BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30091_g1_i1 len=711 path=[689:0-710]

Length=711
                                                                      Score     E

ref|XP_009592276.1|  PREDICTED: protein 108-like                      98.2    3e-22   
ref|XP_009783380.1|  PREDICTED: protein 108-like                      97.8    4e-22   
gb|KDP22317.1|  hypothetical protein JCGZ_26148                       95.9    2e-21   
ref|XP_006490470.1|  PREDICTED: stamen-specific protein FIL1-like     94.7    4e-21   
gb|KDO60065.1|  hypothetical protein CISIN_1g037923mg                 94.7    5e-21   
ref|XP_006421867.1|  hypothetical protein CICLE_v10006307mg           94.7    5e-21   
ref|XP_009609847.1|  PREDICTED: protein 108-like                      94.4    7e-21   
ref|XP_009794896.1|  PREDICTED: protein 108-like                      94.4    7e-21   
ref|XP_004240793.1|  PREDICTED: stamen-specific protein FIL1-like     91.3    1e-19   
ref|XP_010317583.1|  PREDICTED: stamen-specific protein FIL1-like     89.4    5e-19   
ref|XP_002510828.1|  MEN-8 protein precursor, putative                88.6    8e-19   Ricinus communis
ref|XP_007038611.1|  FAR1-related sequence 5 isoform 1                95.5    1e-18   
ref|XP_007038613.1|  FAR1-related sequence 5 isoform 3                95.1    1e-18   
ref|XP_010693481.1|  PREDICTED: protein MEN-8-like                    87.4    3e-18   
gb|EYU25068.1|  hypothetical protein MIMGU_mgv1a017004mg              87.0    3e-18   
ref|XP_010107405.1|  hypothetical protein L484_015746                 89.7    5e-18   
ref|XP_002321889.1|  hypothetical protein POPTR_0015s13570g           86.3    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008376537.1|  PREDICTED: protein MEN-8-like                    85.9    1e-17   
ref|XP_009371295.1|  PREDICTED: protein MEN-8-like                    85.5    2e-17   
ref|XP_007220851.1|  hypothetical protein PRUPE_ppa020886mg           85.5    2e-17   
sp|Q38737.1|FIL1_ANTMA  RecName: Full=Stamen-specific protein FIL...  85.1    2e-17   Antirrhinum majus [garden snapdragon]
ref|XP_008234470.1|  PREDICTED: protein 108-like                      85.1    2e-17   
ref|XP_006599627.1|  PREDICTED: stamen-specific protein FIL1-like     83.2    9e-17   
gb|EYU19525.1|  hypothetical protein MIMGU_mgv1a017062mg              82.0    3e-16   
ref|XP_002318831.1|  Tapetum-specific protein A9 precursor            81.6    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002279400.2|  PREDICTED: stamen-specific protein FIL1          81.6    3e-16   Vitis vinifera
ref|XP_003533216.1|  PREDICTED: protein 108-like                      81.3    4e-16   
sp|O24356.1|MEN8_SILLA  RecName: Full=Protein MEN-8; Flags: Precu...  81.3    4e-16   Silene latifolia
ref|XP_007152323.1|  hypothetical protein PHAVU_004G120100g           81.6    4e-16   
ref|XP_006401858.1|  hypothetical protein EUTSA_v10015124mg           79.3    2e-15   
ref|XP_003592302.1|  Tapetum-specific protein A9                      79.3    2e-15   
gb|KHM99143.1|  Stamen-specific protein FIL1                          80.1    3e-15   
ref|XP_002510832.1|  MEN-8 protein precursor, putative                78.6    4e-15   Ricinus communis
gb|KHN31527.1|  Stamen-specific protein FIL1                          79.0    4e-15   
ref|XP_008378198.1|  PREDICTED: protein MEN-8                         78.6    4e-15   
emb|CDY31917.1|  BnaC09g28270D                                        78.2    5e-15   
ref|XP_009106919.1|  PREDICTED: protein 108                           77.8    6e-15   
gb|AII99868.1|  protease inhibitor/seed storage/ltp family            78.2    8e-15   
ref|XP_004496598.1|  PREDICTED: stamen-specific protein FIL1-like     77.4    1e-14   
emb|CDY00514.1|  BnaA10g07590D                                        77.8    1e-14   
gb|AEE92794.1|  LTP-like protein                                      77.0    1e-14   
ref|NP_200029.1|  bifunctional inhibitor/lipid-transfer protein/s...  76.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281994.1|  hypothetical protein CARUB_v10028221mg           76.6    2e-14   
ref|XP_002864156.1|  protease inhibitor/seed storage/lipid transf...  75.9    3e-14   
ref|XP_006365769.1|  PREDICTED: protein 108-like                      75.5    5e-14   
ref|XP_004228450.1|  PREDICTED: protein 108                           75.1    9e-14   
emb|CDY32594.1|  BnaC03g15620D                                        74.7    9e-14   
gb|EPS60738.1|  hypothetical protein M569_14064                       73.9    1e-13   
emb|CDY38904.1|  BnaA03g12750D                                        74.3    1e-13   
ref|XP_009800829.1|  PREDICTED: stamen-specific protein FIL1-like     74.3    1e-13   
ref|XP_010038429.1|  PREDICTED: stamen-specific protein FIL1          73.9    1e-13   
gb|KCW46398.1|  hypothetical protein EUGRSUZ_K00231                   73.9    2e-13   
ref|XP_010263270.1|  PREDICTED: stamen-specific protein FIL1-like     73.2    3e-13   
ref|XP_004140787.1|  PREDICTED: protein MEN-8-like                    72.4    6e-13   
ref|XP_008439180.1|  PREDICTED: protein MEN-8-like                    72.4    6e-13   
emb|CDP05237.1|  unnamed protein product                              71.6    1e-12   
ref|XP_011101182.1|  PREDICTED: stamen-specific protein FIL1          71.2    1e-12   
ref|XP_006394437.1|  hypothetical protein EUTSA_v10005193mg           71.2    1e-12   
ref|XP_010933873.1|  PREDICTED: protein LIM1                          71.2    2e-12   
gb|KFK27943.1|  hypothetical protein AALP_AA8G451200                  70.5    3e-12   
gb|AGW52139.1|  A9                                                    70.1    4e-12   
ref|XP_010483942.1|  PREDICTED: tapetum-specific protein A9-like      69.3    6e-12   
ref|NP_568949.1|  protease inhibitor/seed storage/lipid transfer ...  68.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25117.1|  hypothetical protein AALP_AA8G068000                  68.2    1e-11   
gb|AAM63848.1|  A9 protein precursor-like                             68.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10170.1|  tapetum-specific protein A9-like protein             68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281768.1|  hypothetical protein CARUB_v10027932mg           67.8    2e-11   
ref|XP_002866469.1|  hypothetical protein ARALYDRAFT_496383           67.8    2e-11   
ref|XP_006857882.1|  hypothetical protein AMTR_s00069p00110230        67.0    6e-11   
ref|XP_010444077.1|  PREDICTED: tapetum-specific protein A9-like      65.9    1e-10   
gb|ABV68563.1|  A9 protein                                            65.9    1e-10   Brassica napus [oilseed rape]
gb|ABV68560.1|  A9 protein                                            65.9    1e-10   Brassica rapa
gb|ABO40457.2|  A9-like protein                                       65.9    1e-10   Sinapis arvensis [charlock mustard]
gb|ABV68561.1|  A9 protein                                            65.9    1e-10   Brassica nigra
ref|XP_009122360.1|  PREDICTED: tapetum-specific protein A9           65.9    1e-10   
gb|ABO40456.2|  A9-like protein                                       65.9    1e-10   Sinapis alba [bai jie]
gb|ABO40455.2|  A9-like protein                                       65.5    1e-10   Eruca vesicaria subsp. sativa [arugula]
emb|CDX98995.1|  BnaC09g48400D                                        65.9    1e-10   
gb|AAO85389.1|  tapetum-specific protein BcA9                         65.9    2e-10   Brassica rapa
gb|ABV68565.1|  A9 protein                                            65.1    2e-10   Brassica juncea [brown mustard]
ref|XP_010452679.1|  PREDICTED: tapetum-specific protein A9           65.5    2e-10   
gb|ABO40458.2|  A9-like protein                                       64.7    2e-10   Brassica oxyrrhina
gb|ABV68564.1|  A9 protein                                            65.1    2e-10   Brassica napus [oilseed rape]
gb|ABV68562.1|  A9 protein                                            64.7    2e-10   Brassica oleracea
ref|XP_006399206.1|  hypothetical protein EUTSA_v10015126mg           64.7    3e-10   
ref|XP_008799573.1|  PREDICTED: protein LIM2                          65.5    3e-10   
gb|ABO40454.2|  A9-like protein                                       64.3    4e-10   Brassica tournefortii
ref|XP_002871258.1|  protease inhibitor/seed storage/lipid transf...  63.9    5e-10   
ref|XP_006289528.1|  hypothetical protein CARUB_v10003071mg           63.5    7e-10   
ref|XP_006363333.1|  PREDICTED: stamen-specific protein FIL1-like     60.8    5e-09   
ref|NP_196340.1|  Tapetum-specific protein A9                         60.8    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66993.1|  A9                                                    60.8    9e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA43889.1|  A9                                                   60.8    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389821.1|  PREDICTED: protein LIM1-like                     59.7    3e-08   
sp|Q40227.2|LIM3_LILLO  RecName: Full=Protein LIM3; Flags: Precursor  57.0    2e-07   Lilium longiflorum [Easter lily]
dbj|BAA04833.1|  ORF                                                  57.4    2e-07   Lilium longiflorum [Easter lily]
dbj|BAO51846.1|  CjMALE1                                              56.2    3e-07   
sp|Q40190.1|M7_LILHE  RecName: Full=Protein M7; AltName: Full=LhM...  53.9    2e-06   Lilium henryi
sp|Q43533.1|LIM1_LILLO  RecName: Full=Protein LIM1; Flags: Precursor  53.9    3e-06   Lilium longiflorum [Easter lily]
gb|ABM68544.1|  unknown                                               53.5    4e-06   Lilium longiflorum [Easter lily]
sp|Q43534.2|LIM2_LILLO  RecName: Full=Protein LIM2; Flags: Precursor  52.8    6e-06   Lilium longiflorum [Easter lily]
dbj|BAA04832.1|  ORF                                                  52.8    7e-06   Lilium longiflorum [Easter lily]
ref|XP_009387684.1|  PREDICTED: protein LIM1-like                     52.8    2e-05   
dbj|BAK05897.1|  predicted protein                                    51.2    2e-05   
ref|NP_001148543.1|  YY1 protein precursor                            48.9    2e-04   Zea mays [maize]
gb|ACF84585.1|  unknown                                               48.9    2e-04   Zea mays [maize]
ref|NP_001158983.1|  YY1 protein precursor                            48.9    2e-04   Zea mays [maize]
ref|NP_001167670.1|  YY1 protein precursor                            48.9    3e-04   Zea mays [maize]
ref|NP_001105123.1|  anther-specific protein MZm3-3 precursor         48.1    4e-04   Zea mays [maize]
ref|XP_004974078.1|  PREDICTED: anther-specific protein MZm3-3-like   47.4    6e-04   
gb|AAG31822.1|  fil1B                                                 46.6    6e-04   Antirrhinum graniticum
ref|XP_002445754.1|  hypothetical protein SORBIDRAFT_07g025160        47.4    9e-04   Sorghum bicolor [broomcorn]



>ref|XP_009592276.1| PREDICTED: protein 108-like [Nicotiana tomentosiformis]
Length=93

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+NVCAPFV+PG T   PSADCC ALQSVD +C+CNTLR+SARLP+QCN+PPLSC AN
Sbjct  34   LNNLNVCAPFVVPGTTNPTPSADCCSALQSVDHECLCNTLRISARLPAQCNLPPLSCAAN  93



>ref|XP_009783380.1| PREDICTED: protein 108-like [Nicotiana sylvestris]
Length=93

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+NVCAPFV+PG T   PSADCC ALQSVD +C+CNTLR+SARLP+QCN+PPLSC AN
Sbjct  34   LNNLNVCAPFVVPGTTNPTPSADCCSALQSVDHECLCNTLRISARLPAQCNLPPLSCAAN  93



>gb|KDP22317.1| hypothetical protein JCGZ_26148 [Jatropha curcas]
Length=94

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+NVCA +V+PG T +NPSA+CC ALQSV  DC+CNTLRV+ARLPSQCN+PPLSC AN
Sbjct  34   LNNLNVCAQYVVPGSTNTNPSAECCNALQSVQHDCLCNTLRVTARLPSQCNLPPLSCAAN  93



>ref|XP_006490470.1| PREDICTED: stamen-specific protein FIL1-like [Citrus sinensis]
Length=97

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+N CAP+V+PG+  + PS+DCC ALQSVDRDC CNT+R++ARLPSQCN+PPLSC
Sbjct  39   LTNLNSCAPYVVPGVATTTPSSDCCAALQSVDRDCFCNTVRIAARLPSQCNLPPLSC  95



>gb|KDO60065.1| hypothetical protein CISIN_1g037923mg [Citrus sinensis]
Length=97

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+N CAP+V+PG+  + PS+DCC ALQSVDRDC CNT+R++ARLPSQCN+PPLSC
Sbjct  39   LTNLNSCAPYVVPGVATTTPSSDCCAALQSVDRDCFCNTVRIAARLPSQCNLPPLSC  95



>ref|XP_006421867.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
 ref|XP_006421868.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
 gb|ESR35107.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
 gb|ESR35108.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
Length=97

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+N CAP+V+PG+  + PS+DCC ALQSVDRDC CNT+R++ARLPSQCN+PPLSC
Sbjct  39   LTNLNSCAPYVVPGVATTTPSSDCCAALQSVDRDCFCNTVRIAARLPSQCNLPPLSC  95



>ref|XP_009609847.1| PREDICTED: protein 108-like [Nicotiana tomentosiformis]
Length=94

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            LGN+NVCAPFV+PG  A N SA+CC AL+S+D DC+CNT+R+SARLPSQCN+PPLSC AN
Sbjct  37   LGNLNVCAPFVVPG--APNASAECCAALRSIDNDCMCNTMRISARLPSQCNLPPLSCAAN  94



>ref|XP_009794896.1| PREDICTED: protein 108-like [Nicotiana sylvestris]
Length=95

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            LGN+NVCAPFV+PG  A N SA+CC AL+S+D DC+CNT+R+SARLPSQCN+PPLSC AN
Sbjct  38   LGNLNVCAPFVVPG--APNASAECCAALRSIDNDCMCNTMRISARLPSQCNLPPLSCAAN  95



>ref|XP_004240793.1| PREDICTED: stamen-specific protein FIL1-like [Solanum lycopersicum]
Length=99

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            LGN+NVC+PFV+PG + + P+ +CC ALQS+D +CICNT+RV+ARLPS CN+PP+SC
Sbjct  39   LGNLNVCSPFVLPGTSNTTPTTECCAALQSLDHECICNTVRVAARLPSHCNLPPISC  95



>ref|XP_010317583.1| PREDICTED: stamen-specific protein FIL1-like [Solanum lycopersicum]
Length=91

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPG-MTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+N+CAPFV+PG +T  NPS DCC ALQ VDR+CICNTLR+ A LPSQCN+PPLSC
Sbjct  34   LNNLNICAPFVVPGTITNPNPSFDCCSALQLVDRECICNTLRIIAHLPSQCNLPPLSC  91



>ref|XP_002510828.1| MEN-8 protein precursor, putative [Ricinus communis]
 gb|EEF51430.1| MEN-8 protein precursor, putative [Ricinus communis]
Length=93

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++NVCAPFV+PG T +NP+A+CC ALQSV+ DC+CNTLR++ARLPSQCN+ P++C
Sbjct  34   LNSLNVCAPFVVPGATNTNPNAECCSALQSVEHDCLCNTLRIAARLPSQCNLAPVNC  90



>ref|XP_007038611.1| FAR1-related sequence 5 isoform 1 [Theobroma cacao]
 gb|EOY23112.1| FAR1-related sequence 5 isoform 1 [Theobroma cacao]
Length=1025

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVCAPFV+PG+  + PS+DCC ALQSV  DC+CNTLR+++RLPS+CNIP LSC
Sbjct  41   LNRLNVCAPFVVPGVPEATPSSDCCAALQSVQHDCLCNTLRIASRLPSRCNIPALSC  97



>ref|XP_007038613.1| FAR1-related sequence 5 isoform 3 [Theobroma cacao]
 gb|EOY23114.1| FAR1-related sequence 5 isoform 3 [Theobroma cacao]
Length=981

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVCAPFV+PG+  + PS+DCC ALQSV  DC+CNTLR+++RLPS+CNIP LSC
Sbjct  41   LNRLNVCAPFVVPGVPEATPSSDCCAALQSVQHDCLCNTLRIASRLPSRCNIPALSC  97



>ref|XP_010693481.1| PREDICTED: protein MEN-8-like [Beta vulgaris subsp. vulgaris]
Length=100

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            LGN+NVCAP+V+PG   + PS+DCC ALQ+V+ +C+CNTLRV++RLPS CN+PPL+C
Sbjct  42   LGNLNVCAPYVVPGTANTIPSSDCCGALQAVEHECLCNTLRVASRLPSSCNLPPLNC  98



>gb|EYU25068.1| hypothetical protein MIMGU_mgv1a017004mg [Erythranthe guttata]
Length=97

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            LGN+NVCAPF++PG   + P ++CC AL +VDRDC+CNTLR+++R+P QCN+PPL+C  N
Sbjct  40   LGNLNVCAPFLIPG--GATPGSECCTALSTVDRDCLCNTLRIASRIPVQCNLPPLTCSGN  97



>ref|XP_010107405.1| hypothetical protein L484_015746 [Morus notabilis]
 gb|EXC15943.1| hypothetical protein L484_015746 [Morus notabilis]
Length=231

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+N CAPFV+PG     PSA CC ALQ+VD DC+CNTLR+++RLPS CNIPPLSC
Sbjct  41   LNNLNSCAPFVVPGAANPQPSAQCCAALQAVDHDCVCNTLRIASRLPSLCNIPPLSC  97



>ref|XP_002321889.1| hypothetical protein POPTR_0015s13570g [Populus trichocarpa]
 gb|EEF06016.1| hypothetical protein POPTR_0015s13570g [Populus trichocarpa]
Length=94

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+NVCAPFV+PG   +NP+A+CC AL++V  DC+C+TL++S+RLPSQCN+PPL+C
Sbjct  36   LNNLNVCAPFVVPGAANTNPNAECCNALEAVQHDCLCSTLQISSRLPSQCNLPPLTC  92



>ref|XP_008376537.1| PREDICTED: protein MEN-8-like [Malus domestica]
Length=105

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L ++NVCAPFV+PG T +NPS+DCC ALQ+V  +CICN +RV+ARLP+QCN+ PL+C  N
Sbjct  46   LSSLNVCAPFVVPGSTNTNPSSDCCSALQAVHPECICNAVRVAARLPAQCNLSPLTCDTN  105



>ref|XP_009371295.1| PREDICTED: protein MEN-8-like [Pyrus x bretschneideri]
Length=105

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L ++NVCAPFV+PG T +NPS+DCC ALQ+V  +CICN +RV+ARLP+QCN+ PL+C  N
Sbjct  46   LSSLNVCAPFVVPGSTNTNPSSDCCSALQAVHPECICNAVRVAARLPAQCNLSPLTCDIN  105



>ref|XP_007220851.1| hypothetical protein PRUPE_ppa020886mg [Prunus persica]
 gb|EMJ22050.1| hypothetical protein PRUPE_ppa020886mg [Prunus persica]
Length=101

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  283  INVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +NVCAPFV+PG T +NPS+DCC ALQ+V  DC+CNTLRV+ARLP+QCN+ P++C
Sbjct  47   LNVCAPFVVPGSTNTNPSSDCCGALQAVHPDCLCNTLRVAARLPTQCNLSPITC  100



>sp|Q38737.1|FIL1_ANTMA RecName: Full=Stamen-specific protein FIL1; Flags: Precursor 
[Antirrhinum majus]
 emb|CAA40553.1| FIL1 [Antirrhinum majus]
Length=99

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+N CAPFV+ G  A+ PS+DCC ALQSVD +C+CNTLR+++R+P+QCN+PPLSC
Sbjct  35   LANLNACAPFVVLG-AATTPSSDCCTALQSVDHECLCNTLRIASRVPAQCNLPPLSC  90



>ref|XP_008234470.1| PREDICTED: protein 108-like [Prunus mume]
Length=101

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  283  INVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +NVCAPFV+PG T +NPS+DCC ALQ+V  DC+CNTLRV+ARLP+QCN+ P++C
Sbjct  47   LNVCAPFVVPGSTNTNPSSDCCGALQAVHPDCLCNTLRVAARLPAQCNLSPITC  100



>ref|XP_006599627.1| PREDICTED: stamen-specific protein FIL1-like [Glycine max]
Length=93

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L ++NVCAPFV+PG+  +NP+A CC ALQ+VDRDC+CNT+R++++L SQC IP LSC AN
Sbjct  35   LSDLNVCAPFVVPGVN-TNPNATCCNALQAVDRDCLCNTIRIASQLASQCQIPSLSCGAN  93



>gb|EYU19525.1| hypothetical protein MIMGU_mgv1a017062mg [Erythranthe guttata]
Length=95

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++NVCA FV+PG  A+ PS DCC ALQ+V+ DC+C+TLR+++R+P+QCN+PPL+C
Sbjct  37   LASLNVCAQFVVPGGGAATPSPDCCGALQAVNHDCLCSTLRIASRIPTQCNLPPLTC  93



>ref|XP_002318831.1| Tapetum-specific protein A9 precursor [Populus trichocarpa]
 gb|EEE97051.1| Tapetum-specific protein A9 precursor [Populus trichocarpa]
Length=94

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++NVCAPFV+PG   +NPS DCC AL +V  DC+C+TL+++ARLPSQCN+PP++C
Sbjct  36   LNSLNVCAPFVVPGAPNTNPSTDCCNALGAVQHDCLCSTLQIAARLPSQCNLPPITC  92



>ref|XP_002279400.2| PREDICTED: stamen-specific protein FIL1 [Vitis vinifera]
Length=100

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N++VCAPFV+PG   S PSADCC ALQ++D  C+C+TLR+++RLPS CN+ P++C  N
Sbjct  40   LNNLSVCAPFVVPGAPDSTPSADCCTALQTIDDACMCSTLRIASRLPSHCNLTPVTCDVN  99



>ref|XP_003533216.1| PREDICTED: protein 108-like [Glycine max]
Length=95

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L  +NVCAPFV+PG+  +NPS+ CC ALQ+VDRDC+C+T+R++++LPSQC IP L C AN
Sbjct  37   LSELNVCAPFVVPGVN-TNPSSRCCNALQAVDRDCLCSTIRIASQLPSQCQIPSLGCSAN  95



>sp|O24356.1|MEN8_SILLA RecName: Full=Protein MEN-8; Flags: Precursor [Silene latifolia]
 emb|CAA70033.1| Men-8 [Silene latifolia]
Length=100

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            LGN+NVCAP+V+PG   +NPS +CC AL  V+ DC+CNTLRV+++LPS CN+  L+C
Sbjct  42   LGNLNVCAPYVVPGAVNTNPSQECCAALSGVNHDCMCNTLRVASQLPSSCNLAALNC  98



>ref|XP_007152323.1| hypothetical protein PHAVU_004G120100g [Phaseolus vulgaris]
 gb|ESW24317.1| hypothetical protein PHAVU_004G120100g [Phaseolus vulgaris]
Length=107

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+NVCAPFV+PG + + PSA CC ALQ++D DC+CNTLR++++LPSQC I  L+C
Sbjct  39   LSNLNVCAPFVLPGASNTKPSATCCNALQAMDHDCLCNTLRIASQLPSQCQIQSLAC  95



>ref|XP_006401858.1| hypothetical protein EUTSA_v10015124mg [Eutrema salsugineum]
 gb|ESQ43311.1| hypothetical protein EUTSA_v10015124mg [Eutrema salsugineum]
Length=96

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            LG +NVC  FV+PG   +NPSA+CC AL++V  +C+CNTLR+++RLP++CNIP LSC
Sbjct  39   LGGLNVCGEFVVPGADKTNPSAECCNALEAVPSECLCNTLRIASRLPTRCNIPTLSC  95



>ref|XP_003592302.1| Tapetum-specific protein A9 [Medicago truncatula]
 gb|AES62553.1| Lipid transfer protein (LIM1/2/3/MEN-8) [Medicago truncatula]
Length=97

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+NVCAPFV+PG   +NPS DCC ALQS + DC+CNTLR++++L SQCN+P   C  N
Sbjct  38   LSNLNVCAPFVVPGSPNTNPSPDCCTALQSTNPDCLCNTLRIASQLTSQCNLPSFGCVLN  97



>gb|KHM99143.1| Stamen-specific protein FIL1 [Glycine soja]
Length=135

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVCAPFV+PG+  +NPS+ CC ALQ+VDRDC+C+T+R++++LPSQC IP L C
Sbjct  37   LSELNVCAPFVVPGVN-TNPSSRCCNALQAVDRDCLCSTIRIASQLPSQCQIPSLGC  92



>ref|XP_002510832.1| MEN-8 protein precursor, putative [Ricinus communis]
 gb|EEF51434.1| MEN-8 protein precursor, putative [Ricinus communis]
Length=97

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++NVCAPFV+PG   ++P+A+CC AL+SV  DCICNTLR++ RLPS CN+ P++C
Sbjct  39   LNSLNVCAPFVVPGAANTSPNAECCNALESVQNDCICNTLRIAGRLPSLCNLSPINC  95



>gb|KHN31527.1| Stamen-specific protein FIL1 [Glycine soja]
Length=112

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++NVCAPFV+PG+  +NP+A CC ALQ+VDRDC+CNT+R++++L SQC IP L C
Sbjct  35   LSDLNVCAPFVVPGVN-TNPNATCCNALQAVDRDCLCNTIRIASQLASQCQIPSLGC  90



>ref|XP_008378198.1| PREDICTED: protein MEN-8 [Malus domestica]
Length=105

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  283  INVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            +NVCAPFV+PG T +NP++DCC ALQ+V  +C+CN  RV+ARLP+QCN+ P++C  N
Sbjct  49   LNVCAPFVVPGSTNTNPNSDCCGALQAVHPECLCNAARVAARLPAQCNLSPITCDTN  105



>emb|CDY31917.1| BnaC09g28270D [Brassica napus]
Length=95

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  DCICNT R+++RLP++CNIP LSC
Sbjct  38   LSGLNVCGEFVVPGADTTNPSAECCNALEAVPSDCICNTFRIASRLPTRCNIPTLSC  94



>ref|XP_009106919.1| PREDICTED: protein 108 [Brassica rapa]
Length=95

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  DCICNT R+++RLP++CNIP LSC
Sbjct  38   LSGLNVCGEFVVPGADTTNPSAECCNALEAVPSDCICNTFRIASRLPTRCNIPTLSC  94



>gb|AII99868.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=108

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+NVCAPFV+PG T ++PSADCC AL++ +RDC+CNTLR++++L SQC +P   C
Sbjct  38   LSNLNVCAPFVVPG-TNADPSADCCSALKATNRDCLCNTLRIASQLTSQCQLPSFGC  93



>ref|XP_004496598.1| PREDICTED: stamen-specific protein FIL1-like [Cicer arietinum]
Length=97

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+NVCAPFV+PG T ++PSADCC AL++ +RDC+CNTLR++++L SQC +P   C
Sbjct  38   LSNLNVCAPFVVPG-TNADPSADCCSALKATNRDCLCNTLRIASQLTSQCQLPSFGC  93



>emb|CDY00514.1| BnaA10g07590D [Brassica napus]
Length=112

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  DCICNT R+++RLP++CNIP LSC
Sbjct  55   LSGLNVCGEFVVPGADTTNPSAECCNALEAVPSDCICNTFRIASRLPTRCNIPTLSC  111



>gb|AEE92794.1| LTP-like protein [Capsicum annuum]
Length=94

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L ++NVCAPFV+PG  A + SA+CC ALQS++  C+C+T+R++A++P+QCN+PPLSC AN
Sbjct  37   LTSLNVCAPFVVPG--APSASAECCTALQSINHGCMCDTMRIAAQIPAQCNLPPLSCAAN  94



>ref|NP_200029.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAA97459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM65986.1| unknown [Arabidopsis thaliana]
 gb|ABD57481.1| At5g52160 [Arabidopsis thaliana]
 gb|ABE66243.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis thaliana]
 gb|AED96178.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=96

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  +C+CNT R+++RLPS+CNIP LSC
Sbjct  39   LSTLNVCGEFVVPGADRTNPSAECCNALEAVPNECLCNTFRIASRLPSRCNIPTLSC  95



>ref|XP_006281994.1| hypothetical protein CARUB_v10028221mg [Capsella rubella]
 gb|EOA14892.1| hypothetical protein CARUB_v10028221mg [Capsella rubella]
Length=96

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG  + NPSA+CC AL++V  +C+CNT R+++RLPS+CNIP LSC
Sbjct  39   LSGLNVCGEFVVPGADSRNPSAECCNALEAVPNECLCNTFRIASRLPSRCNIPTLSC  95



>ref|XP_002864156.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40415.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  +C+CNT R+++RLPS+CNIP LSC
Sbjct  38   LSGLNVCGEFVVPGADRTNPSAECCNALEAVPNECLCNTFRIASRLPSRCNIPTLSC  94



>ref|XP_006365769.1| PREDICTED: protein 108-like [Solanum tuberosum]
Length=97

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L  +NVCAPF++PG  ++  S +CC A+QS++ DC+CNT+R++A++P+QCN+PPLSC AN
Sbjct  40   LTGLNVCAPFLVPGSPSA--STECCNAVQSINHDCMCNTMRIAAQIPAQCNLPPLSCSAN  97



>ref|XP_004228450.1| PREDICTED: protein 108 [Solanum lycopersicum]
 sp|Q43495.1|108_SOLLC RecName: Full=Protein 108; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78466.1| 108 protein [Solanum lycopersicum]
Length=102

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L  +NVCAPF++PG  +   S +CC A+QS++ DC+CNT+R++A++P+QCN+PPLSC AN
Sbjct  45   LTGLNVCAPFLVPG--SPTASTECCNAVQSINHDCMCNTMRIAAQIPAQCNLPPLSCSAN  102



>emb|CDY32594.1| BnaC03g15620D [Brassica napus]
Length=98

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  +C+CNT+R+++RLP++C+IP LSC
Sbjct  41   LSGLNVCGEFVVPGADKTNPSAECCSALEAVPSECLCNTMRIASRLPTRCSIPTLSC  97



>gb|EPS60738.1| hypothetical protein M569_14064, partial [Genlisea aurea]
Length=78

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++N CA FV+PG  A  PSADCC ALQ VD +CIC+TLR+++++PS CN+P ++C
Sbjct  22   LASVNACAAFVLPG--AGEPSADCCAALQGVDHECICSTLRIASQIPSLCNLPAITC  76



>emb|CDY38904.1| BnaA03g12750D [Brassica napus]
Length=97

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +NVC  FV+PG   +NPSA+CC AL++V  +C+CNT+R+++RLP++C+IP LSC
Sbjct  40   LSGLNVCGEFVVPGADKTNPSAECCSALEAVPSECLCNTMRIASRLPTRCSIPTLSC  96



>ref|XP_009800829.1| PREDICTED: stamen-specific protein FIL1-like [Nicotiana sylvestris]
Length=105

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSAR--LPSQCNIPPL  438
            L N+NVCAPFVMPG +  +PSAD C AL+S+D DCICNTLRV+AR  LP Q  +P L
Sbjct  37   LWNLNVCAPFVMPGTSNPSPSADYCAALKSLDHDCICNTLRVAARPSLPVQPFLPSL  93



>ref|XP_010038429.1| PREDICTED: stamen-specific protein FIL1 [Eucalyptus grandis]
Length=96

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            + ++NVCAPFV+PG T+  PS+ CC ALQ+VD DC+C+TL V+  LPS C++PP+SC
Sbjct  36   MASLNVCAPFVVPG-TSRGPSSQCCGALQAVDHDCLCSTLSVANSLPSACHLPPISC  91



>gb|KCW46398.1| hypothetical protein EUGRSUZ_K00231 [Eucalyptus grandis]
Length=92

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            + ++NVCAPFV+PG T+  PS+ CC ALQ+VD DC+C+TL V+  LPS C++PP+SC
Sbjct  36   MASLNVCAPFVVPG-TSRGPSSQCCGALQAVDHDCLCSTLSVANSLPSACHLPPISC  91



>ref|XP_010263270.1| PREDICTED: stamen-specific protein FIL1-like [Nelumbo nucifera]
Length=97

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCP  447
            L N+  CAPFV+PG++ + P+A+CC AL  VD+ C+C+TL++ AR+P+QC +PP++CP
Sbjct  39   LTNLTACAPFVLPGVS-TQPNAECCNALHGVDQTCLCSTLQIVARMPTQCRLPPMACP  95



>ref|XP_004140787.1| PREDICTED: protein MEN-8-like [Cucumis sativus]
 ref|XP_004157201.1| PREDICTED: protein MEN-8-like [Cucumis sativus]
 gb|KGN57351.1| hypothetical protein Csa_3G180390 [Cucumis sativus]
Length=93

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+N CAPFV+PG  A+NPS +CC AL +V +DC+C+TLR+++ LPS C +P LSC +N
Sbjct  36   LSNLNSCAPFVLPG--ATNPSPECCGALGAVQQDCLCSTLRIASTLPSLCQLPTLSCGSN  93



>ref|XP_008439180.1| PREDICTED: protein MEN-8-like [Cucumis melo]
Length=93

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+N CAPFV+PG  A NPS +CC AL +V +DC+C+TLR+++ LPS C++P LSC +N
Sbjct  36   LSNLNSCAPFVLPG--APNPSPECCGALGAVQQDCLCSTLRIASTLPSLCHLPTLSCGSN  93



>emb|CDP05237.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASN--PSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+NVC PF++PG   ++  PSA+CC A+Q+V  DCICNTL++++RLP++CN+P L+C
Sbjct  43   LANLNVCVPFLVPGSGPADNPPSAECCNAVQAVKEDCICNTLQIASRLPTRCNLPVLNC  101



>ref|XP_011101182.1| PREDICTED: stamen-specific protein FIL1 [Sesamum indicum]
Length=96

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSA-DCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            L ++NVCAPF +PG ++S   + +CC ALQ++D DC+C+TLR+++++P+QCN+PPL+C  
Sbjct  36   LSSLNVCAPFAVPGSSSSTTPSPECCGALQAIDHDCMCSTLRIASQIPTQCNLPPLNCGG  95

Query  451  N  453
            N
Sbjct  96   N  96



>ref|XP_006394437.1| hypothetical protein EUTSA_v10005193mg [Eutrema salsugineum]
 gb|ESQ31723.1| hypothetical protein EUTSA_v10005193mg [Eutrema salsugineum]
Length=94

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+ VCA  V+PG  + +PS++CCVALQS ++DC+CN LR +  LPS CN+PP++C  N
Sbjct  36   LANVQVCAAMVLPG--SGSPSSECCVALQSTNKDCLCNALRAATSLPSLCNLPPVNCGVN  93



>ref|XP_010933873.1| PREDICTED: protein LIM1 [Elaeis guineensis]
Length=102

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            LG +  CAPFV+PG     PS  CC ALQ VD  C+CNT+ + +RLPS C +PP++C A
Sbjct  44   LGRLTTCAPFVIPGTGQGPPSDQCCAALQGVDHTCLCNTINIISRLPSSCKLPPVTCNA  102



>gb|KFK27943.1| hypothetical protein AALP_AA8G451200 [Arabis alpina]
Length=94

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+ VCA  V+PG  +  PS+DCC ALQS ++DC+CN LR +  LPS CN+P +SC  N
Sbjct  36   LANVQVCAAMVLPG--SGTPSSDCCAALQSTNKDCLCNALRAATSLPSLCNLPAISCDIN  93



>gb|AGW52139.1| A9 [Populus tomentosa]
Length=97

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  280  NINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            ++NVC PFV+PG   +NPS D C  L +V  DC+C+TL+++ARLPSQC +PP++C
Sbjct  38   SLNVCGPFVVPGAPNTNPSTDRCNPLCAVQHDCLCSTLQIAARLPSQCKLPPITC  92



>ref|XP_010483942.1| PREDICTED: tapetum-specific protein A9-like [Camelina sativa]
Length=91

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            LGN+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR +  LP+ CN+PP+ C
Sbjct  33   LGNVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPALCNLPPVDC  87



>ref|NP_568949.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 dbj|BAC42516.1| putative A9 protein precursor [Arabidopsis thaliana]
 gb|AED97559.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=95

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR +  LPS CN+PP+ C  N
Sbjct  37   LANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNLPPVDCGIN  94



>gb|KFK25117.1| hypothetical protein AALP_AA8G068000 [Arabis alpina]
Length=83

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG    +P+++CC ALQ+ ++DC+CN LR +  L SQCN+P   C
Sbjct  23   LSNVQVCAPLVLPGAVNPSPNSNCCTALQATNKDCLCNALRAATTLASQCNLPSFDC  79



>gb|AAM63848.1| A9 protein precursor-like [Arabidopsis thaliana]
Length=95

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPAN  453
            L N+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR +  LPS CN+PP+ C  N
Sbjct  37   LSNVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNLPPVDCGIN  94



>dbj|BAB10170.1| tapetum-specific protein A9-like protein [Arabidopsis thaliana]
Length=99

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR +  LPS CN+PP+ C
Sbjct  34   LANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNLPPVDC  88



>ref|XP_006281768.1| hypothetical protein CARUB_v10027932mg [Capsella rubella]
 gb|EOA14666.1| hypothetical protein CARUB_v10027932mg [Capsella rubella]
Length=94

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR +  LPS CN+PP+ C
Sbjct  36   LANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNLPPVDC  90



>ref|XP_002866469.1| hypothetical protein ARALYDRAFT_496383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42728.1| hypothetical protein ARALYDRAFT_496383 [Arabidopsis lyrata subsp. 
lyrata]
Length=95

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR +  LPS CN+PP+ C
Sbjct  34   LANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNLPPVDC  88



>ref|XP_006857882.1| hypothetical protein AMTR_s00069p00110230 [Amborella trichopoda]
 gb|ERN19349.1| hypothetical protein AMTR_s00069p00110230 [Amborella trichopoda]
Length=105

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +N CA F++PG +   P+ +CC+ALQ V++ C+C TLR+ +RLPS CN+ PL+C
Sbjct  25   LSGLNQCARFLVPGASQVAPNQECCLALQGVEQRCLCETLRIVSRLPSACNLVPLNC  81



>ref|XP_010444077.1| PREDICTED: tapetum-specific protein A9-like [Camelina sativa]
Length=91

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCA  V+PG  +  P+++CC ALQS +RDC+CN LR    LP+ CN+PP+ C
Sbjct  33   LANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAVTSLPALCNLPPVDC  87



>gb|ABV68563.1| A9 protein [Brassica napus]
Length=95

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>gb|ABV68560.1| A9 protein [Brassica rapa]
Length=92

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>gb|ABO40457.2| A9-like protein [Sinapis arvensis]
Length=92

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>gb|ABV68561.1| A9 protein [Brassica nigra]
 gb|ABV68567.1| A9 protein [Brassica carinata]
Length=92

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>ref|XP_009122360.1| PREDICTED: tapetum-specific protein A9 [Brassica rapa]
 sp|Q05772.1|A9_BRANA RecName: Full=Tapetum-specific protein A9; Flags: Precursor [Brassica 
napus]
 emb|CAA43890.1| A9 [Brassica napus]
 emb|CDX70018.1| BnaA10g23670D [Brassica napus]
Length=96

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>gb|ABO40456.2| A9-like protein [Sinapis alba]
Length=92

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTATCNLPSLDC  92



>gb|ABO40455.2| A9-like protein [Eruca vesicaria subsp. sativa]
Length=92

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTSCNLPSLDC  92



>emb|CDX98995.1| BnaC09g48400D [Brassica napus]
Length=96

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>gb|AAO85389.1| tapetum-specific protein BcA9 [Brassica rapa subsp. oleifera]
Length=103

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>gb|ABV68565.1| A9 protein [Brassica juncea]
Length=80

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  21   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  77



>ref|XP_010452679.1| PREDICTED: tapetum-specific protein A9 [Camelina sativa]
Length=91

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP ++PG  +  P+++CC ALQ+ ++DCICN LR +  L S CN+P   C
Sbjct  31   LSNVQVCAPLLLPGAVSPAPNSNCCAALQATNKDCICNALRAATTLTSLCNLPSFDC  87



>gb|ABO40458.2| A9-like protein [Brassica oxyrrhina]
Length=71

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  15   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  71



>gb|ABV68564.1| A9 protein [Brassica napus]
Length=77

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  21   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  77



>gb|ABV68562.1| A9 protein [Brassica oleracea]
 gb|ABV68568.1| A9 protein [Brassica carinata]
Length=76

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  17   LSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  73



>ref|XP_006399206.1| hypothetical protein EUTSA_v10015126mg [Eutrema salsugineum]
 gb|ESQ40659.1| hypothetical protein EUTSA_v10015126mg [Eutrema salsugineum]
Length=96

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP V+PG     P+++CC ALQS ++DC+CN LR +  L S CN+P   C
Sbjct  36   LTNMQVCAPLVLPGAVNPAPNSNCCTALQSTNKDCLCNALRAATTLTSLCNLPSFDC  92



>ref|XP_008799573.1| PREDICTED: protein LIM2 [Phoenix dactylifera]
Length=138

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +  CAP+V+PG    +P   CC AL+ +D  C+CNTL + +RLPS C +PP++C
Sbjct  70   LAQLTSCAPYVLPGTNQGSPDDQCCAALRGLDHTCLCNTLNIISRLPSSCKLPPVTC  126



>gb|ABO40454.2| A9-like protein [Brassica tournefortii]
Length=92

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L ++ VCAP V+PG     P+++CC+ALQ+ ++DCICN LR +    + CN+P L C
Sbjct  36   LSDMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDC  92



>ref|XP_002871258.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47517.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=91

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP ++PG     P+++CC ALQS ++DC+CN LR +  L S CN+P   C
Sbjct  31   LSNVQVCAPLLLPGAVNPAPNSNCCAALQSTNKDCLCNALRAATTLTSLCNLPSFDC  87



>ref|XP_006289528.1| hypothetical protein CARUB_v10003071mg [Capsella rubella]
 gb|EOA22426.1| hypothetical protein CARUB_v10003071mg [Capsella rubella]
Length=91

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP ++PG     P++ CC ALQ+ D+DC+CN LR +  L S CN+P   C
Sbjct  31   LSNVQVCAPLLLPGAVNPAPNSRCCSALQATDKDCLCNALRAATTLTSLCNLPSFDC  87



>ref|XP_006363333.1| PREDICTED: stamen-specific protein FIL1-like [Solanum tuberosum]
Length=70

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  310  PGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            P  +   PS +CC ALQS+D +CICNT+RV+ RLPS CN+ P+SC
Sbjct  22   PKTSNMTPSTECCAALQSLDHECICNTVRVATRLPSNCNLSPVSC  66



>ref|NP_196340.1| Tapetum-specific protein A9 [Arabidopsis thaliana]
 sp|Q00762.2|A9_ARATH RecName: Full=Tapetum-specific protein A9; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB87279.1| A9 [Arabidopsis thaliana]
 dbj|BAD43757.1| A9 [Arabidopsis thaliana]
 gb|ABD57463.1| At5g07230 [Arabidopsis thaliana]
 gb|AED91125.1| Tapetum-specific protein A9 [Arabidopsis thaliana]
Length=91

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSAD--CCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP ++PG  A NP+A+  CC ALQ+ ++DC+CN LR +  L S CN+P   C
Sbjct  31   LSNVQVCAPLLLPG--AVNPAANSNCCAALQATNKDCLCNALRAATTLTSLCNLPSFDC  87



>gb|AAM66993.1| A9 [Arabidopsis thaliana]
Length=91

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSAD--CCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP ++PG  A NP+A+  CC ALQ+ ++DC+CN LR +  L S CN+P   C
Sbjct  31   LSNVQVCAPLLLPG--AVNPAANSNCCAALQATNKDCLCNALRAATTLTSLCNLPSFDC  87



>emb|CAA43889.1| A9 [Arabidopsis thaliana]
Length=107

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSAD--CCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L N+ VCAP ++PG  A NP+A+  CC ALQ+ ++DC+CN LR +  L S CN+P   C
Sbjct  31   LSNVQVCAPLLLPG--AVNPAANSNCCAALQATNKDCLCNRLRAATTLTSLCNLPSFDC  87



>ref|XP_009389821.1| PREDICTED: protein LIM1-like [Musa acuminata subsp. malaccensis]
Length=112

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            LG +  CA FV+PG     P   CC +L  VD  C+C+TL + ARL ++CN+P ++C
Sbjct  48   LGQLAACARFVVPGQVTGPPGEQCCASLGRVDHGCLCDTLSIIARLSARCNLPWITC  104



>sp|Q40227.2|LIM3_LILLO RecName: Full=Protein LIM3; Flags: Precursor [Lilium longiflorum]
Length=90

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +G +  C P+V+PG   + PS  CC A+Q+V+  C+C T+ + + LP  C++PP+SC
Sbjct  32   IGGLMSCGPYVLPGNQLT-PSTQCCSAIQAVNHGCLCETINIISSLPGHCSLPPVSC  87



>dbj|BAA04833.1| ORF [Lilium longiflorum]
Length=95

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +G +  C P+V+PG   + PS  CC A+Q+V+  C+C T+ + + LP  C++PP+SC
Sbjct  37   IGGLMSCGPYVLPGNQLT-PSTQCCSAIQAVNHGCLCETINIISSLPGHCSLPPVSC  92



>dbj|BAO51846.1| CjMALE1 [Cryptomeria japonica]
Length=87

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +1

Query  280  NINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
             +  C P V  GM   +P+ +CC AL++ D DCIC+T+  + RLPS+CN+PP  C
Sbjct  34   ELGPCLPAV--GMNPQDPTPECCAALKNADVDCICSTVEATFRLPSECNVPPAQC  86



>sp|Q40190.1|M7_LILHE RecName: Full=Protein M7; AltName: Full=LhM7; Flags: Precursor 
[Lilium henryi]
 emb|CAA56724.1| M7 [Lilium henryi]
Length=89

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            +G +  C P+V+PG   + PS  CC AL++V+  C+C T+ + + LP  C++P ++C A
Sbjct  32   IGELMTCGPYVLPGSNGA-PSEQCCSALKAVNHGCLCETINIISSLPDHCSLPAVNCAA  89



>sp|Q43533.1|LIM1_LILLO RecName: Full=Protein LIM1; Flags: Precursor [Lilium longiflorum]
 dbj|BAA04831.1| ORF [Lilium longiflorum]
Length=90

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            +G +  C P+V+PG   + PS  CC AL++V+  C+C T+ + + LP  C++P ++C A
Sbjct  33   IGELMTCGPYVLPGNNGA-PSEQCCSALRAVNHGCLCETINIISSLPDHCSLPAVNCAA  90



>gb|ABM68544.1| unknown [Lilium longiflorum]
Length=94

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +GN+  C P+V+PG    +PS +CC AL  V + C C  + + + LP++C++P ++C
Sbjct  37   IGNLISCDPYVIPGANQGSPSKECCSALGGVKQSCYCTAIDIISNLPARCSLPAVNC  93



>sp|Q43534.2|LIM2_LILLO RecName: Full=Protein LIM2; Flags: Precursor [Lilium longiflorum]
Length=90

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +G +  C P+V+PG   + PS  CC AL++V+  C+C T+ + + LP  C++P ++C
Sbjct  33   IGELMTCGPYVLPGNNGA-PSEQCCSALRAVNHGCLCETINIISSLPDHCSLPAVNC  88



>dbj|BAA04832.1| ORF [Lilium longiflorum]
Length=95

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +G +  C P+V+PG   + PS  CC AL++V+  C+C T+ + + LP  C++P ++C
Sbjct  38   IGELMTCGPYVLPGNNGA-PSEQCCSALRAVNHGCLCETINIISSLPDHCSLPAVNC  93



>ref|XP_009387684.1| PREDICTED: protein LIM1-like, partial [Musa acuminata subsp. 
malaccensis]
Length=140

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            L  +  CA + +PG   + PS +CC A++ VDR C+C+TL + +R+P+ C + P++C
Sbjct  80   LVGLATCASYAVPGSHGA-PSDECCTAMKGVDRVCLCDTLNIISRMPAACKLSPVTC  135



>dbj|BAK05897.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=95

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            L  +  C  +++PG  A++PSA+CC AL S+ RDC C+T+ +   LPS+CNI  ++C A
Sbjct  39   LNRLLACRAYLVPG--AADPSAECCGALSSISRDCACSTMGIINSLPSRCNIGQVNCSA  95



>ref|NP_001148543.1| YY1 protein precursor [Zea mays]
 gb|ACG31941.1| YY1 protein precursor [Zea mays]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  307  MPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +PG     P  +CC AL +V RDC C T  +   LP++C +PP+SC
Sbjct  63   LPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCGLPPVSC  108



>gb|ACF84585.1| unknown [Zea mays]
 gb|ACF87792.1| unknown [Zea mays]
 gb|ACG31947.1| YY1 protein precursor [Zea mays]
 gb|ACG45917.1| YY1 protein precursor [Zea mays]
 tpg|DAA62377.1| TPA: anther-specific protein MZm3-3 Precursor isoform 1 [Zea 
mays]
 tpg|DAA62378.1| TPA: anther-specific protein MZm3-3 Precursor isoform 2 [Zea 
mays]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  307  MPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +PG     P  +CC AL +V RDC C T  +   LP++C +PP+SC
Sbjct  63   LPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCGLPPVSC  108



>ref|NP_001158983.1| YY1 protein precursor [Zea mays]
 gb|ACG31217.1| YY1 protein precursor [Zea mays]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  307  MPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +PG     P  +CC AL +V RDC C T  +   LP++C +PP+SC
Sbjct  63   LPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCGLPPVSC  108



>ref|NP_001167670.1| YY1 protein precursor [Zea mays]
 gb|ACG31974.1| YY1 protein precursor [Zea mays]
 tpg|DAA62379.1| TPA: YY1 protein [Zea mays]
Length=119

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  307  MPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +PG     P  +CC AL +V RDC C T  +   LP++C +PP+SC
Sbjct  63   LPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCGLPPVSC  108



>ref|NP_001105123.1| anther-specific protein MZm3-3 precursor [Zea mays]
 sp|O82106.1|ZM33_MAIZE RecName: Full=Anther-specific protein MZm3-3; Flags: Precursor 
[Zea mays]
 emb|CAA11913.1| anther specific protein [Zea mays]
Length=109

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  307  MPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSC  444
            +PG     P  +CC AL +V RDC C T  +   LP++C +PP+SC
Sbjct  63   LPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCALPPVSC  108



>ref|XP_004974078.1| PREDICTED: anther-specific protein MZm3-3-like [Setaria italica]
Length=97

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +1

Query  292  CAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            C  +++PG  A +PSADCC AL +V  +C C+T+ +   LP +C++ P++C A
Sbjct  47   CRAYLVPG--APDPSADCCGALSAVSHECACSTMGIINSLPGRCSLAPVNCSA  97



>gb|AAG31822.1| fil1B [Antirrhinum graniticum]
 gb|AAG38185.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38186.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38187.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38188.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38189.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38190.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38191.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38192.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38193.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38194.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38195.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38196.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38197.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38198.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38199.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38200.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38201.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38202.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38203.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38204.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38205.1| fil1A1 [Antirrhinum majus subsp. linkianum]
 gb|AAG38206.1| fil1A1 [Antirrhinum majus subsp. linkianum]
 gb|AAG38207.1| fil1A1 [Antirrhinum majus subsp. linkianum]
 gb|AAG38208.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38209.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38210.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38211.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38212.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38213.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38214.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38215.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38216.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38217.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38218.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38219.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38220.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38221.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38222.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38223.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38224.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38225.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38226.1| fil1A2 [Antirrhinum majus subsp. linkianum]
 gb|AAG38227.1| fil1A2 [Antirrhinum majus subsp. linkianum]
 gb|AAG38228.1| fil1A2 [Antirrhinum majus subsp. linkianum]
 gb|AAG38229.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38230.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38231.1| fil1B [Digitalis purpurea]
 gb|AAG38232.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38233.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38234.1| fil1B [Antirrhinum graniticum]
 gb|AAG38235.1| fil1B [Antirrhinum graniticum]
 gb|AAG38236.1| fil1B [Antirrhinum graniticum]
 gb|AAG38237.1| fil1B [Antirrhinum graniticum]
 gb|AAG38238.1| fil1B [Digitalis purpurea]
 gb|AAG38651.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38652.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38653.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38654.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38655.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38945.1| fil1A3 [Antirrhinum graniticum]
 gb|AAG38946.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38947.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38948.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38949.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38950.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38951.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38952.1| fil1B [Antirrhinum majus subsp. linkianum]
Length=28

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  370  RDCICNTLRVSARLPSQCNIPPLSCPAN  453
             +C+CNTLR+++R+P+QCN+PPLSC AN
Sbjct  1    HECLCNTLRIASRVPAQCNLPPLSCGAN  28



>ref|XP_002445754.1| hypothetical protein SORBIDRAFT_07g025160 [Sorghum bicolor]
 gb|EES15249.1| hypothetical protein SORBIDRAFT_07g025160 [Sorghum bicolor]
Length=103

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = +1

Query  274  LGNINVCAPFVMPGMTASNPSADCCVALQSVDRDCICNTLRVSARLPSQCNIPPLSCPA  450
            L  +  C  +++PG  A +PSADCC AL +V  +C C+T+ +   LP +CN+  ++C A
Sbjct  47   LNGLLACRAYLVPG--APDPSADCCSALSAVSHECACSTMGIINSLPGRCNLAQVNCSA  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1154079434412