BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30057_g1_i1 len=840 path=[1:0-839]

Length=840
                                                                      Score     E

ref|XP_009598409.1|  PREDICTED: uncharacterized protein LOC104094238    111   1e-26   
ref|XP_006346307.1|  PREDICTED: uncharacterized protein LOC102586586    108   1e-25   
ref|XP_009760172.1|  PREDICTED: uncharacterized protein LOC104212567    106   6e-25   
ref|XP_010315179.1|  PREDICTED: uncharacterized protein LOC104645408    103   7e-24   
ref|XP_006486919.1|  PREDICTED: uncharacterized protein LOC102607383  93.2    1e-19   
ref|XP_007143117.1|  hypothetical protein PHAVU_007G045200g           89.7    7e-19   
ref|XP_006422824.1|  hypothetical protein CICLE_v10029615mg           87.4    6e-18   
gb|KHN06811.1|  hypothetical protein glysoja_021357                   86.7    9e-18   
ref|NP_001237385.1|  uncharacterized protein LOC100306091             86.3    1e-17   
ref|XP_004496876.1|  PREDICTED: uncharacterized protein LOC101490708  85.9    2e-17   
gb|KHN42312.1|  hypothetical protein glysoja_020024                   85.5    3e-17   
ref|XP_006605999.1|  PREDICTED: uncharacterized protein LOC102662455  84.0    1e-16   
gb|KEH44021.1|  hypothetical protein MTR_1g106215                     82.8    3e-16   
gb|KDP44491.1|  hypothetical protein JCGZ_16324                       82.0    5e-16   
ref|XP_007200633.1|  hypothetical protein PRUPE_ppa013574mg           81.3    9e-16   
ref|XP_002527514.1|  conserved hypothetical protein                   81.3    1e-15   Ricinus communis
emb|CDO97278.1|  unnamed protein product                              79.7    4e-15   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5          85.1    5e-15   
ref|XP_008363604.1|  PREDICTED: uncharacterized protein LOC103427319  79.0    5e-15   
ref|XP_008454395.1|  PREDICTED: uncharacterized protein LOC103494810  78.6    7e-15   
gb|KGN52765.1|  hypothetical protein Csa_4G000840                     78.2    1e-14   
ref|XP_010687346.1|  PREDICTED: uncharacterized protein LOC104901457  77.4    3e-14   
ref|XP_007042639.1|  Uncharacterized protein TCM_007226               76.6    5e-14   
gb|EYU37569.1|  hypothetical protein MIMGU_mgv1a017109mg              75.1    8e-14   
ref|XP_009349165.1|  PREDICTED: uncharacterized protein LOC103940727  74.7    2e-13   
ref|XP_002527513.1|  conserved hypothetical protein                   76.3    2e-13   Ricinus communis
ref|XP_010111679.1|  hypothetical protein L484_003669                 73.9    3e-13   
ref|XP_011012435.1|  PREDICTED: uncharacterized protein LOC105116685  72.4    1e-12   
gb|KCW63595.1|  hypothetical protein EUGRSUZ_G01220                   70.5    6e-12   
ref|XP_002300267.1|  hypothetical protein POPTR_0001s30200g           70.1    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_003631687.1|  PREDICTED: uncharacterized protein LOC100854891  69.3    1e-11   
ref|XP_002885319.1|  beta-1,4-xylosidase                              71.2    2e-10   
ref|XP_006406479.1|  hypothetical protein EUTSA_v10021824mg           66.2    2e-10   
emb|CDY42195.1|  BnaA01g26000D                                        65.9    2e-10   
ref|XP_009111657.1|  PREDICTED: uncharacterized protein LOC103837077  65.1    5e-10   
ref|XP_010487907.1|  PREDICTED: uncharacterized protein LOC104765832  64.3    8e-10   
ref|XP_010272493.1|  PREDICTED: uncharacterized protein LOC104608262  64.3    1e-09   
ref|XP_009135643.1|  PREDICTED: uncharacterized protein LOC103859818  63.5    2e-09   
emb|CDX95432.1|  BnaC01g33240D                                        63.5    2e-09   
emb|CDX82286.1|  BnaA03g35350D                                        63.2    2e-09   
ref|XP_006300141.1|  hypothetical protein CARUB_v10016371mg           62.0    6e-09   
ref|XP_004289805.1|  PREDICTED: probable beta-D-xylosidase 5-like     66.2    6e-09   
ref|NP_001078189.1|  uncharacterized protein                          61.6    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557520.1|  PREDICTED: uncharacterized protein LOC104826494  60.5    3e-08   
emb|CDY22965.1|  BnaC03g41040D                                        60.1    3e-08   
dbj|BAB02547.1|  beta-1,4-xylosidase                                  63.2    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507845.1|  PREDICTED: uncharacterized protein LOC104784511  58.2    1e-07   
gb|EPS58547.1|  hypothetical protein M569_16266                       53.1    6e-06   
ref|XP_010938961.1|  PREDICTED: uncharacterized protein LOC105057936  49.3    2e-04   
ref|XP_008776157.1|  PREDICTED: uncharacterized protein LOC103696339  48.9    3e-04   
ref|XP_007199552.1|  hypothetical protein PRUPE_ppb020688mg           48.9    3e-04   



>ref|XP_009598409.1| PREDICTED: uncharacterized protein LOC104094238 [Nicotiana tomentosiformis]
Length=110

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 83/125 (66%), Gaps = 17/125 (14%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIP+L+HAMKKQKP H ++FRCLSDTSNRSYHMLIGADS EGSSHRRT S+FQPP  
Sbjct  1    MEGLIPFLLHAMKKQKP-HHNTFRCLSDTSNRSYHMLIGADSIEGSSHRRTRSEFQPPVT  59

Query  428  DHFSDHQRSPRGLGCFPKNVT-RAGSVMSPAASKHNNGLRPGTETAVTSGHQASLSMAAT  252
              F +           PK+   RA S++SP ++K+      G+  A TS  Q + + A  
Sbjct  60   VDFLELSH--------PKSFNYRASSLVSPVSNKN------GSRLAATSNLQGT-TTADN  104

Query  251  VSHRR  237
            + HR+
Sbjct  105  LRHRK  109



>ref|XP_006346307.1| PREDICTED: uncharacterized protein LOC102586586 [Solanum tuberosum]
Length=117

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIP+L+HAMKKQ+P H  SFR LSDTSNRSYH+L+GADS EGSSHRRT S+FQPP  
Sbjct  1    MEGLIPFLLHAMKKQRP-HHTSFRSLSDTSNRSYHLLVGADSIEGSSHRRTRSEFQPPVT  59

Query  428  D-HFSDHQRSPRGLGCFPKNVTRAGSVMSPAASKHNNGLRPGTETAVTSGHQASLSMAAT  252
               F D  + PR          RA S++SP ++++ + L+ G+  A T+  Q ++S+   
Sbjct  60   TVDFLDLPQ-PRSFN------NRASSLLSPVSNQNASRLQFGSNMAATNNLQGTISV-DN  111

Query  251  VSHRR  237
            + HR+
Sbjct  112  LRHRK  116



>ref|XP_009760172.1| PREDICTED: uncharacterized protein LOC104212567 [Nicotiana sylvestris]
Length=106

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 10/94 (11%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIP+L+HAMKKQKP H ++FRCLSDTSNRSYHML+GADS EGSSHRRT S+FQPP  
Sbjct  1    MEGLIPFLLHAMKKQKP-HHNTFRCLSDTSNRSYHMLVGADSIEGSSHRRTRSEFQPPVS  59

Query  428  DHFSDHQRSPRGLGCFPKNVT-RAGSVMSPAASK  330
              F +  +        PK+   RA S++SP +++
Sbjct  60   VDFLELSQ--------PKSFNYRASSLVSPVSNR  85



>ref|XP_010315179.1| PREDICTED: uncharacterized protein LOC104645408 [Solanum lycopersicum]
Length=118

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 86/126 (68%), Gaps = 11/126 (9%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIP+L+HAMKKQ+P H +SFR LSDTSNRSYH+L+GADS +GSSHRRT S+FQPP  
Sbjct  1    MEGLIPFLLHAMKKQRP-HHNSFRSLSDTSNRSYHLLVGADSIDGSSHRRTRSEFQPPVT  59

Query  428  D-HFSDHQRSPRGLGCFPKNVTRAGSVMSPAASKHNNGLRPGTET-AVTSGHQASLSMAA  255
               F D  + PR          RA S++SP ++++ + L+ G+   A T+  Q ++S+  
Sbjct  60   TVDFLDLPQ-PRSFN------NRATSLLSPVSNQNASRLKFGSNNMAATNNLQGTVSV-D  111

Query  254  TVSHRR  237
             + HR+
Sbjct  112  NLRHRK  117



>ref|XP_006486919.1| PREDICTED: uncharacterized protein LOC102607383 [Citrus sinensis]
Length=144

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = -2

Query  629  NQQRKKK--MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRT  456
            NQ+RKK+  MEGLIPYLVHAMKKQKP   HS+R  S  S+RSYH+LIG DS EGSSHRR 
Sbjct  23   NQRRKKEVIMEGLIPYLVHAMKKQKP--HHSYRSFSVGSSRSYHLLIGGDSFEGSSHRRA  80

Query  455  FSDFQPPAPD  426
             SDFQ PA +
Sbjct  81   RSDFQQPAVE  90



>ref|XP_007143117.1| hypothetical protein PHAVU_007G045200g [Phaseolus vulgaris]
 gb|ESW15111.1| hypothetical protein PHAVU_007G045200g [Phaseolus vulgaris]
Length=103

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 3/101 (3%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLS--DTSNRSYHMLIGADSAEGSSHRRTFSDFQPP  435
            MEGLIPYL+HAMKKQKP    S+R  S  ++S RSYH+L+ ADS  GSSHRRT SDFQPP
Sbjct  1    MEGLIPYLIHAMKKQKPHAHRSYRSFSHSESSTRSYHLLLAADSFTGSSHRRTRSDFQPP  60

Query  434  APDHFSDHQRSPRGLGCFPKNVTRAGSVMSPAASKHNNGLR  312
              + FS+ +    G    P     A +  +   S +   +R
Sbjct  61   TSE-FSEQRHGAEGFLVSPTTAVNANASYAAQPSTNTTNIR  100



>ref|XP_006422824.1| hypothetical protein CICLE_v10029615mg [Citrus clementina]
 gb|ESR36064.1| hypothetical protein CICLE_v10029615mg [Citrus clementina]
Length=113

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIPYLVHAMKKQKP   HS+R  S  S+RSYH+LIG DS EGSSHRR  SDFQ PA 
Sbjct  1    MEGLIPYLVHAMKKQKP--HHSYRSFSVGSSRSYHLLIGGDSFEGSSHRRARSDFQQPAV  58

Query  428  D  426
            +
Sbjct  59   E  59



>gb|KHN06811.1| hypothetical protein glysoja_021357 [Glycine soja]
Length=108

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 8/102 (8%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLS--DTSNRSYHMLIGADSAEGSSHRRTFSDFQPP  435
            MEGLIPYL+HA+KKQKP H H++R  S  ++SNRSYHML+ ++S  GSSHRRT SDFQPP
Sbjct  1    MEGLIPYLIHAIKKQKP-HHHNYRSYSHSESSNRSYHMLLASESFTGSSHRRTRSDFQPP  59

Query  434  APDHFSDHQRSPRGLGCFPK-NVTRA---GSVMSPAASKHNN  321
              + F + +    G    P+  VT A    +V   AA + NN
Sbjct  60   TSE-FLEQRYGVDGFLVSPRAQVTTAAPPATVNVNAAQRSNN  100



>ref|NP_001237385.1| uncharacterized protein LOC100306091 [Glycine max]
 gb|ACU14103.1| unknown [Glycine max]
Length=108

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 8/102 (8%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLS--DTSNRSYHMLIGADSAEGSSHRRTFSDFQPP  435
            MEGLIPYL+HA+KKQKP H H++R  S  ++SNRSYHML+ ++S  GSSHRRT SDFQPP
Sbjct  1    MEGLIPYLIHAIKKQKP-HHHNYRSYSHSESSNRSYHMLLASESFTGSSHRRTGSDFQPP  59

Query  434  APDHFSDHQRSPRGLGCFPK-NVTRA---GSVMSPAASKHNN  321
              + F + +    G    P+  VT A    +V   AA + NN
Sbjct  60   TSE-FLEQRYGVDGFLVSPRAQVTTAAPPATVNVNAAQRSNN  100



>ref|XP_004496876.1| PREDICTED: uncharacterized protein LOC101490708 [Cicer arietinum]
Length=113

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 6/104 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSF-RCLS--DTSNRSYHMLIGADSAEGSSHRRTFSDFQP  438
            MEGLIPYL+HA+KKQKP H HSF R  S  +++NRSYH+L+ + S  GSSHRRT SDFQ 
Sbjct  1    MEGLIPYLIHAIKKQKP-HHHSFTRSFSHSESTNRSYHLLLESGSITGSSHRRTRSDFQQ  59

Query  437  PAPDHFSDHQRSPRGLGCFPKNVTRAGSVMSPAAS-KHNNGLRP  309
            P  + F +H+    G+   PK +T   S  S   +  H+   RP
Sbjct  60   PTTE-FLEHRFGVDGVLVSPKGITATASTTSHVTTVSHDATQRP  102



>gb|KHN42312.1| hypothetical protein glysoja_020024 [Glycine soja]
Length=108

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLS--DTSNRSYHMLIGADSAEGSSHRRTFSDFQPP  435
            MEGLIPYL+HA+KKQKP H H++R  S  ++SNRSYHML+ ++S  GSSHRRT SDFQPP
Sbjct  1    MEGLIPYLIHAIKKQKP-HHHNYRSYSHSESSNRSYHMLLASESFTGSSHRRTRSDFQPP  59

Query  434  APDHFSDHQRSPRGLGCFPKNVTRAGS---VMSPAASKHNNGL  315
              + F + +    G    P+    A +    ++  A++H+N +
Sbjct  60   TSE-FLEQRYGVDGFLVSPRGQFTAAAPPPTVNVNAAQHSNNI  101



>ref|XP_006605999.1| PREDICTED: uncharacterized protein LOC102662455 [Glycine max]
Length=108

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLS--DTSNRSYHMLIGADSAEGSSHRRTFSDFQPP  435
            MEGLIPYL+HA+KKQKP H H++R  S  ++SNRSYH+L+ ++S  GSSHRRT SDFQPP
Sbjct  1    MEGLIPYLIHAIKKQKP-HHHNYRSYSHSESSNRSYHVLLASESFTGSSHRRTRSDFQPP  59

Query  434  APDHFSDHQRSPRGLGCFPKNVTRAGS---VMSPAASKHNNGL  315
              + F + +    G    P+    A +    ++  A++H+N +
Sbjct  60   TSE-FLEQRYGVDGFLVSPRGQFTAAAPPPTVNVNAAQHSNNI  101



>gb|KEH44021.1| hypothetical protein MTR_1g106215 [Medicago truncatula]
Length=113

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 68/112 (61%), Gaps = 15/112 (13%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFR---CLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQP  438
            MEGLIPYL+HA+KKQKP H HSF      S + NRSYHML+ +DS  GSSHRRT SDFQ 
Sbjct  1    MEGLIPYLIHAIKKQKP-HHHSFNRSFSHSGSVNRSYHMLLESDSLTGSSHRRTRSDFQQ  59

Query  437  PAPDHFSDHQ-------RSPRGLGCFPKNVTRAGSVMSPAA---SKHNNGLR  312
            P  + F +H+        SPRG+       T A +V S A    SK+ N +R
Sbjct  60   PTTE-FLEHRFGVDGSLVSPRGITVTALPPTTANAVASYATQPPSKNFNNVR  110



>gb|KDP44491.1| hypothetical protein JCGZ_16324 [Jatropha curcas]
Length=112

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIG-ADSAEGSSHRRTFSDFQPPA  432
            MEGLIPYL+HAMKKQKP   +++R  S  S+RSYH+L+G  DS  GSSHRRT SDFQP  
Sbjct  1    MEGLIPYLLHAMKKQKP--HNNYRSFSAGSSRSYHLLVGGVDSVSGSSHRRTRSDFQPSN  58

Query  431  PDHFSDHQRSPRGL  390
             D F   QRS   L
Sbjct  59   LDFF--EQRSGENL  70



>ref|XP_007200633.1| hypothetical protein PRUPE_ppa013574mg [Prunus persica]
 gb|EMJ01832.1| hypothetical protein PRUPE_ppa013574mg [Prunus persica]
Length=115

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI-GADSAEGSSHRRTFSDFQPPA  432
            MEGLIP+L HA+KKQ+P HR+     S++SNRSYH+L+ G DS EGSSHRRT S+FQPP 
Sbjct  1    MEGLIPFLFHALKKQRPQHRYRSFSQSNSSNRSYHLLMSGQDSLEGSSHRRTRSEFQPPV  60



>ref|XP_002527514.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34912.1| conserved hypothetical protein [Ricinus communis]
Length=118

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIPYL+HA++KQKP  ++S+R  S  S+RSYH+L GADS  GSSHRRT S+FQPP  
Sbjct  1    MEGLIPYLLHAIRKQKP--QNSYRSFSVGSSRSYHLLTGADSFSGSSHRRTRSEFQPPTM  58

Query  428  DHFSDHQ  408
            +     Q
Sbjct  59   ELLDQRQ  65



>emb|CDO97278.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSA---EGSSHRRTFSDFQP  438
            MEGLIP+++ +++KQ+P +  S+R LSDTSNRSYH+L+G + +   EGSSHRRT S+ Q 
Sbjct  1    MEGLIPFIIRSLRKQRPGN--SYRSLSDTSNRSYHLLLGGEQSVELEGSSHRRTRSECQQ  58

Query  437  PAPDHFSDHQRSPRGLGCF--PKNVT-RAGSVMSPAASK  330
            P+ D FS+ +    GL      K+ T RA SV+SP  ++
Sbjct  59   PSSD-FSEQRSGGTGLDYISHAKSFTGRATSVLSPLTTR  96



>ref|XP_008236322.1| PREDICTED: probable beta-D-xylosidase 5 [Prunus mume]
Length=916

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  626  QQRKKKMEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI-GADSAEGSSHRRTFS  450
            Q R  +MEGLIP+L HA+KKQ+P HR+     S++SNRSYH+L+ G DS EGSSHRRT S
Sbjct  796  QNRANRMEGLIPFLFHALKKQRPQHRYRSFSQSNSSNRSYHLLMSGQDSLEGSSHRRTRS  855

Query  449  DFQPPA  432
            +FQPP 
Sbjct  856  EFQPPV  861



>ref|XP_008363604.1| PREDICTED: uncharacterized protein LOC103427319 [Malus domestica]
Length=98

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHR-HSFRCLSDTSNRSYHMLI-GADSAEGSSHRRTFSDFQPP  435
            MEGLIP+L+HA+KKQ+P H+  SF      SNRSYH+L+ G DS EGSSHRRT S+FQPP
Sbjct  1    MEGLIPFLLHAIKKQRPQHKFRSFSVSESNSNRSYHLLLSGQDSLEGSSHRRTRSEFQPP  60



>ref|XP_008454395.1| PREDICTED: uncharacterized protein LOC103494810 [Cucumis melo]
Length=113

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIPYL HAMKKQKP  RHS+R  S  S+RSYH+LI A+  + SSHRRT SD+QPP  
Sbjct  1    MEGLIPYLFHAMKKQKP--RHSYRSQSVGSSRSYHLLITAN--DESSHRRTRSDYQPPTF  56

Query  428  DHFSDHQR  405
            + F D QR
Sbjct  57   E-FLDQQR  63



>gb|KGN52765.1| hypothetical protein Csa_4G000840 [Cucumis sativus]
Length=112

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 6/73 (8%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIPYL HAMKKQKP  RHS+R  S  S+RSYH+LI A+  + SSHRRT SD+QPP  
Sbjct  1    MEGLIPYLFHAMKKQKP--RHSYRSQSVGSSRSYHLLITAN--DESSHRRTRSDYQPPTF  56

Query  428  DHFSDHQRSPRGL  390
            + F D QRS R L
Sbjct  57   E-FLD-QRSTREL  67



>ref|XP_010687346.1| PREDICTED: uncharacterized protein LOC104901457 [Beta vulgaris 
subsp. vulgaris]
Length=122

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHML--IGADSAEGSSHRRTFSDFQPP  435
            MEGLIPYLV A+K+Q   H  SFRCLSD S RSYH+L   G DS  GSSHRRT S+FQ P
Sbjct  1    MEGLIPYLVRAIKRQNL-HNQSFRCLSDGSRRSYHLLGNAGGDSVNGSSHRRTQSEFQAP  59

Query  434  A  432
             
Sbjct  60   T  60



>ref|XP_007042639.1| Uncharacterized protein TCM_007226 [Theobroma cacao]
 gb|EOX98470.1| Uncharacterized protein TCM_007226 [Theobroma cacao]
Length=116

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 63/100 (63%), Gaps = 10/100 (10%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIG---ADSAEGSSHRRTFSDFQP  438
            MEGLIP+L+HA++KQKP H   ++ +S  S+RSYH+L+G    +S EGSSHRRT S+FQP
Sbjct  1    MEGLIPFLIHAVRKQKPGHH--YKSMSVGSSRSYHLLMGQSQQESVEGSSHRRTRSEFQP  58

Query  437  PAPDHFSDHQRSPRGLGCF-PKNVTRAGSVMSPAASKHNN  321
            P    F   QRS  GL    PK      S+  P+ +  +N
Sbjct  59   PTVGFFE--QRS--GLEFLSPKGYNSGSSINYPSMAGGSN  94



>gb|EYU37569.1| hypothetical protein MIMGU_mgv1a017109mg [Erythranthe guttata]
Length=93

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 3/59 (5%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTS-NRSYHMLIGADSAEGSSHRRTFSDFQPP  435
            MEGLIP+L+ A+KKQKP  ++ +R LS+ S  RSYH+L+  DS +GSSHRRT SDFQPP
Sbjct  1    MEGLIPFLLRAVKKQKP--QNVYRSLSENSIGRSYHLLLAGDSVDGSSHRRTRSDFQPP  57



>ref|XP_009349165.1| PREDICTED: uncharacterized protein LOC103940727 [Pyrus x bretschneideri]
Length=98

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHR-HSFRCLSDTSNRSYHMLI-GADSAEGSSHRRTFSDFQPP  435
            MEGLIP+L+HA+KKQ+P H+  SF      SN SYH+L+ G DS EGSSHRRT S+FQPP
Sbjct  1    MEGLIPFLLHAIKKQRPQHKFRSFSVSESNSNCSYHLLMSGQDSLEGSSHRRTRSEFQPP  60



>ref|XP_002527513.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34911.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 7/93 (8%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGA-DSAEGSSHRRTFSDFQPPA  432
            MEGLIPY++HA+KKQ+P HR +++  S+ S+RSYH+LIG+ DS  GSSHRRT S+FQPPA
Sbjct  1    MEGLIPYILHAIKKQRP-HR-TYKSFSEGSSRSYHLLIGSGDSINGSSHRRTRSEFQPPA  58

Query  431  PDHFSDHQRSPRGLGCFPKNVTRAGSVMSPAAS  333
             +     QRS   L     +  R  SV SP  +
Sbjct  59   MELLE--QRS--ALEYVRSSSLRKRSVNSPTVA  87



>ref|XP_010111679.1| hypothetical protein L484_003669 [Morus notabilis]
 gb|EXC31470.1| hypothetical protein L484_003669 [Morus notabilis]
Length=105

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSD--TSNRSYHMLIGADS---AEGSSHRRTFSDF  444
            MEGLIPYL+HA++ +KP  R+S+R  S+  TS RSYH L+   S   +EGSSHRRT S+F
Sbjct  1    MEGLIPYLIHALRNEKP--RNSYRSFSENSTSQRSYHRLLSGSSHKFSEGSSHRRTRSEF  58

Query  443  QPPAPDHFSDHQRS  402
            QPP P  F++ QRS
Sbjct  59   QPPPPLDFAE-QRS  71



>ref|XP_011012435.1| PREDICTED: uncharacterized protein LOC105116685 [Populus euphratica]
Length=112

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 4/60 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIG--ADSAEGSSHRRTFSDFQPP  435
            MEGLIP+L+H+++KQKP  ++S+R LS  S+R YH+L+G   +S  GSSHRRT SD+QPP
Sbjct  1    MEGLIPFLIHSIRKQKP--QNSYRSLSMGSSRGYHLLMGGEGESVNGSSHRRTRSDYQPP  58



>gb|KCW63595.1| hypothetical protein EUGRSUZ_G01220 [Eucalyptus grandis]
Length=116

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 69/124 (56%), Gaps = 8/124 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPAP  429
            MEGLIP+++ +++KQ+     S+RCLSD S RSYH+L G +S +GSSHRRT S+    + 
Sbjct  1    MEGLIPFVIRSVRKQRLYS--SYRCLSDGSARSYHLLAGGESVDGSSHRRTKSELPQLSA  58

Query  428  DHFSDHQRSPRGLGCFPKNVTRAGSVMSPAASKHNNGLRPGTETAVTSGHQASLSMAATV  249
              F + QRS  G+     +    GS++S A + + + +       +     A  S   T+
Sbjct  59   AEFKE-QRS--GVELAQSHSMNKGSMVSTATAANGSNIASSYYAQINKDVNAGFS---TL  112

Query  248  SHRR  237
             HRR
Sbjct  113  RHRR  116



>ref|XP_002300267.1| hypothetical protein POPTR_0001s30200g [Populus trichocarpa]
 gb|EEE85072.1| hypothetical protein POPTR_0001s30200g [Populus trichocarpa]
Length=112

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGAD--SAEGSSHRRTFSDFQPP  435
            MEGLIP+L+H++KKQKP   +S+R LS  S+RSY +L+G +  S  GSSHRRT SD+QPP
Sbjct  1    MEGLIPFLLHSIKKQKP--HNSYRSLSMGSSRSYRLLMGGEGESVNGSSHRRTRSDYQPP  58



>ref|XP_003631687.1| PREDICTED: uncharacterized protein LOC100854891 [Vitis vinifera]
Length=104

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 5/68 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHS-FRCLSDTSNRSYHMLIGADSAEGSSHRRTFSDFQPPA  432
            MEGLIP+L +A+K +K    HS +RCLS+ S+R Y +L G DS+ GSSHRRT S+FQ P 
Sbjct  1    MEGLIPFLFNAIKSKKA---HSGYRCLSEGSSRGYRLLAGPDSSHGSSHRRTRSEFQAPK  57

Query  431  PDHFSDHQ  408
             D F+D Q
Sbjct  58   YD-FTDRQ  64



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 4/84 (5%)
 Frame = -2

Query  632  DNQQRKKKMEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSH  465
            D+ +++  MEGLIPYL+HA+KK   P    +R +S  S+RSY  L+    G+ S +GSSH
Sbjct  765  DSTKQRSLMEGLIPYLIHAIKKDYKPDHQRYRSMSVGSSRSYRPLMMGQEGSSSMQGSSH  824

Query  464  RRTFSDFQPPAPDHFSDHQRSPRG  393
            RRT SD+ PPA    SD + S  G
Sbjct  825  RRTRSDYNPPAIMDKSDQRSSGFG  848



>ref|XP_006406479.1| hypothetical protein EUTSA_v10021824mg [Eutrema salsugineum]
 gb|ESQ47932.1| hypothetical protein EUTSA_v10021824mg [Eutrema salsugineum]
Length=99

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK   P  H +R +S  S+RSY  L+    G+ S +GSSHRRT S+++
Sbjct  1    MEGLIPYLIHAIKKDHKPQHHKYRSMSIGSSRSYRPLMMGHEGSSSLQGSSHRRTRSEYK  60

Query  440  PPA  432
            PP 
Sbjct  61   PPV  63



>emb|CDY42195.1| BnaA01g26000D [Brassica napus]
Length=100

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK   P    +R LS  S+R Y  L+    G+ S +GSSHRRT S+++
Sbjct  1    MEGLIPYLIHAIKKDHKPQDQGYRSLSVGSSRGYRPLMMGQEGSSSLQGSSHRRTKSEYK  60

Query  440  PPAPDHFSDHQRSPRGLG  387
            PP      D Q S  GLG
Sbjct  61   PPVMMDMFD-QTSSGGLG  77



>ref|XP_009111657.1| PREDICTED: uncharacterized protein LOC103837077 [Brassica rapa]
Length=100

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 48/83 (58%), Gaps = 5/83 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK   P    +R LS  S+R Y  L+    G+ S +GSSHRRT S+++
Sbjct  1    MEGLIPYLIHAIKKDHKPQDQGYRSLSVGSSRGYRPLMMGQEGSSSLQGSSHRRTRSEYK  60

Query  440  PPAPDHFSDHQRSPRGLGCFPKN  372
            PP      D Q S  G G    N
Sbjct  61   PPVIMDMFD-QTSSGGFGLNSVN  82



>ref|XP_010487907.1| PREDICTED: uncharacterized protein LOC104765832 [Camelina sativa]
Length=93

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 50/89 (56%), Gaps = 8/89 (9%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK        +R +S  S+RSY  L+    G+ S +GSSHRRT S++ 
Sbjct  1    MEGLIPYLIHAIKKDHNRAHQMYRSMSVGSSRSYRPLMMGQEGSSSVQGSSHRRTKSEYN  60

Query  440  PPAPDHFSDHQRSPRGLGCFPKNVTRAGS  354
            PP     SD     R  G   KNV +  S
Sbjct  61   PPVIMDMSDQ----RSSGFGQKNVNKDSS  85



>ref|XP_010272493.1| PREDICTED: uncharacterized protein LOC104608262 [Nelumbo nucifera]
Length=116

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLIGA-DSAEGSSHRRTFSDFQPPA  432
            MEGLIPY+ HA+K +K  H+  +R LSD S+RSY  L G   S EGSSHRRT S+FQPP 
Sbjct  1    MEGLIPYIFHAIKNKKA-HK-DYRSLSDGSSRSYRPLTGGMGSFEGSSHRRTRSEFQPPT  58

Query  431  PDHFSDHQRS  402
               F   Q S
Sbjct  59   TYDFQLEQSS  68



>ref|XP_009135643.1| PREDICTED: uncharacterized protein LOC103859818 [Brassica rapa]
Length=96

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK        +R +S+ S+RSY  L+    G+ S +GSSHRRT S+++
Sbjct  1    MEGLIPYLIHAIKKHHKSQHMRYRSMSEGSSRSYRPLMMGQEGSSSLQGSSHRRTRSEYK  60

Query  440  PPAPDHFSDH  411
            PP      DH
Sbjct  61   PPVIMDMFDH  70



>emb|CDX95432.1| BnaC01g33240D [Brassica napus]
Length=100

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK   P    +R LS  S+R Y  L+    G+ S +GSSHRRT S+++
Sbjct  1    MEGLIPYLIHAIKKDHKPQDQGYRSLSVGSSRGYRPLMMGQEGSSSFQGSSHRRTRSEYK  60

Query  440  PPAPDHFSDHQRSPRGLG  387
            PP      D Q S  G G
Sbjct  61   PPVIMDMFD-QTSSSGFG  77



>emb|CDX82286.1| BnaA03g35350D [Brassica napus]
Length=96

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK        +R +S+ S+RSY  L+    G+ S +GSSHRRT S+++
Sbjct  1    MEGLIPYLIHAIKKHHKSQHMRYRSMSEGSSRSYRPLMMGQEGSSSLQGSSHRRTRSEYK  60

Query  440  PPAPDHFSDH  411
            PP      DH
Sbjct  61   PPVIMDMFDH  70



>ref|XP_006300141.1| hypothetical protein CARUB_v10016371mg [Capsella rubella]
 gb|EOA33039.1| hypothetical protein CARUB_v10016371mg [Capsella rubella]
Length=93

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK        +R +S  S+RSY  L+    G+ SA+GSSHRRT S++ 
Sbjct  1    MEGLIPYLIHAIKKDHNRDHQMYRSMSVGSSRSYRPLMMGQEGSSSAQGSSHRRTRSEYN  60

Query  440  PPAPDHFSDHQRSPRGLGCFPKN  372
            PP      D + S  G     K+
Sbjct  61   PPVIMDMFDQRSSGFGQKIVDKD  83



>ref|XP_004289805.1| PREDICTED: probable beta-D-xylosidase 5-like [Fragaria vesca 
subsp. vesca]
Length=904

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = -2

Query  620  RKKKMEGLIPYLVHAMKKQKPPH--RHSFRCLSDTSNRSYHMLI-GADSAEGSSHRRTFS  450
            + K MEGLIPYL+HA+KK +P H  R SF   S  SNRSYH+L  G  S EGSSHRR  S
Sbjct  788  KPKSMEGLIPYLLHAIKKTRPQHKYRTSFSG-SGNSNRSYHLLTSGNASLEGSSHRRARS  846

Query  449  DFQPPA  432
            +   PA
Sbjct  847  ELPAPA  852



>ref|NP_001078189.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76267.1| uncharacterized protein AT3G19615 [Arabidopsis thaliana]
Length=93

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK   P    +R +S  S+RSY  L+    G+ S +GSSHRRT SD+ 
Sbjct  1    MEGLIPYLIHAIKKDHKPDHQRYRSISVGSSRSYRPLMMGQDGSSSMQGSSHRRTRSDYN  60

Query  440  P  438
            P
Sbjct  61   P  61



>ref|XP_010557520.1| PREDICTED: uncharacterized protein LOC104826494 [Tarenaya hassleriana]
Length=111

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYH-MLIGADSAE-----GSSHRRTFSD  447
            MEGLIPYL+ AMKK   P+ H  R +S  S+R    +L+G D        GSSHRRT SD
Sbjct  1    MEGLIPYLMQAMKKGHDPNAHYSRSVSAGSSRGNRPLLLGHDDHSNSLHHGSSHRRTRSD  60

Query  446  FQPPAPDHFSD  414
            ++PP PD   D
Sbjct  61   YKPPGPDQLWD  71



>emb|CDY22965.1| BnaC03g41040D [Brassica napus]
Length=96

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK        +R +S+ S+ SY  L+    G+ S +GSSHRRT S++ 
Sbjct  1    MEGLIPYLIHAIKKHHKSQHMRYRSMSEGSSHSYRPLMMGQEGSSSYQGSSHRRTRSEYM  60

Query  440  PPAPDHFSDH  411
            PP      DH
Sbjct  61   PPVIMDMFDH  70



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = -2

Query  632  DNQQRKKKMEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSH  465
            D+ + +  MEGLIPYL+HA+KK   P    +R +S  S+RSY  L+    G+ S +GSSH
Sbjct  776  DSTKHRILMEGLIPYLIHAIKKDHKPDHQRYRSISVGSSRSYRPLMMGQDGSSSMQGSSH  835

Query  464  RRTFSDFQP  438
            RRT SD+ P
Sbjct  836  RRTRSDYNP  844



>ref|XP_010507845.1| PREDICTED: uncharacterized protein LOC104784511 [Camelina sativa]
Length=93

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSNRSYHMLI----GADSAEGSSHRRTFSDFQ  441
            MEGLIPYL+HA+KK        +R +   S+RSY  L+    G+ S +GSSHRRT S++ 
Sbjct  1    MEGLIPYLIHAIKKDHKRDHQMYRSMFVGSSRSYRPLMMGQEGSSSVQGSSHRRTKSEYN  60

Query  440  PPAPDHFSDHQRSPRGLGCFPKN  372
            PP      D + S  G     K+
Sbjct  61   PPVIMDMFDQRSSGFGQNFVNKD  83



>gb|EPS58547.1| hypothetical protein M569_16266, partial [Genlisea aurea]
Length=64

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 5/50 (10%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSN--RSYHMLI-GADSAEGSS  468
            MEGLIP+L+ A+K Q+P    ++RCLS+ SN  RSYH+LI GA  ++GSS
Sbjct  1    MEGLIPFLIRAVKNQRP--EKAYRCLSNNSNSGRSYHLLIGGAADSDGSS  48



>ref|XP_010938961.1| PREDICTED: uncharacterized protein LOC105057936 [Elaeis guineensis]
Length=86

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 6/63 (10%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSN---RSYHMLIGADSAEGSS-HRRTFSDFQ  441
            MEGLIP+++HA+KK++   R  +RCLS+ S     S   L+     E SS HRRT SDF 
Sbjct  1    MEGLIPFVIHAIKKKR--ERSRYRCLSEGSTGRGGSRKPLVADWPQENSSHHRRTRSDFP  58

Query  440  PPA  432
            PP 
Sbjct  59   PPT  61



>ref|XP_008776157.1| PREDICTED: uncharacterized protein LOC103696339 [Phoenix dactylifera]
Length=86

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRHSFRCLSDTSN---RSYHMLIGADSAEGSS-HRRTFSDFQ  441
            MEGLIP+++HA+KK++   R  +RCLS+ S     S   L+     E SS HRRT SDF 
Sbjct  1    MEGLIPFVIHAIKKRR--ERSRYRCLSEGSTGRGGSRKPLVADWPQENSSHHRRTRSDFL  58

Query  440  PPA  432
            PP+
Sbjct  59   PPS  61



>ref|XP_007199552.1| hypothetical protein PRUPE_ppb020688mg [Prunus persica]
 gb|EMJ00751.1| hypothetical protein PRUPE_ppb020688mg [Prunus persica]
Length=89

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = -2

Query  608  MEGLIPYLVHAMKKQKPPHRH--SFRCLSDTSNRSYHMLI-GADSAEGSSHRRT  456
            MEGLIPYL HA+KKQ+P  RH  SF   S +++ SYH L  G D  E SS RRT
Sbjct  1    MEGLIPYLYHAIKKQRPQRRHRSSF-TESISTHASYHRLTSGHDVLEASSLRRT  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1627375116822