BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30145_g1_i1 len=652 path=[1:0-651]

Length=652
                                                                      Score     E

ref|XP_002274560.1|  PREDICTED: palmitoyl-protein thioesterase 1        176   1e-49   Vitis vinifera
ref|XP_006445409.1|  hypothetical protein CICLE_v10021062mg             174   5e-49   
ref|XP_004983641.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    173   6e-49   
ref|XP_009605499.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    173   8e-49   
ref|XP_003572088.2|  PREDICTED: palmitoyl-protein thioesterase 1-...    172   1e-48   
ref|XP_010089298.1|  Palmitoyl-protein thioesterase 1                   172   1e-48   
ref|XP_006386541.1|  hypothetical protein POPTR_0002s13810g             172   1e-48   
ref|NP_001132014.1|  hypothetical protein                               170   2e-48   Zea mays [maize]
ref|XP_011017335.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    171   2e-48   
ref|XP_006464436.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    174   2e-48   
ref|XP_004246162.2|  PREDICTED: palmitoyl-protein thioesterase 1-...    170   3e-48   
ref|XP_002464925.1|  hypothetical protein SORBIDRAFT_01g028940          170   3e-48   Sorghum bicolor [broomcorn]
gb|KCW76895.1|  hypothetical protein EUGRSUZ_D01239                     170   3e-48   
ref|XP_008355699.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    168   4e-48   
ref|XP_002302491.2|  hypothetical protein POPTR_0002s13810g             172   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006359268.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    170   6e-48   
ref|XP_004306990.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    171   7e-48   
ref|XP_006662607.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    171   9e-48   
ref|NP_001232846.1|  palmitoyl-protein thioesterase 1 precursor         170   1e-47   
gb|ACG35638.1|  palmitoyl-protein thioesterase 1 precursor              170   1e-47   Zea mays [maize]
ref|XP_008658171.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    169   1e-47   
ref|XP_011017334.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    171   1e-47   
gb|EYU19274.1|  hypothetical protein MIMGU_mgv1a010471mg                169   2e-47   
ref|XP_010052813.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    170   2e-47   
ref|XP_011081293.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    171   2e-47   
ref|XP_010052814.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    170   2e-47   
ref|XP_008437044.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    167   2e-47   
ref|XP_008437043.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    167   2e-47   
ref|XP_010052812.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    170   2e-47   
ref|XP_010052811.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    170   3e-47   
ref|XP_009767944.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    168   3e-47   
ref|XP_007157264.1|  hypothetical protein PHAVU_002G056200g             170   3e-47   
ref|NP_001136761.1|  palmitoyl-protein thioesterase 1 precursor         169   4e-47   Zea mays [maize]
ref|XP_010235003.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    168   4e-47   
ref|XP_008437042.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    167   4e-47   
ref|XP_007202352.1|  hypothetical protein PRUPE_ppa008372mg             169   6e-47   
ref|NP_001065397.2|  Os10g0563000                                       168   6e-47   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA42790.1|  TPA: hypothetical protein ZEAMMB73_946813              164   6e-47   
gb|EMS55741.1|  Palmitoyl-protein thioesterase 1                        168   6e-47   
ref|XP_006359249.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    169   9e-47   
ref|XP_007052292.1|  Pentatricopeptide repeat superfamily protein...    175   9e-47   
ref|XP_008437041.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    167   1e-46   
ref|XP_008437040.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    167   1e-46   
ref|XP_003559046.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    167   1e-46   
gb|AFW87849.1|  hypothetical protein ZEAMMB73_061678                    166   1e-46   
ref|XP_008369995.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    169   1e-46   
gb|EMT04362.1|  Palmitoyl-protein thioesterase 1                        167   2e-46   
ref|XP_002511600.1|  Palmitoyl-protein thioesterase 1 precursor, ...    167   2e-46   Ricinus communis
ref|XP_004158129.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-pr...    167   3e-46   
ref|XP_004245795.1|  PREDICTED: palmitoyl-protein thioesterase 1        167   3e-46   
ref|XP_004152390.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    166   3e-46   
ref|XP_006649221.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    166   3e-46   
dbj|BAK02099.1|  predicted protein                                      167   3e-46   
ref|XP_008658169.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    169   4e-46   
ref|XP_008232458.1|  PREDICTED: palmitoyl-protein thioesterase 1        167   4e-46   
emb|CBI25849.3|  unnamed protein product                                166   4e-46   
ref|XP_006837356.1|  hypothetical protein AMTR_s00111p00103430          166   5e-46   
ref|XP_002269785.3|  PREDICTED: palmitoyl-protein thioesterase 1-...    166   7e-46   Vitis vinifera
ref|XP_003552498.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    166   7e-46   
ref|XP_010919692.1|  PREDICTED: palmitoyl-protein thioesterase 1        166   7e-46   
ref|XP_004986087.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    166   8e-46   
ref|XP_010275409.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    166   8e-46   
ref|XP_009790581.1|  PREDICTED: uncharacterized protein LOC104238022    171   9e-46   
ref|XP_003517409.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    166   9e-46   
gb|KFK44000.1|  hypothetical protein AALP_AA1G201800                    164   1e-45   
ref|NP_001048650.1|  Os03g0101100                                       165   1e-45   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93476.1|  Palmitoyl protein thioesterase containing protein...    165   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|ABK23278.1|  unknown                                                 164   2e-45   Picea sitchensis
ref|XP_009347695.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    165   2e-45   
gb|KHG13172.1|  Palmitoyl-protein thioesterase 1                        165   2e-45   
gb|AFK44258.1|  unknown                                                 164   2e-45   
ref|XP_002468707.1|  hypothetical protein SORBIDRAFT_01g050600          164   2e-45   Sorghum bicolor [broomcorn]
ref|XP_010054693.1|  PREDICTED: uncharacterized protein LOC104443025    169   3e-45   
emb|CDX67823.1|  BnaA07g18630D                                          164   4e-45   
ref|XP_008798849.1|  PREDICTED: palmitoyl-protein thioesterase 1        164   5e-45   
ref|XP_009104259.1|  PREDICTED: palmitoyl-protein thioesterase 1        164   5e-45   
ref|XP_004983640.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    163   6e-45   
emb|CDP09444.1|  unnamed protein product                                164   6e-45   
gb|AAR92492.1|  putative palmitoyl-protein thioesterase                 164   6e-45   Tropaeolum majus
ref|NP_191593.1|  palmitoyl protein thioesterase family protein         163   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009605498.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    164   7e-45   
ref|XP_006285286.1|  hypothetical protein CARUB_v10006663mg             159   7e-45   
ref|XP_010524433.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    163   8e-45   
gb|AAK59537.1|  putative palmitoyl-protein thioesterase precursor       163   8e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30728.1|  Palmitoyl-protein thioesterase 1                        163   1e-44   
ref|XP_006347949.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    163   1e-44   
gb|EMS63343.1|  Palmitoyl-protein thioesterase 1                        162   1e-44   
gb|AFY98638.1|  palmitoyl-protein thioesterase                          163   1e-44   
ref|XP_006402591.1|  hypothetical protein EUTSA_v10006085mg             162   1e-44   
ref|XP_010229362.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    162   1e-44   
ref|XP_002876550.1|  palmitoyl protein thioesterase family protein      162   2e-44   
emb|CDY64763.1|  BnaC06g42800D                                          162   2e-44   
ref|XP_004489139.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   2e-44   
ref|XP_010512353.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    162   2e-44   
ref|XP_009383948.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   2e-44   
gb|KHN42678.1|  Palmitoyl-protein thioesterase 1                        162   2e-44   
ref|XP_004300365.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   3e-44   
ref|XP_010524432.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    163   4e-44   
ref|XP_010413568.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    161   5e-44   
ref|XP_009123837.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    156   5e-44   
gb|AAM65342.1|  palmitoyl-protein thioesterase precursor-like           161   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258785.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   6e-44   
ref|XP_008369436.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   6e-44   
ref|XP_006291453.1|  hypothetical protein CARUB_v10017590mg             161   6e-44   
dbj|BAJ88880.1|  predicted protein                                      160   6e-44   
ref|XP_009342091.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   7e-44   
ref|XP_009334531.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    161   7e-44   
ref|XP_006414227.1|  hypothetical protein EUTSA_v10025863mg             160   7e-44   
ref|XP_002531468.1|  Palmitoyl-protein thioesterase 1 precursor, ...    160   8e-44   Ricinus communis
gb|KDO61327.1|  hypothetical protein CISIN_1g024701mg                   158   1e-43   
gb|KDO61326.1|  hypothetical protein CISIN_1g024701mg                   158   1e-43   
ref|XP_006440242.1|  hypothetical protein CICLE_v10020946mg             159   1e-43   
ref|XP_010677184.1|  PREDICTED: uncharacterized protein LOC104892862    165   1e-43   
ref|XP_009144476.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    157   1e-43   
ref|XP_004229756.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    159   1e-43   
gb|KGN55843.1|  hypothetical protein Csa_3G019340                       155   2e-43   
ref|XP_010434662.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    158   2e-43   
ref|XP_006440241.1|  hypothetical protein CICLE_v10020946mg             159   2e-43   
ref|XP_010544577.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    159   3e-43   
ref|XP_008448812.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    158   3e-43   
gb|KDP28824.1|  hypothetical protein JCGZ_14595                         159   3e-43   
gb|KCW71934.1|  hypothetical protein EUGRSUZ_E00394                     159   3e-43   
ref|XP_010055462.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    159   3e-43   
gb|EMS65899.1|  Palmitoyl-protein thioesterase 1                        158   5e-43   
ref|XP_010451416.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    157   6e-43   
emb|CDY18971.1|  BnaC01g20970D                                          157   7e-43   
ref|XP_009144453.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    157   9e-43   
ref|NP_199545.2|  palmitoyl protein thioesterase family protein         156   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304295.2|  hypothetical protein POPTR_0003s07790g             158   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006477132.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    157   3e-42   
ref|XP_006285186.1|  hypothetical protein CARUB_v10006536mg             155   3e-42   
ref|XP_011089658.1|  PREDICTED: palmitoyl-protein thioesterase 1        156   3e-42   
gb|AAM63476.1|  palmitoyl-protein thioesterase precursor-like           155   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449610.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    155   4e-42   
ref|XP_003611348.1|  Palmitoyl-protein thioesterase                     155   5e-42   
emb|CAN68811.1|  hypothetical protein VITISV_001083                     154   5e-42   Vitis vinifera
emb|CDP10012.1|  unnamed protein product                                157   7e-42   
ref|XP_004511715.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   7e-42   
ref|XP_009591270.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    155   8e-42   
gb|AAO42190.1|  putative palmitoyl-protein thioesterase precursor       154   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199544.1|  palmitoyl protein thioesterase family protein         154   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439999.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    154   1e-41   
ref|XP_010439997.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    154   1e-41   
ref|NP_193478.1|  palmitoyl protein thioesterase family protein         154   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411584.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   1e-41   
ref|XP_010439998.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   1e-41   
ref|XP_009797091.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    153   1e-41   
ref|XP_002865123.1|  palmitoyl protein thioesterase family protein      154   2e-41   
gb|ABK93080.1|  unknown                                                 156   2e-41   Populus trichocarpa [western balsam poplar]
emb|CDY18970.1|  BnaC01g20980D                                          150   2e-41   
ref|XP_009797089.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    154   2e-41   
ref|XP_006368987.1|  hypothetical protein POPTR_0001s15440g             154   2e-41   
ref|XP_002865126.1|  hypothetical protein ARALYDRAFT_494249             154   2e-41   
ref|XP_009591271.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   2e-41   
gb|KFK24549.1|  hypothetical protein AALP_AAs62283U000300               153   2e-41   
ref|XP_009591269.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   2e-41   
ref|XP_004511713.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   3e-41   
ref|XP_010440002.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    153   3e-41   
ref|XP_006368986.1|  hypothetical protein POPTR_0001s15440g             154   3e-41   
ref|XP_011047609.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    154   3e-41   
gb|KDO61330.1|  hypothetical protein CISIN_1g024701mg                   151   3e-41   
ref|XP_004511714.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    153   3e-41   
ref|XP_009144465.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    153   3e-41   
ref|XP_009797090.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    154   4e-41   
gb|EYU31902.1|  hypothetical protein MIMGU_mgv1a010171mg                153   4e-41   
gb|EYU19286.1|  hypothetical protein MIMGU_mgv1a021282mg                150   4e-41   
ref|XP_009797088.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    153   5e-41   
gb|EPS59624.1|  hypothetical protein M569_15181                         152   6e-41   
ref|XP_001765759.1|  predicted protein                                  151   9e-41   
ref|XP_006280829.1|  hypothetical protein CARUB_v10026804mg             152   9e-41   
gb|ABD65098.1|  palmitoyl protein thioesterase family protein           152   9e-41   Brassica oleracea
ref|XP_010441474.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    152   1e-40   
ref|XP_008238428.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    152   1e-40   
ref|XP_007210516.1|  hypothetical protein PRUPE_ppa007666mg             152   1e-40   
ref|XP_010529980.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    151   2e-40   
ref|XP_002868063.1|  palmitoyl protein thioesterase family protein      151   2e-40   
gb|KCW77193.1|  hypothetical protein EUGRSUZ_D01540                     147   2e-40   
ref|XP_007039751.1|  Alpha/beta-Hydrolases superfamily protein is...    152   3e-40   
gb|KDP39913.1|  hypothetical protein JCGZ_03444                         151   3e-40   
emb|CDY41045.1|  BnaA09g18240D                                          150   3e-40   
ref|XP_010481340.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    150   3e-40   
emb|CDX77758.1|  BnaC07g20120D                                          150   5e-40   
gb|KFK31386.1|  hypothetical protein AALP_AA6G105200                    150   6e-40   
ref|XP_007039750.1|  Alpha/beta-Hydrolases superfamily protein is...    152   6e-40   
ref|XP_010481339.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    149   6e-40   
ref|XP_010434663.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    149   7e-40   
gb|ABD64963.1|  palmitoyl protein thioesterase family protein           150   7e-40   Brassica oleracea
ref|XP_010494964.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    149   2e-39   
ref|XP_006285486.1|  hypothetical protein CARUB_v10006914mg             148   2e-39   
emb|CDY64683.1|  BnaA06g40130D                                          149   2e-39   
ref|NP_193477.1|  putative palmitoyl-protein thioesterase               148   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865124.1|  palmitoyl protein thioesterase family protein      148   2e-39   
dbj|BAA97168.1|  palmitoyl-protein thioesterase precursor-like          147   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30318.1|  hypothetical protein AALP_AA7G246200                    147   5e-39   
ref|XP_006398427.1|  hypothetical protein EUTSA_v10000967mg             147   5e-39   
ref|XP_002863365.1|  predicted protein                                  147   6e-39   
ref|XP_010440003.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    146   6e-39   
gb|KFK24041.1|  hypothetical protein AALP_AAs42697U000100               147   7e-39   
ref|XP_010449612.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    147   8e-39   
ref|XP_010481338.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    147   8e-39   
emb|CDY25974.1|  BnaC09g20130D                                          146   1e-38   
ref|XP_011081401.1|  PREDICTED: palmitoyl-protein thioesterase 3        145   1e-38   
gb|AAG60184.1|AC084763_4  putative palmitoyl-protein thioesterase       145   2e-38   Oryza sativa [red rice]
ref|XP_010494966.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    145   2e-38   
ref|XP_008353815.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-pr...    142   2e-38   
emb|CDP10011.1|  unnamed protein product                                146   3e-38   
ref|XP_006414226.1|  hypothetical protein EUTSA_v10025854mg             145   3e-38   
emb|CDX90472.1|  BnaA03g43090D                                          145   3e-38   
ref|XP_009136845.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    145   3e-38   
gb|EYU19279.1|  hypothetical protein MIMGU_mgv1a021288mg                142   3e-38   
ref|XP_010434661.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    144   6e-38   
dbj|BAD43298.1|  unknown protein                                        140   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449608.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    144   6e-38   
ref|XP_010677098.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    144   6e-38   
ref|XP_009108322.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    144   6e-38   
ref|XP_010440001.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    144   6e-38   
gb|ABD65142.1|  palmitoyl protein thioesterase family protein           144   7e-38   Brassica oleracea
dbj|BAJ93249.1|  predicted protein                                      140   8e-38   
ref|XP_010518714.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    143   9e-38   
ref|XP_010677096.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    144   1e-37   
ref|XP_006282269.1|  hypothetical protein CARUB_v10028547mg             143   1e-37   
ref|XP_002865125.1|  predicted protein                                  144   1e-37   
gb|ABD65081.1|  palmitoyl protein thioesterase family protein           143   1e-37   Brassica oleracea
emb|CDY09625.1|  BnaC07g34360D                                          144   2e-37   
ref|XP_010440000.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    144   2e-37   
gb|ACO35364.1|  palmitoyl protein thioesterase                          143   2e-37   Elaeis oleifera
ref|NP_193479.1|  putative palmitoyl-(protein) hydrolase                142   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19278.1|  hypothetical protein MIMGU_mgv1a023056mg                141   7e-37   
ref|XP_010325388.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    142   8e-37   
ref|XP_002868061.1|  palmitoyl protein thioesterase family protein      141   1e-36   
ref|XP_010449616.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    140   2e-36   
ref|XP_009387902.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    135   3e-36   
ref|XP_010439996.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    140   3e-36   
ref|XP_010449611.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    139   3e-36   
ref|XP_006282773.1|  hypothetical protein CARUB_v10006201mg             139   4e-36   
gb|AAM61704.1|  palmitoyl-protein thioesterase precursor-like           140   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010696248.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    138   4e-36   
ref|XP_010696247.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    138   5e-36   
ref|NP_199546.1|  alpha/beta-Hydrolases superfamily protein             139   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010696246.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    138   6e-36   
emb|CAB10529.1|  thioesterase like protein                              142   7e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76572.1|  BnaA08g08280D                                          141   9e-36   
ref|XP_002877170.1|  hypothetical protein ARALYDRAFT_323005             136   5e-35   
ref|XP_006414225.1|  hypothetical protein EUTSA_v10026142mg             133   2e-34   
ref|XP_002967315.1|  hypothetical protein SELMODRAFT_168809             135   3e-34   
ref|XP_002960405.1|  hypothetical protein SELMODRAFT_74606              135   3e-34   
ref|XP_010104856.1|  Palmitoyl-protein thioesterase 1                   129   5e-32   
gb|EYU19277.1|  hypothetical protein MIMGU_mgv1a0236221mg               123   1e-31   
emb|CDY67058.1|  BnaAnng23510D                                          122   3e-31   
ref|XP_002863363.1|  hypothetical protein ARALYDRAFT_916694             121   3e-31   
gb|ABD64925.1|  palmitoyl-protein thioesterase -related                 119   5e-30   Brassica oleracea
ref|XP_001763636.1|  predicted protein                                  124   7e-30   
emb|CAN78143.1|  hypothetical protein VITISV_032028                     124   1e-29   Vitis vinifera
ref|XP_010677097.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    120   1e-28   
ref|XP_010696249.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    115   2e-27   
gb|KDO85536.1|  hypothetical protein CISIN_1g016717mg                   115   5e-27   
ref|XP_010275410.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    115   5e-27   
gb|KDO61331.1|  hypothetical protein CISIN_1g024701mg                   110   4e-26   
gb|KDO61333.1|  hypothetical protein CISIN_1g024701mg                   109   5e-26   
ref|XP_006440240.1|  hypothetical protein CICLE_v10020946mg             112   5e-26   
gb|KDO61332.1|  hypothetical protein CISIN_1g024701mg                   110   1e-25   
gb|AFK39282.1|  unknown                                                 105   8e-25   
ref|XP_006590575.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    106   2e-24   
gb|AIG56250.1|  secreted protein                                        107   6e-24   
ref|XP_004511717.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    105   1e-23   
gb|KHN34910.1|  Palmitoyl-protein thioesterase 3                        104   2e-23   
gb|EJY65300.1|  Palmitoyl-protein thioesterase 1                        102   1e-22   
emb|CCA21412.1|  palmitoylprotein thioesterase 1 putative               101   7e-22   
gb|KDO35472.1|  hypothetical protein SPRG_00319                         100   1e-21   
gb|AIG55480.1|  secreted protein                                        100   2e-21   
gb|EFA78126.1|  palmitoyl-protein thioesterase 1                        101   5e-21   Polysphondylium pallidum PN500
ref|XP_002400476.1|  palmitoyl-protein thioesterase precursor, pu...  98.2    8e-21   Ixodes scapularis [blacklegged tick]
gb|AIG56249.1|  secreted protein                                      98.2    1e-20   
gb|EUC58525.1|  palmitoyl-protein thioesterase                        96.7    1e-20   
emb|CEG83055.1|  hypothetical protein RMATCC62417_17031               95.1    1e-20   
gb|EPY49496.1|  palmitoyl protein thioesterase-dolichol pyrophosp...    100   1e-20   
dbj|GAM27989.1|  hypothetical protein SAMD00019534_111650             97.4    1e-20   
gb|KEP50576.1|  palmitoyl-protein thioesterase                        96.7    3e-20   
ref|XP_008607440.1|  hypothetical protein SDRG_03581                  96.7    4e-20   
ref|XP_003292685.1|  hypothetical protein DICPUDRAFT_157425           95.9    4e-20   
gb|KDO35471.1|  hypothetical protein SPRG_00318                       95.9    6e-20   
ref|XP_005848514.1|  hypothetical protein CHLNCDRAFT_35163            95.5    6e-20   
ref|XP_008873712.1|  hypothetical protein H310_09425                  94.7    1e-19   
gb|KHN20475.1|  Palmitoyl-protein thioesterase 1                      90.9    2e-19   
gb|ACZ01968.1|  unknown                                               90.1    2e-19   
ref|XP_009521054.1|  hypothetical protein PHYSODRAFT_555467           94.0    2e-19   
ref|XP_003057898.1|  palmitoyl-protein thioesterase                   94.7    2e-19   
ref|XP_008607441.1|  hypothetical protein SDRG_03582                  94.0    2e-19   
ref|XP_009844600.1|  hypothetical protein H257_17487                  94.0    3e-19   
dbj|GAM19389.1|  hypothetical protein SAMD00019534_025640             93.6    3e-19   
ref|XP_001019974.1|  Palmitoyl protein thioesterase containing pr...  92.8    5e-19   
gb|KDN44964.1|  hypothetical protein RSAG8_05137                      90.9    7e-19   
emb|CAB10528.1|  thioesterase like protein                            92.4    8e-19   
emb|CCI49813.1|  unnamed protein product                              94.0    2e-18   
ref|XP_008873709.1|  hypothetical protein, variant 1                  91.3    2e-18   
gb|EPX75144.1|  palmitoyl protein thioesterase-dolichol pyrophosp...  93.6    2e-18   
emb|CBY19151.1|  unnamed protein product                              90.5    4e-18   
gb|ELU36948.1|  palmitoyl-protein thioesterase                        90.1    4e-18   
emb|CEL60494.1|  palmitoyl-protein thioesterase                       90.5    4e-18   
ref|XP_002125680.1|  PREDICTED: palmitoyl-protein thioesterase 1      90.1    5e-18   
ref|XP_010696250.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  88.6    5e-18   
ref|XP_002904995.1|  palmitoyl-protein thioesterase 1, putative       89.7    6e-18   
gb|EMC79467.1|  Palmitoyl-protein thioesterase 1                      89.0    8e-18   
emb|CCO31251.1|  palmitoyl-protein thioesterase                       89.4    9e-18   
ref|XP_002112536.1|  hypothetical protein TRIADDRAFT_25162            89.0    1e-17   
ref|XP_004039360.1|  protein kinase domain protein                    91.3    1e-17   
ref|XP_005512879.1|  PREDICTED: palmitoyl-protein thioesterase 1      88.6    1e-17   
ref|XP_009144493.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  84.7    1e-17   
ref|XP_008912291.1|  hypothetical protein PPTG_16502                  89.0    1e-17   
ref|XP_010224655.1|  PREDICTED: palmitoyl-protein thioesterase 1      87.8    2e-17   
gb|KGL85294.1|  Palmitoyl-protein thioesterase 1                      87.8    2e-17   
ref|XP_010135265.1|  PREDICTED: palmitoyl-protein thioesterase 1      88.2    2e-17   
gb|KFO90229.1|  Palmitoyl-protein thioesterase 1                      88.2    2e-17   
ref|XP_008496673.1|  PREDICTED: palmitoyl-protein thioesterase 1      88.6    2e-17   
emb|CDW83133.1|  palmitoyl-protein thioesterase 1-like                88.2    2e-17   
gb|ETL30639.1|  hypothetical protein L916_16434                       88.6    2e-17   
gb|AIG55479.1|  secreted protein                                      88.6    2e-17   
ref|XP_009998883.1|  PREDICTED: palmitoyl-protein thioesterase 1      87.8    2e-17   
gb|KFU91852.1|  Palmitoyl-protein thioesterase 1                      87.8    2e-17   
gb|KFP27613.1|  Palmitoyl-protein thioesterase 1                      87.8    3e-17   
gb|KDD74445.1|  palmitoyl protein thioesterase                        87.8    3e-17   
ref|XP_010209089.1|  PREDICTED: palmitoyl-protein thioesterase 1      87.4    3e-17   
emb|CBY34234.1|  unnamed protein product                              86.7    5e-17   
ref|NP_001091368.1|  palmitoyl-protein thioesterase 1 precursor       87.0    5e-17   
ref|XP_005529790.1|  PREDICTED: palmitoyl-protein thioesterase 1      87.0    5e-17   
ref|XP_007328415.1|  hypothetical protein AGABI1DRAFT_112549          87.0    5e-17   
emb|CEG63420.1|  hypothetical protein RMATCC62417_00564               87.4    5e-17   
ref|XP_006460944.1|  hypothetical protein AGABI2DRAFT_192516          87.0    6e-17   
emb|CEJ00038.1|  hypothetical protein RMCBS344292_14107               86.7    6e-17   
ref|XP_004371954.1|  PREDICTED: palmitoyl-protein thioesterase 1      87.0    6e-17   
gb|KIJ49683.1|  hypothetical protein M422DRAFT_205209                 87.0    6e-17   
ref|XP_005494779.1|  PREDICTED: palmitoyl-protein thioesterase 1      85.5    7e-17   
ref|XP_009274577.1|  PREDICTED: palmitoyl-protein thioesterase 1      86.7    7e-17   
ref|XP_010406376.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  86.3    7e-17   
ref|XP_009068290.1|  PREDICTED: palmitoyl-protein thioesterase 1      86.3    7e-17   
gb|KFM05523.1|  Palmitoyl-protein thioesterase 1                      86.3    7e-17   
ref|XP_638108.1|  palmitoyl-protein thioesterase 1                    86.7    8e-17   
gb|KFP75598.1|  Palmitoyl-protein thioesterase 1                      86.3    8e-17   
ref|XP_006886564.1|  PREDICTED: palmitoyl-protein thioesterase 1      86.7    8e-17   
ref|XP_002868064.1|  hypothetical protein ARALYDRAFT_493131           86.7    8e-17   
ref|XP_009330470.1|  PREDICTED: palmitoyl-protein thioesterase 1      86.3    9e-17   
gb|AFK40085.1|  unknown                                               85.5    9e-17   
emb|CEI91623.1|  hypothetical protein RMCBS344292_05906               84.7    9e-17   
gb|AAI29707.1|  LOC100036952 protein                                  86.3    9e-17   
gb|KFW72839.1|  Palmitoyl-protein thioesterase 1                      85.9    1e-16   
ref|XP_008633292.1|  PREDICTED: palmitoyl-protein thioesterase 1      85.9    1e-16   
ref|XP_010303132.1|  PREDICTED: palmitoyl-protein thioesterase 1      85.9    1e-16   
ref|XP_007369008.1|  alpha/beta-hydrolase                             86.3    1e-16   
gb|KFO05345.1|  Palmitoyl-protein thioesterase 1                      85.5    1e-16   
ref|XP_009964313.1|  PREDICTED: palmitoyl-protein thioesterase 1      85.1    2e-16   
gb|KFP49474.1|  Palmitoyl-protein thioesterase 1                      84.0    2e-16   
ref|XP_008149408.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  84.3    2e-16   
ref|XP_009844598.1|  hypothetical protein H257_17486                  85.5    2e-16   
ref|XP_005427166.1|  PREDICTED: palmitoyl-protein thioesterase 1      85.1    2e-16   
ref|XP_008939592.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    2e-16   
ref|XP_003212680.2|  PREDICTED: palmitoyl-protein thioesterase 1      85.1    2e-16   
ref|XP_010084384.1|  PREDICTED: palmitoyl-protein thioesterase 1      85.1    2e-16   
ref|XP_009096833.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    2e-16   
gb|KFV02676.1|  Palmitoyl-protein thioesterase 1                      84.7    2e-16   
ref|XP_007339373.1|  alpha/beta-hydrolase                             85.1    2e-16   
gb|KFX90359.1|  hypothetical protein O988_08246                       85.1    2e-16   
gb|KFP72796.1|  Palmitoyl-protein thioesterase 1                      84.7    2e-16   
gb|KFP43453.1|  Palmitoyl-protein thioesterase 1                      84.7    2e-16   
gb|KFV75094.1|  Palmitoyl-protein thioesterase 1                      84.7    2e-16   
ref|XP_009906837.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    2e-16   
ref|XP_010121836.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    3e-16   
ref|XP_009953402.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    3e-16   
ref|XP_009870644.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    3e-16   
gb|KFZ64625.1|  Palmitoyl-protein thioesterase 1                      84.7    3e-16   
gb|KFP95882.1|  Palmitoyl-protein thioesterase 1                      84.7    3e-16   
gb|KFQ77824.1|  Palmitoyl-protein thioesterase 1                      84.3    3e-16   
ref|XP_009813968.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    3e-16   
ref|XP_009506253.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    3e-16   
gb|KFY23402.1|  hypothetical protein V493_05873                       85.1    3e-16   
ref|XP_009929139.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    3e-16   
gb|KFW92772.1|  Palmitoyl-protein thioesterase 1                      84.7    3e-16   
gb|KFP10855.1|  Palmitoyl-protein thioesterase 1                      84.3    3e-16   
gb|KGL91454.1|  Palmitoyl-protein thioesterase 1                      84.7    3e-16   
gb|EMP28451.1|  Palmitoyl-protein thioesterase 1                      84.3    3e-16   
gb|KFY81946.1|  hypothetical protein V500_10948                       84.7    3e-16   
gb|KFV56592.1|  Palmitoyl-protein thioesterase 1                      84.3    3e-16   
gb|KFP93230.1|  Palmitoyl-protein thioesterase 1                      84.3    3e-16   
ref|XP_010574379.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.7    4e-16   
ref|XP_009172165.1|  hypothetical protein T265_08176                  84.7    4e-16   
ref|XP_004426068.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  83.6    4e-16   
ref|XP_010286701.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    4e-16   
ref|XP_009978743.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    4e-16   
ref|NP_001026074.1|  palmitoyl-protein thioesterase 1 precursor       84.7    4e-16   
gb|KFV00269.1|  Palmitoyl-protein thioesterase 1                      84.3    4e-16   
ref|XP_004359144.1|  palmitoyl-protein thioesterase 3                 84.3    4e-16   
ref|XP_009693844.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    4e-16   
gb|KFQ76277.1|  Palmitoyl-protein thioesterase 1                      84.3    4e-16   
ref|XP_010175567.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    4e-16   
gb|KFR16527.1|  Palmitoyl-protein thioesterase 1                      84.3    4e-16   
gb|KFP62723.1|  Palmitoyl-protein thioesterase 1                      84.3    4e-16   
gb|KFW78199.1|  Palmitoyl-protein thioesterase 1                      84.0    4e-16   
ref|XP_009646870.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    5e-16   
ref|XP_006375122.1|  hypothetical protein POPTR_0014s04550g           81.3    5e-16   
ref|XP_009881100.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.3    5e-16   
ref|XP_007067664.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.0    5e-16   
gb|KFZ11152.1|  hypothetical protein V502_07709                       84.3    5e-16   
ref|XP_005433148.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.0    6e-16   
gb|KFO76849.1|  Palmitoyl-protein thioesterase 1                      84.0    6e-16   
ref|XP_003227610.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.0    6e-16   
ref|XP_009940312.1|  PREDICTED: palmitoyl-protein thioesterase 1      84.0    6e-16   
gb|KFQ30613.1|  Palmitoyl-protein thioesterase 1                      83.6    7e-16   
emb|CCL98365.1|  predicted protein                                    84.0    7e-16   
ref|XP_008149407.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  84.0    7e-16   
ref|XP_010177477.1|  PREDICTED: palmitoyl-protein thioesterase 1      83.6    7e-16   
gb|ELR04396.1|  hypothetical protein GMDG_01472                       83.6    7e-16   
ref|XP_009560155.1|  PREDICTED: palmitoyl-protein thioesterase 1      83.6    7e-16   
ref|XP_005353365.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.8    8e-16   
gb|KFV77895.1|  Palmitoyl-protein thioesterase 1                      83.2    8e-16   
gb|KHJ31945.1|  putative palmitoyl-protein thioesterase precursor     84.0    8e-16   
ref|XP_009666526.1|  PREDICTED: palmitoyl-protein thioesterase 1      83.2    8e-16   
gb|KIM69723.1|  hypothetical protein SCLCIDRAFT_1208233               83.6    9e-16   
gb|KFY87643.1|  hypothetical protein V498_07081                       83.2    1e-15   
ref|XP_009583382.1|  PREDICTED: palmitoyl-protein thioesterase 1      83.2    1e-15   
gb|ELK34615.1|  Palmitoyl-protein thioesterase 1                      83.2    1e-15   
gb|KFZ06556.1|  hypothetical protein V501_07308                       83.2    1e-15   
ref|XP_006114851.1|  PREDICTED: palmitoyl-protein thioesterase 1      83.2    1e-15   
ref|XP_004678900.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  83.2    1e-15   
gb|KFV95616.1|  Palmitoyl-protein thioesterase 1                      82.8    1e-15   
ref|XP_010018924.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.8    1e-15   
gb|EMD32081.1|  hypothetical protein CERSUDRAFT_119066                83.2    1e-15   
emb|CDW84115.1|  palmitoyl-protein thioesterase precursor             83.2    1e-15   
ref|XP_003415366.1|  PREDICTED: palmitoyl-protein thioesterase 1      83.2    1e-15   
ref|XP_002540698.1|  conserved hypothetical protein                   83.2    1e-15   
ref|XP_009469214.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.8    1e-15   
ref|XP_006098259.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.8    1e-15   
gb|KFR03497.1|  Palmitoyl-protein thioesterase 1                      82.8    1e-15   
ref|XP_001749551.1|  hypothetical protein                             84.7    1e-15   
ref|XP_009479693.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
gb|KFQ55185.1|  Palmitoyl-protein thioesterase 1                      82.8    2e-15   
gb|KFQ50899.1|  Palmitoyl-protein thioesterase 1                      82.4    2e-15   
ref|XP_004426067.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  82.8    2e-15   
ref|XP_002637293.1|  C. briggsae CBR-PPT-1 protein                    82.8    2e-15   
ref|XP_005993967.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.8    2e-15   
gb|KFY56100.1|  hypothetical protein V496_06788                       82.8    2e-15   
ref|XP_006904029.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.8    2e-15   
ref|XP_007950880.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
ref|XP_008832493.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
ref|XP_005318164.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
gb|EPS27111.1|  hypothetical protein PDE_02052                        82.8    2e-15   
gb|ERG80540.1|  hypothetical protein ASU_11710                        82.0    2e-15   
emb|CAP36301.2|  Protein CBR-PPT-1                                    82.4    2e-15   
ref|XP_004450685.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
ref|XP_004931557.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  82.0    2e-15   
ref|XP_008600936.1|  palmitoyl protein thioesterase                   82.8    2e-15   
dbj|GAD95270.1|  hypothetical protein AN2497.2                        82.4    2e-15   
ref|XP_004740742.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  81.3    2e-15   
ref|XP_003799033.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
ref|XP_008034457.1|  alpha/beta-hydrolase                             82.4    2e-15   
ref|NP_001085801.1|  lysosomal thioesterase PPT2-B precursor          82.0    2e-15   
ref|XP_006758047.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.4    2e-15   
gb|KGQ06440.1|  Palmitoyl-protein thioesterase 1                      82.4    3e-15   
ref|XP_010158246.1|  PREDICTED: palmitoyl-protein thioesterase 1      82.0    3e-15   
gb|KFV96681.1|  Palmitoyl-protein thioesterase 1                      81.6    3e-15   
gb|KDR21202.1|  Palmitoyl-protein thioesterase 1                      82.0    3e-15   
ref|XP_005234221.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.6    3e-15   
ref|XP_005868751.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.6    3e-15   
ref|XP_004931556.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  82.0    3e-15   
gb|EPQ09247.1|  Palmitoyl-protein thioesterase 1                      81.6    3e-15   
ref|XP_005140145.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.6    3e-15   
gb|EFX86245.1|  hypothetical protein DAPPUDRAFT_308437                81.6    3e-15   
gb|EJT97386.1|  alpha/beta-hydrolase                                  82.0    3e-15   
ref|XP_001698944.1|  hypothetical protein CHLREDRAFT_131913           81.3    4e-15   
ref|XP_001439979.1|  hypothetical protein                             81.3    4e-15   
ref|XP_004415420.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  80.5    4e-15   
ref|XP_002500030.1|  palmitoyl-protein thioesterase                   81.6    4e-15   
ref|XP_003290057.1|  hypothetical protein DICPUDRAFT_154535           81.3    4e-15   
gb|EJY83195.1|  palmitoyl protein thioesterase family protein         81.6    4e-15   
ref|XP_005628890.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  80.5    4e-15   
ref|XP_008071363.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  81.3    4e-15   
ref|XP_004359216.1|  palmitoyl-protein thioesterase 1                 84.0    4e-15   
ref|XP_004591595.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.3    5e-15   
emb|CCQ18670.1|  Palmitoyl protein thioesterase                       81.3    5e-15   
gb|EPS61619.1|  hypothetical protein M569_13177                       80.5    5e-15   
ref|XP_006268031.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.3    5e-15   
gb|KFH45311.1|  Palmitoyl-protein thioesterase-like protein           81.3    5e-15   
gb|ACZ01971.1|  unknown                                               77.4    5e-15   
ref|XP_004665350.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.3    5e-15   
ref|XP_004704995.1|  PREDICTED: palmitoyl-protein thioesterase 1      81.3    6e-15   
ref|XP_006019356.1|  PREDICTED: palmitoyl-protein thioesterase 1      80.9    6e-15   
ref|XP_003736994.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  80.9    6e-15   
ref|XP_001631725.1|  predicted protein                                80.5    6e-15   
gb|KIK68818.1|  hypothetical protein GYMLUDRAFT_34807                 80.9    7e-15   
ref|XP_006992301.1|  PREDICTED: palmitoyl-protein thioesterase 1      80.9    8e-15   
ref|NP_071947.1|  palmitoyl-protein thioesterase 1 precursor          80.9    8e-15   
ref|XP_001951992.1|  PREDICTED: palmitoyl-protein thioesterase 1      80.9    8e-15   
ref|XP_008873708.1|  hypothetical protein H310_09423                  81.3    8e-15   
ref|XP_004740741.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  80.9    8e-15   
ref|XP_008071362.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  80.9    8e-15   
gb|ESA21582.1|  hypothetical protein GLOINDRAFT_334791                80.5    9e-15   
ref|XP_008544079.1|  PREDICTED: palmitoyl-protein thioesterase 1      80.5    9e-15   
ref|XP_002715236.1|  PREDICTED: palmitoyl-protein thioesterase 1      80.5    9e-15   
ref|XP_006677521.1|  hypothetical protein BATDEDRAFT_86823            80.9    9e-15   
ref|XP_003112411.1|  CRE-PPT-1 protein                                80.9    9e-15   
ref|XP_005628889.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...  80.1    1e-14   
ref|XP_005302150.1|  PREDICTED: palmitoyl-protein thioesterase 1      80.5    1e-14   



>ref|XP_002274560.1| PREDICTED: palmitoyl-protein thioesterase 1 [Vitis vinifera]
 emb|CBI16648.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    + G+Y+   Q+HLAPSGY+KIP D+  YL GCRFLPK+NNE+ D +
Sbjct  144  CGSGFICILVDNLIKSGIYSDYVQEHLAPSGYLKIPTDIISYLEGCRFLPKLNNEIIDKR  203

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DTI++P+ ++ FGYYPDG FS+  P  +T++Y +D  G 
Sbjct  204  NSTYKERFSSLQNLVLIMFEHDTILIPKETAWFGYYPDGSFSSVFPANETELYTEDWIGL  263

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  VPG HL I+  ++K Y+VPY++
Sbjct  264  KTLDEAGKVKFISVPGNHLAISRSDMKTYMVPYLE  298



>ref|XP_006445409.1| hypothetical protein CICLE_v10021062mg [Citrus clementina]
 gb|ESR58649.1| hypothetical protein CICLE_v10021062mg [Citrus clementina]
Length=334

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG  P C  +    +  +Y+   QDHLAPSGY KIP D+  YL GC+FLPK+NNE+ +++
Sbjct  136  CGFLPICILLDALVKLEIYSDFLQDHLAPSGYYKIPTDIPEYLKGCKFLPKLNNEIVNER  195

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ D++++P+ +S FGYYPDG F   +P Q+TQ+Y +D  G 
Sbjct  196  NSTYKERFASLENLVLIMFEQDSVLVPKETSWFGYYPDGSFDPLLPAQQTQLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA  163
            +TLDEAGKVKF  V G+HL I+  ++K+YIVPY+K  D SL 
Sbjct  256  KTLDEAGKVKFINVTGSHLEISRSDMKKYIVPYLK--DQSLT  295



>ref|XP_004983641.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Setaria 
italica]
Length=310

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GCRFLPK+NNE++ ++
Sbjct  141  CGSGFLCILIDNLIKLEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIRSER  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG F+  +P Q+T++Y +D  G 
Sbjct  201  NATYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFNPVLPPQETKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAG+VKF  VPG HL I+  ++K+YIVPY+K
Sbjct  261  KTLDEAGRVKFVSVPGGHLRISRSDMKKYIVPYLK  295



>ref|XP_009605499.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nicotiana tomentosiformis]
Length=302

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   PWC   G     G+Y+   Q H APSGY K+PND+ GYL GCR+LPK+NNE+ +  
Sbjct  137  CTGGPWCAGAGGV---GIYSDYVQAHYAPSGYTKLPNDIAGYLKGCRYLPKLNNEIPNAT  193

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            + I K+RFTSL  LVLI+F+ D +I P+ SS FG+Y DG +S  +P Q+T +Y++DTFG 
Sbjct  194  NPIYKQRFTSLKNLVLIMFENDNVINPKESSWFGFYQDGTYSQILPPQQTNLYLEDTFGL  253

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVKF K+PG HL + + E+++Y+ PY+
Sbjct  254  QTLDKAGKVKFIKLPGIHLGMDIQEMQQYVAPYL  287



>ref|XP_003572088.2| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Brachypodium 
distachyon]
Length=307

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIP DM  YL GC+FLPK+NNE+  ++
Sbjct  137  CGSGILCILVDALIQLEIYSNYVQAHLAPSGYLKIPTDMAEYLKGCKFLPKLNNEIPSER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F+  +P QKT++Y +D  G 
Sbjct  197  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGSFNPVLPPQKTKLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDE G+VKF  VPG HL I+  ++K+YIVPY+K
Sbjct  257  RTLDETGRVKFVSVPGGHLRISRSDMKKYIVPYLK  291



>ref|XP_010089298.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
 gb|EXB37623.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
Length=308

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q+HLAPSGY+KIP D+  YLSGC+FLPK+NNE+ +++
Sbjct  111  CGSGWICILIDSLIKSEIYSNYIQEHLAPSGYLKIPTDIDDYLSGCKFLPKLNNEIPNER  170

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF S+  LVLI+F+ DTI++P+ ++ FGYYPDG F + +P Q+T++YI+D  G 
Sbjct  171  NATYKERFASIENLVLIMFEQDTILIPKETAWFGYYPDGTFDSVLPPQETKLYIEDWIGL  230

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAGKVKF  V G HL I+  ++ +YIVPY+
Sbjct  231  RTLDEAGKVKFVSVSGNHLEISRSDMAKYIVPYL  264



>ref|XP_006386541.1| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
 gb|ERP64338.1| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
Length=291

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGYIKIP D+  Y+ GCRFLPK+NNE+++ +
Sbjct  93   CGSTIICALLDDLIKSEIYSSYVQEHLAPSGYIKIPTDIPAYIKGCRFLPKLNNEIKNTR  152

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T +Y +D  G 
Sbjct  153  NSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFDTVLPAQETLLYTEDWIGL  212

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+YI+PY++
Sbjct  213  KTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLE  247



>ref|NP_001132014.1| hypothetical protein [Zea mays]
 gb|ACF80685.1| unknown [Zea mays]
 tpg|DAA42789.1| TPA: hypothetical protein ZEAMMB73_946813 [Zea mays]
Length=239

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q+HLAPSGY+KIP DM  YL  CRFLPK+NNE+ D +
Sbjct  52   CGSGFFCIIVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDKR  111

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++Y +D  G 
Sbjct  112  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYEEDWIGL  171

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  VPG HL I+  ++K+YIVPY+
Sbjct  172  KTLDEAGRVKFVSVPGGHLGISKGDMKKYIVPYL  205



>ref|XP_011017335.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Populus 
euphratica]
 ref|XP_011017336.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Populus 
euphratica]
 ref|XP_011017337.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Populus 
euphratica]
Length=266

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGYIKIP D+  YL GCRFLPK+NNE+++ +
Sbjct  68   CGCTIVCVLLDNLIKSEIYSSYVQEHLAPSGYIKIPTDIPAYLKGCRFLPKLNNEIKNTR  127

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T +Y +D  G 
Sbjct  128  NSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFDTVLPAQETLLYTEDWIGL  187

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+YI+PY++
Sbjct  188  KTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLE  222



>ref|XP_006464436.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Citrus sinensis]
 gb|KDO85535.1| hypothetical protein CISIN_1g016717mg [Citrus sinensis]
Length=384

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG  P C  +    +  +Y+   QDHLAPSGY KIP D+  YL GC+FLPK+NNE+ +++
Sbjct  186  CGFLPICILLDALVKLEIYSDFLQDHLAPSGYYKIPTDIPEYLKGCKFLPKLNNEIVNER  245

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ D++++P+ +S FGYYPDG F   +P Q+TQ+Y +D  G 
Sbjct  246  NSTYKERFASLENLVLIMFEQDSVLVPKETSWFGYYPDGSFDPLLPAQQTQLYTEDWIGL  305

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA  163
            +TLDEAGKVKF  V G+HL I+  ++K+YIVPY+K  D SL 
Sbjct  306  KTLDEAGKVKFINVTGSHLEISRSDMKKYIVPYLK--DQSLT  345



>ref|XP_004246162.2| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum lycopersicum]
Length=270

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   PWC   G  +  G+Y+   Q H APSGYIK+PND+ GYL GCR+LPK+NNE+ +  
Sbjct  102  CTGNPWCDGAGGIFGIGIYSDYVQTHYAPSGYIKLPNDIAGYLRGCRYLPKLNNEIPNAT  161

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            + I K+RFTSL  LVLI+F+ D +I P+ SS FG+Y DG  S  +P Q+T +Y++DTFG 
Sbjct  162  NPIYKERFTSLQNLVLIMFEHDGVITPKESSWFGFYQDGTNSQILPPQQTNLYLEDTFGL  221

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVKF K+PG HLV+ + E+++ +VPY+
Sbjct  222  QTLDKAGKVKFIKLPGYHLVMDIQEMQQNVVPYL  255



>ref|XP_002464925.1| hypothetical protein SORBIDRAFT_01g028940 [Sorghum bicolor]
 gb|EER91923.1| hypothetical protein SORBIDRAFT_01g028940 [Sorghum bicolor]
Length=269

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GCRFLPK+NNE+   +
Sbjct  100  CGSGFVCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIPSAR  159

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P Q+T++Y +D  G 
Sbjct  160  NTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGL  219

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+VKF  VPG HL I+  ++K+YIVPY+
Sbjct  220  RTLDEAGRVKFVSVPGGHLRISRSDMKKYIVPYL  253



>gb|KCW76895.1| hypothetical protein EUGRSUZ_D01239 [Eucalyptus grandis]
Length=266

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEK-GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            CG   +C  +    E  GVY+   Q+HLAPS Y+KIP D+  YL GC+FLPK+NNE+   
Sbjct  68   CGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPKLNNELVHH  127

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++YI+D  G
Sbjct  128  RNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETELYIEDWIG  187

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             +TLDEAGKVKF  V G HL I++ ++++YIVPY+
Sbjct  188  LKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYL  222



>ref|XP_008355699.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Malus domestica]
Length=201

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            C  +    +  +Y+   Q+HLAPSGY+KIP D+ GYL GCRFLPK+NNE++  +++  K+
Sbjct  11   CVLLDDLIQSEIYSDFIQEHLAPSGYLKIPTDIDGYLKGCRFLPKLNNEIKASRNSTYKE  70

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RF SL  LVLI+F+ DT+++P+ +S FGY+PDG F   +P Q+T +Y +D  G +TLDEA
Sbjct  71   RFASLENLVLIMFEQDTVLIPKETSWFGYFPDGAFDPILPAQETMLYTEDWIGLKTLDEA  130

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            GKVKF  V G HL I+  ++K YIVPY++
Sbjct  131  GKVKFINVSGGHLQISRSDMKTYIVPYLE  159



>ref|XP_002302491.2| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
 gb|EEE81764.2| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
Length=340

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGYIKIP D+  Y+ GCRFLPK+NNE+++ +
Sbjct  142  CGSTIICALLDDLIKSEIYSSYVQEHLAPSGYIKIPTDIPAYIKGCRFLPKLNNEIKNTR  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T +Y +D  G 
Sbjct  202  NSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFDTVLPAQETLLYTEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+YI+PY++
Sbjct  262  KTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLE  296



>ref|XP_006359268.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum tuberosum]
Length=280

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   PWC   G     G+Y+   Q H APSGYIK+PND+ GYL GCR+LPK+NNE+ +  
Sbjct  112  CTGNPWCDGAGGISGIGIYSDYVQTHYAPSGYIKLPNDIAGYLRGCRYLPKLNNEIPNAT  171

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            + I K+RFTSL  LVLI+F+ D +I P+ SS FG+Y DG  S  +P Q+T +Y++DTFG 
Sbjct  172  NPIYKERFTSLQNLVLIMFENDDVITPKESSWFGFYQDGTDSQILPPQQTNLYLEDTFGL  231

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVKF K+PG HLV+ + E+++ +VPY+
Sbjct  232  QTLDKAGKVKFIKLPGYHLVMDIQEMQQNVVPYL  265



>ref|XP_004306990.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Fragaria vesca 
subsp. vesca]
Length=331

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGY+KIP D+  YL GC FLPK+NNE+   +
Sbjct  135  CGSEWICVLLDNLIKSEIYSSYIQEHLAPSGYLKIPTDIAAYLKGCTFLPKLNNEINSTR  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RFTSL  LVLI+F+ DTI++P+ +S FGY+PDG F   +P Q+T++Y +D  G 
Sbjct  195  NSTYKERFTSLENLVLIMFEQDTILIPKETSWFGYFPDGAFDPILPAQETELYTEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL IT  ++++Y+VPY++
Sbjct  255  KTLDEAGKVKFINVSGNHLAITKSDMRKYVVPYLE  289



>ref|XP_006662607.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Oryza brachyantha]
Length=353

 Score =   171 bits (434),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM  YL GC+FLPK+NNE+  ++
Sbjct  184  CGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIPTDMTDYLKGCKFLPKLNNEIPSER  243

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG F    P QKT++YI+D  G 
Sbjct  244  NATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGSFGPVQPPQKTKLYIEDWIGL  303

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA*TRRI  148
            +TLDEAG+V+F  VPG HL I+  ++K+YIVPY+K   +S    RR+
Sbjct  304  KTLDEAGRVQFVSVPGGHLSISRSDMKKYIVPYLKPGGSSRQGIRRM  350



>ref|NP_001232846.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
 ref|XP_008651020.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN33930.1| unknown [Zea mays]
 tpg|DAA42787.1| TPA: palmitoyl-protein thioesterase 1 [Zea mays]
Length=325

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q+HLAPSGY+KIP DM  YL  CRFLPK+NNE+ D +
Sbjct  138  CGSGFFCIIVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDKR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++Y +D  G 
Sbjct  198  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYEEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  VPG HL I+  ++K+YIVPY+
Sbjct  258  KTLDEAGRVKFVSVPGGHLGISKGDMKKYIVPYL  291



>gb|ACG35638.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
Length=325

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q+HLAPSGY+KIP DM  YL  CRFLPK+NNE+ D +
Sbjct  138  CGSGFFCIIVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDKR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++Y +D  G 
Sbjct  198  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYEEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  VPG HL I+  ++K+YIVPY+
Sbjct  258  KTLDEAGRVKFVSVPGGHLGISKGDMKKYIVPYL  291



>ref|XP_008658171.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X3 [Zea mays]
Length=282

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GC+FLPK+NNE+   +
Sbjct  111  CGSGFLCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCKFLPKLNNEIPSAR  170

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P Q+T++Y +D  G 
Sbjct  171  NTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGL  230

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  VPG HL IT  ++K+YIVPY+
Sbjct  231  KTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  264



>ref|XP_011017334.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Populus 
euphratica]
Length=340

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGYIKIP D+  YL GCRFLPK+NNE+++ +
Sbjct  142  CGCTIVCVLLDNLIKSEIYSSYVQEHLAPSGYIKIPTDIPAYLKGCRFLPKLNNEIKNTR  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T +Y +D  G 
Sbjct  202  NSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFDTVLPAQETLLYTEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+YI+PY++
Sbjct  262  KTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLE  296



>gb|EYU19274.1| hypothetical protein MIMGU_mgv1a010471mg [Erythranthe guttata]
 gb|EYU19275.1| hypothetical protein MIMGU_mgv1a010471mg [Erythranthe guttata]
Length=311

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PND++GYLS CRFLPK+NNE  D++
Sbjct  98   CGTGIFCIIADNLIKSEIYSDYIQAHLAPSGYLKMPNDIEGYLSKCRFLPKLNNEHADEK  157

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RFTSL  LVLI+F+ DT+++P+ +S FGYYPDG F+  +P Q+T++Y +D  G 
Sbjct  158  NATYKERFTSLQNLVLIMFEHDTVLIPKETSWFGYYPDGAFNPILPPQQTKLYKEDWIGL  217

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + L EAG+VK+ KV G HL I+ D++K+Y+VPY++
Sbjct  218  KELTEAGRVKYIKVAGNHLGISKDDMKKYVVPYLE  252



>ref|XP_010052813.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Eucalyptus 
grandis]
 gb|KCW76894.1| hypothetical protein EUGRSUZ_D01239 [Eucalyptus grandis]
Length=339

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEK-GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            CG   +C  +    E  GVY+   Q+HLAPS Y+KIP D+  YL GC+FLPK+NNE+   
Sbjct  141  CGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPKLNNELVHH  200

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++YI+D  G
Sbjct  201  RNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETELYIEDWIG  260

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             +TLDEAGKVKF  V G HL I++ ++++YIVPY+
Sbjct  261  LKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYL  295



>ref|XP_011081293.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Sesamum indicum]
Length=350

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PN++ GYL+ CRFLPK+NNE+  ++
Sbjct  134  CGTGIFCIIADNLIKSEIYSDYVQAHLAPSGYLKLPNNIAGYLNKCRFLPKLNNELPGER  193

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RFTSL  LVLI+F+ DT+++P+ +S FGYYPDG F+  VP Q+T++Y +D  G 
Sbjct  194  NATYKERFTSLQNLVLIMFEHDTVLIPKETSLFGYYPDGAFTPVVPPQRTKLYTEDWIGL  253

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  VPG HL I+ D++K+Y+VPY++
Sbjct  254  KTLDDAGRVKYITVPGNHLGISKDDMKKYVVPYLE  288



>ref|XP_010052814.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X4 [Eucalyptus 
grandis]
Length=339

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEK-GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            CG   +C  +    E  GVY+   Q+HLAPS Y+KIP D+  YL GC+FLPK+NNE+   
Sbjct  141  CGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPKLNNELVHH  200

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++YI+D  G
Sbjct  201  RNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETELYIEDWIG  260

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             +TLDEAGKVKF  V G HL I++ ++++YIVPY+
Sbjct  261  LKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYL  295



>ref|XP_008437044.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X5 [Cucumis 
melo]
Length=244

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  68   CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDAR  127

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  128  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  187

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  188  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  222



>ref|XP_008437043.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X4 [Cucumis 
melo]
Length=245

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  69   CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDAR  128

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  129  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  188

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  189  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  223



>ref|XP_010052812.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Eucalyptus 
grandis]
Length=354

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEK-GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            CG   +C  +    E  GVY+   Q+HLAPS Y+KIP D+  YL GC+FLPK+NNE+   
Sbjct  156  CGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPKLNNELVHH  215

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++YI+D  G
Sbjct  216  RNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETELYIEDWIG  275

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             +TLDEAGKVKF  V G HL I++ ++++YIVPY+
Sbjct  276  LKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYL  310



>ref|XP_010052811.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Eucalyptus 
grandis]
Length=354

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEK-GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            CG   +C  +    E  GVY+   Q+HLAPS Y+KIP D+  YL GC+FLPK+NNE+   
Sbjct  156  CGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPKLNNELVHH  215

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++YI+D  G
Sbjct  216  RNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETELYIEDWIG  275

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             +TLDEAGKVKF  V G HL I++ ++++YIVPY+
Sbjct  276  LKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYL  310



>ref|XP_009767944.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nicotiana sylvestris]
Length=289

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 109/154 (71%), Gaps = 3/154 (2%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   PWC   G      +Y+   Q H APSGY K+P D+ GYL GCR+LPK+NNE+ +  
Sbjct  137  CTGGPWCAEAGGVR---IYSDYAQAHYAPSGYTKLPKDIAGYLKGCRYLPKLNNEIPNAT  193

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            + I K+RFTSL  LVLI+F+ D++I P+ SS FG+Y DG +S  +P Q+T +Y++DTFG 
Sbjct  194  NPIYKQRFTSLKNLVLIMFENDSVINPKESSWFGFYQDGTYSQILPPQQTNLYLEDTFGL  253

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVKF K+PG HL + + E+++Y+ PY+
Sbjct  254  QTLDKAGKVKFIKLPGIHLGMDIQEMQQYVAPYL  287



>ref|XP_007157264.1| hypothetical protein PHAVU_002G056200g [Phaseolus vulgaris]
 gb|ESW29258.1| hypothetical protein PHAVU_002G056200g [Phaseolus vulgaris]
Length=354

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    Q  +  VY+   Q+HLAPSGY+K+PN +  YL  CRFLP +NNE+ D +
Sbjct  137  CGSGIFCILADQLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCRFLPVLNNEIPDKR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F+  +P Q TQ+YI+D  G 
Sbjct  197  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFNPILPPQSTQLYIEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKV F  VPG HL I+  ++K+Y+VPY+K
Sbjct  257  RTLDEAGKVHFISVPGKHLGISEPDMKKYVVPYLK  291



>ref|NP_001136761.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
 ref|XP_008658170.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Zea mays]
 gb|ACF82561.1| unknown [Zea mays]
 gb|ACG33007.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
 gb|ACR37702.1| unknown [Zea mays]
 gb|AFW87851.1| palmitoyl-protein thioesterase 1 [Zea mays]
Length=309

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GC+FLPK+NNE+   +
Sbjct  138  CGSGFLCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCKFLPKLNNEIPSAR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P Q+T++Y +D  G 
Sbjct  198  NTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  VPG HL IT  ++K+YIVPY+
Sbjct  258  KTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  291



>ref|XP_010235003.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Brachypodium 
distachyon]
Length=285

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = -2

Query  624  TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRF  445
            +IG  +      P    HLAPSGY+KIP DM  YL GC+FLPK+NNE+  +++A  K+RF
Sbjct  123  SIGGPHAGTASVPLCGAHLAPSGYLKIPTDMAEYLKGCKFLPKLNNEIPSERNATYKERF  182

Query  444  TSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGK  265
            +SL  LVLI+FQ D +++P+ ++ FGYYPDG F+  +P QKT++Y +D  G RTLDE G+
Sbjct  183  SSLENLVLIMFQDDAVLIPRETAWFGYYPDGSFNPVLPPQKTKLYTEDWIGLRTLDETGR  242

Query  264  VKFFKVPGAHLVITVDEIKRYIVPYMK  184
            VKF  VPG HL I+  ++K+YIVPY+K
Sbjct  243  VKFVSVPGGHLRISRSDMKKYIVPYLK  269



>ref|XP_008437042.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Cucumis 
melo]
Length=275

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  99   CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDAR  158

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  159  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  218

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  219  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  253



>ref|XP_007202352.1| hypothetical protein PRUPE_ppa008372mg [Prunus persica]
 gb|EMJ03551.1| hypothetical protein PRUPE_ppa008372mg [Prunus persica]
Length=335

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HL+PSGY+KIP D+  YL GCRFLP++NNE +   
Sbjct  139  CGSEWICALLDNLIKSEIYSSYVQEHLSPSGYLKIPTDIAAYLKGCRFLPRLNNERKTMS  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DTI++P+ +S FGY+PDG F   +P Q+T++Y +D  G 
Sbjct  199  NSTYKERFSSLEKLVLIMFEQDTILIPKETSWFGYFPDGAFDPILPAQETKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF KV G HL I+  ++K+Y+VPY++
Sbjct  259  KTLDEAGKVKFIKVSGGHLHISRSDMKKYVVPYLE  293



>ref|NP_001065397.2| Os10g0563000 [Oryza sativa Japonica Group]
 gb|ABB47987.1| Palmitoyl protein thioesterase containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG92988.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67448.1| hypothetical protein OsI_34663 [Oryza sativa Indica Group]
 gb|EEE51405.1| hypothetical protein OsJ_32474 [Oryza sativa Japonica Group]
 dbj|BAF27234.2| Os10g0563000 [Oryza sativa Japonica Group]
Length=314

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM  YL GC+FLPK+NNE+  ++
Sbjct  145  CGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIPTDMTDYLKGCKFLPKLNNEIPSER  204

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS   P QKT++Y +D  G 
Sbjct  205  NATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVQPPQKTKLYTEDWIGL  264

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA*TRRI  148
            + L+EAG+VKF  VPG HL I+  + K+YIVPY+K   +S    RRI
Sbjct  265  KALEEAGRVKFVSVPGGHLSISRSDTKKYIVPYLKPDGSSRFGIRRI  311



>tpg|DAA42790.1| TPA: hypothetical protein ZEAMMB73_946813 [Zea mays]
Length=165

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  579  QDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADT  400
             +HLAPSGY+KIP DM  YL  CRFLPK+NNE+ D ++A  K+RF+SL  LVLI+FQ D 
Sbjct  1    MEHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDKRNATYKERFSSLENLVLIMFQDDA  60

Query  399  IIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITV  220
            +++P+ ++ FGYYPDG F   +P QKT++Y +D  G +TLDEAG+VKF  VPG HL I+ 
Sbjct  61   VLIPRETAWFGYYPDGAFDPVLPPQKTKLYEEDWIGLKTLDEAGRVKFVSVPGGHLGISK  120

Query  219  DEIKRYIVPYM  187
             ++K+YIVPY+
Sbjct  121  GDMKKYIVPYL  131



>gb|EMS55741.1| Palmitoyl-protein thioesterase 1 [Triticum urartu]
Length=322

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGYIKIP DM  YL GCRFLPK+NNE+  ++
Sbjct  133  CGSGIFCVIADALIKLEIYSDYVQAHLAPSGYIKIPTDMDDYLKGCRFLPKLNNEIPGER  192

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  193  NATYKERFSSLENLVLIMFENDIVVIPRETSWFGYYPDGAFEPVLPPQQTKLYQEDWIGL  252

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAG+VKF  VPG HL I+  +++++IVPY+K
Sbjct  253  KTLDEAGRVKFVSVPGGHLGISNSDMRKHIVPYLK  287



>ref|XP_006359249.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum tuberosum]
Length=356

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PN++ GY+  CRFLPK NNE+   +
Sbjct  141  CGSGIFCIIADNLIKSEIYSDFVQAHLAPSGYLKLPNNIPGYMKSCRFLPKFNNEIPSHR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++I KKRF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P QKTQ+Y +D  G 
Sbjct  201  NSIYKKRFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFEPILPAQKTQLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVK+ KV G HL I+  ++K+++VPY+
Sbjct  261  KTLDDAGKVKYVKVAGNHLQISSSDMKKHVVPYL  294



>ref|XP_007052292.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007052293.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007052294.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX96449.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX96450.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX96451.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
Length=890

 Score =   175 bits (444),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 77/155 (50%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGY+KIP D+  YL GCRFLPK+NNE+   +
Sbjct  142  CGSALICILLDSLIKSEIYSNYVQEHLAPSGYLKIPTDLTDYLKGCRFLPKLNNELNGTR  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F + +P Q+T++Y +D  G 
Sbjct  202  NSTYKERFASLQNLVLIMFEDDTVLIPKETSWFGYYPDGSFDSVLPAQETKLYKEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+YIVPY++
Sbjct  262  KTLDEAGKVKFINVSGNHLQISKSDMKKYIVPYLE  296



>ref|XP_008437041.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Cucumis 
melo]
Length=315

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  139  CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDAR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  199  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  259  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  293



>ref|XP_008437040.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  140  CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDAR  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  200  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  260  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  294



>ref|XP_003559046.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Brachypodium 
distachyon]
Length=304

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q HLAPSGY+KIP DMK YL GCRFLPK+NNE+  ++
Sbjct  140  CGSGIFCIIVDALIKLEIYSEYVQAHLAPSGYLKIPTDMKDYLEGCRFLPKLNNEIPGER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   +P QKT++Y++D  G 
Sbjct  200  NATYKERFSSLENLVLIMFEDDIVLIPRETSWFGYYPDGAFDQVLPPQKTKLYMEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            ++LD+ G+VKF  V G HL I+  ++++YIVPY+K
Sbjct  260  KSLDDGGRVKFVSVAGGHLGISDSDMRKYIVPYLK  294



>gb|AFW87849.1| hypothetical protein ZEAMMB73_061678 [Zea mays]
Length=288

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GC+FLPK+NNE+   ++   K+
Sbjct  123  CILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCKFLPKLNNEIPSARNTTYKE  182

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P Q+T++Y +D  G +TLDEA
Sbjct  183  RFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGLKTLDEA  242

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            G+VKF  VPG HL IT  ++K+YIVPY+
Sbjct  243  GRVKFVSVPGGHLRITRSDMKKYIVPYL  270



>ref|XP_008369995.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Malus domestica]
Length=378

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 110/157 (70%), Gaps = 1/157 (1%)
 Frame = -2

Query  651  PCGKFPW-CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQD  475
            P  K  W C  +    +  +Y+   Q+HLAPSGY+KIP D+ GYL GCRFLPK+NNE++ 
Sbjct  180  PFCKCEWICVLLDDLIQSEIYSDFIQEHLAPSGYLKIPTDIDGYLKGCRFLPKLNNEIKA  239

Query  474  DQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTF  295
             +++  K+RF SL  LVLI+F+ DT+++P+ +S FGY+PDG F   +P Q+T +Y +D  
Sbjct  240  SRNSTYKERFASLENLVLIMFEQDTVLIPKETSWFGYFPDGAFDPILPAQETMLYTEDWI  299

Query  294  GFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            G +TLDEAGKVKF  V G HL I+  ++K YIVPY++
Sbjct  300  GLKTLDEAGKVKFINVSGGHLQISRSDMKTYIVPYLE  336



>gb|EMT04362.1| Palmitoyl-protein thioesterase 1 [Aegilops tauschii]
Length=322

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGYIKIP DM  YL GCRFLPK+NNE+  ++
Sbjct  133  CGSGIFCVIADALIKLEIYSDYVQAHLAPSGYIKIPTDMDDYLKGCRFLPKLNNEIPGER  192

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  193  NATYKERFSSLENLVLIMFENDIVVIPRETSWFGYYPDGAFEPVLPPQQTKLYQEDWIGL  252

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + LDEAG+VKF  VPG HL I+  +++++IVPY+K
Sbjct  253  KALDEAGRVKFVSVPGGHLGISNSDMRKHIVPYLK  287



>ref|XP_002511600.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
 gb|EEF50269.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
Length=335

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +       VY+   Q+HLAPSGY+KIP D+  YL GC+FLP++NNE+   Q
Sbjct  142  CGSSTICILVDILIRLEVYSSYVQEHLAPSGYVKIPTDIADYLKGCKFLPRLNNEII--Q  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+R TSL  LVLI+F+ DT+++P+ +S FGYYPDG FS  +PVQ+T++Y +D  G 
Sbjct  200  NSTYKERLTSLENLVLIMFEQDTVLIPKETSWFGYYPDGAFSPVLPVQETKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+ D +K+YIVPY++
Sbjct  260  KTLDEAGKVKFLTVSGNHLQISQDVMKKYIVPYLE  294



>ref|XP_004158129.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-protein thioesterase 
1-like [Cucumis sativus]
Length=316

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  139  CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPDYLEHCKFLPKLNNERPDAR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  199  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  259  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  293



>ref|XP_004245795.1| PREDICTED: palmitoyl-protein thioesterase 1 [Solanum lycopersicum]
Length=357

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PN++ GY+  CRFLPK+NNE+   +
Sbjct  141  CGSGIFCIIADNLIKSEIYSDFVQAHLAPSGYLKLPNNIPGYMKSCRFLPKLNNEIPSHR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P QKTQ+Y +D  G 
Sbjct  201  NSTYKKRFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFEPILPAQKTQLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVK+ KV G HL I+  ++K+++VPY+
Sbjct  261  KTLDDAGKVKYVKVAGNHLQISSRDMKKHVVPYL  294



>ref|XP_004152390.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Cucumis sativus]
Length=316

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q+ LAPSG+IK+PND+  YL  C+FLPK+NNE  D +
Sbjct  139  CGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPDYLEHCKFLPKLNNERPDAR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG+F   +P Q+T++YI+D  G 
Sbjct  199  NSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDE G+VKF KV G HL I+  + K+YIVPY++
Sbjct  259  RSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  293



>ref|XP_006649221.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Oryza brachyantha]
Length=320

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q+HLAPSGY+KIP D++ Y  GCRFLPK+NNE+  ++
Sbjct  139  CGSGIFCMLADSLIKLEIYSDYVQEHLAPSGYMKIPTDIEDYFKGCRFLPKLNNEIPGER  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF++L  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++YI+D  G 
Sbjct  199  NATYKERFSNLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYIEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+ G+VKF  VPG HL I+  ++++YIVPY+K
Sbjct  259  KTLDDDGRVKFVSVPGGHLGISKSDMRKYIVPYLK  293



>dbj|BAK02099.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93710.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGYIKIP DM  YL GCRFLPK+NNE+  ++
Sbjct  142  CGSGIFCIIADALIKLEIYSDYVQAHLAPSGYIKIPTDMDDYLKGCRFLPKLNNEIPGER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  202  NATYKERFSSLENLVLIMFENDIVVIPRETSWFGYYPDGAFEPVLPPQQTKLYQEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + LDEAG+VKF  VPG HL I+  +++++IVPY+K
Sbjct  262  KALDEAGRVKFVSVPGGHLGISNSDMRKHIVPYLK  296



>ref|XP_008658169.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Zea mays]
Length=427

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GC+FLPK+NNE+   +
Sbjct  256  CGSGFLCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCKFLPKLNNEIPSAR  315

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P Q+T++Y +D  G 
Sbjct  316  NTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGL  375

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  VPG HL IT  ++K+YIVPY+
Sbjct  376  KTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  409



>ref|XP_008232458.1| PREDICTED: palmitoyl-protein thioesterase 1 [Prunus mume]
Length=335

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HL+PSGY+KIP D+  YL GCRFLP +NNE+ + +
Sbjct  139  CGSEWICVLLDNLIKSEIYSCFIQEHLSPSGYVKIPTDIAAYLKGCRFLPGLNNEINNMR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DTI++P+ +S FGY+PDG F   +P Q+T++Y +D  G 
Sbjct  199  NSTYKERFSSLEKLVLIMFEQDTILIPKETSWFGYFPDGAFDPILPAQETKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+Y+VPY++
Sbjct  259  KTLDEAGKVKFINVSGGHLHISRSDMKKYVVPYLE  293



>emb|CBI25849.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PND+  YL  CRFLPK+NNE+ D++
Sbjct  110  CGSGVFCIIADNLIKSQIYSDYVQTHLAPSGYLKLPNDIPKYLEKCRFLPKLNNELPDER  169

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  170  NSTYKERFSSLENLVLIMFEQDTVLIPKETSWFGYYPDGAFEPVLPPQQTKLYTEDWIGL  229

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  VPG HL I+  ++K+Y+VPY++
Sbjct  230  KTLDDAGRVKYISVPGNHLGISHSDMKQYVVPYLE  264



>ref|XP_006837356.1| hypothetical protein AMTR_s00111p00103430 [Amborella trichopoda]
 gb|ERN00210.1| hypothetical protein AMTR_s00111p00103430 [Amborella trichopoda]
Length=319

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG+   C  +    +  +Y+   Q+HLAP+G++KIP D++ YL GCRFLPK+NNE+ +++
Sbjct  140  CGRGFICILVDTLIKSEIYSDYVQEHLAPAGFLKIPTDIEDYLKGCRFLPKLNNEIPNER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +  Q+T +Y++D  G 
Sbjct  200  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGSFRTILAPQETALYVEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVKF  VPG HL I+  ++++YIVPY+
Sbjct  260  KTLDDAGKVKFISVPGNHLGISKSDMRKYIVPYL  293



>ref|XP_002269785.3| PREDICTED: palmitoyl-protein thioesterase 1-like [Vitis vinifera]
Length=327

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PND+  YL  CRFLPK+NNE+ D++
Sbjct  137  CGSGVFCIIADNLIKSQIYSDYVQTHLAPSGYLKLPNDIPKYLEKCRFLPKLNNELPDER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  NSTYKERFSSLENLVLIMFEQDTVLIPKETSWFGYYPDGAFEPVLPPQQTKLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  VPG HL I+  ++K+Y+VPY++
Sbjct  257  KTLDDAGRVKYISVPGNHLGISHSDMKQYVVPYLE  291



>ref|XP_003552498.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max]
Length=330

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 108/154 (70%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    + G+Y+   Q +LAPSGY+KIP D+ GY+ GC+FLPK+NNE+ + +
Sbjct  134  CGSESLCTLIDVVLQLGIYSRFAQQNLAPSGYVKIPIDIAGYIRGCKFLPKLNNEIVNKR  193

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  ++RF SL  L+LI+F+ DTI++P+ ++ FGYYP+G     VPVQ+T++YI D  G 
Sbjct  194  NSTYRQRFASLQNLILIMFEQDTIVIPKETAWFGYYPNGALHPVVPVQQTELYIDDWIGL  253

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            R LDEAGKVKF  V G HL I+  ++K YIVPY+
Sbjct  254  RALDEAGKVKFVNVSGDHLDISRSDMKTYIVPYL  287



>ref|XP_010919692.1| PREDICTED: palmitoyl-protein thioesterase 1 [Elaeis guineensis]
Length=328

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIP D+  YL GCRFLPK+NNE+  ++
Sbjct  139  CGSGIICMLVDDLIKSQIYSDYIQAHLAPSGYLKIPTDIPAYLEGCRFLPKLNNEIPSER  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ D++++P+ +S FGYYPDG+F+  +  Q+T +YI+D  G 
Sbjct  199  NSTYKERFSSLQTLVLIMFEQDSVLIPRETSWFGYYPDGNFTPVLSPQQTTLYIEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R LDEAG+VKF  V G HL I+  ++++YIVPY+ 
Sbjct  259  RALDEAGRVKFISVQGGHLRISDSDMQKYIVPYLN  293



>ref|XP_004986087.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Setaria italica]
Length=335

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 108/154 (70%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q HLAPSGY+KIP DM  YL  CRFLPK+NNE+ D +
Sbjct  139  CGSGIFCIIVDALIKLEIYSDYVQAHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDGR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG F   +P QKT++Y +D  G 
Sbjct  199  NATYKERFSSLENLVLIMFENDAVLIPRETAWFGYYPDGAFDPILPPQKTKLYEEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  V G HL I+  ++K+YIVPY+
Sbjct  259  KTLDEAGRVKFVSVAGGHLGISKGDMKKYIVPYL  292



>ref|XP_010275409.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Nelumbo 
nucifera]
Length=329

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIP D+  YL GC+FLPK+NNE+ +++
Sbjct  135  CGSSFICILVDSLIKSEIYSDYVQAHLAPSGYLKIPTDIPAYLEGCKFLPKLNNELPNER  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  L+LI+F+ DT+++P+ +S FGYYPDG FS  +P Q+T++Y +D  G 
Sbjct  195  NSTYKERFSSLENLILIMFEHDTVLIPRETSWFGYYPDGAFSPILPPQQTKLYTEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  VPG HL I+   +K+YIVPY++
Sbjct  255  KTLDDAGRVKYISVPGNHLAISKAGMKKYIVPYLE  289



>ref|XP_009790581.1| PREDICTED: uncharacterized protein LOC104238022 [Nicotiana sylvestris]
Length=665

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   PWC   G     G+Y+   Q H APSGY K+PND+ GYL GCR+LPK+NNE+ +  
Sbjct  497  CAGGPWCAGAGGASGIGIYSDYVQAHYAPSGYTKLPNDISGYLRGCRYLPKLNNEIPNAT  556

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            + I K+RFTSL  LVLI+F+ D +I P+ SS FG+Y DG +S  +P Q+T +Y++DTFG 
Sbjct  557  NPIYKQRFTSLQNLVLIMFENDNVINPKESSWFGFYQDGTYSQILPPQQTNLYLEDTFGL  616

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVKF K+PG HL + + E+++Y+ PY+
Sbjct  617  QTLDKAGKVKFIKLPGYHLGMDIQEMQQYVAPYL  650


 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PN++ GY+  C FLPK+NNE+   +
Sbjct  137  CGSGIFCIIADSLIKSEIYSAFVQAHLAPSGYLKLPNNIAGYMKACHFLPKLNNEIPSHR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRFTSL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P  KT++YI+D  G 
Sbjct  197  NSTYKKRFTSLENLVLIMFEHDTVLIPRETSWFGYYPDGAFDPILPPNKTELYIEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD++GKV++ KV G HL I+ +++++++VPY+
Sbjct  257  KTLDDSGKVQYVKVAGNHLQISSNDMRKHVVPYL  290



>ref|XP_003517409.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max]
Length=367

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   Q+HLAPSGY+K+PN +  YL  CRFLP +NNE+ D +
Sbjct  137  CGSGIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCRFLPVLNNEIPDKR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q T++YI+D  G 
Sbjct  197  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFKPVLPPQSTELYIEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKV F  VPG HL I+ +++K+++VPY+K
Sbjct  257  RTLDEAGKVHFISVPGNHLGISQEDMKKHVVPYLK  291



>gb|KFK44000.1| hypothetical protein AALP_AA1G201800 [Arabis alpina]
Length=303

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC    +  EK +YT   QDHLAPSGYIKIPN +  YL   ++LPK+NNE+   +
Sbjct  138  CGSGIWCEEADKLIEKDIYTDYVQDHLAPSGYIKIPNAITKYLERSKYLPKLNNEIPTQR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAP-VPVQKTQVYIKDTFG  292
            +A  K RFTSL  LVL++FQ DT+I+P+ SS FG+YPD   + P +  Q+T++Y +D  G
Sbjct  198  NATYKNRFTSLHNLVLVMFQNDTVIVPRDSSWFGFYPDNGANQPLLSAQQTKLYTEDWIG  257

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             +TLD AGKVKF  VPG HL + + +I +Y+VPY++
Sbjct  258  LKTLDVAGKVKFVSVPGGHLQMAIQDIVKYVVPYLQ  293



>ref|NP_001048650.1| Os03g0101100 [Oryza sativa Japonica Group]
 gb|ABF93475.1| Palmitoyl protein thioesterase containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10564.1| Os03g0101100 [Oryza sativa Japonica Group]
 dbj|BAH00197.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74327.1| hypothetical protein OsI_09612 [Oryza sativa Indica Group]
 gb|EEE58142.1| hypothetical protein OsJ_09054 [Oryza sativa Japonica Group]
Length=313

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+KIP D+  YL GCRFLPK+NNE+  ++
Sbjct  131  CGSGIFCILADSLIKMEIYSDYVQAHLAPSGYMKIPTDISDYLKGCRFLPKLNNELPGER  190

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++Y++D  G 
Sbjct  191  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGGFDPVLPPQKTKLYMEDWIGL  250

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+ G+VKF  VPG HL I+  ++ +YIVPY+K
Sbjct  251  KTLDDEGRVKFVSVPGGHLGISKTDMMKYIVPYLK  285



>gb|ABF93476.1| Palmitoyl protein thioesterase containing protein, expressed 
[Oryza sativa Japonica Group]
Length=321

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+KIP D+  YL GCRFLPK+NNE+  ++
Sbjct  139  CGSGIFCILADSLIKMEIYSDYVQAHLAPSGYMKIPTDISDYLKGCRFLPKLNNELPGER  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++Y++D  G 
Sbjct  199  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGGFDPVLPPQKTKLYMEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+ G+VKF  VPG HL I+  ++ +YIVPY+K
Sbjct  259  KTLDDEGRVKFVSVPGGHLGISKTDMMKYIVPYLK  293



>gb|ABK23278.1| unknown [Picea sitchensis]
Length=307

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGY+KIP D+  YL GCRFLPK+NNE+ D++
Sbjct  137  CGTSFICELVDALIKGELYSDFVQEHLAPSGYLKIPTDISKYLKGCRFLPKLNNELPDER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  L+LI+F+ DT+++P+ ++ FGYYPDG+FS  +P  +T +Y +D  G 
Sbjct  197  NSTYKERFSSLKNLILIMFEHDTVLIPRETAWFGYYPDGNFSVILPANETALYKEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  VPG HL IT  ++ +++VPY++
Sbjct  257  KTLDDAGRVKYISVPGNHLGITPSDMLKHVVPYLE  291



>ref|XP_009347695.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
Length=336

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = -2

Query  651  PCGKFPW-CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQD  475
            P  K  W C  +    +  +Y+   Q+HLAPSGYIKIP D+  YL GCRFLPK+NNE++ 
Sbjct  138  PFCKSEWICVLLDTLIKSEIYSDFIQEHLAPSGYIKIPTDIDAYLKGCRFLPKLNNEIKA  197

Query  474  DQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTF  295
             +++  K+RF SL  LVLI+F+ DTI++P+ +S FGY+PDG     +P Q+T +Y +D  
Sbjct  198  SRNSTYKERFASLENLVLIMFEQDTILIPKETSWFGYFPDGASDPILPAQETMLYTEDWI  257

Query  294  GFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            G +TLDEAGKVKF  V G HL I+  ++K YIVPY++
Sbjct  258  GLKTLDEAGKVKFINVSGGHLQISRSDMKTYIVPYLE  294



>gb|KHG13172.1| Palmitoyl-protein thioesterase 1 [Gossypium arboreum]
Length=334

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            C  +    +  VY+   Q+HLAPSGY+KIP D+  YL GCRFLPK+NNE++  +++  K+
Sbjct  149  CIFLDSLIKSEVYSNFVQEHLAPSGYLKIPTDITDYLKGCRFLPKLNNEIKGARNSTYKE  208

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RF SL  LVLI+F  DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G +TLDEA
Sbjct  209  RFASLQNLVLIMFDDDTVLVPKETSWFGYYPDGAFDPILPAQETELYKEDWIGLKTLDEA  268

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            GKVKF  V G+HL I+  ++K+YIVPY+
Sbjct  269  GKVKFVNVSGSHLKISESDMKKYIVPYL  296



>gb|AFK44258.1| unknown [Medicago truncatula]
 gb|KEH21572.1| palmitoyl protein thioesterase family protein [Medicago truncatula]
Length=313

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    + GVY+   Q+ LAP+GY+K+P D+ GYL GC+FLPK+NNE+ + +
Sbjct  143  CGSEKVCTLIDSVIKFGVYSSIVQNSLAPTGYVKMPIDIAGYLKGCKFLPKLNNEIINKR  202

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++   KRF SL  LVLI+F  DTI++P+ ++ FG+YPDG   + +P Q+T++Y +D  G 
Sbjct  203  NSTYSKRFASLENLVLIMFDHDTILIPKETAWFGFYPDGALHSVLPPQQTKLYTEDWIGL  262

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R LDEAGKVKFF V G HL I+  ++K YIVPY+K
Sbjct  263  RALDEAGKVKFFNVSGDHLDISHSDMKSYIVPYLK  297



>ref|XP_002468707.1| hypothetical protein SORBIDRAFT_01g050600 [Sorghum bicolor]
 gb|EER95705.1| hypothetical protein SORBIDRAFT_01g050600 [Sorghum bicolor]
Length=332

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 108/154 (70%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGY+KIP DM  YL  CRFLPK+NNE+ + +
Sbjct  138  CGSGILCILVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPEKR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+FQ D +++P+ ++ FGYYPDG F   +P QKT++Y +D  G 
Sbjct  198  NATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYEEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AG+VKF  V G HL I+  ++K+YIVPY+
Sbjct  258  KTLDKAGRVKFVSVAGGHLGISKSDMKKYIVPYL  291



>ref|XP_010054693.1| PREDICTED: uncharacterized protein LOC104443025 [Eucalyptus grandis]
Length=651

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEK-GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            CG   +C  +    E  GVY+   Q+HLAPS Y+KIP D+  YL GC+FLPK+NNE+   
Sbjct  451  CGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYMKIPTDLANYLKGCKFLPKLNNELVHH  510

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++YI+D  G
Sbjct  511  RNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETELYIEDWIG  570

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             +TLDEAGKVKF  V G HL I++ ++++YIVPY+
Sbjct  571  LKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYL  605



>emb|CDX67823.1| BnaA07g18630D [Brassica napus]
Length=333

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    
Sbjct  137  CGVTWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKN  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKVKF  V G HL I+ +++K++IVPY+ 
Sbjct  256  RTLDEAGKVKFVNVSGNHLQISHEDMKKHIVPYLS  290



>ref|XP_008798849.1| PREDICTED: palmitoyl-protein thioesterase 1 [Phoenix dactylifera]
Length=343

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIP ++  YL GCRFLPK+NNE+  ++
Sbjct  159  CGSGIICMLVDDLIKSEIYSDYIQAHLAPSGYLKIPTEIPAYLEGCRFLPKLNNEIPGER  218

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG FS  +P Q+T +Y++D  G 
Sbjct  219  NSTYKERFSSLQTLVLIMFEQDNVLIPRETSWFGYYPDGAFSPVLPPQQTALYMEDWIGL  278

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R LDEAG+V+F  V G HL I+  ++++YIVPY+ 
Sbjct  279  RALDEAGRVQFITVQGGHLRISESDMQKYIVPYLN  313



>ref|XP_009104259.1| PREDICTED: palmitoyl-protein thioesterase 1 [Brassica rapa]
Length=337

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    
Sbjct  141  CGVTWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKN  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  201  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKVKF  V G HL I+ +++K++IVPY+ 
Sbjct  260  RTLDEAGKVKFVNVSGNHLQISHEDMKKHIVPYLS  294



>ref|XP_004983640.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Setaria 
italica]
Length=326

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 113/171 (66%), Gaps = 16/171 (9%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM+ YL GCRFLPK+NNE++ ++
Sbjct  141  CGSGFLCILIDNLIKLEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIRSER  200

Query  468  SAIRKKRFTSLTLLVLIL----------------FQADTIIMPQISSHFGYYPDGDFSAP  337
            +A  K+RF+SL  LVLI+                F+ D +++P+ ++ FGYYPDG F+  
Sbjct  201  NATYKERFSSLENLVLIMKILLKIAKSSHFVLLQFEDDAVLIPRETAWFGYYPDGAFNPV  260

Query  336  VPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +P Q+T++Y +D  G +TLDEAG+VKF  VPG HL I+  ++K+YIVPY+K
Sbjct  261  LPPQETKLYTEDWIGLKTLDEAGRVKFVSVPGGHLRISRSDMKKYIVPYLK  311



>emb|CDP09444.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  VY+   QDHLAP+GYIKIP D+ GY  GC+FLPK+NNE    +
Sbjct  141  CGSSILCVLVDFLIQLAVYSDYVQDHLAPAGYIKIPTDIDGYRKGCKFLPKLNNEFH--K  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF SL  LVLI+F+ D +++P+ +S FGYYPDG +   +P Q+T +Y +D  G 
Sbjct  199  NATYKQRFASLENLVLIMFEQDEVLVPKETSLFGYYPDGSWCTVLPAQETALYKEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAGKVKF  V G+HL I++ ++K+YIVPY+
Sbjct  259  RTLDEAGKVKFVNVSGSHLEISLGDMKKYIVPYL  292



>gb|AAR92492.1| putative palmitoyl-protein thioesterase [Tropaeolum majus]
Length=339

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSGY+KIP D+ GYL GCRFLPK+NNE     
Sbjct  142  CGSGWMCIFLDSLIKMEIYSNYIQEHLAPSGYLKIPTDINGYLQGCRFLPKVNNEAP--M  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            + I K+RF+ L  LVLI+F+ DTI++P+ +S FGYYPDG F + +PVQ+T +Y +D  G 
Sbjct  200  NPIYKERFSKLENLVLIMFEQDTILIPKETSWFGYYPDGSFGSVLPVQQTPLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+VKF  V G HL I+  ++K++IVPY+
Sbjct  260  KTLDEAGRVKFVNVTGNHLDISKSDMKKHIVPYL  293



>ref|NP_191593.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 ref|NP_850728.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 emb|CAB87871.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
 gb|AAN13045.1| putative palmitoyl-protein thioesterase precursor [Arabidopsis 
thaliana]
 dbj|BAH20058.1| AT3G60340 [Arabidopsis thaliana]
 gb|AEE80048.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 gb|AEE80049.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=338

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    
Sbjct  137  CGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKN  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAGKVKF  V G HL I+  ++K++IVPY+
Sbjct  256  RTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>ref|XP_009605498.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nicotiana tomentosiformis]
Length=350

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 108/154 (70%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PN++ GY+  C FLPK+NNE+   +
Sbjct  137  CGSGIFCIIADSLIKSEIYSAFVQAHLAPSGYLKLPNNIAGYMKACHFLPKLNNEIPSHR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P QKTQ+Y +D  G 
Sbjct  197  NSTYKKRFSSLENLVLIMFEHDTVLIPRETSWFGYYPDGVFEPILPPQKTQLYAEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD AGKVK+ KV G HL I+  ++++++VPY+
Sbjct  257  KTLDNAGKVKYVKVAGNHLQISSSDMRKHVVPYL  290



>ref|XP_006285286.1| hypothetical protein CARUB_v10006663mg, partial [Capsella rubella]
 gb|EOA18184.1| hypothetical protein CARUB_v10006663mg, partial [Capsella rubella]
Length=196

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 107/154 (69%), Gaps = 4/154 (3%)
 Frame = -2

Query  633  WCGTIGQYYEKGV----YTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQS  466
            WC ++     K V    YT   QDH+APSGY+KIP D+K YL   ++LPK+NNE   +++
Sbjct  31   WCTSLFCLILKAVFSQVYTDLAQDHIAPSGYVKIPTDIKNYLENSKYLPKLNNERPLEKN  90

Query  465  AIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFR  286
            +  K RFTSL  LVLI+F+ + +++P+ +S FGYYPDG  +  +P QKT++Y +D  G +
Sbjct  91   STYKDRFTSLHHLVLIMFEKENVMIPKETSWFGYYPDGASTPVLPPQKTKLYTEDWIGLK  150

Query  285  TLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            TLD AGKVKF  VPGAH+ IT DE+  Y+VPY++
Sbjct  151  TLDAAGKVKFLSVPGAHIEITDDEVVEYVVPYLQ  184



>ref|XP_010524433.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524434.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524435.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=337

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+  Y+ GCRFLPK+NNE+    
Sbjct  141  CGSSWVCIMLDSLIKTEIYSEYIQEHLAPSGFLKIPTDVANYMEGCRFLPKLNNELPVKN  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF SL  LVLI+F  DTI++P+ +S FGYYPDG F   +P QKT++Y +D  G 
Sbjct  201  ST-YKERFLSLDNLVLIMFDHDTILIPKETSWFGYYPDGSFQTVLPPQKTKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            R LDEAGKVKF  VPG HL I+  ++K+YIVPY+
Sbjct  260  RMLDEAGKVKFINVPGNHLQISHSDMKKYIVPYL  293



>gb|AAK59537.1| putative palmitoyl-protein thioesterase precursor [Arabidopsis 
thaliana]
Length=338

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    
Sbjct  137  CGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKN  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAGKVKF  V G HL I+  ++K++IVPY+
Sbjct  256  RTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>gb|KHG30728.1| Palmitoyl-protein thioesterase 1 [Gossypium arboreum]
Length=339

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    + G+Y+   Q+HLAPSGY+KIP DM  YL GCRFLPK+NNE+   +
Sbjct  141  CGSAVICILLDSLIKFGIYSDYLQEHLAPSGYLKIPTDMSDYLKGCRFLPKLNNEINGMR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+R  SL  LVLI+F+ DT+++P+ ++ F Y+PDG F   +PVQ  ++Y +D  G 
Sbjct  201  NSTYKERLASLQNLVLIMFEDDTVLIPKETAWFSYFPDGAFEPVLPVQAAKLYKEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K+Y+VPY++
Sbjct  261  KTLDEAGKVKFVNVSGNHLQISTSDMKKYMVPYLE  295



>ref|XP_006347949.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum tuberosum]
Length=333

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q HLAP+GYIKIP D+  Y  GC+FLP +NNEV   +
Sbjct  136  CGSGIWCILEDSLLKLAIYSNFIQAHLAPAGYIKIPTDIANYRKGCKFLPVLNNEVH--R  193

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG FS  +P QKT++Y +D  G 
Sbjct  194  NSTYKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSFSTVLPAQKTKLYTEDWIGL  253

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAGKVK  KV G+HL I+  E+K+ I+PY+
Sbjct  254  KMLDEAGKVKLLKVCGSHLEISTSEMKKNILPYL  287



>gb|EMS63343.1| Palmitoyl-protein thioesterase 1 [Triticum urartu]
Length=310

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  579  QDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADT  400
            Q HLAPSGY+KIP DM  YL GC+FLPK+NNE+  +++   K+RF+SL  LVLI+F+ D 
Sbjct  163  QAHLAPSGYLKIPTDMTDYLKGCKFLPKLNNEIPSERNITYKERFSSLENLVLIMFEDDA  222

Query  399  IIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITV  220
            +++P+ ++ FGYYPDG F+  +P Q+T++Y +D  G RTLDEAG+VKF  VPG HL I+ 
Sbjct  223  VLIPRETAWFGYYPDGAFNPVLPPQETKLYTEDWIGLRTLDEAGRVKFVSVPGGHLRISR  282

Query  219  DEIKRYIVPYM  187
              +K+YIVPY+
Sbjct  283  SNMKKYIVPYL  293



>gb|AFY98638.1| palmitoyl-protein thioesterase [Phaseolus vulgaris]
Length=357

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    Q  +  VY+   Q+HLAPSGY+K+PN +  YL  C+FLP +NNE+ D +
Sbjct  137  CGSGIFCILADQLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCKFLPVLNNEIPDKR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F+  +P Q TQ+YI+D  G 
Sbjct  197  NSPYKERFSSLQNLVLIMFEPDPVLIPKETSWFGYYPDGYFNPILPPQSTQLYIEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKV F  VPG H  I+  ++K+Y+VPY+K
Sbjct  257  RTLDEAGKVHFISVPGKHFGISEPDMKKYVVPYLK  291



>ref|XP_006402591.1| hypothetical protein EUTSA_v10006085mg [Eutrema salsugineum]
 gb|ESQ44044.1| hypothetical protein EUTSA_v10006085mg [Eutrema salsugineum]
Length=337

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    
Sbjct  137  CGATWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKN  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAGKVKF  V G HL I+  ++K++IVPY+
Sbjct  256  RTLDEAGKVKFVNVSGNHLQISHADMKKHIVPYL  289



>ref|XP_010229362.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Brachypodium 
distachyon]
Length=307

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 111/158 (70%), Gaps = 3/158 (2%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q HLAPSGY+KIP DMK YL GCRFLPK+NNE+  ++
Sbjct  140  CGSGIFCIIVDALIKLEIYSEYVQAHLAPSGYLKIPTDMKDYLEGCRFLPKLNNEIPGER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQK---TQVYIKDT  298
            +A  K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   +P QK   T++Y++D 
Sbjct  200  NATYKERFSSLENLVLIMFEDDIVLIPRETSWFGYYPDGAFDQVLPPQKDVQTKLYMEDW  259

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             G ++LD+ G+VKF  V G HL I+  ++++YIVPY+K
Sbjct  260  IGLKSLDDGGRVKFVSVAGGHLGISDSDMRKYIVPYLK  297



>ref|XP_002876550.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52809.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=338

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    
Sbjct  137  CGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKN  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAGKVKF  V G HL I+  ++K++IVPY+
Sbjct  256  KTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>emb|CDY64763.1| BnaC06g42800D [Brassica napus]
Length=337

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GYL GCRFLPK+NNE+    
Sbjct  140  CGVTWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYLEGCRFLPKLNNELPVKN  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  200  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKV F  V G HL I+ +++K++IVPY+ 
Sbjct  259  RTLDEAGKVMFVNVSGNHLQISHEDMKKHIVPYLS  293



>ref|XP_004489139.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Cicer arietinum]
Length=305

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            C  I    + G+Y+   Q+ LAP+GY+K+P D+ GYL GCRFLPK+NNE+ + +++   +
Sbjct  151  CTLIDSVIQLGIYSSLVQNSLAPTGYVKMPIDIDGYLKGCRFLPKLNNEIINKRNSTYSQ  210

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RF+SL  L+LI+F  DTI++P+ ++ FG+YPDG     +PVQ+T++Y +D  G R LDEA
Sbjct  211  RFSSLENLILIMFDQDTILIPKETAWFGFYPDGALHPVLPVQQTKLYTEDWIGLRALDEA  270

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            GKVKFF V G HL I+  ++K +IVPY+K
Sbjct  271  GKVKFFNVSGDHLDISDSDMKIHIVPYLK  299



>ref|XP_010512353.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
 ref|XP_010512354.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=339

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE     
Sbjct  138  CGATWICIMLDSMIKAEIYSDYLQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNEYPVKN  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  198  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKVKF  V G HL I+  ++K++IVPY+ 
Sbjct  257  RTLDEAGKVKFVNVSGNHLQISQADMKKHIVPYLS  291



>ref|XP_009383948.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIP D+  YL GCRFLPK+NNE+  ++
Sbjct  137  CGSGIICILVDNLIKSQIYSDYVQAHLAPSGYLKIPTDIPEYLEGCRFLPKLNNELPSER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  L+LI+F+ DT+++P+ +S FGYYPDG F+  +P Q+T +Y +D  G 
Sbjct  197  NSTYKERFSSLENLILIMFEHDTVLIPRETSWFGYYPDGAFNPILPPQQTTLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VKF  V G HL I+  ++K++IVPY++
Sbjct  257  KTLDDAGRVKFISVKGNHLRISQSDMKKHIVPYLE  291



>gb|KHN42678.1| Palmitoyl-protein thioesterase 1 [Glycine soja]
Length=367

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   Q+HLAPSGY+K+PN +  YL  CRFLP +NNE+ D +
Sbjct  137  CGSGIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCRFLPVLNNEIPDKR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q T++YI+D  G 
Sbjct  197  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFKPVLPPQSTELYIEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKV F  V G HL I+ +++K+++VPY+K
Sbjct  257  RTLDEAGKVHFISVLGNHLGISKEDMKKHVVPYLK  291



>ref|XP_004300365.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Fragaria vesca 
subsp. vesca]
Length=314

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  + +  +  +Y+   Q HLAPSGYIK+PN M  YL  CRFLPK+NNE+ D++
Sbjct  140  CGSGIFCIIVNKLIKGEIYSDYIQAHLAPSGYIKLPNAMTDYLGRCRFLPKLNNELPDER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ D +++P+ +S FGYY DG F++ V  Q+T +Y +D  G 
Sbjct  200  NSTYKERFSSLENLVLIMFEQDNVLVPRETSWFGYYQDGAFNSIVGPQQTDLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+VK+  V G HL I+  +IK+++VPY+
Sbjct  260  RTLDEAGRVKYVSVSGGHLGISESDIKKHVVPYL  293



>ref|XP_010524432.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=409

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+  Y+ GCRFLPK+NNE+    
Sbjct  213  CGSSWVCIMLDSLIKTEIYSEYIQEHLAPSGFLKIPTDVANYMEGCRFLPKLNNELPVKN  272

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF SL  LVLI+F  DTI++P+ +S FGYYPDG F   +P QKT++Y +D  G 
Sbjct  273  STY-KERFLSLDNLVLIMFDHDTILIPKETSWFGYYPDGSFQTVLPPQKTKLYTEDWIGL  331

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            R LDEAGKVKF  VPG HL I+  ++K+YIVPY+
Sbjct  332  RMLDEAGKVKFINVPGNHLQISHSDMKKYIVPYL  365



>ref|XP_010413568.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
 ref|XP_010413569.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=339

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE     
Sbjct  138  CGATWICIMLDSMIKAEIYSDYLQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNEYPVKN  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  198  ST-YKERFSSLETLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K++IVPY+ 
Sbjct  257  KTLDEAGKVKFVNVSGNHLQISDADMKKHIVPYLS  291



>ref|XP_009123837.1| PREDICTED: palmitoyl-protein thioesterase 1-like, partial [Brassica 
rapa]
Length=178

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  645  GKFPWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
               P C + + Q     VY+   QDH+APSGYIK+PN+M  YL   ++LPK+NNE  +++
Sbjct  17   ANIPKCTSPVCQLLRTDVYSDYVQDHIAPSGYIKLPNEMSKYLEHSKYLPKLNNERPNER  76

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++I K+RFTSL  L+L++FQ D ++MP+ S  FGYYPDG  +  +P Q+T++Y +D  G 
Sbjct  77   NSIYKERFTSLHNLILVMFQGDKVVMPKESCWFGYYPDGATTPLLPPQQTKLYTEDWIGL  136

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  VPG HL +  D++ +++VPY++
Sbjct  137  KTLDAAGKVKFVGVPGEHLQMAHDDVVKHVVPYLQ  171



>gb|AAM65342.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=338

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            C  +    +  +Y+   Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE+    S   K+
Sbjct  143  CIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNELPVKNST-YKE  201

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G RTLDEA
Sbjct  202  RFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGLRTLDEA  261

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            GKVKF  V G HL I+  ++K++IVPY+
Sbjct  262  GKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>ref|XP_010258785.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nelumbo nucifera]
Length=334

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +       +Y+   Q HLAPSGY+KIP ++  YL GC+FLPK+NNE+   +
Sbjct  139  CGTGVICVLVDSLIRLEIYSDYVQAHLAPSGYLKIPTEIPAYLEGCKFLPKLNNELPTAR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++YI+D  G 
Sbjct  199  NSTYKERFCSLENLVLIMFEHDTILIPRETSWFGYYPDGGFIPILPPQQTKLYIEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  VPG HL I+   +K+YIVPY++
Sbjct  259  KTLDDAGRVKYISVPGQHLQISNANMKKYIVPYLR  293



>ref|XP_008369436.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Malus domestica]
Length=353

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  + +  +  +YT   Q+HLAPSGY+K+PN M  YL  C+FLPK+NNE+ D++
Sbjct  135  CGSGIFCIIVNKLLKSEIYTDYIQEHLAPSGYLKLPNAMSEYLGKCKFLPKLNNELPDER  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYY D  F + +  Q+T +Y +D  G 
Sbjct  195  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYQDDSFKSILSPQQTDLYTEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAG+VK+  V G HL I+  ++K+++VPY++
Sbjct  255  RTLDEAGRVKYISVAGGHLGISTSDMKKHVVPYLQ  289



>ref|XP_006291453.1| hypothetical protein CARUB_v10017590mg [Capsella rubella]
 gb|EOA24351.1| hypothetical protein CARUB_v10017590mg [Capsella rubella]
Length=338

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 106/155 (68%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y    Q+HLAPSG++KIP D+ GY+ GCRFLPK+NNE     
Sbjct  137  CGATWICIMLDSMIKAEIYGDYLQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNEYSVKN  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F+ DTI++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  197  ST-YKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAGKVKF  V G HL I+  ++K++IVPY+ 
Sbjct  256  RTLDEAGKVKFVNVSGNHLQISDTDMKKHIVPYLS  290



>dbj|BAJ88880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q+HLAPSGYIKIP DM  YL GC+FLPK+NNE+  ++
Sbjct  143  CGSGFFCVIVDALIKSEIYSDYVQEHLAPSGYIKIPTDMDDYLKGCKFLPKLNNEIPGER  202

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F++DT+++P+ +S FGYYPDG F   +P Q+T +Y +D  G 
Sbjct  203  NATYKERFSSLENLVLIMFESDTVLIPRETSWFGYYPDGAFDPVLPPQQTNLYQEDWIGL  262

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + LD+A +VKF  V G HL I+  +++++I+PY+K
Sbjct  263  KALDDARRVKFVSVAGDHLGISNIDMRKHILPYLK  297



>ref|XP_009342091.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
Length=353

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  + +  +  +YT   Q+HLAPSGY+K+PN M  YL  C+FLPK+NNE+ D++
Sbjct  135  CGSGIFCIIVNKLLKSEIYTDYIQEHLAPSGYLKLPNAMSEYLGKCKFLPKLNNELPDER  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYY D  F + +  Q+T +Y +D  G 
Sbjct  195  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYQDDSFKSILSPQETDLYTEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAG+VK+  V G HL I+  ++K+++VPY++
Sbjct  255  RTLDEAGRVKYISVAGGHLGISTSDMKKHVVPYLQ  289



>ref|XP_009334531.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
 ref|XP_009334538.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
Length=353

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  + +  +  +YT   Q+HLAPSGY+K+PN M  YL  C+FLPK+NNE+ D++
Sbjct  135  CGSGIFCIIVNKLLKSEIYTDYIQEHLAPSGYLKLPNAMSEYLGKCKFLPKLNNELPDER  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYY D  F + +  Q+T +Y +D  G 
Sbjct  195  NSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYQDDSFKSILSPQETDLYTEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAG+VK+  V G HL I+  ++K+++VPY++
Sbjct  255  RTLDEAGRVKYISVAGGHLGISTSDMKKHVVPYLQ  289



>ref|XP_006414227.1| hypothetical protein EUTSA_v10025863mg [Eutrema salsugineum]
 gb|ESQ55680.1| hypothetical protein EUTSA_v10025863mg [Eutrema salsugineum]
Length=296

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = -2

Query  636  PWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAI  460
            P C + + Q  +  VY+   QDH+APSGYIKIP DMK YL   ++LPK+NNE  +++++ 
Sbjct  138  PNCSSPVCQLLKTDVYSDYVQDHIAPSGYIKIPTDMKNYLKHSKYLPKLNNERPNERNST  197

Query  459  RKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTL  280
             K+RFTSL  LVL++FQ DT+++P+ S  FGYYPDG  +  +P Q+T++Y +D  G +TL
Sbjct  198  YKERFTSLHNLVLVMFQGDTVVIPKESCWFGYYPDGASTPLLPPQQTKLYKEDWIGLKTL  257

Query  279  DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            D AGKVKF  VPG HL +  D++ +Y+VPY++
Sbjct  258  DAAGKVKFVSVPGKHLQMAHDDVVKYVVPYLQ  289



>ref|XP_002531468.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
 gb|EEF30918.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
Length=327

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   QDHLAP+GY+K+PND+  YL  C+FLPK+NNE+ D++
Sbjct  110  CGSGIFCIIADNLIKGEIYSDFIQDHLAPAGYLKLPNDIPHYLDKCKFLPKLNNEIPDER  169

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RFTSL  LVLI+ + D +++P+ +S FGYYPDG F   +PVQ+T++Y++D  G 
Sbjct  170  NSTYKERFTSLENLVLIMSEDDNVLIPKETSWFGYYPDGSFKTILPVQQTKLYVEDWIGL  229

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAG+V F  V G HL I+  ++++++VP++
Sbjct  230  KTLDEAGRVHFVNVSGGHLGISRSDMEKHVVPFL  263



>gb|KDO61327.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
 gb|KDO61328.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
 gb|KDO61329.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
Length=258

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   QDHLAPSGY+K PND+  YL  C+FLPK+NNE+ D +
Sbjct  52   CGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKR  111

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+ F+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P QKT++Y +D  G 
Sbjct  112  NSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGL  171

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V F  V G HL I+  ++K++I+PY+K
Sbjct  172  KTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  206



>gb|KDO61326.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
Length=264

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   QDHLAPSGY+K PND+  YL  C+FLPK+NNE+ D +
Sbjct  58   CGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKR  117

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+ F+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P QKT++Y +D  G 
Sbjct  118  NSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGL  177

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V F  V G HL I+  ++K++I+PY+K
Sbjct  178  KTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  212



>ref|XP_006440242.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
 gb|ESR53482.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
Length=316

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   QDHLAPSGY+K PND+  YL  C+FLPK+NNE+ D +
Sbjct  110  CGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKR  169

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+ L  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P QKT++Y +D  G 
Sbjct  170  NSTYKERFSCLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGL  229

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V F  V G HL I+  ++K++I+PY+K
Sbjct  230  KTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  264



>ref|XP_010677184.1| PREDICTED: uncharacterized protein LOC104892862 [Beta vulgaris 
subsp. vulgaris]
Length=703

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +YT   Q HLAPSGY+KIP++M GYL  CRFLPK+NNE+ +++
Sbjct  137  CGTGIFCVLADALIKSEIYTDYIQAHLAPSGYLKIPSNMDGYLEKCRFLPKLNNEIPEER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG FS  +  Q+T++Y +D  G 
Sbjct  197  NSTYKERFSSLETLVLIMFEHDTVLVPKETSWFGYYPDGAFSPLLTPQETKLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AG+VKF  V G HL I+ +++K+Y+VPY+K
Sbjct  257  KTLDVAGRVKFVSVAGNHLGISHEDMKKYMVPYLK  291


 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y    Q +LA SGYIKIPN++  YL   +FLPK+NNE+ +++S+I K+RF SL  LVL
Sbjct  526  GIYRKFIQKNLAVSGYIKIPNNIPSYLENSKFLPKLNNEIPNERSSIYKERFKSLENLVL  585

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I F  + +++P+ +S FGYY D  F + +P ++T+++++D  G + L+EAGKV +  +PG
Sbjct  586  IKFDNEHVLIPKETSWFGYYQDHSFRSVLPARETKLFVEDWIGLKALEEAGKVTYVTLPG  645

Query  240  AHLVITVDEIKRYIVPYMK  184
             HL I+ D +K+YIVP++K
Sbjct  646  DHLAISDDGLKKYIVPFLK  664



>ref|XP_009144476.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Brassica rapa]
Length=224

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  645  GKFPWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
               P C + + Q     VY+   QDH+APSGYIK+PN+M  YL   ++LPK+NNE  +++
Sbjct  63   ANIPKCTSPVCQLLRTDVYSDYVQDHIAPSGYIKLPNEMSKYLEHSKYLPKLNNERPNER  122

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++I K+RFTSL  L+L++FQ D ++MP+ S  FGYYPDG  +  +P Q+T++Y +D  G 
Sbjct  123  NSIYKERFTSLHNLILVMFQGDKVVMPKESCWFGYYPDGATTPLLPPQQTKLYTEDWIGL  182

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  VPG HL +  D++ +++VPY++
Sbjct  183  KTLDAAGKVKFVGVPGEHLQMAHDDVVKHVVPYLQ  217



>ref|XP_004229756.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Solanum 
lycopersicum]
Length=322

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q HLAP+GYIKIP D+  Y  GC+FLP +NNEV   +
Sbjct  137  CGSGIWCILEDSLLKLAIYSNFIQAHLAPAGYIKIPTDIANYRKGCKFLPVLNNEVH--R  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG F+  +P  KT++Y +D  G 
Sbjct  195  NSTYKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSFTTVLPAHKTKLYTEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAGKVK  KV G+HL I+  E+K+ I+PY+
Sbjct  255  KKLDEAGKVKLLKVCGSHLEISTSEMKKNILPYL  288



>gb|KGN55843.1| hypothetical protein Csa_3G019340 [Cucumis sativus]
Length=199

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    +  +  +Y+   QDHLAPSGYIK+PN +  YL  C+FLPK+NNE+   +
Sbjct  44   CGSAIFCRLADELIKSEIYSDYVQDHLAPSGYIKLPNAIPKYLEKCKFLPKLNNELPQAK  103

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  L+LI+F+ DT+++P+ +S FGYY D   ++ +P Q+T++Y +D  G 
Sbjct  104  NSTYKERFSSLQNLILIMFEHDTVLVPKETSLFGYYSDRALNSTIPAQQTKLYTEDWIGL  163

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAG+VK+  V G H+ I+  ++++Y++PY++
Sbjct  164  KTLDEAGRVKYISVAGDHVKISNSDMRKYVIPYLQ  198



>ref|XP_010434662.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X1 [Camelina 
sativa]
Length=296

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  636  PWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAI  460
            P C + I +  +  VYT   Q+H+APSGYIKIP +M  YL   ++LPK+NNE  + ++ +
Sbjct  137  PKCNSPICKLLKTRVYTDYIQNHIAPSGYIKIPTEMSKYLEHSKYLPKLNNERPNKRNPV  196

Query  459  RKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTL  280
             K RFTSL  LVL++FQ DT+++P+ SS FGYYPDG  +  +  Q+T++YI+D  G +TL
Sbjct  197  FKDRFTSLHNLVLVMFQGDTVVIPKESSWFGYYPDGASTPLLSPQQTKIYIEDWIGLKTL  256

Query  279  DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            D AGKVKF  VPG HL I  DE+ +Y+VPY+K
Sbjct  257  DAAGKVKFVSVPGEHLRIAQDEVVKYVVPYLK  288



>ref|XP_006440241.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
 gb|ESR53481.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
Length=345

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   QDHLAPSGY+K PND+  YL  C+FLPK+NNE+ D +
Sbjct  139  CGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+ L  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P QKT++Y +D  G 
Sbjct  199  NSTYKERFSCLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V F  V G HL I+  ++K++I+PY+K
Sbjct  259  KTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  293



>ref|XP_010544577.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Tarenaya hassleriana]
Length=326

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q+HLAPSG++KIP D+  Y+ GC+FLPK+NNE+    
Sbjct  141  CGSTWVCIMLDSLIKTEIYSDYIQEHLAPSGFLKIPTDISSYMEGCKFLPKLNNELPVKN  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            S   K+RF+SL  LVLI+F  D I++P+ +S FGYYPDG F   +P QKT++Y +D  G 
Sbjct  201  ST-YKERFSSLDNLVLIMFDHDAILIPKETSWFGYYPDGSFQTVLPPQKTKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            R+LDEAGKVKF  V G HL I+  ++K+YIVPY+
Sbjct  260  RSLDEAGKVKFVNVSGNHLQISYSDMKKYIVPYL  293



>ref|XP_008448812.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Cucumis melo]
Length=295

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    +  +  +Y+   QDHLAPSGY+K+PN +  YL  CRFLPK+NNE+   +
Sbjct  140  CGSAIFCRLADELIKSEIYSDYVQDHLAPSGYLKLPNAIPKYLEKCRFLPKLNNELPQAK  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYY DG  ++ +P Q+T++YI+D  G 
Sbjct  200  NSTYKERFSSLQNLVLIMFEHDTVLVPKETSLFGYYLDGALNSTIPAQQTKLYIEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAG+VK+  V G H+ I+  ++ +Y++PY++
Sbjct  260  KTLDEAGRVKYISVAGEHVKISNSDMIKYVIPYLQ  294



>gb|KDP28824.1| hypothetical protein JCGZ_14595 [Jatropha curcas]
Length=334

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +       +Y+   Q+HLAPSGYIKIP D++ Y+ GC+FLP++NNE+  + 
Sbjct  141  CGSGLICILVDALLRLEIYSIYVQEHLAPSGYIKIPTDIEHYVKGCKFLPELNNEIIKNS  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF SL  LVLI+F+ DT+++P+ +S FGYYPDG F++ +P Q+T++Y +D  G 
Sbjct  201  T--YKERFASLENLVLIMFEHDTVLVPKETSWFGYYPDGCFTSVLPPQETKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAGKVKF  V G HL I+  ++K YIVPY++
Sbjct  259  KTLDEAGKVKFINVSGNHLQISRSDMKNYIVPYLE  293



>gb|KCW71934.1| hypothetical protein EUGRSUZ_E00394 [Eucalyptus grandis]
Length=347

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   Q HLAPSGY+K+PN +  YL+ CRFLPK+NNE+ D++
Sbjct  138  CGTGLLCIIADRLIKSHIYSDYIQAHLAPSGYLKLPNAISDYLAKCRFLPKLNNELPDER  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F+  +   +TQ+Y++D  G 
Sbjct  198  NSTYKERFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFNPIMFPNETQLYMEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDEAG+V +  VPG HL I+  ++K+Y+VPY++
Sbjct  258  RSLDEAGRVHYVSVPGNHLGISRGDMKKYVVPYLE  292



>ref|XP_010055462.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Eucalyptus 
grandis]
 gb|KCW71935.1| hypothetical protein EUGRSUZ_E00394 [Eucalyptus grandis]
Length=346

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   Q HLAPSGY+K+PN +  YL+ CRFLPK+NNE+ D++
Sbjct  137  CGTGLLCIIADRLIKSHIYSDYIQAHLAPSGYLKLPNAISDYLAKCRFLPKLNNELPDER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F+  +   +TQ+Y++D  G 
Sbjct  197  NSTYKERFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFNPIMFPNETQLYMEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R+LDEAG+V +  VPG HL I+  ++K+Y+VPY++
Sbjct  257  RSLDEAGRVHYVSVPGNHLGISRGDMKKYVVPYLE  291



>gb|EMS65899.1| Palmitoyl-protein thioesterase 1 [Triticum urartu]
Length=331

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C  +    +  +Y+   Q HLAPSGYIKIP D+  YL GCRFLPK+NNE+  ++
Sbjct  172  CGSGFFCVIVDALIKSEIYSDYVQAHLAPSGYIKIPTDIDDYLKGCRFLPKLNNEILGER  231

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF++L  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  232  NAAHKERFSNLENLVLIMFENDTVLIPRETSWFGYYPDGAFDPVLPPQQTKLYQEDWIGL  291

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + LD+ G+VKF  V G HL I+  ++ ++I+PY+K
Sbjct  292  KALDDVGRVKFVSVAGDHLDISNTDMTKHILPYLK  326



>ref|XP_010451416.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=304

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  594  YTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLIL  415
            YT   QD++APSGY+K+P  +  YL   ++LPK+NNE    +++I K RFTSL  LVLI+
Sbjct  156  YTDLVQDNVAPSGYVKVPTKITEYLEHSKYLPKLNNERPGQKNSIFKDRFTSLHNLVLIM  215

Query  414  FQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAH  235
            FQ DT+++P+ +S FGYYPDGDF+  +P QKT++Y KD  G +TLD+AGKVKF  VPG H
Sbjct  216  FQKDTVLIPRETSWFGYYPDGDFTPVLPPQKTKLYTKDWIGLKTLDDAGKVKFLSVPGGH  275

Query  234  LVITVDEIKRYIVPYMK  184
            + IT +E+  Y+VPY++
Sbjct  276  IEITEEELLNYVVPYLQ  292



>emb|CDY18971.1| BnaC01g20970D [Brassica napus]
Length=305

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = -2

Query  645  GKFPWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
               P C + + Q     VY+   QDH+APSGYIK+PN+M  YL   ++LPK+NNE   ++
Sbjct  137  ANIPKCTSPVCQLLRTDVYSDYVQDHIAPSGYIKLPNEMSKYLEHSKYLPKLNNERPTER  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++I K+RFTSL  LVL++FQ D ++MP+ S  FGYYPDG  +  +P Q+T++Y +D  G 
Sbjct  197  NSIYKERFTSLHNLVLVMFQGDKVVMPKESCWFGYYPDGATTPLLPPQQTKLYTEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  VPG HL +  D++ +++VPY++
Sbjct  257  KTLDAAGKVKFVSVPGEHLQMAHDDVVKHVVPYLQ  291



>ref|XP_009144453.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Brassica rapa]
Length=306

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  645  GKFPWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
               P C + + Q     VY+   QDH+APSGYIK+PN+M  YL   ++LPK+NNE  +++
Sbjct  145  ANIPKCTSPVCQLLRTDVYSDYVQDHIAPSGYIKLPNEMSKYLEHSKYLPKLNNERPNER  204

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++I K+RFTSL  L+L++FQ D ++MP+ S  FGYYPDG  +  +P Q+T++Y +D  G 
Sbjct  205  NSIYKERFTSLHNLILVMFQGDKVVMPKESCWFGYYPDGATTPLLPPQQTKLYTEDWIGL  264

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  VPG HL +  D++ +++VPY++
Sbjct  265  KTLDAAGKVKFVGVPGEHLQMAHDDVVKHVVPYLQ  299



>ref|NP_199545.2| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 gb|AED95500.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=317

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 102/151 (68%), Gaps = 0/151 (0%)
 Frame = -2

Query  636  PWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIR  457
            P C    +  +  +Y+   QDHLAPSGY KIPNDMK YL   ++LPK+NNE+ + ++   
Sbjct  148  PACKKFNELIKGALYSETIQDHLAPSGYYKIPNDMKQYLERSKYLPKLNNEIPNQRNQTY  207

Query  456  KKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLD  277
            K RFTSL  LVL+ FQ D +I P  S+ FG+YPDG+F   +   +T++Y +D  G +TLD
Sbjct  208  KDRFTSLHNLVLVKFQDDEVITPNDSTWFGFYPDGEFETLLSANQTKLYTEDWIGLKTLD  267

Query  276  EAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +AGKVKF  VPG H+ +  +++ +Y+VPY++
Sbjct  268  DAGKVKFVSVPGGHVRMAEEDVVKYVVPYLQ  298



>ref|XP_002304295.2| hypothetical protein POPTR_0003s07790g [Populus trichocarpa]
 gb|EEE79274.2| hypothetical protein POPTR_0003s07790g [Populus trichocarpa]
Length=393

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K PND+  YL  CRFLPK+NNE+ + +
Sbjct  182  CGSGIFCILADALMKSEIYSDYVQAHLAPSGYLKFPNDIPRYLEKCRFLPKLNNEIPEGR  241

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D+I++P+ +S FGYYPDG F   VP ++T++Y +D  G 
Sbjct  242  NTTYKERFSSLQNLVLIMFENDSILIPKETSWFGYYPDGAFKPIVPAKETKLYTEDWIGL  301

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+V F  V G HL I+  ++K+++VP++
Sbjct  302  RTLDEAGRVHFVNVSGGHLGISKSDLKKHVVPFL  335



>ref|XP_006477132.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Citrus sinensis]
Length=351

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   QDHLAPSGY+K PND+  YL  C+FLPK+NNE+ D +
Sbjct  139  CGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+ F+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P Q+T++Y +D  G 
Sbjct  199  NSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQRTKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V F  V G HL I+  ++K++I+PY+K
Sbjct  259  KTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  293



>ref|XP_006285186.1| hypothetical protein CARUB_v10006536mg [Capsella rubella]
 gb|EOA18084.1| hypothetical protein CARUB_v10006536mg [Capsella rubella]
Length=297

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  636  PWC-GTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAI  460
            P C  ++ +  +  VYT   QDH+APSGYIKIP +M  YL   ++LPK+NNE  + ++ I
Sbjct  139  PKCTSSLCKLLKAEVYTDYIQDHIAPSGYIKIPTEMSKYLEHSKYLPKLNNERPNKRNPI  198

Query  459  RKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTL  280
             K RFTSL  LVL++FQ DT+++P+ SS FG+YPDG  +  +  Q+T++Y +D  G +TL
Sbjct  199  LKDRFTSLHNLVLVMFQGDTVVIPKESSWFGFYPDGASTPLLSPQQTKLYTEDWIGLKTL  258

Query  279  DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            D AGKVKF  VPG HL +  DE+ +Y+VPY+K
Sbjct  259  DAAGKVKFVSVPGEHLRMAQDEVVKYVVPYLK  290



>ref|XP_011089658.1| PREDICTED: palmitoyl-protein thioesterase 1 [Sesamum indicum]
Length=327

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    E  +Y+   Q+HLAP+ YIKIP D+  Y  GC+FLPK+NNE+  + 
Sbjct  143  CGSAEVCILVDLLIELAIYSNFVQEHLAPASYIKIPTDIDAYRKGCKFLPKLNNEIYKNS  202

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI F+ D I++P+ +S FGY+PDG +   +P Q+T +Y +D  G 
Sbjct  203  T--YKERFSSLENLVLIKFEKDDILVPKETSWFGYFPDGSWDTVLPAQETTLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLDEAGKVKF  V G HL I+  E+K+YI+PY+
Sbjct  261  KTLDEAGKVKFVSVSGGHLEISYSEMKKYILPYL  294



>gb|AAM63476.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=304

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  639  FPWCG-TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSA  463
             P C  T+ +  +  VYT   QDH+APSGYIKIP D+K YL   ++LPKINNE  ++++ 
Sbjct  137  IPKCNSTLCELLKTAVYTDFVQDHIAPSGYIKIPTDIKDYLEHSKYLPKINNERPNERNT  196

Query  462  IRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRT  283
              K RFTSL  LVL++F+ D +++P+ SS FGYYPDG  S  +  Q+T++Y +D  G +T
Sbjct  197  TFKDRFTSLHNLVLVMFEGDAVVIPKESSWFGYYPDGASSPLLSPQQTKLYTEDWIGLKT  256

Query  282  LDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA  163
            LD A KVKF  VPG HL I  D++ +++VPY+K   AS++
Sbjct  257  LDAARKVKFVSVPGEHLRIAQDDVVKHVVPYLKNQPASMS  296



>ref|XP_010449610.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=295

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  636  PWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAI  460
            P C + I +  +  VYT   QDH+APSGYIKIP +M  YL   ++LPK+NNE  + ++ I
Sbjct  137  PTCTSPICKLLKTRVYTDYIQDHIAPSGYIKIPTEMSKYLEHSKYLPKLNNERPNKRNPI  196

Query  459  RKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTL  280
             K RFTSL  LVL++FQ DT+++P+ SS FGYYP+G  +  +  Q+T++Y +D  G +TL
Sbjct  197  FKDRFTSLHNLVLVMFQGDTVVIPKESSWFGYYPEGASTPLLSPQQTKLYTEDWIGLKTL  256

Query  279  DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            D AGKVKF  VPG HL +  DE+ +Y+VPY+K
Sbjct  257  DAAGKVKFVSVPGEHLRMAQDEVVKYVVPYLK  288



>ref|XP_003611348.1| Palmitoyl-protein thioesterase [Medicago truncatula]
 gb|AES94306.1| palmitoyl protein thioesterase family protein [Medicago truncatula]
Length=327

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  VY+   Q+HLAPSGY+K+PN +  YL  CR+LPK+NNE    +
Sbjct  142  CGTGIFCVLADNLIKGEVYSNYIQEHLAPSGYLKLPNAIPKYLENCRYLPKLNNEKPGQR  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  202  NSTYKERFSSLENLVLIMFEQDTVLIPRETSWFGYYPDGFFKPVLPPQETKLYTEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLDEAG+V F  VPG HL I+  ++K+++VPY+ 
Sbjct  262  KTLDEAGRVHFISVPGKHLGISEADMKKHVVPYLN  296



>emb|CAN68811.1| hypothetical protein VITISV_001083 [Vitis vinifera]
Length=282

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K+PND+  YL  CRFLPK+NNE+ D++
Sbjct  120  CGSGVFCIIADNLIKSQIYSDYVQTHLAPSGYLKLPNDIPKYLEKCRFLPKLNNELPDER  179

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  180  NSTYKERFSSLENLVLIMFEQDTVLIPKETSWFGYYPDGAFEPVLPPQQTKLYTEDWIGL  239

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKR  205
            +TLD+AG+VK+  VPG HL I+  ++K+
Sbjct  240  KTLDDAGRVKYISVPGNHLGISHSDMKQ  267



>emb|CDP10012.1| unnamed protein product [Coffea canephora]
Length=389

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  576  DHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTI  397
            +HLAPSGY+K+PN++ GYL  CRFLPK+NNE+  ++++  K RF+SL  LVLI+F+ DT+
Sbjct  185  EHLAPSGYLKLPNNIAGYLEKCRFLPKLNNEIPGERNSTYKARFSSLQNLVLIMFEHDTV  244

Query  396  IMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVD  217
            ++P+ +S FGYYPDG F+  +  Q+TQ+YI+D  G +TLD+AG+VK+  V G HL I+  
Sbjct  245  LVPKETSWFGYYPDGAFNPVLAPQQTQLYIEDWIGLKTLDDAGRVKYVTVSGNHLGISKP  304

Query  216  EIKRYIVPYMK  184
            ++K+Y+VPY++
Sbjct  305  DMKKYVVPYLE  315



>ref|XP_004511715.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Cicer 
arietinum]
 ref|XP_004511716.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X4 [Cicer 
arietinum]
Length=269

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C       +  VY+   Q+HLAPSGY+K+PN +  YL  CR+LPK+NNE   ++
Sbjct  84   CGTGILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPAER  143

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  144  NSTYKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQETKLYTEDWIGL  203

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+V F  + G HL I+  ++K+++VPY+
Sbjct  204  RTLDEAGRVHFVSIEGKHLGISETDMKKHVVPYL  237



>ref|XP_009591270.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=338

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 102/154 (66%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C       +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNEV  + 
Sbjct  135  CGSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEVHGNS  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P  +T++Y +D  G 
Sbjct  195  TF--KKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSWSTVLPANETKLYTEDWIGL  252

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAGKVKF  V G+HL I+  E+K+ I+PY+
Sbjct  253  KILDEAGKVKFLNVSGSHLEISTSEMKKNILPYL  286



>gb|AAO42190.1| putative palmitoyl-protein thioesterase precursor [Arabidopsis 
thaliana]
Length=314

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    +  +  +Y+   QDHLAPSGY+KIP DM  YL   ++LPK+NNE+ D +
Sbjct  141  CGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKLNNEIPDQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K RFTSL  LVLI FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  201  NQTYKDRFTSLHNLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AGKVKF  V G H+ +  +++ +++VPY++
Sbjct  261  KTLDDAGKVKFVSVAGEHIRMVDEDVVKHVVPYLQ  295



>ref|NP_199544.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 dbj|BAA97167.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
 gb|AAV97798.1| At5g47330 [Arabidopsis thaliana]
 gb|AAW38984.1| At5g47330 [Arabidopsis thaliana]
 gb|AED95499.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=314

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    +  +  +Y+   QDHLAPSGY+KIP DM  YL   ++LPK+NNE+ D +
Sbjct  141  CGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKLNNEIPDQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K RFTSL  LVLI FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  201  NQTYKDRFTSLHNLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AGKVKF  V G H+ +  +++ +++VPY++
Sbjct  261  KTLDDAGKVKFVSVAGEHIRMVDEDVVKHVVPYLQ  295



>ref|XP_010439999.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=305

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -2

Query  597  VYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLI  418
            VY    QDH  PSG++K+P  +  YL   ++LPK+NNE   ++++  K+RFTSL  LVLI
Sbjct  156  VYNDLVQDHAGPSGFVKVPTKITEYLEHSKYLPKLNNERPAEKNSTFKERFTSLKNLVLI  215

Query  417  LFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGA  238
            +FQ DT+++P+ +S FGYYPDG FS  +P QKT++Y +D  G +TLD+AGKVKF  VPG 
Sbjct  216  MFQKDTVLIPRETSWFGYYPDGAFSPVLPHQKTKLYTEDWIGLKTLDDAGKVKFLSVPGG  275

Query  237  HLVITVDEIKRYIVPYMK  184
            H+ IT +E+ +Y+VPY++
Sbjct  276  HIEITEEELLKYVVPYLQ  293



>ref|XP_010439997.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=310

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = -2

Query  639  FPWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSA  463
             P C + I +  +  VYT   QDH+APSGYIKIP +M  YL   ++LPK+NNE  + ++ 
Sbjct  136  IPKCTSPICKLLKTRVYTDYIQDHIAPSGYIKIPTEMSKYLEHSKYLPKLNNERPNKRNP  195

Query  462  IRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRT  283
            + K RFTSL  LVL++FQ DT+++P+ SS FGYYPDG  +  +  Q+T++Y +D  G + 
Sbjct  196  VFKDRFTSLHNLVLVMFQGDTVVIPKESSWFGYYPDGASTPLLSPQQTKLYTEDWIGLKA  255

Query  282  LDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            LD AGKVKF  VPG HL +  DE+ +Y+VPY+K
Sbjct  256  LDAAGKVKFVSVPGEHLRMAQDEVVKYVVPYLK  288



>ref|NP_193478.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 gb|AAO42200.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63889.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83898.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=304

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  639  FPWCG-TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSA  463
             P C  T+ +  +  VYT   QDH+APSGYIKIP D+K YL   ++LPKINNE  ++++ 
Sbjct  137  IPKCNSTLCELLKTAVYTDFVQDHIAPSGYIKIPTDIKDYLEHSKYLPKINNERPNERNT  196

Query  462  IRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRT  283
              K RFTSL  LVL++F+ D +++P+ SS FGYYPDG  +  +  Q+T++Y +D  G +T
Sbjct  197  TFKDRFTSLHNLVLVMFEGDAVVIPKESSWFGYYPDGASTPLLSPQQTKLYTEDWIGLKT  256

Query  282  LDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA  163
            LD A KVKF  VPG HL I  D++ +++VPY+K   AS++
Sbjct  257  LDAARKVKFVSVPGEHLRIAQDDVVKHVVPYLKNQPASMS  296



>ref|XP_009411584.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIPND+ GY+ GC FLPK+NNE    +
Sbjct  139  CGSGILCKLVDNLIKLQIYSDYVQAHLAPSGYLKIPNDIPGYMEGCMFLPKLNNEDPSKR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+R +SL  LVLI+F+ DT+++P+ +S FGYYPD +F+  +P  +T +Y +D  G 
Sbjct  199  NATYKERLSSLQNLVLIMFEHDTVLVPRETSWFGYYPDDNFNPILPPNQTTLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VK+  V G H+ I+  +++++IVPY++
Sbjct  259  KTLDDAGRVKYISVKGNHIKISQSDMRKHIVPYLE  293



>ref|XP_010439998.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=305

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = -2

Query  609  YEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTL  430
            Y   VY    QDH APSG  KIP D+K YL   ++LPK+NNE   ++++  K RFTSL  
Sbjct  152  YLSDVYNNFVQDHAAPSGCFKIPTDIKNYLEHSKYLPKLNNERPGEKNSTYKDRFTSLHN  211

Query  429  LVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFK  250
            LVLI+F+ D ++ P+ SS FGYYPDG ++  +P QKT++Y KD  G +TLD+AGKVKF  
Sbjct  212  LVLIMFEKDNVLTPKESSWFGYYPDGAYTPILPPQKTKLYTKDWIGLKTLDDAGKVKFVS  271

Query  249  VPGAHLVITVDEIKRYIVPYMK  184
            VPG H+ IT +E+ +Y+VPY++
Sbjct  272  VPGGHIEITKEELVKYVVPYLQ  293



>ref|XP_009797091.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X4 [Nicotiana 
sylvestris]
Length=273

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = -2

Query  636  PWCGTIG-------QYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQ  478
            P+CG  G          +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNE+ 
Sbjct  66   PFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIH  125

Query  477  DDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDT  298
             + +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P ++T++Y +D 
Sbjct  126  GNSTF--KKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDW  183

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             G + LDEAGKVKF  V G HL I+  E+K+ I+PY+
Sbjct  184  IGLKILDEAGKVKFLNVSGNHLEISTSEMKKNILPYL  220



>ref|XP_002865123.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41382.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=313

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = -2

Query  651  PCGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            PC     C    +     VY+   QD+LAPSGY K P+++  YL GC++LPK+NNE  D 
Sbjct  139  PCNSGGICNITNEIINGDVYSDFAQDNLAPSGYYKNPHNVTEYLKGCKYLPKLNNERPDQ  198

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            ++   K RFTSL  LV +LFQ DT+I+P+ SS FG+YPDGD +  +PV +T++YI+D  G
Sbjct  199  RNQTYKDRFTSLQKLVFVLFQNDTVIVPKESSWFGFYPDGDLTHVLPVSQTKLYIEDWIG  258

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             + L  AGKV+F  VP AHL+I  +++  Y+VP ++
Sbjct  259  LKALARAGKVQFVIVPSAHLIIADEDLVNYVVPLLE  294



>gb|ABK93080.1| unknown [Populus trichocarpa]
Length=394

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 104/154 (68%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K PND+  YL  CRFLPK+NNE  +  
Sbjct  182  CGSGIFCILADALMKSEIYSDYVQAHLAPSGYLKFPNDIPRYLEKCRFLPKLNNESPEGM  241

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D+I++P+ +S FGYYPDG F   VP ++T++Y +D  G 
Sbjct  242  NTTYKERFSSLQNLVLIMFENDSILIPKETSWFGYYPDGAFKPIVPAKETKLYTEDWIGL  301

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+V F  V G HL I+  ++K+++VP++
Sbjct  302  RTLDEAGRVHFVNVSGGHLGISKSDLKKHVVPFL  335



>emb|CDY18970.1| BnaC01g20980D [Brassica napus]
Length=191

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 107/154 (69%), Gaps = 4/154 (3%)
 Frame = -2

Query  645  GKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQS  466
              +P C    Q  E  VY+   QDH+AP GYIK+  ++  Y+   +FLPK+NNE  ++++
Sbjct  35   ASYPLC----QLQETEVYSDSAQDHIAPCGYIKLATEISEYMEHSKFLPKLNNERPNERN  90

Query  465  AIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFR  286
            +  K+RFTSL  LVL++F+ DTI++P+ +  FG+YP+G  +  +P QKT++YI+D  G +
Sbjct  91   STYKERFTSLHNLVLVMFEGDTIVVPRETCWFGFYPEGATAPLLPPQKTKLYIEDWIGLK  150

Query  285  TLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            TLD+AGKVKF  VPG HL +  D++ +Y+VPY++
Sbjct  151  TLDDAGKVKFVGVPGDHLEMAHDDVVKYVVPYLQ  184



>ref|XP_009797089.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Nicotiana 
sylvestris]
Length=339

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 102/154 (66%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C       +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNE+  + 
Sbjct  135  CGSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIHGNS  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P ++T++Y +D  G 
Sbjct  195  TF--KKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDWIGL  252

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAGKVKF  V G HL I+  E+K+ I+PY+
Sbjct  253  KILDEAGKVKFLNVSGNHLEISTSEMKKNILPYL  286



>ref|XP_006368987.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
 gb|ERP65556.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
Length=341

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 103/154 (67%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K PND+  Y+  CRFLPK+NNE+ +++
Sbjct  140  CGSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFLPKLNNEIPEER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   VP  +T +Y +D  G 
Sbjct  200  NTTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPAHQTALYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAG+V F  V G HL I+  ++K+++VP++
Sbjct  260  KALDEAGRVHFVNVSGGHLGISESDMKKHVVPFL  293



>ref|XP_002865126.1| hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41385.1| hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    +  +  +Y+   QDHLAPSGY+KIP DM  YL   ++LPK+NNE+ + +
Sbjct  141  CGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLENSKYLPKLNNEIPNQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  LVLI FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  201  NSTYKDRFTSLQNLVLIKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AGKVKF  V G H+ +  +++ +++VPY++
Sbjct  261  KTLDDAGKVKFVSVAGEHIRMADEDVVKHVVPYLQ  295



>ref|XP_009591271.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=332

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = -2

Query  636  PWCGTIG-------QYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQ  478
            P+CG  G          +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNEV 
Sbjct  126  PFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEVH  185

Query  477  DDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDT  298
             + +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P  +T++Y +D 
Sbjct  186  GNSTF--KKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSWSTVLPANETKLYTEDW  243

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             G + LDEAGKVKF  V G+HL I+  E+K+ I+PY+
Sbjct  244  IGLKILDEAGKVKFLNVSGSHLEISTSEMKKNILPYL  280



>gb|KFK24549.1| hypothetical protein AALP_AAs62283U000300 [Arabis alpina]
Length=312

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  636  PWCG-TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAI  460
            P C   I +  ++ VYT   QDH+APSG+IKIP DMK YL   ++LPK+NNE   ++++ 
Sbjct  140  PTCTFQICKLLKEEVYTDYVQDHIAPSGFIKIPTDMKNYLEHSKYLPKLNNERPKERNST  199

Query  459  RKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTL  280
             K+RFTSL  LVL++FQ D +++P+ S  FGYYP+G     +P QKT++Y +D  G +TL
Sbjct  200  FKQRFTSLHNLVLVMFQGDKVVIPKESCWFGYYPEGASKPLLPPQKTKLYREDWIGLKTL  259

Query  279  DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            D AGKVKF  VPG HL +  D++ +Y+VPY++
Sbjct  260  DVAGKVKFVSVPGEHLQMAKDDVVKYVVPYLQ  291



>ref|XP_009591269.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=339

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = -2

Query  636  PWCGTIG-------QYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQ  478
            P+CG  G          +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNEV 
Sbjct  133  PFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEVH  192

Query  477  DDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDT  298
             + +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P  +T++Y +D 
Sbjct  193  GNSTF--KKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSWSTVLPANETKLYTEDW  250

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             G + LDEAGKVKF  V G+HL I+  E+K+ I+PY+
Sbjct  251  IGLKILDEAGKVKFLNVSGSHLEISTSEMKKNILPYL  287



>ref|XP_004511713.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Cicer 
arietinum]
Length=327

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C       +  VY+   Q+HLAPSGY+K+PN +  YL  CR+LPK+NNE   ++
Sbjct  142  CGTGILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPAER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  202  NSTYKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQETKLYTEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+V F  + G HL I+  ++K+++VPY+
Sbjct  262  RTLDEAGRVHFVSIEGKHLGISETDMKKHVVPYL  295



>ref|XP_010440002.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Camelina 
sativa]
Length=306

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = -2

Query  651  PCGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            P   FP C  + + Y   VY    QDH APSGY K+P  +  YL   ++LPK+NNE   +
Sbjct  140  PKCTFPLCKLL-ELYLSDVYNDFVQDHAAPSGYFKLPTKITEYLEHSKYLPKLNNERPGE  198

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K RFTSL  LVLI+F+ D ++ P+ SS FGYYPDG ++  +P QKT++Y +D  G
Sbjct  199  KNSTYKDRFTSLHNLVLIMFEKDDVLTPKESSWFGYYPDGTYTPILPPQKTKLYTEDWIG  258

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             +TLD+AGKV F  VPG H+ IT +E+ +Y+VPY+K
Sbjct  259  LKTLDDAGKVNFVSVPGGHIEITEEELVKYVVPYLK  294



>ref|XP_006368986.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
 gb|ABK93872.1| unknown [Populus trichocarpa]
 gb|ERP65555.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
Length=366

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 103/154 (67%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K PND+  Y+  CRFLPK+NNE+ +++
Sbjct  140  CGSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFLPKLNNEIPEER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   VP  +T +Y +D  G 
Sbjct  200  NTTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPAHQTALYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAG+V F  V G HL I+  ++K+++VP++
Sbjct  260  KALDEAGRVHFVNVSGGHLGISESDMKKHVVPFL  293



>ref|XP_011047609.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Populus euphratica]
 ref|XP_011047610.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Populus euphratica]
 ref|XP_011047611.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Populus euphratica]
Length=366

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 103/154 (67%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   Q HLAPSGY+K PND+  Y+  CRFLPK+NNE+ +++
Sbjct  140  CGSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFLPKLNNEIPEER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   K+RF+SL  LVLI+F+ D +++P+ +S FGYYPDG F   VP  +T +Y +D  G 
Sbjct  200  NTTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPANQTALYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAG+V F  V G HL I+  ++K+++VP++
Sbjct  260  KALDEAGRVHFVNVSGGHLGISESDMKKHVVPFL  293



>gb|KDO61330.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
Length=236

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = -2

Query  624  TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRF  445
            ++G  +      P   DHLAPSGY+K PND+  YL  C+FLPK+NNE+ D +++  K+ F
Sbjct  38   SLGGPHAGTASVPLCGDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECF  97

Query  444  TSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGK  265
            +SL  LVLI+F+ D +++P+ ++ FGYYPDG FS  +P QKT++Y +D  G +TLD+AG+
Sbjct  98   SSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGR  157

Query  264  VKFFKVPGAHLVITVDEIKRYIVPYMK  184
            V F  V G HL I+  ++K++I+PY+K
Sbjct  158  VHFISVAGGHLKISKADMKKHIIPYLK  184



>ref|XP_004511714.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Cicer 
arietinum]
Length=327

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C       +  VY+   Q+HLAPSGY+K+PN +  YL  CR+LPK+NNE   ++
Sbjct  142  CGVSILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPAER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG F   +P Q+T++Y +D  G 
Sbjct  202  NSTYKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQETKLYTEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            RTLDEAG+V F  + G HL I+  ++K+++VPY+
Sbjct  262  RTLDEAGRVHFVSIEGKHLGISETDMKKHVVPYL  295



>ref|XP_009144465.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Brassica rapa]
Length=300

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 107/154 (69%), Gaps = 4/154 (3%)
 Frame = -2

Query  645  GKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQS  466
              +P C    Q  E  VY+   QDH+AP GYIK+  ++  Y+   +FLPK+NNE  ++++
Sbjct  144  ASYPLC----QLQETEVYSDSAQDHIAPCGYIKLATEISEYMEHSKFLPKLNNERPNERN  199

Query  465  AIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFR  286
            +  K+RFTSL  LVL++F+ DTI++P+ +  FG+YPDG  +  +P QKT++YI+D  G +
Sbjct  200  STYKERFTSLHNLVLVMFEGDTIVVPRETCWFGFYPDGATAPLLPPQKTKLYIEDWIGLK  259

Query  285  TLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            TLD+AGKVKF  VPG HL +  D++ +Y+VPY++
Sbjct  260  TLDDAGKVKFVGVPGDHLEMAHDDVVKYVVPYLQ  293



>ref|XP_009797090.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X3 [Nicotiana 
sylvestris]
Length=333

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = -2

Query  636  PWCGTIG-------QYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQ  478
            P+CG  G          +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNE+ 
Sbjct  126  PFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIH  185

Query  477  DDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDT  298
             + +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P ++T++Y +D 
Sbjct  186  GNSTF--KKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDW  243

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             G + LDEAGKVKF  V G HL I+  E+K+ I+PY+
Sbjct  244  IGLKILDEAGKVKFLNVSGNHLEISTSEMKKNILPYL  280



>gb|EYU31902.1| hypothetical protein MIMGU_mgv1a010171mg [Erythranthe guttata]
Length=320

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    E  +Y    Q+HLAP+ YIKIP D+  Y  GC+FLPKINNE+   +
Sbjct  143  CGSGLVCILVDFLIELAIYGNYVQEHLAPASYIKIPTDLDQYKKGCKFLPKINNEIH--K  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRF+SL  LVLI+F+ D I++P+ +S FGY+PDG +   +P  +T +Y +D  G 
Sbjct  201  NSTYKKRFSSLDNLVLIMFENDVILVPKETSWFGYFPDGSWETILPANETTLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAGKVK+  V G HL I+ DE+++Y++PY+
Sbjct  261  KALDEAGKVKYVNVSGGHLDISYDEMEKYVLPYL  294



>gb|EYU19286.1| hypothetical protein MIMGU_mgv1a021282mg, partial [Erythranthe 
guttata]
Length=214

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            GVY+   Q+  APSGY KIP +MKGYL  C+FLPK+NNE  +D++ + KKRFTSL  L+L
Sbjct  50   GVYSEYAQNQFAPSGYTKIPENMKGYLKSCKFLPKLNNERPNDRNPVYKKRFTSLKNLIL  109

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I+ + +T+I P+ SS FGYY +G     +  ++T++YI+D  G + LD+AG+VKF KVPG
Sbjct  110  IMSENETVIKPKESSWFGYYEEGITKKILQPRQTKLYIEDWIGLKALDKAGRVKFIKVPG  169

Query  240  AHLVITVDEIKRYIVPYMK  184
             H+ ++  + K+Y+VPY++
Sbjct  170  THIEVSDVDTKKYVVPYLQ  188



>ref|XP_009797088.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Nicotiana 
sylvestris]
Length=340

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = -2

Query  636  PWCGTIG-------QYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQ  478
            P+CG  G          +  +Y+   Q+HLAP+GYIKIP D+  Y  GC+FLP +NNE+ 
Sbjct  133  PFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIH  192

Query  477  DDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDT  298
             + +   KKRF SL  LVLI+F+ D I++P+ +S FGYYPDG +S  +P ++T++Y +D 
Sbjct  193  GNSTF--KKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDW  250

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             G + LDEAGKVKF  V G HL I+  E+K+ I+PY+
Sbjct  251  IGLKILDEAGKVKFLNVSGNHLEISTSEMKKNILPYL  287



>gb|EPS59624.1| hypothetical protein M569_15181, partial [Genlisea aurea]
Length=286

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 111/158 (70%), Gaps = 8/158 (5%)
 Frame = -2

Query  636  PWCGTIGQY-------YEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQ  478
            P CG+ G          +  +Y+   QDHLAPSGY+K+PND+ GYLS CRFLPK+NNE+ 
Sbjct  129  PLCGSGGALCVVADALIKSEIYSNFVQDHLAPSGYLKLPNDISGYLSKCRFLPKLNNEIP  188

Query  477  DDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFS-APVPVQKTQVYIKD  301
            + ++A  ++RF+ L  LVLI+F  DT+++P+ +S FGYYP+G+F  A +  ++T++Y +D
Sbjct  189  NGRNATYRERFSGLRNLVLIMFDRDTVVIPKETSWFGYYPEGEFGPAILGPRETRLYRED  248

Query  300  TFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
              G + LD+AG+VK+  V G HL I+  ++K+++VPY+
Sbjct  249  WIGLKALDDAGRVKYVAVAGNHLGISEADMKKHVVPYL  286



>ref|XP_001765759.1| predicted protein [Physcomitrella patens]
 gb|EDQ69350.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C     C         GVY+   Q+HLAPSGY+KIPND+  Y  G  FLPK+NNE+   +
Sbjct  103  CSIMSLCKLADALIRLGVYSSFVQNHLAPSGYVKIPNDLAAYYKGSMFLPKLNNEIASTR  162

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   KKRF S+  LVLI+FQ D I++P  ++ FGYY + DF+  +P ++T +Y +D  G 
Sbjct  163  NETYKKRFESINHLVLIMFQEDAILVPPQTAWFGYYGENDFTTVLPPERTDLYKEDWIGL  222

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            RTLDEAG+V +   PG HL I   ++K+++VPY++
Sbjct  223  RTLDEAGRVTYIAFPGDHLSINDVQLKKFVVPYLR  257



>ref|XP_006280829.1| hypothetical protein CARUB_v10026804mg [Capsella rubella]
 gb|EOA13727.1| hypothetical protein CARUB_v10026804mg [Capsella rubella]
Length=316

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   QDHLAPSGY+KIP DM  YL   ++LPK+NNE+ + +
Sbjct  142  CGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLESSKYLPKLNNEIPNQR  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  LVL+ FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  202  NSTYKDRFTSLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  V G H+ +  +++ +Y+VPY++
Sbjct  262  KTLDVAGKVKFVSVAGEHIRMANEDVVKYVVPYLQ  296



>gb|ABD65098.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
Length=300

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 108/154 (70%), Gaps = 4/154 (3%)
 Frame = -2

Query  645  GKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQS  466
              +P C    Q  E  VY+   QDH+AP GYIK+ +++  Y+   +FLPK+NNE  ++++
Sbjct  144  ASYPLC----QLQETEVYSDSAQDHIAPCGYIKLASEISEYMEHSKFLPKLNNERPNERN  199

Query  465  AIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFR  286
            +  K+RFTSL  LVL++F+ DTI++P+ +  FG+YP+G  +  +P QKT++YI+D  G +
Sbjct  200  STYKERFTSLHNLVLVMFEGDTIVVPRETCWFGFYPEGATAPLLPPQKTKLYIEDWIGLK  259

Query  285  TLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            TLD+AGKVKF  VPG HL +  D++ +Y+VPY++
Sbjct  260  TLDDAGKVKFVGVPGDHLEMAHDDVVKYVVPYLQ  293



>ref|XP_010441474.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=314

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   QDHLAPSGY+KIP DMK YL   ++LP++NNE+ + +
Sbjct  141  CGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDMKKYLESSKYLPRLNNEIPNQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVL+ FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  201  NSTYKERFASLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFKPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  V G H+ +  +++ +Y+VPY++
Sbjct  261  KTLDVAGKVKFVSVAGEHIRMADEDVVKYVVPYLQ  295



>ref|XP_008238428.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Prunus mume]
Length=360

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    Q  +  +Y+   Q HLAPSGY+K+PN M  YL  C+FLP +NNE  D +
Sbjct  140  CGSGIFCIIANQLLKSEIYSDYIQAHLAPSGYLKLPNAMADYLEKCKFLPMLNNERPDGK  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYY D  F + +  ++T +Y +D  G 
Sbjct  200  NSTLKERFSSLENLVLIMFEHDTVLIPKETSWFGYYQDDTFKSILSPRQTNLYKEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R LDEAG+VK+  VPG HL I+  ++K+++VPY+ 
Sbjct  260  RALDEAGRVKYISVPGGHLGISTSDMKKHVVPYLN  294



>ref|XP_007210516.1| hypothetical protein PRUPE_ppa007666mg [Prunus persica]
 gb|EMJ11715.1| hypothetical protein PRUPE_ppa007666mg [Prunus persica]
Length=360

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C    Q  +  +Y+   Q HLAPSGY+K+PN M  YL  C+FLPK+NNE  D +
Sbjct  140  CGSGIFCIIANQLLKSEIYSDYIQAHLAPSGYLKLPNAMADYLEKCKFLPKLNNERPDGK  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYY D  F + +  ++T +Y +D  G 
Sbjct  200  NSTLKERFSSLENLVLIMFEHDTVLIPKETSWFGYYQDDTFKSILSPRQTNLYKEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            R LDEAG+VK+  VPG HL I+  ++ +++VPY+ 
Sbjct  260  RALDEAGRVKYISVPGGHLGISTSDMMKHVVPYLN  294



>ref|XP_010529980.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Tarenaya hassleriana]
Length=290

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   QD LAPSGYIKIP D+  YL   ++LPK+NNE  DD+
Sbjct  136  CGSGEICRLADELIKLEIYSDYIQDRLAPSGYIKIPTDITSYLQHSKYLPKLNNEKADDR  195

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  LVL++F+ D +++P+ +S FG+YPDGDF   +  Q+T++Y +D  G 
Sbjct  196  NSTFKDRFTSLHNLVLVMFEDDKVLVPKETSWFGFYPDGDFHRLLSPQQTKLYEEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VKF  V G H+ +  D++ +Y+VPY++
Sbjct  256  KTLDDAGRVKFVSVAGEHIRMAHDDVLKYVVPYLR  290



>ref|XP_002868063.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44322.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=304

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -2

Query  636  PWCG-TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAI  460
            P C  T+ +  +  VYT   QDH+APSGYIKIP D+K YL   ++LP++NNE   +++A 
Sbjct  138  PKCNSTLCELLKTEVYTDFVQDHIAPSGYIKIPTDIKNYLEHSKYLPQLNNERPKERNAT  197

Query  459  RKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTL  280
             K RFTSL  LVL++F  DT+++P+ SS FGYYPDG  +  +  Q+T++Y +D  G +TL
Sbjct  198  FKDRFTSLHNLVLVMFDGDTVVIPKESSWFGYYPDGASTPLLSPQETKLYTEDWIGLKTL  257

Query  279  DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK**DASLA  163
            + AGKVKF  V G HL I  D++ +Y+ PY+K   AS++
Sbjct  258  NTAGKVKFVSVHGEHLRIAQDDVVKYVAPYLKNQPASMS  296



>gb|KCW77193.1| hypothetical protein EUGRSUZ_D01540 [Eucalyptus grandis]
Length=168

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -2

Query  552  IKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSH  373
            +KIP D+  YL GC+FLPK+NNE+   +++  K+RF SL  LVLI+F+ DT+++P+ +S 
Sbjct  1    MKIPTDLANYLKGCKFLPKLNNELVHHRNSTYKERFASLQNLVLIMFEQDTVLIPKETSW  60

Query  372  FGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVP  193
            FGYYPDG F   +P Q+T++YI+D  G +TLDEAGKVKF  V G HL I++ ++++YIVP
Sbjct  61   FGYYPDGTFDTLLPAQETELYIEDWIGLKTLDEAGKVKFINVSGNHLQISLADMQKYIVP  120

Query  192  YM  187
            Y+
Sbjct  121  YL  122



>ref|XP_007039751.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY24252.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=364

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +YT   Q HLAPSGY+K+PND+  YL  CRFLPK+NNE+  ++
Sbjct  139  CGSGFLCLIADKLIKSEIYTDYIQAHLAPSGYLKLPNDIVHYLEKCRFLPKLNNELPGER  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RFT L  LVLI+F+ D +++P+ +S FGYYP+G F   +  Q+T++Y +D  G 
Sbjct  199  NSTYKERFTRLQNLVLIMFEQDNVLIPRETSWFGYYPNGGFKPVIRPQETKLYTEDWIGL  258

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V +  V G HL I+  ++K+++VPY+K
Sbjct  259  KTLDDAGRVHYISVSGGHLGISRKDMKKHVVPYLK  293



>gb|KDP39913.1| hypothetical protein JCGZ_03444 [Jatropha curcas]
Length=351

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 104/154 (68%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C       +  +Y+   QDHLAP+GY+K PND+  YL  C+FLPK+NNE+  ++
Sbjct  140  CGTGILCIIANNLLKSEIYSDYVQDHLAPAGYLKFPNDIPNYLKKCKFLPKLNNELPGER  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++I K+R TSL  LVLI+F+ D +++P+ ++ FGYY DG F   +P ++T++Y +D  G 
Sbjct  200  NSIYKERLTSLQNLVLIMFENDKVLIPKETAWFGYYADGSFETILPAEQTKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + L+EAG+V F  V G HL I+  ++K+++VP++
Sbjct  260  KALNEAGRVHFVNVSGGHLGISRSDMKKHVVPFL  293



>emb|CDY41045.1| BnaA09g18240D [Brassica napus]
Length=315

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   QDHLAPS Y+KIP ++  YL   ++LPK+NNE+ + +
Sbjct  141  CGNGSLCEIADKLIKSEIYSDFIQDHLAPSNYLKIPTEINKYLEKSKYLPKLNNEIPNQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  LVL+ FQ D +I+PQ SS FG+YPDG F   +  Q+T++Y +D  G 
Sbjct  201  NSTYKDRFTSLHNLVLVKFQDDKVIVPQDSSWFGFYPDGAFKPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AGKVKF  V GAH+++   ++ +Y+VPY++
Sbjct  261  KTLDDAGKVKFVSVKGAHIIMADLDVVKYVVPYLQ  295



>ref|XP_010481340.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=314

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   QDHLAPSGY+KIP +MK YL   ++LP++NNE+ + +
Sbjct  141  CGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTNMKKYLESSKYLPRLNNEIPNQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVL+ FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  201  NSTYKERFASLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AGKVKF  V G H+ +  +++ +++VPY++
Sbjct  261  KTLDDAGKVKFVSVAGEHIRMADEDVVKHVVPYLQ  295



>emb|CDX77758.1| BnaC07g20120D [Brassica napus]
Length=312

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC    +  +  +Y+   QDHLAPSGY+KIP +MK YL   ++LPK+NNE+   +
Sbjct  138  CGSGLWCEIADELIKSDIYSDFIQDHLAPSGYLKIPTEMKKYLESSKYLPKLNNEIPGQR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ D +I+P+ SS FG+YPDGDF   + V++T+++ +D  G 
Sbjct  198  NSTYKERFASLHNLVLIMFEDDKVIVPKDSSWFGFYPDGDFGPLLTVRETKLFKEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + L + GKV+F  + GAHL ++  +I +Y+VPY++
Sbjct  258  KPLVDTGKVEFVSIDGAHLRMSNVDIVKYVVPYLQ  292



>gb|KFK31386.1| hypothetical protein AALP_AA6G105200 [Arabis alpina]
Length=311

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 103/155 (66%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   QDHLAPSGY+KIP DM  YL   ++LPK+NNE+ + +
Sbjct  138  CGSGLLCEIADELIKSDIYSDFIQDHLAPSGYLKIPTDMTKYLESSKYLPKLNNEIPNQR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  L+L+ F+ D +I+P+ SS FG+YPDG+F   +   +T++Y +D  G 
Sbjct  198  NSTYKDRFTSLHNLILVKFEDDKVIVPKDSSWFGFYPDGEFEPLLSANQTKLYTEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  V GAH+ +   ++ +Y+VPY++
Sbjct  258  KTLDVAGKVKFVSVAGAHIKMANLDVLKYVVPYLQ  292



>ref|XP_007039750.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY24251.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +YT   Q HLAPSGY+K+PND+  YL  CRFLPK+NNE+  ++
Sbjct  196  CGSGFLCLIADKLIKSEIYTDYIQAHLAPSGYLKLPNDIVHYLEKCRFLPKLNNELPGER  255

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RFT L  LVLI+F+ D +++P+ +S FGYYP+G F   +  Q+T++Y +D  G 
Sbjct  256  NSTYKERFTRLQNLVLIMFEQDNVLIPRETSWFGYYPNGGFKPVIRPQETKLYTEDWIGL  315

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+V +  V G HL I+  ++K+++VPY+K
Sbjct  316  KTLDDAGRVHYISVSGGHLGISRKDMKKHVVPYLK  350



>ref|XP_010481339.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X2 [Camelina 
sativa]
Length=305

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 103/155 (66%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P+C    +  ++G+Y+   Q++ APSGY KIP D+  YL   ++LPK++NE+ + +
Sbjct  140  CNSSPYCKKFDEIIKRGLYSDFAQNNAAPSGYYKIPTDITMYLESSKYLPKLSNEIPNQR  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL+ FQ D +I+P  S+ FG+YPDGDF   +P Q+T++Y +D  G 
Sbjct  200  NSTYKDRFASLHNLVLVKFQDDKVIVPIESTWFGFYPDGDFKHVLPAQQTKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  VPG HL +   ++  ++VPY+K
Sbjct  260  KTLDTAGKVKFVSVPGGHLDMAYQDVVTHVVPYLK  294



>ref|XP_010434663.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X2 [Camelina 
sativa]
Length=294

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = -2

Query  639  FPWCGT-IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSA  463
             P C + I +  +  VYT   Q+H+APSGYIKIP +M  YL   ++LPK+NNE  + ++ 
Sbjct  136  IPKCNSPICKLLKTRVYTDYIQNHIAPSGYIKIPTEMSKYLEHSKYLPKLNNERPNKRNP  195

Query  462  IRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRT  283
            + K RFTSL  LVL++   DT+++P+ SS FGYYPDG  +  +  Q+T++YI+D  G +T
Sbjct  196  VFKDRFTSLHNLVLVM--GDTVVIPKESSWFGYYPDGASTPLLSPQQTKIYIEDWIGLKT  253

Query  282  LDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            LD AGKVKF  VPG HL I  DE+ +Y+VPY+K
Sbjct  254  LDAAGKVKFVSVPGEHLRIAQDEVVKYVVPYLK  286



>gb|ABD64963.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
Length=328

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC    +  +  +Y+   QDHLAPSGY+KIP +MK YL   ++LPK+NNE+   +
Sbjct  138  CGSGLWCEIADELIKSDIYSDFIQDHLAPSGYLKIPTEMKKYLESSKYLPKLNNEIPGQR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI+F+ D +I+P+ SS FG+YPDGDF   + V++T+++ +D  G 
Sbjct  198  NSTYKERFASLHNLVLIMFEDDKVIVPKDSSWFGFYPDGDFGPLLTVRETKLFKEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + L + GKV+F  + GAHL ++  +I +Y+VPY++
Sbjct  258  KPLVDTGKVEFVSIDGAHLRMSNVDIVKYVVPYLQ  292



>ref|XP_010494964.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=314

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   +C       +  +Y+   QDHLAPSGY+KIP DMK YL   ++LP++NNE+ + +
Sbjct  141  CGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDMKKYLESSKYLPRLNNEIPNQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVL+ FQ D +I+P+ SS FG+YPDG+    +  Q+T++Y +D  G 
Sbjct  201  NSTYKERFASLHNLVLVKFQDDKVIVPKDSSWFGFYPDGESKPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKVKF  V G H+ +  +++ +Y+VPY++
Sbjct  261  KTLDVAGKVKFVSVAGEHIRMADEDVVKYVVPYLQ  295



>ref|XP_006285486.1| hypothetical protein CARUB_v10006914mg [Capsella rubella]
 gb|EOA18384.1| hypothetical protein CARUB_v10006914mg [Capsella rubella]
Length=287

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  576  DHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTI  397
            DH+APSGY+KIP D++ YL   ++LP++NNE   ++++  K RFTSL  LVLI++Q DT+
Sbjct  145  DHVAPSGYVKIPTDIEKYLEYSKYLPELNNERPGEKNSTFKDRFTSLHNLVLIMYQNDTM  204

Query  396  IMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVD  217
            ++P+ +S FGYYPDG FS  +P QKT++Y +D  G +TLD+AGKVKF  VPG H+ I  +
Sbjct  205  LVPRETSWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGKVKFVSVPGGHIEIRDE  264

Query  216  EIKRYIVPYMK  184
            ++ +Y+VPY++
Sbjct  265  DLVKYVVPYLQ  275



>emb|CDY64683.1| BnaA06g40130D [Brassica napus]
Length=312

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC    +  +  +Y+   QDHLAPSGY+KIP +MK YL   ++LPK+NNE+ + +
Sbjct  138  CGSGLWCEIADELIKSDIYSDFIQDHLAPSGYLKIPTEMKKYLESSKYLPKLNNEIPNQR  197

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVLI F+ D +I+P+ SS FG+YPDGDF   + V++T+++ +D  G 
Sbjct  198  NSTYKERFASLHNLVLIKFEDDKVIVPKDSSWFGFYPDGDFGPLLTVRETKLFQEDWIGL  257

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + L + GKV+F  + GAHL I+  +I +Y+VP+++
Sbjct  258  KPLIDTGKVEFVSIDGAHLKISNIDIVKYVVPHLQ  292



>ref|NP_193477.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 ref|NP_001190752.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 ref|NP_001190753.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 gb|AAY25412.1| At4g17470 [Arabidopsis thaliana]
 gb|AEE83895.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 gb|AEE83896.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 gb|AEE83897.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
Length=308

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  597  VYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLI  418
            +Y+   QDH APSGY+K P ++K YL   ++LPK+NNE   ++++  K RFTSL  LVLI
Sbjct  157  IYSDFAQDHTAPSGYVKKPMEIKNYLEHSKYLPKLNNERPGEKNSTFKDRFTSLQNLVLI  216

Query  417  LFQADTIIMPQISSHFGYYPDGDFSAP--VPVQKTQVYIKDTFGFRTLDEAGKVKFFKVP  244
            +FQ DTI++P+ +S FGYYPDG  S+   +P QKT++Y +D  G +TLD+AGKV+F  VP
Sbjct  217  MFQNDTILVPRETSWFGYYPDGASSSTPVLPPQKTKLYTEDWIGLKTLDDAGKVRFISVP  276

Query  243  GAHLVITVDEIKRYIVPYMK  184
            G H+ IT +++ +Y+VPY++
Sbjct  277  GGHIEITEEDLVKYVVPYLQ  296



>ref|XP_002865124.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41383.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=316

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            CG         VY+   QD LAPSGY K P ++  YL GC++LPK+NNE  D ++   K 
Sbjct  149  CGIANGIGNGDVYSDFVQDSLAPSGYFKDPKNVTEYLKGCKYLPKLNNERPDQRNQTYKD  208

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RFTSL  +VL+LFQ DT+I+P+ SS FG+YPDGD +  + V KT++YI+D  G + L  A
Sbjct  209  RFTSLHNVVLVLFQNDTVIVPKESSWFGFYPDGDLTHVLSVDKTKLYIEDWIGLKALVVA  268

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            GKV+F  VPG HL+I  +++ +Y+VP ++
Sbjct  269  GKVQFVNVPGNHLIIADEDLVKYVVPLLQ  297



>dbj|BAA97168.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=293

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -2

Query  576  DHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTI  397
            DHLAPSGY KIPNDMK YL   ++LPK+NNE+ + ++   K RFTSL  LVL+ FQ D +
Sbjct  144  DHLAPSGYYKIPNDMKQYLERSKYLPKLNNEIPNQRNQTYKDRFTSLHNLVLVKFQDDEV  203

Query  396  IMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVD  217
            I P  S+ FG+YPDG+F   +   +T++Y +D  G +TLD+AGKVKF  VPG H+ +  +
Sbjct  204  ITPNDSTWFGFYPDGEFETLLSANQTKLYTEDWIGLKTLDDAGKVKFVSVPGGHVRMAEE  263

Query  216  EIKRYIVPYMK  184
            ++ +Y+VPY++
Sbjct  264  DVVKYVVPYLQ  274



>gb|KFK30318.1| hypothetical protein AALP_AA7G246200 [Arabis alpina]
Length=318

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C    WC  +    EKG+YT   QDHLAPSGY KIP+D+  YL   ++LP +NNE  + +
Sbjct  139  CTYGKWCNEVNTLIEKGLYTDFVQDHLAPSGYYKIPSDIPKYLESAKYLPILNNEKPNQR  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDG----DFSAP--VPVQKTQVYI  307
            ++  K RFTSL  LVL++FQ D+ I+P+ SS FG +PDG    D S P  +  Q+T +YI
Sbjct  199  NSTYKDRFTSLNNLVLVMFQNDSAIIPKESSWFGVFPDGTNPNDTSPPPLLSAQQTPLYI  258

Query  306  KDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +D  G +TLD AGKV+F  VPG H+ +   +I +Y+VP ++
Sbjct  259  EDWIGLKTLDVAGKVQFVSVPGQHVEMATPDIIKYVVPLLQ  299



>ref|XP_006398427.1| hypothetical protein EUTSA_v10000967mg [Eutrema salsugineum]
 gb|ESQ39880.1| hypothetical protein EUTSA_v10000967mg [Eutrema salsugineum]
Length=314

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 103/155 (66%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   Q+HLAPSGY+KIP ++  YL   ++LPK+NNE+ D +
Sbjct  141  CGSGLLCEIADELIKADIYSDFIQEHLAPSGYLKIPTELTKYLERSKYLPKLNNEIPDQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  LVL+ FQ D +I+P+ SS FG+YPDG+F   +  Q+T++Y +D  G 
Sbjct  201  NSTYKDRFTSLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD AGKV+F  V G H+ +   ++ +YIVPY++
Sbjct  261  KTLDAAGKVRFVSVAGEHIKMANLDVVKYIVPYLQ  295



>ref|XP_002863365.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39624.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=304

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 96/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  630  CGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKK  451
            C       +  VY+   QDH APSGY K P DMK YL   ++LPK++NE+ + +++  K 
Sbjct  153  CDAFDALVKADVYSEFVQDHFAPSGYFKNPMDMKRYLENSKYLPKLSNEIPNQRNSTYKD  212

Query  450  RFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEA  271
            RFTSL  LVL+ FQ +TII+P  S+ FG+YPDG     +P  KT +Y +D  G +TLD A
Sbjct  213  RFTSLHNLVLVKFQNETIIIPNDSTWFGFYPDGQVEPVLPANKTALYTEDWIGLKTLDAA  272

Query  270  GKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            GKVKF  VPG HL +   ++ +YIVPY++
Sbjct  273  GKVKFVSVPGGHLEMADHDVLKYIVPYLQ  301



>ref|XP_010440003.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Camelina 
sativa]
Length=286

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  588  PDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQ  409
            P   DH APSGY K+P  +  YL   ++LPK+NNE   ++++  K RFTSL  LVLI+F+
Sbjct  140  PKCTDHAAPSGYFKLPTKITEYLEHSKYLPKLNNERPGEKNSTYKDRFTSLHNLVLIMFE  199

Query  408  ADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLV  229
             D ++ P+ SS FGYYPDG ++  +P QKT++Y +D  G +TLD+AGKV F  VPG H+ 
Sbjct  200  KDDVLTPKESSWFGYYPDGTYTPILPPQKTKLYTEDWIGLKTLDDAGKVNFVSVPGGHIE  259

Query  228  ITVDEIKRYIVPYMK  184
            IT +E+ +Y+VPY+K
Sbjct  260  ITEEELVKYVVPYLK  274



>gb|KFK24041.1| hypothetical protein AALP_AAs42697U000100 [Arabis alpina]
Length=300

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  VY    QDH+APSG++KIP +M  YL   ++LPK+NNE  D++
Sbjct  142  CASGPICDIAEAMMKLEVYNDFVQDHIAPSGFVKIPGEMSKYLKHSKYLPKLNNERPDER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL++F+ DT ++P+ +S FGYYPD  F   +  Q+T++YI+D  G 
Sbjct  202  NSTFKDRFASLHNLVLVMFEDDTTLIPKETSWFGYYPDDGFDILLSTQQTKLYIEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +TLD+AGKVK+  V G HL I  +++ +Y+VPY+
Sbjct  262  KTLDDAGKVKYVSVSGDHLNIAYEDVVKYVVPYL  295



>ref|XP_010449612.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
 ref|XP_010449613.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
 ref|XP_010449614.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=306

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  651  PCGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            PC   P+C  +   +   VY+   QD +APSG++K+P  +  YL   ++LPK+NNE   +
Sbjct  141  PCN-VPFCWLLKALF-PFVYSDLAQDLVAPSGFVKVPTKIAEYLEHSKYLPKLNNERPAE  198

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +S+  K RFTSL  LVL++F+ DT+++P+ +S FGYYPDG  +  +P QKT++Y +D  G
Sbjct  199  KSSTFKDRFTSLQNLVLVMFENDTMLIPRETSWFGYYPDGASTPVLPPQKTKLYTEDWIG  258

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             +TLD+AGKVKF  +PG H+ IT +E+ +Y+VPY++
Sbjct  259  LKTLDDAGKVKFISLPGGHVEITKEELVKYVVPYLQ  294



>ref|XP_010481338.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X1 [Camelina 
sativa]
Length=308

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 102/151 (68%), Gaps = 0/151 (0%)
 Frame = -2

Query  636  PWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIR  457
            P+C    +  ++G+Y+   Q++ APSGY KIP D+  YL   ++LPK++NE+ + +++  
Sbjct  147  PYCKKFDEIIKRGLYSDFAQNNAAPSGYYKIPTDITMYLESSKYLPKLSNEIPNQRNSTY  206

Query  456  KKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLD  277
            K RF SL  LVL+ FQ D +I+P  S+ FG+YPDGDF   +P Q+T++Y +D  G +TLD
Sbjct  207  KDRFASLHNLVLVKFQDDKVIVPIESTWFGFYPDGDFKHVLPAQQTKLYTEDWIGLKTLD  266

Query  276  EAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             AGKVKF  VPG HL +   ++  ++VPY+K
Sbjct  267  TAGKVKFVSVPGGHLDMAYQDVVTHVVPYLK  297



>emb|CDY25974.1| BnaC09g20130D [Brassica napus]
Length=315

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C    +  +  +Y+   Q+HLAPS Y+KIP ++  YL   ++LPK+NNE+ + +
Sbjct  141  CGNGSLCEIADKLIKSEIYSDFIQNHLAPSNYLKIPTEINKYLEKSKYLPKLNNEIPNQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RFTSL  LVL+ FQ D +I+PQ SS FG+Y DG F   +  Q+T++Y +D  G 
Sbjct  201  NSTYKERFTSLHNLVLVKFQDDKVIVPQDSSWFGFYRDGAFKPLLSAQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AGKVKF  V GAH+++   ++ +Y+VPY++
Sbjct  261  KTLDDAGKVKFVSVKGAHIIMADLDVVKYVVPYLQ  295



>ref|XP_011081401.1| PREDICTED: palmitoyl-protein thioesterase 3 [Sesamum indicum]
Length=259

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y+   Q+  APSGY K+P+++  YL  CRFLPK+NNE  D ++ I KKRF+SL  LVL
Sbjct  93   GIYSDYVQNRFAPSGYTKLPHNIPDYLEKCRFLPKLNNERPDQRNPIYKKRFSSLKNLVL  152

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I+   DT+I P+ SS FGYY DG     +  Q+T++Y +D  G ++LD+AG+VKF K  G
Sbjct  153  IMNANDTVIKPKESSWFGYYADGGLGTILQPQETKLYTEDWIGLKSLDKAGRVKFIKAAG  212

Query  240  AHLVITVDEIKRYIVPYMK  184
            AH+ ++  +IK+Y+VPY++
Sbjct  213  AHIDMSDADIKKYVVPYLR  231



>gb|AAG60184.1|AC084763_4 putative palmitoyl-protein thioesterase [Oryza sativa Japonica 
Group]
Length=295

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  I    +  +Y+   Q HLAPSGY+KIP DM  YL GC+FLPK+NNE+  ++
Sbjct  151  CGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIPTDMTDYLKGCKFLPKLNNEIPSER  210

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K+RF+SL  LVLI+F+ D +++P+ ++ FGYYPDG FS   P QKT++Y +D  G 
Sbjct  211  NATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVQPPQKTKLYTEDWIGL  270

Query  288  RTLDEAGKVKFFKVPGAHLV  229
            + L+EAG+VKF  VPG   V
Sbjct  271  KALEEAGRVKFVSVPGEEGV  290



>ref|XP_010494966.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=305

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 101/155 (65%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C    +  ++G+Y+   Q++ APSGY KIP D+  YL   ++LPK++NE+ + +
Sbjct  140  CHSTPHCKKFDEIIKRGLYSDFAQNNAAPSGYYKIPTDITMYLESSKYLPKLSNEIPNQR  199

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL+ FQ D II+P  S+ FG+YPDGDF   +P Q+T++Y +D  G 
Sbjct  200  NSTYKDRFASLHNLVLVKFQDDKIIVPSESTWFGFYPDGDFKHVLPAQQTKLYTEDWIGL  259

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            + LD AGKVKF  VPG HL +   ++  ++VPY++
Sbjct  260  KKLDTAGKVKFVSVPGGHLDMAYQDVVTHVVPYLQ  294



>ref|XP_008353815.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-protein thioesterase 
1-like [Malus domestica]
Length=198

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  579  QDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADT  400
            Q+HLAPSGY+K+PN M  Y   C+FLPK+NNE+  ++++  K+RF+SL  LVLI+F+ DT
Sbjct  2    QEHLAPSGYLKLPNAMSDYXEKCKFLPKLNNELPGEKNSTYKERFSSLQNLVLIMFEHDT  61

Query  399  IIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITV  220
            +++P+ ++ FGYY D  F + +  Q+T ++ +D  G R LDEAG+V +  V G HL I+ 
Sbjct  62   VLIPKETAWFGYYEDESFKSILSPQQTDLFTEDWIGLRNLDEAGRVMYISVAGGHLGIST  121

Query  219  DEIKRYIVPYMK  184
             ++K+++VPY++
Sbjct  122  SDMKKHVVPYLQ  133



>emb|CDP10011.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 2/156 (1%)
 Frame = -2

Query  648  CGKF-PWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            C +F   C        +GVYT   Q H+APSGY K+P D   YL+ C FLPK+NNE+   
Sbjct  191  CSQFDALCNHYTALLGRGVYTNYVQAHVAPSGYTKLPYDYLVYLAKCSFLPKLNNELLQ-  249

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            ++A  K+R T+L  LVLI+FQ D ++ P+ SS FGYY DG     +P+Q+T++Y +D  G
Sbjct  250  KNATYKQRITNLKNLVLIMFQEDGVVKPKESSLFGYYADGIPGPVLPLQQTRLYTEDWIG  309

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             RTLDE G++K   VPG HL+I++ +  RY+VPY+K
Sbjct  310  LRTLDETGRLKLISVPGVHLLISLSDTMRYVVPYLK  345



>ref|XP_006414226.1| hypothetical protein EUTSA_v10025854mg [Eutrema salsugineum]
 gb|ESQ55679.1| hypothetical protein EUTSA_v10025854mg [Eutrema salsugineum]
Length=297

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 101/151 (67%), Gaps = 1/151 (1%)
 Frame = -2

Query  633  WCGTIG-QYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIR  457
            +C ++  Q      Y+   QDH+APSGYIKIP +M  YL   ++LP +NNE  +++++  
Sbjct  140  YCSSLACQLLITETYSDYVQDHIAPSGYIKIPTEMSEYLEHSKYLPMLNNERANERNSTF  199

Query  456  KKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLD  277
            K RFTSL  LVL++FQ D +++P+ S  FGYYPDG  +  +  Q+T++Y +D  G +TLD
Sbjct  200  KDRFTSLQNLVLVMFQGDKVVIPKESCWFGYYPDGASTPLLSPQQTKLYTEDWIGLKTLD  259

Query  276  EAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +AGKVKF  VPG H  +  D+  RY+VPY++
Sbjct  260  DAGKVKFVSVPGEHNQMAQDDAVRYVVPYLQ  290



>emb|CDX90472.1| BnaA03g43090D [Brassica napus]
Length=296

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  +Y    QDH+APSGY+KIP +M  YL   ++LPK+NNE  D +
Sbjct  141  CSSGPICAIAEDLMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLPKLNNERPDQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL++FQ DT ++P+ +S FGYY D  F + +  Q+T++YI+D  G 
Sbjct  201  NSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYTDDGFDSLLSTQQTKLYIEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD+ GKVK+  V G HL+I  +++ +Y+VPY+
Sbjct  261  KALDDVGKVKYVSVSGDHLMIAYNDVVKYVVPYL  294



>ref|XP_009136845.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Brassica 
rapa]
Length=296

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  +Y    QDH+APSGY+KIP +M  YL   ++LPK+NNE  D +
Sbjct  141  CSSGPICAIAEDLMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLPKLNNERPDQR  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL++FQ DT ++P+ +S FGYY D  F + +  Q+T++YI+D  G 
Sbjct  201  NSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYTDDGFDSLLSTQQTKLYIEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD+ GKVK+  V G HL+I  +++ +Y+VPY+
Sbjct  261  KALDDVGKVKYVSVSGDHLMIAYNDVVKYVVPYL  294



>gb|EYU19279.1| hypothetical protein MIMGU_mgv1a021288mg, partial [Erythranthe 
guttata]
Length=206

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G Y+   Q   AP+GYIK+P ++KGYL  C+FLPK+NNE  +D++   KKRF+SL  LVL
Sbjct  69   GAYSDYAQKRFAPTGYIKLPKNIKGYLKSCKFLPKLNNERPNDRNPAYKKRFSSLKNLVL  128

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I+ + DT I P+ SS FGYY DG     +  ++T++Y++D  G + LD+AG+VKF KV G
Sbjct  129  IMNENDTTIRPKESSWFGYYEDGSTKKVLQPRETKLYMEDWIGLKKLDKAGRVKFIKVEG  188

Query  240  AHLVITVDEIKRYIVPYM  187
             HL I+  E+  YI+PY+
Sbjct  189  NHLQISGAELLHYIIPYL  206



>ref|XP_010434661.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=309

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C  +    +  +Y    QDHLAPSG++KIP  +  YL+  ++LPK+NNE  D++
Sbjct  142  CASGPLCAMVEALLKSAIYNDFIQDHLAPSGFVKIPGQISKYLAHSKYLPKLNNERPDER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL++FQ DT ++P+ ++ FGYY DG     +  Q+T++Y +D  G 
Sbjct  202  NSTFKDRFASLHNLVLVMFQKDTTLIPKETAWFGYYQDGGLDTLLSTQQTKLYKEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD AGKVKF  V G HL I+ +E++ Y+VPY+
Sbjct  262  KALDVAGKVKFESVLGDHLDISDEEVEEYVVPYL  295



>dbj|BAD43298.1| unknown protein [Arabidopsis thaliana]
Length=165

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = -2

Query  636  PWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIR  457
            P C       +  VYT   QDH+APSGYIKIP ++  YL   ++LPK+NNE  D++++  
Sbjct  11   PICAIGEALLKLEVYTDFVQDHIAPSGYIKIPGEISKYLEHSKYLPKLNNERPDERNSTF  70

Query  456  KKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLD  277
            K RFT+L  LVL++F++DT+++P+ ++ FGYY D  F   +  Q+T++Y +D  G + LD
Sbjct  71   KDRFTNLHNLVLVMFESDTMLIPKETAWFGYYEDEGFDTLLSAQQTKLYREDWIGLKALD  130

Query  276  EAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             AGKVKF  V G HL I+ +E+  ++VPY+
Sbjct  131  AAGKVKFESVLGDHLSISDEEVVEFVVPYL  160



>ref|XP_010449608.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=316

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 100/154 (65%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  +Y    QDHLAPSG++KIP+ +  YL+  ++LPK+NNE  D++
Sbjct  142  CTSGPLCAIAEALLKSAIYNDFIQDHLAPSGFVKIPSQISKYLAHSKYLPKLNNERPDEK  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++    RF SL  LVL++FQ DT ++P+ ++ FGYY DG F   +  Q+T++Y +D  G 
Sbjct  202  NSTFNDRFASLHNLVLVMFQNDTTLIPKETAWFGYYQDGGFDTLLSPQQTKLYKEDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD AGKVKF  V G HLVI+ +E++ Y+VPY+
Sbjct  262  KALDVAGKVKFESVLGDHLVISDEEVEEYVVPYL  295



>ref|XP_010677098.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=315

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y   TQ +LA SGYIKIPN++  YL   +FLPK+NNE+ +++S+I K+RF SL  LVL
Sbjct  138  GIYRKFTQKNLAVSGYIKIPNNIPTYLENSKFLPKLNNEIPNERSSIYKERFKSLENLVL  197

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I F  + +++P+ +S FGYY D  F + +PV++T+++++D  G + L+EAGKV +  +PG
Sbjct  198  IKFDNEHVLIPKETSWFGYYQDHSFRSVLPVRETKLFVEDWIGLKALEEAGKVTYVTLPG  257

Query  240  AHLVITVDEIKRYIVPYMK  184
             HL I+ D +K+YIVP++K
Sbjct  258  DHLAISDDGLKKYIVPFLK  276



>ref|XP_009108322.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Brassica rapa]
Length=298

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = -2

Query  597  VYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLI  418
            +Y    QDH+APSGYIKIP +M  YL   ++LPK+NNE  DD+++I K RF SL  LVL+
Sbjct  158  IYNDFVQDHIAPSGYIKIPGEMTKYLEHSQYLPKLNNERPDDRNSIFKDRFASLHNLVLV  217

Query  417  LFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGA  238
            +FQ DT+++P+ +S FGYY D  F   +  Q+T++Y +D  G + LD+AGKVK+  V G 
Sbjct  218  MFQDDTVLIPKETSWFGYYTDEGFGTLLSTQETKLYTEDWIGLKALDDAGKVKYVSVSGE  277

Query  237  HLVITVDEIKRYIVPYM  187
            HL+I+  ++ +Y+ PY+
Sbjct  278  HLMISFQDVVKYVAPYL  294



>ref|XP_010440001.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X2 [Camelina 
sativa]
Length=305

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 103/154 (67%), Gaps = 4/154 (3%)
 Frame = -2

Query  633  WCGT----IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQS  466
            WC      I + +   VY    Q  +APS ++KIP  +  YL   ++LPK+NNE   +++
Sbjct  140  WCNNWFCKILKAFFSQVYDDHVQGFIAPSNFVKIPTKITEYLEHSKYLPKLNNERPGEKN  199

Query  465  AIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFR  286
            +  K+RFTSL  LVLI+F+ D +++P+ SS FGYYPDGD +  +P +KT++Y +D  G +
Sbjct  200  STYKERFTSLHNLVLIMFEKDDVLIPKESSWFGYYPDGDNTTILPPRKTKLYTEDWIGLK  259

Query  285  TLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            TLD AGK+KF  +PGAH+ IT DE+  Y+VPY++
Sbjct  260  TLDAAGKLKFVSLPGAHIQITDDEVVEYVVPYLQ  293



>gb|ABD65142.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
Length=314

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P+C       +  +Y    QDH+APSGY+KIP +M  YL   ++LPK+NNE  D +
Sbjct  159  CSSGPFCAIAEALMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLPKLNNERPDQR  218

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL++FQ DT ++P+ +S FGYY D  F + +  Q+T++Y +D  G 
Sbjct  219  NSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYTDDGFDSLLSTQQTKLYTEDWIGL  278

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD+ GKVK+  V G HL+I  +++ +Y+VPY+
Sbjct  279  KALDDVGKVKYVSVSGDHLMIAYNDVVKYVVPYL  312



>dbj|BAJ93249.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  537  DMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYP  358
            DM  YL GCRFLPK+NNE+  ++SA  K+RF+SL  LVLI+F+ D +++P+ +S FGYYP
Sbjct  8    DMDDYLKGCRFLPKLNNEIPGERSATYKERFSSLENLVLIMFENDIVVIPRETSWFGYYP  67

Query  357  DGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            DG F   +P Q+T++Y +D  G + LDEAG+VKF  VPG HL I+  +++++IVPY+K
Sbjct  68   DGAFEPVLPPQQTKLYQEDWIGLKALDEAGRVKFVSVPGGHLGISNSDMRKHIVPYLK  125



>ref|XP_010518714.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Tarenaya hassleriana]
Length=288

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = -2

Query  621  IGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFT  442
            I +  EK VY  + Q+ LAPS Y+KIP D+  YL   R+LP +NNE  D+++   K RF+
Sbjct  141  ICKLAEKSVYADNVQNTLAPSNYVKIPTDIANYLEHSRYLPLLNNEKPDEKNPSFKDRFS  200

Query  441  SLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKV  262
            SL  L L++F+ DT+++P+ ++ FGYYPDGD       Q+T++Y +D  G +TLD AGKV
Sbjct  201  SLQNLALLMFEEDTVLIPKETAWFGYYPDGDSQTLQSPQQTKLYTEDWIGLKTLDTAGKV  260

Query  261  KFFKVPGAHLVITVDEIKRYIVPYMK  184
            KF  V G HL ++ D++ +Y+VPY++
Sbjct  261  KFISVAGKHLQLSHDDVVKYVVPYLQ  286



>ref|XP_010677096.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=332

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y   TQ +LA SGYIKIPN++  YL   +FLPK+NNE+ +++S+I K+RF SL  LVL
Sbjct  155  GIYRKFTQKNLAVSGYIKIPNNIPTYLENSKFLPKLNNEIPNERSSIYKERFKSLENLVL  214

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I F  + +++P+ +S FGYY D  F + +PV++T+++++D  G + L+EAGKV +  +PG
Sbjct  215  IKFDNEHVLIPKETSWFGYYQDHSFRSVLPVRETKLFVEDWIGLKALEEAGKVTYVTLPG  274

Query  240  AHLVITVDEIKRYIVPYMK  184
             HL I+ D +K+YIVP++K
Sbjct  275  DHLAISDDGLKKYIVPFLK  293



>ref|XP_006282269.1| hypothetical protein CARUB_v10028547mg [Capsella rubella]
 gb|EOA15167.1| hypothetical protein CARUB_v10028547mg [Capsella rubella]
Length=275

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  588  PDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQ  409
            P   D LAPSGY K P D+  YL   ++LPK++NE+ + +++  K+RF SL  LVL+ FQ
Sbjct  122  PKCLDRLAPSGYFKDPMDVAKYLESSKYLPKLSNEIPEQRNSTYKERFASLHNLVLVKFQ  181

Query  408  ADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLV  229
             DTII+P  S+ FG+YPDGDF   +P QKT++Y +D  G +TLD AGKVKF  VPG H+ 
Sbjct  182  DDTIIVPNDSTWFGFYPDGDFEHVLPAQKTKLYTEDWIGLKTLDVAGKVKFVSVPGEHVK  241

Query  228  ITVDEIKRYIVPYMK  184
            +  +++ +Y+VPY++
Sbjct  242  MAKEDVVKYVVPYLQ  256



>ref|XP_002865125.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41384.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 98/151 (65%), Gaps = 0/151 (0%)
 Frame = -2

Query  636  PWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIR  457
            P C    +  +  +Y+   QDHLAPSGY KIPND+  YL   ++LPK+NNE+ D ++   
Sbjct  148  PACKKFDELIKGALYSEFIQDHLAPSGYYKIPNDINEYLESSKYLPKLNNEIPDQRNQTY  207

Query  456  KKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLD  277
            K RFT L  LVL+ FQ D II P  S+ FG+YP+G+F   +   +T++Y +D  G +TLD
Sbjct  208  KDRFTILQNLVLVKFQDDEIITPNDSTWFGFYPEGEFEPLLSPNQTKLYTEDWIGLKTLD  267

Query  276  EAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +AGKVKF  V G HL +   ++ +++VPY++
Sbjct  268  DAGKVKFVSVAGGHLNMADQDVVKHVVPYLQ  298



>gb|ABD65081.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
 emb|CDY27920.1| BnaCnng05050D [Brassica napus]
Length=298

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 98/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG  P C       +  +Y    QDH+APSGY+KIP +M  YL   ++LPK+NNE  D++
Sbjct  141  CGDGPKCAIAEDILKLEIYNDFVQDHIAPSGYVKIPGEMTKYLEHSQYLPKLNNERPDER  200

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFTSL  LVL++FQ DT ++P+ +S FGY+ D  F   +  Q+T++Y +D  G 
Sbjct  201  NSTFKDRFTSLHNLVLVMFQNDTTLIPKETSWFGYFTDEGFGTLLLTQQTKLYTEDWIGL  260

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD+ GKVKF  V G HL+I   ++ +Y+ PY+
Sbjct  261  KALDDVGKVKFVSVSGDHLMIAFQDVVKYVAPYL  294



>emb|CDY09625.1| BnaC07g34360D [Brassica napus]
Length=316

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P+C       +  +Y    QDH+APSGY+KIP +M  YL   ++LPK+NNE  D +
Sbjct  161  CSSGPFCDIAEALMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLPKLNNERPDQR  220

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RF SL  LVL++FQ DT ++P+ +S FGYY D  F + +  Q+T++Y +D  G 
Sbjct  221  NSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYTDDGFDSLLSTQQTKLYTEDWIGL  280

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD+ GKVK+  V G HL+I  +++ +Y+VPY+
Sbjct  281  KALDDVGKVKYVTVSGDHLMIAYNDVVKYVVPYL  314



>ref|XP_010440000.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X1 [Camelina 
sativa]
Length=339

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = -2

Query  633  WCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRK  454
            W   I + +   VY    Q  +APS ++KIP  +  YL   ++LPK+NNE   ++++  K
Sbjct  178  WFCKILKAFFSQVYDDHVQGFIAPSNFVKIPTKITEYLEHSKYLPKLNNERPGEKNSTYK  237

Query  453  KRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDE  274
            +RFTSL  LVLI+F+ D +++P+ SS FGYYPDGD +  +P +KT++Y +D  G +TLD 
Sbjct  238  ERFTSLHNLVLIMFEKDDVLIPKESSWFGYYPDGDNTTILPPRKTKLYTEDWIGLKTLDA  297

Query  273  AGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            AGK+KF  +PGAH+ IT DE+  Y+VPY++
Sbjct  298  AGKLKFVSLPGAHIQITDDEVVEYVVPYLQ  327



>gb|ACO35364.1| palmitoyl protein thioesterase [Elaeis oleifera]
Length=332

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG    C  +    +  +Y+   Q HLAPSGY+KIP D+  YL GCRFLPK+NNE+  ++
Sbjct  139  CGSGIICMLVDDLIKSQIYSDYIQAHLAPSGYLKIPTDIPAYLEGCRFLPKLNNEIPSER  198

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPV--PVQKTQVYIKDTF  295
            ++  K+RF+SL  LVLI+F+ +++++P+++S FGYYPDG+F+ PV  P+Q T +  +   
Sbjct  199  NSTYKERFSSLQTLVLIMFEQESVLIPRVTSWFGYYPDGNFT-PVLSPLQTTLLNRRTGI  257

Query  294  GFRTL-DEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            G + L  + G+VKF  V G HL I+  ++++Y+VPY+ 
Sbjct  258  GLKKLWTKLGRVKFISVQGGHLRISDSDMQKYMVPYLN  295



>ref|NP_193479.1| putative palmitoyl-(protein) hydrolase [Arabidopsis thaliana]
 gb|AAM91633.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83899.1| putative palmitoyl-(protein) hydrolase [Arabidopsis thaliana]
Length=300

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  VYT   QDH+APSGYIKIP ++  YL   ++LPK+NNE  D++
Sbjct  142  CNSGPICAIGEALLKLEVYTDFVQDHIAPSGYIKIPGEISKYLEHSKYLPKLNNERPDER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFT+L  LVL++F++DT+++P+ ++ FGYY D  F   +  Q+T++Y +D  G 
Sbjct  202  NSTFKDRFTNLHNLVLVMFESDTMLIPKETAWFGYYEDEGFDTLLSAQQTKLYREDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD AGKVKF  V G HL I+ +E+  ++VPY+
Sbjct  262  KALDAAGKVKFESVLGDHLSISDEEVVEFVVPYL  295



>gb|EYU19278.1| hypothetical protein MIMGU_mgv1a023056mg, partial [Erythranthe 
guttata]
Length=292

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 102/155 (66%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
             G  P         + G+Y+   Q   APSGY K+P ++KGYL  C+FLPK+NNE  +D+
Sbjct  135  AGGVPVITLANNILKAGIYSDYAQKRFAPSGYTKLPKNIKGYLKNCKFLPKLNNERPNDR  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +   KKR TSL  LVLI+ + +T++ P+ SS FGYY DG+    +  ++T++Y +D  G 
Sbjct  195  NPNYKKRLTSLNNLVLIMHENETVVKPKESSWFGYYEDGNDKKVLQPRETKLYKEDWIGL  254

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            +TLD+AG+VKF KV G H+ +  ++IK+Y++PY++
Sbjct  255  KTLDKAGRVKFIKVGGPHVQMLDEDIKKYVIPYLQ  289



>ref|XP_010325388.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Solanum 
lycopersicum]
Length=311

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 95/154 (62%), Gaps = 13/154 (8%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG   WC       +  +Y+   Q HLAP+GYIKIP D+  Y  GC+FLP +NNEV   +
Sbjct  137  CGSGIWCILEDSLLKLAIYSNFIQAHLAPAGYIKIPTDIANYRKGCKFLPVLNNEVH--R  194

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  KKRF SL  LVLI+           +S FGYYPDG F+  +P  KT++Y +D  G 
Sbjct  195  NSTYKKRFASLENLVLIM-----------TSWFGYYPDGSFTTVLPAHKTKLYTEDWIGL  243

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LDEAGKVK  KV G+HL I+  E+K+ I+PY+
Sbjct  244  KKLDEAGKVKLLKVCGSHLEISTSEMKKNILPYL  277



>ref|XP_002868061.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44320.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=300

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  VYT   QDH+APSGYIKIP ++  YL   ++LPK+NNE  D++
Sbjct  142  CASGPICDIGEAMLKLEVYTDFVQDHIAPSGYIKIPGEISKYLEHSKYLPKVNNERPDER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFT L  LVL++F++DT ++P+ ++ FGYY D  F   +  Q+T++Y +D  G 
Sbjct  202  NSTFKDRFTKLHNLVLVMFESDTTLIPKETAWFGYYEDEGFDTLLSTQQTKLYREDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD AGKVKF  V G HL I+ +E+  Y+VPY+
Sbjct  262  KALDVAGKVKFESVLGDHLSISDEEVVEYVVPYL  295



>ref|XP_010449616.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=305

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 101/154 (66%), Gaps = 4/154 (3%)
 Frame = -2

Query  633  WCG----TIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQS  466
            WC     TI + +   VY    Q  +APS ++KIP  +  YL    +LPK++NE   +++
Sbjct  140  WCTNFFCTILKAFFSQVYNDGVQAFIAPSNFVKIPTKITEYLEHSTYLPKLSNERPGEKN  199

Query  465  AIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFR  286
            +  K RFTSL  LVLI+F+ D +++P+ SS FGYYPDGD S  +P QKT++Y +D  G +
Sbjct  200  STYKDRFTSLHNLVLIMFEKDDVLIPKESSWFGYYPDGDNSTILPPQKTKLYTEDWIGLK  259

Query  285  TLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            TLD AGK++F  +PG H+ IT +E+  Y+VPY++
Sbjct  260  TLDAAGKLRFVSLPGVHIQITDEEVIEYVVPYLQ  293



>ref|XP_009387902.1| PREDICTED: palmitoyl-protein thioesterase 1-like, partial [Musa 
acuminata subsp. malaccensis]
Length=145

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  537  DMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYP  358
            D++ YL GC+FLPK+NNE+  ++++  K+RF+SL  LVLI+F+ DTI++P  +S FGYYP
Sbjct  1    DIQEYLEGCKFLPKLNNELPTERNSTYKERFSSLQNLVLIMFEHDTILIPPETSWFGYYP  60

Query  357  DGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            DG FSA +P Q+T +Y +D  G + LD+AG+VKF  V G HL I+ D+IK+YIVP++
Sbjct  61   DGAFSAVLPPQQTILYTEDWIGLKALDDAGRVKFISVQGNHLRISEDDIKKYIVPFL  117



>ref|XP_010439996.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=318

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 1/155 (1%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPD-TQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDD  472
            C   P C       +  +Y  D  QDHLAPSG++KIP  +  YL+  ++LPK+NNE  D+
Sbjct  143  CASGPLCAMAEALLKSAIYNNDFIQDHLAPSGFVKIPGQISKYLAHSKYLPKLNNERPDE  202

Query  471  QSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFG  292
            +++  K RF SL  LVL++FQ DT + P+ ++ FGYY DG     +  Q+T++Y +D  G
Sbjct  203  RNSTFKDRFASLHNLVLVMFQNDTTLTPKETAWFGYYQDGGLDTLLSTQQTKLYKEDWIG  262

Query  291  FRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
             + LD AGKVKF  V G HL I+ +E+  Y+VPY+
Sbjct  263  LKALDIAGKVKFESVLGDHLDISDEEVVEYVVPYL  297



>ref|XP_010449611.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=295

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -2

Query  609  YEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTL  430
            Y   VY    QDH APSG  KIP D+K YL   ++LPK+NNE   ++++  K RFTSL  
Sbjct  152  YLSDVYNDFVQDHAAPSGCFKIPTDIKNYLEHSKYLPKLNNERPGEKNSTYKDRFTSLHN  211

Query  429  LVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQ-VYIKDTFGFRTLDEAGKVKFF  253
            LVLI+FQ D +++P+  S FGYYP+G   A  P+   Q +Y++D  G +TLD AGKVKF 
Sbjct  212  LVLIMFQGDIVVIPKEISWFGYYPEG---ASTPLLSPQKLYLEDWIGLKTLDAAGKVKFV  268

Query  252  KVPGAHLVITVDEIKRYIVPYMK  184
             VPG HL +  DE+  Y+VPY+K
Sbjct  269  SVPGEHLRMAQDEVVNYVVPYLK  291



>ref|XP_006282773.1| hypothetical protein CARUB_v10006201mg [Capsella rubella]
 gb|EOA15671.1| hypothetical protein CARUB_v10006201mg [Capsella rubella]
Length=300

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 98/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P+C       +  +Y    Q+H+APSGY+KIP  M  YL   ++LPK+NNE  +++
Sbjct  142  CDAGPFCAIAEDLMKLAIYNDFVQEHIAPSGYVKIPGQMSNYLEHSKYLPKLNNERPEER  201

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K+RF SL  LVL++FQ DT ++P+ ++ FGYY D  F   +  ++T++Y +D  G 
Sbjct  202  NSTFKERFASLHNLVLVMFQKDTTLIPKETAWFGYYQDEGFDTLLSTKQTKLYREDWIGL  261

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD AGKVKF  V G HL I+ +E+  Y+VPY+
Sbjct  262  KALDVAGKVKFESVLGDHLSISDEEVGEYVVPYL  295



>gb|AAM61704.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=316

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -2

Query  594  YTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLIL  415
            Y+   QD+LAPSGY K P ++ GYL  C++LPK+NNE   +++   K RF SL  LV +L
Sbjct  161  YSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPYERNTTYKDRFASLQNLVFVL  220

Query  414  FQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAH  235
            F+ DT+I+P+ SS FG+YPDGD +  +PVQ+T++YI+D  G + L  AGKV+F  V G H
Sbjct  221  FENDTVIVPKESSWFGFYPDGDLTHVLPVQETKLYIEDWIGLKALVVAGKVQFVNVTGDH  280

Query  234  LVITVDEIKRYIVPYMK  184
            L++  +++ +Y+VP ++
Sbjct  281  LIMADEDLVKYVVPLLQ  297



>ref|XP_010696248.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=245

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y    Q +LA SGYIKIP ++  YL   +FLPK+NNE+ +++++  K+RF SL  LVL
Sbjct  68   GIYGKFIQKNLAASGYIKIPYNIPSYLRNSKFLPKLNNELSNERNSTYKERFESLENLVL  127

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I F  + ++ P+ +S FGY+PD  FS+ +  Q+T+++I+D  G + L+EAG V +  +PG
Sbjct  128  IKFDNENVLQPKETSWFGYHPDCSFSSVLSTQETKLFIEDWIGLKALEEAGNVTYITLPG  187

Query  240  AHLVITVDEIKRYIVPYMK  184
             HL I+ D +K+YIVPY+K
Sbjct  188  VHLEISDDGLKKYIVPYLK  206



>ref|XP_010696247.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=253

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y    Q +LA SGYIKIP ++  YL   +FLPK+NNE+ +++++  K+RF SL  LVL
Sbjct  76   GIYGKFIQKNLAASGYIKIPYNIPSYLRNSKFLPKLNNELSNERNSTYKERFESLENLVL  135

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I F  + ++ P+ +S FGY+PD  FS+ +  Q+T+++I+D  G + L+EAG V +  +PG
Sbjct  136  IKFDNENVLQPKETSWFGYHPDCSFSSVLSTQETKLFIEDWIGLKALEEAGNVTYITLPG  195

Query  240  AHLVITVDEIKRYIVPYMK  184
             HL I+ D +K+YIVPY+K
Sbjct  196  VHLEISDDGLKKYIVPYLK  214



>ref|NP_199546.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97169.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
 gb|AAM13072.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91172.1| unknown protein [Arabidopsis thaliana]
 gb|AED95501.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=316

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -2

Query  594  YTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLIL  415
            Y+   QD+LAPSGY K P ++ GYL  C++LPK+NNE   +++   K RF SL  LV +L
Sbjct  161  YSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPYERNTTYKDRFASLQNLVFVL  220

Query  414  FQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAH  235
            F+ DT+I+P+ SS FG+YPDGD +  +PVQ+T++YI+D  G + L  AGKV+F  V G H
Sbjct  221  FENDTVIVPKESSWFGFYPDGDLTHVLPVQETKLYIEDWIGLKALVVAGKVQFVNVTGDH  280

Query  234  LVITVDEIKRYIVPYMK  184
            L++  +++ +Y+VP ++
Sbjct  281  LIMADEDLVKYVVPLLQ  297



>ref|XP_010696246.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=258

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = -2

Query  600  GVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVL  421
            G+Y    Q +LA SGYIKIP ++  YL   +FLPK+NNE+ +++++  K+RF SL  LVL
Sbjct  81   GIYGKFIQKNLAASGYIKIPYNIPSYLRNSKFLPKLNNELSNERNSTYKERFESLENLVL  140

Query  420  ILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPG  241
            I F  + ++ P+ +S FGY+PD  FS+ +  Q+T+++I+D  G + L+EAG V +  +PG
Sbjct  141  IKFDNENVLQPKETSWFGYHPDCSFSSVLSTQETKLFIEDWIGLKALEEAGNVTYITLPG  200

Query  240  AHLVITVDEIKRYIVPYMK  184
             HL I+ D +K+YIVPY+K
Sbjct  201  VHLEISDDGLKKYIVPYLK  219



>emb|CAB10529.1| thioesterase like protein [Arabidopsis thaliana]
 emb|CAB78751.1| thioesterase like protein [Arabidopsis thaliana]
Length=555

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  VYT   QDH+APSGYIKIP ++  YL   ++LPK+NNE  D++
Sbjct  108  CNSGPICAIGEALLKLEVYTDFVQDHIAPSGYIKIPGEISKYLEHSKYLPKLNNERPDER  167

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            ++  K RFT+L  LVL++F++DT+++P+ ++ FGYY D  F   +  Q+T++Y +D  G 
Sbjct  168  NSTFKDRFTNLHNLVLVMFESDTMLIPKETAWFGYYEDEGFDTLLSAQQTKLYREDWIGL  227

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            + LD AGKVKF  V G HL I+ +E+  ++VPY+
Sbjct  228  KALDAAGKVKFESVLGDHLSISDEEVVEFVVPYL  261


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -2

Query  414  FQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAH  235
            F+ D +++P+ SS FGYYPDG  +  +  Q+T++Y +D  G +TLD A KVKF  VPG H
Sbjct  464  FEGDAVVIPKESSWFGYYPDGASTPLLSPQQTKLYTEDWIGLKTLDAARKVKFVSVPGEH  523

Query  234  LVITVDEIKRYIVPYMK**DASLA  163
            L I  D++ +++VPY+K   AS++
Sbjct  524  LRIAQDDVVKHVVPYLKNQPASMS  547



>emb|CDX76572.1| BnaA08g08280D [Brassica napus]
Length=461

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = -2

Query  597  VYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLI  418
            +Y    QDH+APSGYIKIP +M  YL   ++LPK+NNE  DD+++I K RF SL  LVL+
Sbjct  158  IYNDFVQDHIAPSGYIKIPGEMTKYLEHSQYLPKLNNERPDDRNSIFKDRFASLHNLVLV  217

Query  417  LFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGA  238
            +FQ DT+++P+ +S FGYY D  F   +  Q+T++Y +D  G + LD+ GKVK+  V G 
Sbjct  218  MFQDDTVLIPKETSWFGYYTDEGFGTLLSTQETKLYTEDWIGLKALDDVGKVKYVSVSGE  277

Query  237  HLVITVDEIKRYIVPYM  187
            HL+I+  ++ +Y+ PY+
Sbjct  278  HLMISFQDVVKYVAPYL  294



>ref|XP_002877170.1| hypothetical protein ARALYDRAFT_323005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53429.1| hypothetical protein ARALYDRAFT_323005 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 103/158 (65%), Gaps = 8/158 (5%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            CG + WC    +  EK +Y+   Q+ L       +  D+  Y+   ++LPK+NNE+ +++
Sbjct  138  CGCYEWCDIADKLMEKNIYSDFVQESL-----FLVSQDISEYMKSSKYLPKLNNEIPNER  192

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPV---QKTQVYIKDT  298
            ++  K+RFT L  LVLI+FQ DT+I+P+ SS FG+Y DG++++  P+   Q+T++Y +D 
Sbjct  193  NSTYKERFTRLKNLVLIMFQNDTVIVPKESSWFGFYQDGNYTSQPPLLSAQQTKLYTEDW  252

Query  297  FGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
             G +TLD AGKVKF  +PG HL I   ++ +Y+VPY++
Sbjct  253  IGLKTLDVAGKVKFVSLPGGHLQIATTDVIKYVVPYLQ  290



>ref|XP_006414225.1| hypothetical protein EUTSA_v10026142mg [Eutrema salsugineum]
 gb|ESQ55678.1| hypothetical protein EUTSA_v10026142mg [Eutrema salsugineum]
Length=233

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 100/165 (61%), Gaps = 10/165 (6%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C   P C       +  VY    QDH+APS Y+KIP +M  YL   ++LPK+NNE  D++
Sbjct  68   CSFGPICDIGEAMMKLEVYNDFVQDHIAPSNYVKIPGEMTKYLKHSKYLPKLNNERPDER  127

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQ----------KT  319
            ++  K RF SL  LVL++FQ DT ++P+ ++ FGYY D  F + +  Q          +T
Sbjct  128  NSTFKDRFASLHNLVLVMFQNDTTLIPKETAWFGYYTDEGFESFLSTQQNCFLKNLYVQT  187

Query  318  QVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            ++Y +D  G + LD+ GKVKF  V G HL IT +++++Y+VPY+K
Sbjct  188  KLYREDWIGLKALDDVGKVKFVSVSGDHLSITDEDVEKYVVPYLK  232



>ref|XP_002967315.1| hypothetical protein SELMODRAFT_168809 [Selaginella moellendorffii]
 gb|EFJ31914.1| hypothetical protein SELMODRAFT_168809 [Selaginella moellendorffii]
Length=305

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 96/155 (62%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C  + +C         GVY+   Q+HLAP+GYIK+P D+  Y   C FLPK+NNE+  ++
Sbjct  137  CAAYSFCALADIILHMGVYSDFVQNHLAPTGYIKMPKDLSSYYRSCVFLPKLNNELPQNR  196

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K R + L  LVL+ F  DT+++PQ ++ FG++P  D +  +P+++T +Y +D  G 
Sbjct  197  NATFKHRLSDLNQLVLVKFDKDTVLVPQETAWFGFFPPNDLTKVLPMEETALYKEDWIGL  256

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            ++L E G+++F    G HL I+  E+  ++ PY+K
Sbjct  257  KSLHEQGRIQFVTFSGDHLSISDQEMLDHVAPYLK  291



>ref|XP_002960405.1| hypothetical protein SELMODRAFT_74606 [Selaginella moellendorffii]
 gb|EFJ37944.1| hypothetical protein SELMODRAFT_74606 [Selaginella moellendorffii]
Length=304

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 96/155 (62%), Gaps = 0/155 (0%)
 Frame = -2

Query  648  CGKFPWCGTIGQYYEKGVYTPDTQDHLAPSGYIKIPNDMKGYLSGCRFLPKINNEVQDDQ  469
            C  + +C         GVY+   Q+HLAP+GYIK+P D+  Y   C FLPK+NNE+  ++
Sbjct  136  CAAYSFCALADIILHMGVYSDFVQNHLAPTGYIKMPKDLSSYYRSCVFLPKLNNELPQNR  195

Query  468  SAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFSAPVPVQKTQVYIKDTFGF  289
            +A  K R + L  LVL+ F  DT+++PQ ++ FG++P  D +  +P+++T +Y +D  G 
Sbjct  196  NATFKHRLSDLNQLVLVKFDKDTVLVPQETAWFGFFPPNDLTKVLPMEETALYKEDWIGL  255

Query  288  RTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            ++L E G+++F    G HL I+  E+  ++ PY+K
Sbjct  256  KSLHEQGRIQFVTFSGDHLSISDQEMLDHVAPYLK  290



>ref|XP_010104856.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
 gb|EXC02092.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
Length=328

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  525  YLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDF  346
            YL  C+FLPK+NNE+ + +++  K+RF+SL  LVLI+F+ DT+++P+ +S FGYYPDG +
Sbjct  145  YLEHCKFLPKLNNEIPEKRNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGAY  204

Query  345  SAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            +  +P Q+T++YI+D  G + LDEAG+VK+  VPG HL I+  ++K+++VPY+
Sbjct  205  NPILPPQQTKLYIEDWIGLKALDEAGRVKYIAVPGNHLGISKSDMKKHVVPYL  257



>gb|EYU19277.1| hypothetical protein MIMGU_mgv1a0236221mg, partial [Erythranthe 
guttata]
Length=134

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  537  DMKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYP  358
            ++KGYL  C+FLPK+NNE  +D++   KKRF+SL  LVLI+ + DT+I P+ SS FG+Y 
Sbjct  1    NIKGYLKSCKFLPKLNNERPNDRNPPYKKRFSSLKNLVLIMSENDTVITPKESSWFGFYE  60

Query  357  DGDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYM  187
            DG  +  +  +KT++Y++D  G +TLD+AG+VKF KV G H+ ++  ++K+Y+VP++
Sbjct  61   DGSTNNILQPKKTKLYVEDWIGLKTLDKAGRVKFIKVGGTHIEVSDADMKKYVVPFL  117



>emb|CDY67058.1| BnaAnng23510D [Brassica napus]
Length=120

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  522  LSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPDGDFS  343
            +   +FLPK+NNE  +++++  K+RFTSL  LVL++F+ DTI++P+ +  FG+YPDG  +
Sbjct  1    MEHSKFLPKLNNERPNERNSTYKERFTSLHNLVLVMFEGDTIVVPRETCWFGFYPDGATA  60

Query  342  APVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
              +P QKT++YI+D  G +TLD+AGKVKF  VPG HL +  D++ +Y+VPY++
Sbjct  61   PLLPPQKTKLYIEDWIGLKTLDDAGKVKFVGVPGDHLEMAHDDVVKYVVPYLQ  113



>ref|XP_002863363.1| hypothetical protein ARALYDRAFT_916694 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39622.1| hypothetical protein ARALYDRAFT_916694 [Arabidopsis lyrata subsp. 
lyrata]
Length=120

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  534  MKGYLSGCRFLPKINNEVQDDQSAIRKKRFTSLTLLVLILFQADTIIMPQISSHFGYYPD  355
            MK YL   ++LPK++NE+ + +++  K RFTSL  LVL+ FQ +TII+P  S+ FG+YPD
Sbjct  1    MKRYLENSKYLPKLSNEIPNQRNSTYKDRFTSLHNLVLVKFQNETIIIPNDSTWFGFYPD  60

Query  354  GDFSAPVPVQKTQVYIKDTFGFRTLDEAGKVKFFKVPGAHLVITVDEIKRYIVPYMK  184
            G     +P  KT +Y +D  G +TLD AGKVKF  VPG HL +   ++ +YIVPY++
Sbjct  61   GQVEPVLPANKTALYTEDWIGLKTLDAAGKVKFVSVPGGHLEMADHDVLKYIVPYLQ  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 944445735466