ DCVEE+ ++VD L +SL E+K L     G DF   +++++TW SAAL
Sbjct  94   YKGITKRQHEAVLDCVEEMGDTVDRLSKSLKELKHLEEGESGEDFWFCLSNVRTWTSAAL  153

Query  720  TDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLH  863
            TD+ TC DGF GK     +K+ +R  I++VA  TSNALALIN FA  H
Sbjct  154  TDETTCLDGFGGKAMDGELKSLIRAHIVRVAQDTSNALALINVFASKH  201



>ref|XP_010273892.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=202

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  348  SAMAAGATNTEFIRTSCETTSYPRLCFNSLSSHARFIRADPQLMAHTALTVTLQTAQSTA  527
            +A +   T  + +R+SC   SYP LC  +LSS+    R    L A  A+TV+L  A++ +
Sbjct  25   TAASRSGTPGDLVRSSCIHASYPNLCLRTLSSYTGSTRTANDL-ARAAVTVSLSRARAVS  83

Query  528  AAMGRLARSHGLTHREIGAMRDCVEELSESVDELRESLGEMKQLRGRDFEMKMNDIQTWV  707
              + RLA+ HG + R+ GA+RDCVE+LS+SVDELRE+L E++ LR   F  +M++ +TWV
Sbjct  84   GCIARLAKLHGGSKRQQGALRDCVEQLSDSVDELRETLAELRHLRRGSFRWQMSNAETWV  143

Query  708  SAALTDDDTCTDGFAGKVTRRGVKTAVRGKIMKVAHLTSNALALINRFAQLHG  866
            SAALT++DTC DGF  KV  + VK AVR KI  VA +TSNAL  INR  + HG
Sbjct  144  SAALTNEDTCLDGFE-KVDGK-VKLAVRRKINNVARVTSNALYFINRLDESHG  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2254357392324